metagRoot

F497127

General Info

Members	Datasets	Scaffolds	Average Seq Length
2889	844	2733	231

Family's Representative Sequence

Representative Sequence	3300053079\|Ga0500610_0118470\|Ga0500610_0118470_499_1344
Length	281
Sequence	MDADHRRQTGRQVQVGGFVLDAERQQLGNVHGIPRIEFGDVLIRFWTIMTMIGDDLQQVKNRIANACVTAGRDPAGVRLLAVSKTFGPEAVREAHAAGQQAFGENYVQEGLDKIEALADLRSSLEWHCIGPLQSNKTRPVAERFDWVHSIDRLKIAERLSAQRPAHLPPLFVCLQVNVDGGANKSGVTPGEALELARAVAALPQLKLRGLMAIPEPAPDFAGQRDLFLRAHAVFDAIRDAGIELDTLSLGMSADLEAAISAGSTMVRVGTAIFGGRARKPA

Samples

	Sample ID	Description	Type	Environment
1	2501025501	Paraburkholderia silvatlantica PVA5	Isolate	Unclassified
2	2501025502	Paraburkholderia unamae MTI-641	Isolate	Rhizosphere
3	2501025504	Paraburkholderia silvatlantica SRMrh-20	Isolate	Unclassified
4	2508501125	Burkholderia sp. WSM2232	Isolate	Nodule
5	2510065045	Paraburkholderia sprentiae WSM5005	Isolate	Nodule
6	2510917013	Paraburkholderia unamae MTI-641	Isolate	Rhizosphere
7	2510917014	Paraburkholderia silvatlantica SRMrh-20	Isolate	Unclassified
8	2510917015	Paraburkholderia silvatlantica PVA5	Isolate	Unclassified
9	2511231002	Polaromonas sp. CF318	Isolate	Rhizosphere
10	2511231003	Herbaspirillum sp. CF444	Isolate	Rhizosphere
11	2511231026	Herbaspirillum sp. YR522	Isolate	Rhizosphere
12	2512047030	Paraburkholderia tuberum STM678	Isolate	Nodule
13	2513020051	Variovorax sp. CF313	Isolate	Rhizosphere
14	2513237082	Paraburkholderia mimosarum STM3621	Isolate	Nodule
15	2513237083	Paraburkholderia mimosarum LMG 23256	Isolate	Nodule
16	2513237150	Cupriavidus taiwanensis STM6018	Isolate	Nodule
17	2513237151	Burkholderia sp. WSM2230	Isolate	Nodule
18	2513237165	Cupriavidus neocaledonicus STM6070	Isolate	Nodule
19	2513237166	Paraburkholderia azotifigens UYPR1.413	Isolate	Nodule
20	2515154122	Paraburkholderia atlantica JPY251	Isolate	Nodule
21	2515154189	Paraburkholderia nodosa DSM 21604	Isolate	Unclassified
22	2519103095	Burkholderia sp. KJ006	Isolate	Nodule
23	2526164713	Paraburkholderia phenoliruptrix JPY366	Isolate	Nodule
24	2547132103	Chromobacterium sp. C-61	Isolate	Rhizosphere
25	2562617112	Burkholderia sp. BT03	Isolate	Rhizosphere
26	2582581311	Burkholderia sp. WP42	Isolate	Rhizosphere
27	2588253510	Rhizobacter sp. OV335	Isolate	Rhizosphere
28	2599185214	Variovorax sp. NFACC26	Isolate	Rhizoplane
29	2599185226	Variovorax sp. NFACC27	Isolate	Rhizoplane
30	2599185227	Variovorax sp. NFACC28	Isolate	Rhizoplane
31	2599185229	Variovorax sp. NFACC29	Isolate	Endosphere
32	2599185239	Burkholderia sp. NFACC38-1	Isolate	Rhizoplane
33	2599185240	Burkholderia sp. NFPP32	Isolate	Rhizoplane
34	2599185355	Burkholderia sp. NFACC33-1	Isolate	Rhizoplane
35	2600255067	Paraburkholderia kururiensis thiooxydans NBRC 107107	Isolate	Unclassified
36	2600255292	Janthinobacterium lividum NFR18	Isolate	Rhizoplane
37	2643221603	Noviherbaspirillum sp. Root189	Isolate	Unclassified
38	2643221628	Variovorax sp. Root318D1	Isolate	Unclassified
39	2643221638	Duganella sp. Root336D2	Isolate	Unclassified
40	2643221645	Massilia sp. Root351	Isolate	Unclassified
41	2643221658	Variovorax sp. Root411	Isolate	Unclassified
42	2643221672	Variovorax sp. Root434	Isolate	Unclassified
43	2643221683	Variovorax sp. Root473	Isolate	Unclassified
44	2675903129	Burkholderia pyrrocinia NFIX32	Isolate	Rhizoplane
45	2687453129	Halotalea alkalilenta IHB B 13600	Isolate	Unclassified
46	2711768613	Burkholderia sp. BT03	Isolate	Rhizosphere
47	2718217991	Paraburkholderia sprentiae WSM5005	Isolate	Nodule
48	2721755763	Pandoraea thiooxydans ATSB16	Isolate	Rhizosphere
49	2734482258	Glomeribacter sp. phylotype 3	Isolate	Unclassified
50	2738541276	Cellvibrio sp. YR554	Isolate	Unclassified
51	2738541277	Variovorax sp. GV051	Isolate	Unclassified
52	2738541296	Paraburkholderia sp. GV073	Isolate	Unclassified
53	2738541297	Duganella sp. GV083	Isolate	Unclassified
54	2738541298	Paraburkholderia sp. GV068	Isolate	Unclassified
55	2738541306	Paraburkholderia sp. GV052	Isolate	Unclassified
56	2738541307	Variovorax sp. GV008	Isolate	Unclassified
57	2738541357	Duganella sp. GV053	Isolate	Unclassified
58	2738543002	Paraburkholderia sp. GV072	Isolate	Unclassified
59	2738543003	Duganella sp. GV066	Isolate	Unclassified
60	2738543008	Paraburkholderia sp. GV060	Isolate	Unclassified
61	2738543013	Variovorax sp. BT01	Isolate	Unclassified
62	2738543018	Massilia sp. GV045	Isolate	Unclassified
63	2738543019	Variovorax sp. GV040	Isolate	Unclassified
64	2738543026	Duganella sp. GV089	Isolate	Unclassified
65	2738543029	Duganella sp. GV039	Isolate	Unclassified
66	2738543030	Massilia sp. GV097	Isolate	Unclassified
67	2744054900	Paraburkholderia ginsengiterrae DCY85-1	Isolate	Unclassified
68	2744054901	Paraburkholderia ginsengiterrae DCY85	Isolate	Unclassified
69	2751185846	Paraburkholderia ribeironis STM 7296	Isolate	Unclassified
70	2765235838	Herbaspirillum robiniae AA6	Isolate	Unclassified
71	2791355137	Paraburkholderia piptadeniae STM7183	Isolate	Unclassified
72	2808606384	Burkholderia sp. SJZ089	Isolate	Rhizosphere
73	2808606390	Burkholderia sp. SJZ115	Isolate	Rhizosphere
74	2808606391	Burkholderia sp. SJZ091	Isolate	Rhizosphere
75	2816332253	Burkholderia vietnamiensis HI2297	Isolate	Unclassified
76	2816332256	Burkholderia vietnamiensis MSMB608WGS	Isolate	Unclassified
77	2816332286	Burkholderia vietnamiensis HI2221	Isolate	Rhizosphere
78	2818991445	Herbaspirillum hiltneri 3195	Isolate	Unclassified
79	2818991446	Variovorax sp. 1180	Isolate	Unclassified
80	2818991450	Burkholderia sp. 604	Isolate	Unclassified
81	2818991452	Burkholderia cepacia 561	Isolate	Unclassified
82	2831265667	Variovorax guangxiensis DSM 27352	Isolate	Rhizosphere
83	2834641062	Cupriavidus gilardii JZ4	Isolate	Unclassified
84	2838054893	Variovorax guangxiensis 34/80	Isolate	Nodule
85	2839094727	Herbaspirillum robiniae HZ10	Isolate	Nodule
86	2842324504	Paraburkholderia fungorum SEMIA 4007	Isolate	Nodule
87	2842348783	Paraburkholderia fungorum SEMIA 4013	Isolate	Nodule
88	2842454564	Paraburkholderia fungorum SEMIA 4056	Isolate	Nodule
89	2842718218	Acidovorax sp. R-73343	Isolate	Unclassified
90	2842747753	Variovorax sp. R-72060	Isolate	Unclassified
91	2843690924	Chromobacterium rhizoryzae JP2-74	Isolate	Rhizosphere
92	2856287931	Paraburkholderia bannensis BE22	Isolate	Rhizosphere
93	2857357740	Paraburkholderia tropica BE15	Isolate	Rhizosphere
94	2857547612	Janthinobacterium sp. R-74502	Isolate	Unclassified
95	2857576091	Pigmentiphaga sp. R-72090	Isolate	Unclassified
96	2860339153	Pseudomonas sp. JAI111	Isolate	Rhizosphere
97	2863421361	Burkholderia cenocepacia CACua-24	Isolate	Rhizosphere
98	2870068957	Burkholderia sp. JP2-270	Isolate	Unclassified
99	2883087390	Paraburkholderia guartelaensis CNPSo 3008	Isolate	Unclassified
100	2884811622	Herbaspirillum sp. 3C11	Isolate	Unclassified
101	2884836552	Herbaspirillum sp. 3R-11	Isolate	Unclassified
102	2884852848	Herbaspirillum sp. 3R11	Isolate	Unclassified
103	2885080285	Janthinobacterium sp. AD80	Isolate	Rhizosphere
104	2885198086	Variovorax sp. 679	Isolate	Unclassified
105	2885211737	Variovorax sp. 553	Isolate	Unclassified
106	2885270888	Paraburkholderia sp. UYCPa14C	Isolate	Unclassified
107	2896154374	Herbaspirillum sp. 3R-3a1	Isolate	Nodule
108	2899924645	Variovorax sp. 369	Isolate	Unclassified
109	2900634093	Paraburkholderia dipogonis ICMP 19430	Isolate	Unclassified
110	2902682994	Paraburkholderia atlantica CNPSo 3155	Isolate	Unclassified
111	2904483920	Paraburkholderia caledonica 575	Isolate	Unclassified
112	2904541872	Variovorax sp. 1615	Isolate	Rhizosphere
113	2904564687	Burkholderia sp. 571	Isolate	Unclassified
114	2904571731	Burkholderia cenocepacia 574	Isolate	Unclassified
115	2904615490	Paraburkholderia franconis CNPSo 3157	Isolate	Unclassified
116	2919462493	Variovorax sp. 3319	Isolate	Rhizosphere
117	2919527303	Paraburkholderia strydomiana 3827	Isolate	Unclassified
118	2928037797	Variovorax sp. 1126	Isolate	Unclassified
119	2928044640	Variovorax sp. 1128	Isolate	Unclassified
120	2928051484	Variovorax sp. 1133	Isolate	Unclassified
121	2928064002	Variovorax sp. 1140	Isolate	Rhizosphere
122	2928084124	Variovorax paradoxus 1218	Isolate	Unclassified
123	2928108538	Paraburkholderia terricola 1595	Isolate	Rhizosphere
124	2928135762	Paraburkholderia terricola 1988	Isolate	Unclassified
125	2928157003	Burkholderia ambifaria 566	Isolate	Unclassified
126	2928163908	Burkholderia sp. 567	Isolate	Unclassified
127	2928170801	Burkholderia sp. 572	Isolate	Unclassified
128	2928503688	Paraburkholderia terricola 1263	Isolate	Rhizosphere
129	2928536128	Burkholderia sola 565	Isolate	Unclassified
130	2929160207	Variovorax sp. R-72349 Hybrid assembly	Isolate	Unclassified
131	2931396565	Pseudomonas sp. DR48	Isolate	Rhizosphere
132	2932410948	Janthinobacterium lividum 2829	Isolate	Rhizosphere
133	2932416698	Janthinobacterium lividum 2830	Isolate	Rhizosphere
134	2945909444	Variovorax sp. CRF3-Va-1 W1I1	Isolate	Rhizosphere
135	2945934425	Paraburkholderia graminis W1I13	Isolate	Rhizosphere
136	2945972063	Variovorax paradoxus W2I8	Isolate	Rhizosphere
137	2945984333	Variovorax sp. W2I14	Isolate	Rhizosphere
138	2990703756	Paraburkholderia graminis SLBN-33	Isolate	Rhizosphere
139	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
140	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
141	3300001990	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3	Metagenome	Rhizosphere
142	3300002067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1	Metagenome	Rhizosphere
143	3300002704	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB	Metagenome	Unclassified
144	3300002705	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS	Metagenome	Unclassified
145	3300002737	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA	Metagenome	Endosphere
146	3300002738	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA	Metagenome	Unclassified
147	3300002739	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA	Metagenome	Endosphere
148	3300002741	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL	Metagenome	Unclassified
149	3300002773	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS	Metagenome	Endosphere
150	3300002774	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA	Metagenome	Endosphere
151	3300002987	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB	Metagenome	Endosphere
152	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
153	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
154	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
155	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
156	3300003316	Sugarcane root Sample L1	Metagenome	Unclassified
157	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
158	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
159	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
160	3300003374	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF	Metagenome	Endosphere
161	3300003578	Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Unclassified
162	3300003752	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2	Metagenome	Endosphere
163	3300003756	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2	Metagenome	Endosphere
164	3300003758	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2	Metagenome	Endosphere
165	3300003759	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2	Metagenome	Endosphere
166	3300003760	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2	Metagenome	Endosphere
167	3300003761	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2	Metagenome	Endosphere
168	3300003762	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2	Metagenome	Endosphere
169	3300003763	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2	Metagenome	Endosphere
170	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
171	3300003773	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2	Metagenome	Endosphere
172	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
173	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
174	3300003784	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2	Metagenome	Endosphere
175	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
176	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
177	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
178	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
179	3300003856	Agave microbial communities from Guanajuato, Mexico - At.Am.rz	Metagenome	Rhizosphere
180	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
181	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
182	3300005288	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
183	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
184	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
185	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
186	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
187	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
188	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
189	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
190	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
191	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
192	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
193	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
194	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
195	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
196	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
197	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
198	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
199	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
200	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
201	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
202	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
203	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
204	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
205	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
206	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
207	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
208	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
209	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
210	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
211	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
212	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
213	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
214	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
215	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
216	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
217	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
218	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
219	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
220	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
221	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
222	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
223	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
224	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
225	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
226	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
227	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
228	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
229	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
230	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
231	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
232	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
233	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
234	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
235	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
236	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
237	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
238	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
239	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
240	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
241	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
242	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
243	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
244	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
245	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
246	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
247	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
248	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
249	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
250	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
251	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
252	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
253	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
254	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
255	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
256	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
257	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
258	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
259	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
260	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
261	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
262	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
263	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
264	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
265	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
266	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
267	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
268	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
269	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
270	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
271	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
272	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
273	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
274	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
275	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
276	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
277	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
278	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
279	3300006948	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15	Metagenome	Nodule
280	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
281	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
282	3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Metagenome	Rhizosphere
283	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
284	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
285	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
286	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
287	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
288	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
289	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
290	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
291	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
292	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
293	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
294	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
295	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
296	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
297	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
298	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
299	3300012502	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610	Metagenome	Rhizosphere
300	3300012513	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510	Metagenome	Rhizosphere
301	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
302	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
303	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
304	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
305	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
306	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
307	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
308	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
309	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
310	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
311	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
312	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
313	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
314	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
315	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
316	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
317	3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Metagenome	Rhizosphere
318	3300015683	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04	Metagenome	Rhizosphere
319	3300016635	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10	Metagenome	Rhizosphere
320	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
321	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
322	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
323	3300025206	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2)	Metagenome	Unclassified
324	3300025208	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
325	3300025225	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
326	3300025226	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
327	3300025228	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
328	3300025229	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
329	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
330	3300025231	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
331	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
332	3300025242	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
333	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
334	3300025246	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2)	Metagenome	Unclassified
335	3300025250	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2)	Metagenome	Unclassified
336	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
337	3300025256	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2)	Metagenome	Unclassified
338	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
339	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
340	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
341	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
342	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
343	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
344	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
345	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
346	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
347	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
348	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
349	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
350	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
351	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
352	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
353	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
354	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
355	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
356	3300025728	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
357	3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
358	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
359	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
360	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
361	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
362	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
363	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
364	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
365	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
366	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
367	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
368	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
369	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
370	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
371	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
372	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
373	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
374	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
375	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
376	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
377	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
378	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
379	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
380	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
381	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
382	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
383	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
384	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
385	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
386	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
387	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
388	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
389	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
390	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
391	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
392	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
393	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
394	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
395	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
396	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
397	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
398	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
399	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
400	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
401	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
402	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
403	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
404	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
405	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
406	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
407	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
408	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
409	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
410	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
411	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
412	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
413	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
414	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
415	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
416	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
417	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
418	3300027312	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2)	Metagenome	Rhizosphere
419	3300027360	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2)	Metagenome	Rhizosphere
420	3300027364	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2)	Metagenome	Rhizosphere
421	3300027378	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2)	Metagenome	Rhizosphere
422	3300027395	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2)	Metagenome	Rhizosphere
423	3300027462	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2)	Metagenome	Rhizosphere
424	3300027471	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
425	3300027526	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
426	3300027543	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
427	3300027666	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2)	Metagenome	Nodule
428	3300027671	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2)	Metagenome	Rhizosphere
429	3300027682	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
430	3300027695	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2)	Metagenome	Rhizosphere
431	3300027717	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
432	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
433	3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
434	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
435	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
436	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
437	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
438	3300028558	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG	Metagenome	Rhizosphere
439	3300028666	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG	Metagenome	Rhizosphere
440	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
441	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
442	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
443	3300029957	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG	Metagenome	Rhizosphere
444	3300030500	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3)	Metagenome	Rhizosphere
445	3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Metagenome	Unclassified
446	3300030522	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM	Metagenome	Unclassified
447	3300030733	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2	Metagenome	Rhizosphere
448	3300030742	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9	Metagenome	Rhizosphere
449	3300030744	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7	Metagenome	Rhizosphere
450	3300031235	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG	Metagenome	Rhizosphere
451	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
452	3300031239	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG	Metagenome	Rhizosphere
453	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
454	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
455	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
456	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
457	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
458	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
459	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
460	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
461	3300031649	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM	Metagenome	Unclassified
462	3300031665	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3	Metagenome	Rhizosphere
463	3300031691	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA	Metagenome	Rhizosphere
464	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
465	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
466	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
467	3300031728	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC	Metagenome	Rhizosphere
468	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
469	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
470	3300031733	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1	Metagenome	Rhizosphere
471	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
472	3300031838	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM	Metagenome	Unclassified
473	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
474	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
475	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
476	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
477	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
478	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
479	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
480	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
481	3300032133	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA	Metagenome	Rhizosphere
482	3300032137	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC	Metagenome	Rhizosphere
483	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
484	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
485	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
486	3300035115	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11	Metagenome	Rhizosphere
487	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
488	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
489	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
490	3300035120	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5	Metagenome	Rhizosphere
491	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
492	3300035242	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11	Metagenome	Rhizosphere
493	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
494	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
495	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
496	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
497	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
498	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
499	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
500	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
501	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
502	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
503	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
504	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
505	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
506	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
507	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
508	3300037588	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA	Metagenome	Rhizosphere
509	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
510	3300039062	Seagrass microbial communities from Seahorse Key, FL, USA - HH0818	Metagenome	Unclassified
511	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
512	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
513	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
514	3300041404	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272	Metagenome	Rhizosphere
515	3300041405	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414	Metagenome	Rhizosphere
516	3300041407	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416	Metagenome	Rhizosphere
517	3300041408	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195	Metagenome	Rhizosphere
518	3300041410	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596	Metagenome	Rhizosphere
519	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
520	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
521	3300041443	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG	Metagenome	Rhizoplane
522	3300041451	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG	Metagenome	Rhizoplane
523	3300041452	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG	Metagenome	Rhizoplane
524	3300041459	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG	Metagenome	Rhizoplane
525	3300041463	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG	Metagenome	Rhizoplane
526	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
527	3300041997	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607	Metagenome	Rhizosphere
528	3300041999	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297	Metagenome	Rhizosphere
529	3300042001	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542	Metagenome	Rhizosphere
530	3300042002	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616	Metagenome	Rhizosphere
531	3300042003	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551	Metagenome	Rhizosphere
532	3300042004	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619	Metagenome	Rhizosphere
533	3300042005	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216	Metagenome	Rhizosphere
534	3300042006	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437	Metagenome	Rhizosphere
535	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
536	3300042010	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431	Metagenome	Rhizosphere
537	3300042012	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213	Metagenome	Rhizosphere
538	3300042014	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275	Metagenome	Rhizosphere
539	3300042015	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287	Metagenome	Rhizosphere
540	3300042115	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642	Metagenome	Rhizosphere
541	3300042121	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398	Metagenome	Rhizosphere
542	3300042123	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228	Metagenome	Rhizosphere
543	3300042126	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87	Metagenome	Rhizosphere
544	3300042127	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91	Metagenome	Rhizosphere
545	3300042128	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123	Metagenome	Rhizosphere
546	3300042129	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95	Metagenome	Rhizosphere
547	3300042133	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134	Metagenome	Rhizosphere
548	3300042134	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126	Metagenome	Rhizosphere
549	3300042135	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127	Metagenome	Rhizosphere
550	3300042137	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519	Metagenome	Rhizosphere
551	3300042145	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581	Metagenome	Rhizosphere
552	3300042156	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593	Metagenome	Rhizosphere
553	3300042184	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630	Metagenome	Rhizosphere
554	3300042185	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592	Metagenome	Rhizosphere
555	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
556	3300042436	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520	Metagenome	Rhizosphere
557	3300042437	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554	Metagenome	Rhizosphere
558	3300042438	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533	Metagenome	Rhizosphere
559	3300042461	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366	Metagenome	Rhizosphere
560	3300042531	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253	Metagenome	Rhizosphere
561	3300042532	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92	Metagenome	Rhizosphere
562	3300042533	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472	Metagenome	Rhizosphere
563	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
564	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
565	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
566	3300044659	Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E	Metagenome	Unclassified
567	3300044666	Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E	Metagenome	Unclassified
568	3300044672	Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E	Metagenome	Unclassified
569	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
570	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
571	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
572	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
573	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
574	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
575	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
576	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
577	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
578	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
579	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
580	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
581	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
582	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
583	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
584	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
585	3300046452	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere	Metagenome	Rhizosphere
586	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
587	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
588	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
589	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
590	3300046458	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere	Metagenome	Rhizosphere
591	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
592	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
593	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
594	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
595	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
596	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
597	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
598	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
599	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
600	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
601	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
602	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
603	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
604	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
605	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
606	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
607	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
608	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
609	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
610	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
611	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
612	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
613	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
614	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
615	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
616	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
617	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
618	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
619	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
620	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
621	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
622	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
623	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
624	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
625	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
626	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
627	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
628	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
629	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
630	3300046537	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere	Metagenome	Rhizosphere
631	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
632	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
633	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
634	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
635	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
636	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
637	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
638	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
639	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
640	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
641	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
642	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
643	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
644	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
645	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
646	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
647	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
648	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
649	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
650	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
651	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
652	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
653	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
654	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
655	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
656	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
657	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
658	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
659	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
660	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
661	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
662	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
663	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
664	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
665	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
666	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
667	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
668	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
669	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
670	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
671	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
672	3300047446	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere	Metagenome	Rhizosphere
673	3300047447	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere	Metagenome	Rhizosphere
674	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
675	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
676	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
677	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
678	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
679	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
680	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
681	3300048090	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere	Metagenome	Rhizosphere
682	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
683	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
684	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
685	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
686	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
687	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
688	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
689	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
690	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
691	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
692	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
693	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
694	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
695	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
696	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
697	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
698	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
699	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
700	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
701	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
702	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
703	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
704	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
705	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
706	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
707	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
708	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
709	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
710	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
711	3300049523	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control	Metagenome	Rhizosphere
712	3300049530	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
713	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
714	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
715	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
716	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
717	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
718	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
719	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
720	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
721	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
722	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
723	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
724	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
725	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
726	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
727	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
728	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
729	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
730	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
731	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
732	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
733	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
734	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
735	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
736	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
737	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
738	3300049649	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought	Metagenome	Rhizosphere
739	3300049650	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought	Metagenome	Rhizosphere
740	3300049658	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought	Metagenome	Rhizosphere
741	3300049662	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control	Metagenome	Rhizosphere
742	3300049663	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought	Metagenome	Rhizosphere
743	3300049665	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought	Metagenome	Rhizosphere
744	3300049679	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought	Metagenome	Rhizosphere
745	3300049690	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought	Metagenome	Rhizosphere
746	3300049704	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control	Metagenome	Rhizosphere
747	3300049706	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control	Metagenome	Rhizosphere
748	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
749	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
750	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
751	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
752	3300049759	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought	Metagenome	Rhizosphere
753	3300049764	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control	Metagenome	Rhizosphere
754	3300049775	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought	Metagenome	Rhizosphere
755	3300049776	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought	Metagenome	Rhizosphere
756	3300049778	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control	Metagenome	Rhizosphere
757	3300049779	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought	Metagenome	Rhizosphere
758	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
759	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
760	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
761	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
762	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
763	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
764	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
765	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
766	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
767	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
768	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
769	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
770	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
771	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
772	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
773	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
774	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
775	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
776	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
777	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
778	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
779	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
780	3300053079	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere	Metagenome	Endosphere
781	3300053080	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere	Metagenome	Endosphere
782	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
783	3300053086	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere	Metagenome	Endosphere
784	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
785	3300053088	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere	Metagenome	Endosphere
786	3300053090	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere	Metagenome	Endosphere
787	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
788	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
789	3300053098	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere	Metagenome	Endosphere
790	3300053110	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere	Metagenome	Endosphere
791	3300053116	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere	Metagenome	Endosphere
792	3300053117	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere	Metagenome	Endosphere
793	3300053118	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere	Metagenome	Endosphere
794	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
795	3300053121	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere	Metagenome	Endosphere
796	3300053122	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere	Metagenome	Endosphere
797	3300053125	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere	Metagenome	Endosphere
798	3300053126	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere	Metagenome	Endosphere
799	3300053129	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere	Metagenome	Endosphere
800	3300053130	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere	Metagenome	Endosphere
801	3300053131	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere	Metagenome	Endosphere
802	3300053133	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere	Metagenome	Endosphere
803	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
804	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
805	3300053137	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere	Metagenome	Endosphere
806	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
807	3300053140	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere	Metagenome	Endosphere
808	3300053141	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere	Metagenome	Endosphere
809	3300053142	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere	Metagenome	Endosphere
810	3300053145	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere	Metagenome	Endosphere
811	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
812	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
813	3300053157	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere	Metagenome	Endosphere
814	3300053158	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere	Metagenome	Endosphere
815	3300053161	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere	Metagenome	Endosphere
816	3300053162	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere	Metagenome	Endosphere
817	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
818	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
819	3300053735	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere	Metagenome	Endosphere
820	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
821	3300055283	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere	Metagenome	Endosphere
822	3300059423	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
823	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
824	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
825	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere
826	639633007	Azoarcus olearius BH72	Isolate	Unclassified
827	641736151	Paraburkholderia graminis C4D1M	Isolate	Rhizoplane
828	641736154	Burkholderia ambifaria IOP40-10	Isolate	Rhizosphere
829	642555112	Paraburkholderia phymatum STM815	Isolate	Nodule
830	642555113	Paraburkholderia phytofirmans PsJN	Isolate	Unclassified
831	644736347	Cupriavidus taiwanensis LMG 19424	Isolate	Nodule
832	8003400568	Cupriavidus gilardii USM5	Isolate	Rhizosphere
833	8003955200	Paraburkholderia mimosarum LMG 23256	Isolate	Nodule
834	8018845410	Burkholderia reimsis BE51	Isolate	Rhizosphere
835	8020807995	Burkholderia sp. B10	Isolate	Rhizosphere
836	8020938398	Burkholderia sp. BE12	Isolate	Rhizosphere
837	8020945358	Burkholderia sp. BE17	Isolate	Rhizosphere
838	8020953355	Burkholderia sp. BE24	Isolate	Rhizosphere
839	8021120328	Burkholderia sp. LS-044	Isolate	Rhizosphere
840	8039098773	Burkholderia multivorans MSMB612WGS	Isolate	Unclassified
841	8040167225	Burkholderia vietnamiensis RS1	Isolate	Unclassified
842	8040173305	Burkholderia vietnamiensis BE10	Isolate	Rhizosphere
843	8055266321	Paraburkholderia rhynchosiae LMG 27174	Isolate	Nodule
844	8055301274	Paraburkholderia kirstenboschensis LMG 28727	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	94.46
Metatranscriptomes	0.1
Isolates	5.43

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	16.79
Nodule	1.11
Rhizoplane	3.15
Rhizosphere	70.13
Stem	0
Stem Tuber	0
Unclassified	8.83

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24740J21852_10001524	3300001979	Bacteria	10652
2	JGI24740J21852_10003346	3300001979	Bacteria	7063
3	JGI24740J21852_10027159	3300001979	Bacteria	1907
4	JGI24739J22299_10002337	3300001989	Bacteria	7306
5	JGI24739J22299_10002468	3300001989	Bacteria	7136
6	JGI24739J22299_10035783	3300001989	Bacteria	1680
7	JGI24737J22298_10014452	3300001990	Bacteria	2563
8	JGI24737J22298_10064773	3300001990	Bacteria	1096
9	JGI24735J21928_10001085	3300002067	Bacteria	9725
10	JGI24735J21928_10009375	3300002067	Bacteria	3145
11	JGI24735J21928_10019460	3300002067	Bacteria	2087
12	JGI24735J21928_10019885	3300002067	Bacteria	2061
13	JGI25155J39150_1000031	3300002704	Bacteria	106418
14	JGI25155J39150_1000658	3300002704	Bacteria	6733
15	JGI25156J39149_1000040	3300002705	Bacteria	106617
16	JGI25156J39149_1001225	3300002705	Bacteria	11272
17	JGI25156J39149_1001322	3300002705	Bacteria	10707
18	JGI25156J39149_1002033	3300002705	Bacteria	7717
19	JGI25156J39149_1002411	3300002705	Bacteria	6730
20	JGI25156J39149_1002930	3300002705	Bacteria	5806
21	JGI25156J39149_1024306	3300002705	Bacteria	993
22	JGI25162J39368_1004129	3300002737	Bacteria	3578
23	JGI25154J39366_1000060	3300002738	Bacteria	106617
24	JGI25154J39366_1000806	3300002738	Bacteria	13754
25	JGI25154J39366_1001739	3300002738	Bacteria	7031
26	JGI25154J39366_1001868	3300002738	Bacteria	6414
27	JGI25158J39367_1000991	3300002739	Bacteria	5229
28	JGI25158J39367_1002379	3300002739	Bacteria	3066
29	JGI25157J39369_1000038	3300002741	Bacteria	130270
30	JGI25157J39369_1000058	3300002741	Bacteria	106617
31	JGI25157J39369_1000747	3300002741	Bacteria	17104
32	JGI25152J39213_1000152	3300002773	Bacteria	47329
33	JGI25152J39213_1008611	3300002773	Bacteria	2515
34	JGI25152J39213_1017287	3300002773	Bacteria	1366
35	JGI25152J39213_1026506	3300002773	Bacteria	946
36	JGI25150J39212_1000950	3300002774	Bacteria	9269
37	JGI25150J39212_1001600	3300002774	Bacteria	6165
38	JGI25159J45721_1001210	3300002987	Bacteria	10940
39	JGI25159J45721_1002607	3300002987	Bacteria	6755
40	JGI25159J45721_1005461	3300002987	Bacteria	3989
41	JGI25159J45721_1021163	3300002987	Bacteria	1234
42	JGI25151J46595_10000618	3300003187	Bacteria	31089
43	JGI25151J46595_10003753	3300003187	Bacteria	8247
44	JGI25151J46595_10004874	3300003187	Bacteria	7008
45	JGI25151J46595_10013403	3300003187	Bacteria	3689
46	JGI25151J46595_10017357	3300003187	Bacteria	3123
47	JGI25151J46595_10018149	3300003187	Bacteria	3032
48	JGI25151J46595_10063915	3300003187	Bacteria	1155
49	JGI25151J46595_10080416	3300003187	Bacteria	946
50	JGI25406J46586_10049226	3300003203	Bacteria	1423
51	JGI25165J46597_1001003	3300003214	Bacteria	18718
52	JGI25153J46596_10001554	3300003215	Bacteria	13642
53	JGI25153J46596_10002204	3300003215	Bacteria	11372
54	JGI25153J46596_10008024	3300003215	Bacteria	5103
55	JGI25153J46596_10067081	3300003215	Bacteria	946
56	rootH1_10013764	3300003316	Bacteria	11552
57	rootH1_10013764	3300003323	Bacteria	34814
58	rootH1_10034976	3300003316	Bacteria	1985
59	rootL2_10034186	3300003322	Bacteria	1817
60	rootL2_10052331	3300003322	Bacteria	4668
61	rootH1_10015799	3300003323	Bacteria	2022
62	rootH1_10174403	3300003323	Bacteria	1434
63	JGI25160J50197_1000122	3300003354	Bacteria	70535
64	JGI25160J50197_1000171	3300003354	Bacteria	55915
65	JGI25160J50197_1001086	3300003354	Bacteria	13949
66	JGI25160J50197_1016798	3300003354	Bacteria	2345
67	JGI25160J50197_1035637	3300003354	Bacteria	1218
68	JGI25161J50226_1000021	3300003374	Bacteria	163584
69	JGI25161J50226_1000635	3300003374	Bacteria	14223
70	JGI25161J50226_1012947	3300003374	Bacteria	982
71	JGI25161J50226_1012958	3300003374	Bacteria	981
72	Ga0006562J51391_1049265	3300003578	Bacteria	3250
73	Ga0006562J51391_1049268	3300003578	Bacteria	1240
74	Ga0055539_1001512	3300003752	Bacteria	4256
75	Ga0055539_1003062	3300003752	Bacteria	2400
76	Ga0055533_1000026	3300003756	Bacteria	323407
77	Ga0055533_1000557	3300003756	Bacteria	13209
78	Ga0055532_1000001	3300003758	Bacteria	1119836
79	Ga0055532_1000271	3300003758	Bacteria	33888
80	Ga0055525_1000783	3300003759	Bacteria	10217
81	Ga0055527_1000014	3300003760	Bacteria	289449
82	Ga0055527_1000415	3300003760	Bacteria	17616
83	Ga0055527_1002231	3300003760	Bacteria	3390
84	Ga0055527_1004273	3300003760	Bacteria	1985
85	Ga0055535_1000001	3300003761	Bacteria	1119836
86	Ga0055535_1000192	3300003761	Bacteria	64814
87	Ga0055535_1000986	3300003761	Bacteria	18474
88	Ga0055535_1001029	3300003761	Bacteria	17616
89	Ga0055535_1001544	3300003761	Bacteria	11260
90	Ga0055542_1000001	3300003762	Bacteria	1119836
91	Ga0055542_1000058	3300003762	Bacteria	162781
92	Ga0055542_1000984	3300003762	Bacteria	18488
93	Ga0055542_1001409	3300003762	Bacteria	12120
94	Ga0055529_1000001	3300003763	Bacteria	826680
95	Ga0055529_1000103	3300003763	Bacteria	127175
96	Ga0055529_1000791	3300003763	Bacteria	19381
97	Ga0055526_1001230	3300003771	Bacteria	18427
98	Ga0055526_1003865	3300003771	Bacteria	9286
99	Ga0055526_1004127	3300003771	Bacteria	8861
100	Ga0055526_1007909	3300003771	Bacteria	5415
101	Ga0055526_1008505	3300003771	Bacteria	5111
102	Ga0055526_1009528	3300003771	Bacteria	4654
103	Ga0055526_1048836	3300003771	Bacteria	982
104	Ga0055526_1048857	3300003771	Bacteria	981
105	Ga0055537_1000040	3300003773	Bacteria	92014
106	Ga0055537_1000117	3300003773	Bacteria	60144
107	Ga0055537_1000399	3300003773	Bacteria	29114
108	Ga0055537_1004404	3300003773	Bacteria	4031
109	Ga0055537_1008407	3300003773	Bacteria	2385
110	Ga0055537_1008513	3300003773	Bacteria	2360
111	Ga0055537_1020931	3300003773	Bacteria	982
112	Ga0055524_1000039	3300003775	Bacteria	159897
113	Ga0055524_1000382	3300003775	Bacteria	38462
114	Ga0055524_1001130	3300003775	Bacteria	16051
115	Ga0055524_1016214	3300003775	Bacteria	2683
116	Ga0055524_1016660	3300003775	Bacteria	2624
117	Ga0055524_1017778	3300003775	Bacteria	2495
118	Ga0055524_1048229	3300003775	Bacteria	995
119	Ga0055524_1048849	3300003775	Bacteria	982
120	Ga0055536_1000044	3300003781	Bacteria	123111
121	Ga0055536_1001124	3300003781	Bacteria	16799
122	Ga0055536_1005814	3300003781	Bacteria	5929
123	Ga0055536_1008554	3300003781	Bacteria	4383
124	Ga0055534_1000160	3300003784	Bacteria	50576
125	Ga0055534_1000315	3300003784	Bacteria	32280
126	Ga0055534_1000584	3300003784	Bacteria	19110
127	Ga0055534_1000649	3300003784	Bacteria	17691
128	Ga0055534_1004500	3300003784	Bacteria	4020
129	Ga0055534_1012283	3300003784	Bacteria	1700
130	Ga0055534_1024346	3300003784	Bacteria	982
131	Ga0055528_1000031	3300003790	Bacteria	120960
132	Ga0055528_1000517	3300003790	Bacteria	30214
133	Ga0055528_1002137	3300003790	Bacteria	10890
134	Ga0055528_1006002	3300003790	Bacteria	5563
135	Ga0055528_1006806	3300003790	Bacteria	5138
136	Ga0055528_1015417	3300003790	Bacteria	2763
137	Ga0055528_1035444	3300003790	Bacteria	1210
138	Ga0055528_1043292	3300003790	Bacteria	982
139	Ga0055530_10000386	3300003791	Bacteria	39620
140	Ga0055530_10001364	3300003791	Bacteria	18106
141	Ga0055530_10002767	3300003791	Bacteria	10849
142	Ga0055530_10003883	3300003791	Bacteria	8163
143	Ga0055530_10007810	3300003791	Bacteria	4423
144	Ga0055530_10026077	3300003791	Bacteria	1621
145	Ga0055540_1000007	3300003792	Bacteria	318178
146	Ga0055540_1000047	3300003792	Bacteria	146914
147	Ga0055540_1001164	3300003792	Bacteria	16364
148	Ga0055540_1001430	3300003792	Bacteria	14233
149	Ga0055540_1005861	3300003792	Bacteria	5032
150	Ga0055540_1006933	3300003792	Bacteria	4383
151	Ga0055531_10000179	3300003794	Bacteria	72059
152	Ga0055531_10001612	3300003794	Bacteria	16364
153	Ga0055531_10002477	3300003794	Bacteria	12313
154	Ga0055531_10006757	3300003794	Bacteria	6415
155	Ga0055531_10014710	3300003794	Bacteria	3505
156	Ga0055531_10034347	3300003794	Bacteria	1611
157	Ga0058692_1005548	3300003856	Bacteria	3584
158	Ga0058692_1020145	3300003856	Bacteria	1408
159	Ga0055543_1000107	3300004625	Bacteria	71784
160	Ga0055543_1000922	3300004625	Bacteria	13701
161	Ga0055543_1006104	3300004625	Bacteria	2969
162	Ga0065165_1000466	3300005262	Bacteria	63334
163	Ga0065165_1001186	3300005262	Bacteria	30210
164	Ga0065165_1001400	3300005262	Bacteria	26315
165	Ga0065165_1001411	3300005262	Bacteria	26128
166	Ga0065165_1002803	3300005262	Bacteria	13701
167	Ga0065165_1011702	3300005262	Bacteria	3627
168	Ga0065165_1022031	3300005262	Bacteria	2196
169	Ga0065714_10083798	3300005288	Bacteria	2231
170	Ga0065715_10182275	3300005293	Bacteria	1468
171	Ga0065707_10274740	3300005295	Bacteria	1062
172	Ga0070658_10017290	3300005327	Bacteria	5771
173	Ga0070658_10020322	3300005327	Bacteria	5321
174	Ga0070658_10020398	3300005327	Bacteria	5312
175	Ga0070658_10070959	3300005327	Bacteria	2852
176	Ga0070676_10050322	3300005328	Bacteria	2442
177	Ga0070676_10099427	3300005328	Bacteria	1795
178	Ga0070690_100299544	3300005330	Unclassified	1153
179	Ga0070670_100000001	3300005331	Bacteria	728788
180	Ga0070670_100000002	3300005331	Bacteria	568775
181	Ga0070670_100006483	3300005331	Bacteria	9904
182	Ga0070670_100145152	3300005331	Bacteria	2053
183	Ga0070677_10008659	3300005333	Bacteria	3431
184	Ga0070677_10021062	3300005333	Bacteria	2386
185	Ga0070677_10104546	3300005333	Bacteria	1255
186	Ga0070677_10171528	3300005333	Bacteria	1026
187	Ga0068869_100034778	3300005334	Bacteria	3567
188	Ga0068869_100090348	3300005334	Bacteria	2301
189	Ga0070666_10000278	3300005335	Bacteria	33841
190	Ga0070666_10102211	3300005335	Bacteria	1976
191	Ga0070666_10191338	3300005335	Bacteria	1438
192	Ga0070680_100051006	3300005336	Bacteria	3376
193	Ga0070680_100207165	3300005336	Bacteria	1654
194	Ga0070680_100286276	3300005336	Bacteria	1397
195	Ga0070680_100310628	3300005336	Bacteria	1337
196	Ga0070680_100314760	3300005336	Unclassified	1328
197	Ga0070680_100399234	3300005336	Bacteria	1172
198	Ga0070680_100440302	3300005336	Bacteria	1113
199	Ga0070680_100554496	3300005336	Bacteria	985
200	Ga0070682_100005788	3300005337	Bacteria	6901
201	Ga0070682_100045456	3300005337	Bacteria	2722
202	Ga0070682_100388402	3300005337	Bacteria	1052
203	Ga0068868_100023163	3300005338	Bacteria	4697
204	Ga0068868_100084267	3300005338	Bacteria	2552
205	Ga0068868_100158985	3300005338	Bacteria	1865
206	Ga0070660_100000032	3300005339	Bacteria	85304
207	Ga0070660_100006752	3300005339	Bacteria	7962
208	Ga0070660_100012152	3300005339	Bacteria	6148
209	Ga0070660_100198856	3300005339	Bacteria	1625
210	Ga0070687_100117303	3300005343	Bacteria	1517
211	Ga0070687_100498676	3300005343	Bacteria	819
212	Ga0070661_100011585	3300005344	Bacteria	6146
213	Ga0070661_100014151	3300005344	Bacteria	5619
214	Ga0070661_100077141	3300005344	Bacteria	2456
215	Ga0070661_100210599	3300005344	Bacteria	1488
216	Ga0070692_10152695	3300005345	Bacteria	1316
217	Ga0070668_100001632	3300005347	Bacteria	16244
218	Ga0070669_100000774	3300005353	Bacteria	23214
219	Ga0070669_100003551	3300005353	Bacteria	11253
220	Ga0070669_100053480	3300005353	Bacteria	2956
221	Ga0070669_100108805	3300005353	Bacteria	2101
222	Ga0070669_100206576	3300005353	Bacteria	1547
223	Ga0070669_100224106	3300005353	Bacteria	1487
224	Ga0070675_100001142	3300005354	Bacteria	19151
225	Ga0070675_100010453	3300005354	Bacteria	7251
226	Ga0070675_100574570	3300005354	Bacteria	1021
227	Ga0070671_100000023	3300005355	Bacteria	123775
228	Ga0070671_100015764	3300005355	Bacteria	6106
229	Ga0070671_100070394	3300005355	Bacteria	2918
230	Ga0070671_100104101	3300005355	Bacteria	2382
231	Ga0070671_100210614	3300005355	Bacteria	1649
232	Ga0070671_100503188	3300005355	Bacteria	1042
233	Ga0070671_100622227	3300005355	Bacteria	934
234	Ga0070674_100122309	3300005356	Bacteria	1928
235	Ga0070674_100359019	3300005356	Bacteria	1179
236	Ga0070674_100515967	3300005356	Bacteria	997
237	Ga0070673_100021682	3300005364	Bacteria	4664
238	Ga0070673_100046760	3300005364	Bacteria	3363
239	Ga0070673_100104635	3300005364	Bacteria	2337
240	Ga0070673_100119792	3300005364	Bacteria	2194
241	Ga0070673_100875911	3300005364	Bacteria	832
242	Ga0070688_100009510	3300005365	Bacteria	5321
243	Ga0070688_100023257	3300005365	Bacteria	3643
244	Ga0070659_100000035	3300005366	Bacteria	115022
245	Ga0070659_100001539	3300005366	Bacteria	16606
246	Ga0070659_100024164	3300005366	Bacteria	4657
247	Ga0070659_100040351	3300005366	Bacteria	3647
248	Ga0070659_100325450	3300005366	Bacteria	1285
249	Ga0070667_100000018	3300005367	Bacteria	226033
250	Ga0070667_100000181	3300005367	Bacteria	75613
251	Ga0070667_100004868	3300005367	Bacteria	11250
252	Ga0070667_100193977	3300005367	Bacteria	1800
253	Ga0070667_100258079	3300005367	Bacteria	1560
254	Ga0070667_100393677	3300005367	Bacteria	1260
255	Ga0070667_100437669	3300005367	Bacteria	1194
256	Ga0070667_100620101	3300005367	Bacteria	997
257	Ga0070713_100002610	3300005436	Bacteria	11772
258	Ga0070713_100208834	3300005436	Bacteria	1767
259	Ga0070710_10121112	3300005437	Bacteria	1584
260	Ga0070701_10246944	3300005438	Bacteria	1076
261	Ga0070701_10319519	3300005438	Bacteria	960
262	Ga0070711_100426892	3300005439	Bacteria	1081
263	Ga0070705_100292699	3300005440	Bacteria	1163
264	Ga0070705_100457142	3300005440	Bacteria	959
265	Ga0070700_100007531	3300005441	Bacteria	5887
266	Ga0070700_100308926	3300005441	Bacteria	1157
267	Ga0070694_100007242	3300005444	Bacteria	6757
268	Ga0070694_100015912	3300005444	Bacteria	4731
269	Ga0070694_100064215	3300005444	Bacteria	2513
270	Ga0070694_100143518	3300005444	Bacteria	1736
271	Ga0070694_100180608	3300005444	Bacteria	1561
272	Ga0070708_100054926	3300005445	Bacteria	3540
273	Ga0070708_100496173	3300005445	Bacteria	1152
274	Ga0070708_100625930	3300005445	Bacteria	1014
275	Ga0070663_100000222	3300005455	Bacteria	28738
276	Ga0070663_100027249	3300005455	Bacteria	3878
277	Ga0070663_100047832	3300005455	Bacteria	3031
278	Ga0070663_100060728	3300005455	Bacteria	2720
279	Ga0070663_100267449	3300005455	Bacteria	1358
280	Ga0070663_100334208	3300005455	Bacteria	1222
281	Ga0070663_100362043	3300005455	Bacteria	1177
282	Ga0070678_100262398	3300005456	Bacteria	1453
283	Ga0070678_100320795	3300005456	Bacteria	1323
284	Ga0070678_100358706	3300005456	Bacteria	1255
285	Ga0070662_100024237	3300005457	Bacteria	4178
286	Ga0070662_100100347	3300005457	Bacteria	2190
287	Ga0070662_100146445	3300005457	Bacteria	1835
288	Ga0070662_100452784	3300005457	Bacteria	1065
289	Ga0070662_100583474	3300005457	Bacteria	939
290	Ga0070681_10005152	3300005458	Bacteria	12610
291	Ga0070681_10006361	3300005458	Bacteria	11481
292	Ga0070681_10032614	3300005458	Bacteria	5228
293	Ga0070681_10109880	3300005458	Bacteria	2697
294	Ga0070681_10137088	3300005458	Bacteria	2377
295	Ga0068867_100002905	3300005459	Bacteria	12070
296	Ga0068867_100039288	3300005459	Bacteria	3449
297	Ga0068867_100055869	3300005459	Bacteria	2920
298	Ga0068867_100111816	3300005459	Bacteria	2099
299	Ga0070685_10000002	3300005466	Bacteria	295205
300	Ga0070685_10000011	3300005466	Bacteria	137723
301	Ga0070706_100000789	3300005467	Bacteria	35385
302	Ga0070706_100024975	3300005467	Bacteria	5501
303	Ga0070706_100057302	3300005467	Bacteria	3595
304	Ga0070706_100158670	3300005467	Bacteria	2112
305	Ga0070707_100004600	3300005468	Bacteria	12909
306	Ga0070707_100230797	3300005468	Bacteria	1802
307	Ga0070707_100454405	3300005468	Bacteria	1242
308	Ga0070698_100065470	3300005471	Bacteria	3659
309	Ga0070698_100071857	3300005471	Bacteria	3469
310	Ga0070699_100006048	3300005518	Bacteria	10581
311	Ga0070699_100028575	3300005518	Bacteria	4809
312	Ga0070699_100123173	3300005518	Bacteria	2281
313	Ga0070699_100315818	3300005518	Bacteria	1403
314	Ga0070679_100090249	3300005530	Bacteria	3052
315	Ga0070679_100201503	3300005530	Bacteria	1956
316	Ga0070679_100478437	3300005530	Bacteria	1189
317	Ga0070697_100001878	3300005536	Bacteria	16058
318	Ga0070697_100160601	3300005536	Bacteria	1898
319	Ga0070697_100497000	3300005536	Bacteria	1066
320	Ga0068853_100011938	3300005539	Bacteria	7064
321	Ga0068853_100015329	3300005539	Bacteria	6298
322	Ga0068853_100018334	3300005539	Bacteria	5792
323	Ga0068853_100106151	3300005539	Bacteria	2489
324	Ga0068853_100200382	3300005539	Bacteria	1816
325	Ga0068853_100491673	3300005539	Bacteria	1157
326	Ga0068853_100540543	3300005539	Bacteria	1103
327	Ga0068853_100610611	3300005539	Bacteria	1036
328	Ga0070672_100000122	3300005543	Bacteria	40112
329	Ga0070672_100027555	3300005543	Bacteria	4239
330	Ga0070672_100047269	3300005543	Bacteria	3339
331	Ga0070672_100054159	3300005543	Bacteria	3139
332	Ga0070672_100137734	3300005543	Bacteria	2011
333	Ga0070672_100155240	3300005543	Bacteria	1895
334	Ga0070672_100214819	3300005543	Bacteria	1612
335	Ga0070672_100994270	3300005543	Bacteria	743
336	Ga0070686_100348962	3300005544	Bacteria	1111
337	Ga0070686_100437451	3300005544	Bacteria	1003
338	Ga0070686_100588718	3300005544	Bacteria	875
339	Ga0070695_100010565	3300005545	Bacteria	5516
340	Ga0070695_100033798	3300005545	Bacteria	3201
341	Ga0070695_100037387	3300005545	Bacteria	3059
342	Ga0070695_100103007	3300005545	Bacteria	1925
343	Ga0070695_100423938	3300005545	Bacteria	1014
344	Ga0070696_100047259	3300005546	Bacteria	2986
345	Ga0070696_100061761	3300005546	Bacteria	2621
346	Ga0070696_100142217	3300005546	Bacteria	1755
347	Ga0070693_100018797	3300005547	Bacteria	3614
348	Ga0070693_100036619	3300005547	Bacteria	2729
349	Ga0070693_100046476	3300005547	Bacteria	2465
350	Ga0070693_100052030	3300005547	Bacteria	2347
351	Ga0070665_100004037	3300005548	Bacteria	15433
352	Ga0070665_100039387	3300005548	Bacteria	4752
353	Ga0070665_100063282	3300005548	Bacteria	3709
354	Ga0070665_100210128	3300005548	Bacteria	1947
355	Ga0070665_100360983	3300005548	Bacteria	1459
356	Ga0070665_100447037	3300005548	Bacteria	1302
357	Ga0070704_100000704	3300005549	Bacteria	16287
358	Ga0070704_100012313	3300005549	Bacteria	5282
359	Ga0070704_100021568	3300005549	Bacteria	4180
360	Ga0070704_100024510	3300005549	Bacteria	3960
361	Ga0070704_100026759	3300005549	Bacteria	3817
362	Ga0070704_100068682	3300005549	Bacteria	2565
363	Ga0070704_100093944	3300005549	Bacteria	2243
364	Ga0070704_100408996	3300005549	Bacteria	1159
365	Ga0068855_100018523	3300005563	Bacteria	8371
366	Ga0068855_100031855	3300005563	Bacteria	6294
367	Ga0068855_100045477	3300005563	Bacteria	5193
368	Ga0068855_100199007	3300005563	Bacteria	2256
369	Ga0070664_100001967	3300005564	Bacteria	16475
370	Ga0070664_100013666	3300005564	Bacteria	6617
371	Ga0070664_100041429	3300005564	Bacteria	3886
372	Ga0070664_100093161	3300005564	Bacteria	2610
373	Ga0070664_100245338	3300005564	Bacteria	1609
374	Ga0070664_100493559	3300005564	Bacteria	1128
375	Ga0068857_100015708	3300005577	Bacteria	6622
376	Ga0068857_100121119	3300005577	Bacteria	2355
377	Ga0068857_100163964	3300005577	Bacteria	2017
378	Ga0068857_100221346	3300005577	Bacteria	1729
379	Ga0068854_100084139	3300005578	Bacteria	2353
380	Ga0068854_100165833	3300005578	Bacteria	1715
381	Ga0068854_100188537	3300005578	Bacteria	1615
382	Ga0068854_100330537	3300005578	Bacteria	1242
383	Ga0068854_100426659	3300005578	Bacteria	1102
384	Ga0068856_100063778	3300005614	Bacteria	3640
385	Ga0068856_100069165	3300005614	Bacteria	3491
386	Ga0068856_100132625	3300005614	Bacteria	2496
387	Ga0068856_100197908	3300005614	Bacteria	2024
388	Ga0068856_100280149	3300005614	Bacteria	1684
389	Ga0070702_100019738	3300005615	Bacteria	3522
390	Ga0070702_100282970	3300005615	Bacteria	1139
391	Ga0068852_100009555	3300005616	Bacteria	7205
392	Ga0068852_100011356	3300005616	Bacteria	6701
393	Ga0068852_100049197	3300005616	Bacteria	3605
394	Ga0068852_100102318	3300005616	Bacteria	2588
395	Ga0068852_100105674	3300005616	Bacteria	2551
396	Ga0068852_100125761	3300005616	Bacteria	2354
397	Ga0068852_100735644	3300005616	Bacteria	998
398	Ga0068859_100005235	3300005617	Bacteria	13182
399	Ga0068859_100010733	3300005617	Bacteria	9219
400	Ga0068859_100052357	3300005617	Bacteria	4104
401	Ga0068859_100058580	3300005617	Bacteria	3880
402	Ga0068859_100172225	3300005617	Bacteria	2246
403	Ga0068859_100189146	3300005617	Bacteria	2143
404	Ga0068859_100310386	3300005617	Bacteria	1671
405	Ga0068864_100000006	3300005618	Bacteria	393838
406	Ga0068864_100003860	3300005618	Bacteria	12346
407	Ga0068864_100006357	3300005618	Bacteria	9687
408	Ga0068864_100044978	3300005618	Bacteria	3786
409	Ga0068864_100130397	3300005618	Bacteria	2258
410	Ga0068864_100366429	3300005618	Bacteria	1363
411	Ga0068866_10011655	3300005718	Bacteria	3811
412	Ga0068866_10174665	3300005718	Bacteria	1264
413	Ga0068861_100014337	3300005719	Bacteria	5560
414	Ga0068861_100076722	3300005719	Bacteria	2605
415	Ga0068851_10001286	3300005834	Bacteria	10947
416	Ga0068851_10002342	3300005834	Bacteria	8340
417	Ga0068870_10015252	3300005840	Bacteria	3643
418	Ga0068863_100012954	3300005841	Bacteria	8042
419	Ga0068863_100139283	3300005841	Bacteria	2319
420	Ga0068863_100654750	3300005841	Bacteria	1042
421	Ga0068858_100081348	3300005842	Bacteria	3011
422	Ga0068860_100000294	3300005843	Bacteria	69476
423	Ga0068860_100001007	3300005843	Bacteria	31185
424	Ga0068860_100013362	3300005843	Bacteria	8049
425	Ga0068860_100037173	3300005843	Bacteria	4661
426	Ga0068860_100040211	3300005843	Bacteria	4470
427	Ga0068860_100351830	3300005843	Bacteria	1450
428	Ga0068862_100000156	3300005844	Bacteria	76334
429	Ga0068862_100002168	3300005844	Bacteria	17645
430	Ga0068862_100002195	3300005844	Bacteria	17518
431	Ga0068862_100017481	3300005844	Bacteria	5973
432	Ga0068862_100020833	3300005844	Bacteria	5477
433	Ga0068862_100216477	3300005844	Bacteria	1733
434	Ga0068862_100554182	3300005844	Bacteria	1098
435	Ga0068862_100752271	3300005844	Bacteria	948
436	Ga0081539_10000686	3300005985	Bacteria	67858
437	Ga0081539_10114676	3300005985	Bacteria	1349
438	Ga0070717_10015243	3300006028	Bacteria	5931
439	Ga0075365_10112714	3300006038	Bacteria	1870
440	Ga0075365_10347973	3300006038	Bacteria	1045
441	Ga0075365_10449064	3300006038	Bacteria	910
442	Ga0075368_10007224	3300006042	Bacteria	3914
443	Ga0075368_10033324	3300006042	Bacteria	2004
444	Ga0075363_100013364	3300006048	Bacteria	3976
445	Ga0075363_100044740	3300006048	Bacteria	2346
446	Ga0075363_100077803	3300006048	Bacteria	1810
447	Ga0075363_100098934	3300006048	Bacteria	1612
448	Ga0075363_100115188	3300006048	Bacteria	1496
449	Ga0075363_100237905	3300006048	Bacteria	1046
450	Ga0075364_10006815	3300006051	Bacteria	6741
451	Ga0075364_10092354	3300006051	Bacteria	2009
452	Ga0075364_10111843	3300006051	Bacteria	1823
453	Ga0075364_10273717	3300006051	Bacteria	1148
454	Ga0075364_10326001	3300006051	Bacteria	1046
455	Ga0075432_10024378	3300006058	Bacteria	2073
456	Ga0075432_10030763	3300006058	Bacteria	1856
457	Ga0070716_100002165	3300006173	Bacteria	9031
458	Ga0070712_100094913	3300006175	Bacteria	2193
459	Ga0070712_100249017	3300006175	Bacteria	1419
460	Ga0075362_10004345	3300006177	Bacteria	5078
461	Ga0075362_10016346	3300006177	Bacteria	3037
462	Ga0075362_10016867	3300006177	Bacteria	2999
463	Ga0075362_10023972	3300006177	Bacteria	2585
464	Ga0075362_10024655	3300006177	Bacteria	2553
465	Ga0075362_10040268	3300006177	Bacteria	2057
466	Ga0075362_10042559	3300006177	Bacteria	2008
467	Ga0075362_10063106	3300006177	Bacteria	1679
468	Ga0075362_10063427	3300006177	Bacteria	1676
469	Ga0075367_10011437	3300006178	Bacteria	4696
470	Ga0075367_10021045	3300006178	Bacteria	3640
471	Ga0075367_10021384	3300006178	Bacteria	3614
472	Ga0075367_10025207	3300006178	Bacteria	3361
473	Ga0075367_10055447	3300006178	Bacteria	2352
474	Ga0075367_10060649	3300006178	Bacteria	2256
475	Ga0075367_10079627	3300006178	Bacteria	1980
476	Ga0075369_10004388	3300006186	Bacteria	5209
477	Ga0075369_10012626	3300006186	Bacteria	3337
478	Ga0075369_10043813	3300006186	Bacteria	1921
479	Ga0075369_10106133	3300006186	Bacteria	1263
480	Ga0075366_10003486	3300006195	Bacteria	8312
481	Ga0075366_10006979	3300006195	Bacteria	6219
482	Ga0075366_10011890	3300006195	Bacteria	4925
483	Ga0075366_10026556	3300006195	Bacteria	3393
484	Ga0075366_10036835	3300006195	Bacteria	2885
485	Ga0075366_10040251	3300006195	Bacteria	2764
486	Ga0075366_10047540	3300006195	Bacteria	2543
487	Ga0075366_10071419	3300006195	Bacteria	2068
488	Ga0075366_10081597	3300006195	Bacteria	1931
489	Ga0075366_10218361	3300006195	Bacteria	1161
490	Ga0097621_100016015	3300006237	Bacteria	5655
491	Ga0097621_100066894	3300006237	Bacteria	2960
492	Ga0097621_100089138	3300006237	Bacteria	2578
493	Ga0097621_100171388	3300006237	Bacteria	1871
494	Ga0075370_10001288	3300006353	Bacteria	10716
495	Ga0075370_10002746	3300006353	Bacteria	8241
496	Ga0075370_10007818	3300006353	Bacteria	5468
497	Ga0075370_10008903	3300006353	Bacteria	5185
498	Ga0075370_10027442	3300006353	Bacteria	3159
499	Ga0075370_10048121	3300006353	Bacteria	2415
500	Ga0075370_10065203	3300006353	Bacteria	2077
501	Ga0075370_10068461	3300006353	Bacteria	2028
502	Ga0075370_10079394	3300006353	Bacteria	1885
503	Ga0075370_10083347	3300006353	Bacteria	1839
504	Ga0075370_10091803	3300006353	Bacteria	1752
505	Ga0075370_10092804	3300006353	Bacteria	1742
506	Ga0075370_10098230	3300006353	Bacteria	1693
507	Ga0075370_10368608	3300006353	Bacteria	859
508	Ga0068871_100005051	3300006358	Bacteria	9215
509	Ga0075428_100002569	3300006844	Bacteria	19722
510	Ga0075428_100013267	3300006844	Bacteria	9168
511	Ga0075428_100059086	3300006844	Bacteria	4199
512	Ga0075428_100248657	3300006844	Bacteria	1917
513	Ga0075428_100810590	3300006844	Bacteria	995
514	Ga0075428_100851493	3300006844	Bacteria	968
515	Ga0075430_100003577	3300006846	Bacteria	13020
516	Ga0075430_100033481	3300006846	Bacteria	4361
517	Ga0075430_100117866	3300006846	Bacteria	2213
518	Ga0075431_100000817	3300006847	Bacteria	27171
519	Ga0075431_100109412	3300006847	Bacteria	2852
520	Ga0075431_100230893	3300006847	Bacteria	1885
521	Ga0075433_10120292	3300006852	Bacteria	2331
522	Ga0075433_10237879	3300006852	Bacteria	1617
523	Ga0075434_100000011	3300006871	Bacteria	86261
524	Ga0075434_100223306	3300006871	Bacteria	1904
525	Ga0075429_100000175	3300006880	Bacteria	41423
526	Ga0075429_100002986	3300006880	Bacteria	14345
527	Ga0075429_100003041	3300006880	Bacteria	14216
528	Ga0075429_100007197	3300006880	Bacteria	9654
529	Ga0068865_100105505	3300006881	Bacteria	2070
530	Ga0068865_100138926	3300006881	Bacteria	1830
531	Ga0075436_100000048	3300006914	Bacteria	72013
532	Ga0075436_100019841	3300006914	Bacteria	4609
533	Ga0075436_100153259	3300006914	Bacteria	1622
534	Ga0075436_100176839	3300006914	Bacteria	1508
535	Ga0097620_100005235	3300006931	Bacteria	13182
536	Ga0097620_100010733	3300006931	Bacteria	9219
537	Ga0097620_100052358	3300006931	Bacteria	4104
538	Ga0097620_100058579	3300006931	Bacteria	3880
539	Ga0097620_100171845	3300006931	Bacteria	2248
540	Ga0097620_100172228	3300006931	Bacteria	2246
541	Ga0097620_100189133	3300006931	Bacteria	2143
542	Ga0097620_100310397	3300006931	Bacteria	1671
543	Ga0079104_1000009	3300006946	Bacteria	367015
544	Ga0099826_10000018	3300006948	Bacteria	198330
545	Ga0099826_10001010	3300006948	Bacteria	15770
546	Ga0099826_10315145	3300006948	Bacteria	793
547	Ga0075435_100028979	3300007076	Bacteria	4344
548	Ga0075435_100050006	3300007076	Bacteria	3363
549	Ga0075435_100222984	3300007076	Bacteria	1601
550	Ga0099794_10047118	3300007265	Bacteria	2066
551	Ga0099794_10121460	3300007265	Bacteria	1314
552	Ga0099795_10066637	3300007788	Bacteria	1349
553	Ga0105251_10001090	3300009011	Bacteria	23663
554	Ga0105251_10018515	3300009011	Bacteria	3701
555	Ga0105251_10080243	3300009011	Bacteria	1509
556	Ga0105244_10011233	3300009036	Bacteria	5388
557	Ga0105244_10084025	3300009036	Bacteria	1572
558	Ga0105244_10110196	3300009036	Bacteria	1340
559	Ga0105250_10048672	3300009092	Bacteria	1700
560	Ga0105240_10003800	3300009093	Bacteria	23327
561	Ga0105240_10005167	3300009093	Bacteria	19519
562	Ga0105240_10008881	3300009093	Bacteria	14302
563	Ga0105240_10017231	3300009093	Bacteria	9744
564	Ga0105240_10018026	3300009093	Bacteria	9496
565	Ga0105240_10030539	3300009093	Bacteria	7003
566	Ga0105240_10039409	3300009093	Bacteria	6050
567	Ga0105240_10043049	3300009093	Bacteria	5749
568	Ga0105240_10047998	3300009093	Bacteria	5399
569	Ga0105240_10087625	3300009093	Bacteria	3812
570	Ga0105240_10115118	3300009093	Bacteria	3247
571	Ga0105240_10194877	3300009093	Bacteria	2380
572	Ga0105240_10724171	3300009093	Bacteria	1084
573	Ga0105240_11061240	3300009093	Bacteria	864
574	Ga0111539_10000584	3300009094	Bacteria	47005
575	Ga0111539_10003897	3300009094	Bacteria	19620
576	Ga0111539_10061605	3300009094	Bacteria	4444
577	Ga0111539_10089797	3300009094	Bacteria	3611
578	Ga0111539_10202028	3300009094	Bacteria	2317
579	Ga0111539_10956705	3300009094	Bacteria	996
580	Ga0105245_10228342	3300009098	Bacteria	1799
581	Ga0105245_10434876	3300009098	Bacteria	1318
582	Ga0105245_10698759	3300009098	Bacteria	1047
583	Ga0105245_10862516	3300009098	Bacteria	946
584	Ga0105247_10002331	3300009101	Bacteria	12974
585	Ga0105247_10220457	3300009101	Bacteria	1284
586	Ga0114129_10064378	3300009147	Bacteria	5116
587	Ga0114129_10098472	3300009147	Bacteria	4047
588	Ga0114129_10167312	3300009147	Bacteria	2999
589	Ga0105243_10000294	3300009148	Bacteria	55103
590	Ga0105243_10000415	3300009148	Bacteria	44837
591	Ga0105243_10002909	3300009148	Bacteria	14178
592	Ga0105243_10038253	3300009148	Bacteria	3735
593	Ga0105243_10308947	3300009148	Bacteria	1436
594	Ga0105243_10431552	3300009148	Bacteria	1232
595	Ga0105243_10557383	3300009148	Bacteria	1096
596	Ga0105241_10090716	3300009174	Bacteria	2410
597	Ga0105241_10131890	3300009174	Bacteria	2024
598	Ga0105241_10134536	3300009174	Bacteria	2005
599	Ga0105241_10415706	3300009174	Bacteria	1182
600	Ga0105241_10466269	3300009174	Bacteria	1120
601	Ga0105241_10718696	3300009174	Bacteria	913
602	Ga0105242_10028289	3300009176	Bacteria	4461
603	Ga0105242_10134329	3300009176	Bacteria	2139
604	Ga0105242_10750250	3300009176	Bacteria	961
605	Ga0105248_10000933	3300009177	Bacteria	32561
606	Ga0105248_10027054	3300009177	Bacteria	6380
607	Ga0105248_10035412	3300009177	Bacteria	5584
608	Ga0105248_10071386	3300009177	Bacteria	3901
609	Ga0105248_10112439	3300009177	Bacteria	3071
610	Ga0105248_10132467	3300009177	Bacteria	2813
611	Ga0105248_10595375	3300009177	Bacteria	1248
612	Ga0105237_10000080	3300009545	Bacteria	127788
613	Ga0105237_10012408	3300009545	Bacteria	8981
614	Ga0105237_10017534	3300009545	Bacteria	7421
615	Ga0105237_10025475	3300009545	Bacteria	6049
616	Ga0105237_10025973	3300009545	Bacteria	5987
617	Ga0105237_10098438	3300009545	Bacteria	2916
618	Ga0105237_10169229	3300009545	Bacteria	2185
619	Ga0105237_10255689	3300009545	Bacteria	1754
620	Ga0105237_10359290	3300009545	Bacteria	1461
621	Ga0105238_10006950	3300009551	Bacteria	11308
622	Ga0105238_10085510	3300009551	Bacteria	3141
623	Ga0105238_10211673	3300009551	Bacteria	1915
624	Ga0105238_10219750	3300009551	Bacteria	1876
625	Ga0105238_10227611	3300009551	Bacteria	1841
626	Ga0105238_10240334	3300009551	Bacteria	1788
627	Ga0105238_10346813	3300009551	Bacteria	1473
628	Ga0105238_10481222	3300009551	Bacteria	1241
629	Ga0105238_10563736	3300009551	Bacteria	1144
630	Ga0105249_10020323	3300009553	Bacteria	5937
631	Ga0105249_10036576	3300009553	Bacteria	4454
632	Ga0105249_10166338	3300009553	Bacteria	2135
633	Ga0105249_10529736	3300009553	Bacteria	1227
634	Ga0105239_10006415	3300010375	Bacteria	13654
635	Ga0105239_10010789	3300010375	Bacteria	10206
636	Ga0105239_10012464	3300010375	Bacteria	9467
637	Ga0105239_10015571	3300010375	Bacteria	8422
638	Ga0105239_10030442	3300010375	Bacteria	5935
639	Ga0105239_10063670	3300010375	Bacteria	4049
640	Ga0105239_10318305	3300010375	Bacteria	1754
641	Ga0105239_10345836	3300010375	Bacteria	1679
642	Ga0105239_10712292	3300010375	Bacteria	1148
643	Ga0105239_11260483	3300010375	Bacteria	852
644	Ga0157347_1000091	3300012502	Bacteria	4139
645	Ga0157326_1002135	3300012513	Bacteria	2137
646	Ga0157373_10034000	3300013100	Bacteria	3663
647	Ga0157373_10047398	3300013100	Bacteria	3065
648	Ga0157370_10002979	3300013104	Bacteria	20132
649	Ga0157370_10004029	3300013104	Bacteria	17072
650	Ga0157370_10116723	3300013104	Bacteria	2493
651	Ga0157370_10160440	3300013104	Bacteria	2092
652	Ga0157370_10379175	3300013104	Bacteria	1303
653	Ga0157370_10582198	3300013104	Bacteria	1025
654	Ga0157369_10010368	3300013105	Bacteria	10622
655	Ga0157369_10087925	3300013105	Bacteria	3317
656	Ga0157369_10099577	3300013105	Bacteria	3098
657	Ga0157369_10165343	3300013105	Bacteria	2334
658	Ga0157369_10247535	3300013105	Bacteria	1861
659	Ga0157369_10397664	3300013105	Bacteria	1430
660	Ga0157369_10421727	3300013105	Bacteria	1383
661	Ga0157374_10000721	3300013296	Bacteria	28869
662	Ga0157374_10045419	3300013296	Bacteria	4066
663	Ga0157374_10084611	3300013296	Bacteria	3015
664	Ga0157374_10210186	3300013296	Bacteria	1908
665	Ga0157374_10503019	3300013296	Bacteria	1216
666	Ga0157378_10113935	3300013297	Bacteria	2483
667	Ga0157378_10345802	3300013297	Bacteria	1451
668	Ga0157378_10372070	3300013297	Bacteria	1401
669	Ga0157378_10465646	3300013297	Bacteria	1257
670	Ga0157378_10907238	3300013297	Bacteria	912
671	Ga0163162_10005686	3300013306	Bacteria	12048
672	Ga0163162_10019505	3300013306	Bacteria	6653
673	Ga0163162_10086063	3300013306	Bacteria	3220
674	Ga0163162_10113653	3300013306	Bacteria	2806
675	Ga0163162_10170792	3300013306	Bacteria	2299
676	Ga0163162_10210889	3300013306	Bacteria	2072
677	Ga0163162_10380431	3300013306	Bacteria	1545
678	Ga0163162_10534955	3300013306	Bacteria	1301
679	Ga0163162_10692291	3300013306	Bacteria	1141
680	Ga0163162_10695941	3300013306	Bacteria	1138
681	Ga0157372_10001379	3300013307	Bacteria	26238
682	Ga0157372_10114126	3300013307	Bacteria	3097
683	Ga0157372_10264130	3300013307	Bacteria	1999
684	Ga0157372_10277810	3300013307	Bacteria	1947
685	Ga0157372_10348538	3300013307	Bacteria	1725
686	Ga0157372_10758571	3300013307	Bacteria	1128
687	Ga0157375_10002705	3300013308	Bacteria	15339
688	Ga0157375_10017180	3300013308	Bacteria	6523
689	Ga0157375_10108862	3300013308	Bacteria	2866
690	Ga0157375_10283866	3300013308	Bacteria	1819
691	Ga0157375_10623964	3300013308	Bacteria	1236
692	Ga0163163_10000032	3300014325	Bacteria	167085
693	Ga0163163_10000132	3300014325	Bacteria	76574
694	Ga0163163_10005378	3300014325	Bacteria	11067
695	Ga0163163_10055871	3300014325	Bacteria	3902
696	Ga0163163_10161302	3300014325	Bacteria	2288
697	Ga0163163_11358933	3300014325	Bacteria	772
698	Ga0157380_10077701	3300014326	Bacteria	2706
699	Ga0157380_10091080	3300014326	Bacteria	2517
700	Ga0157380_10112756	3300014326	Bacteria	2288
701	Ga0157380_10185061	3300014326	Bacteria	1834
702	Ga0157380_10474524	3300014326	Bacteria	1208
703	Ga0157380_10996175	3300014326	Bacteria	871
704	Ga0182008_10000056	3300014497	Bacteria	101905
705	Ga0182008_10000626	3300014497	Bacteria	25908
706	Ga0182008_10002185	3300014497	Bacteria	12427
707	Ga0182008_10052764	3300014497	Bacteria	2014
708	Ga0182008_10058687	3300014497	Bacteria	1899
709	Ga0182008_10093780	3300014497	Bacteria	1481
710	Ga0182008_10339451	3300014497	Bacteria	794
711	Ga0157377_10000010	3300014745	Bacteria	380929
712	Ga0157379_10005215	3300014968	Bacteria	11158
713	Ga0157379_10114952	3300014968	Bacteria	2419
714	Ga0157379_10303066	3300014968	Bacteria	1456
715	Ga0157376_10013277	3300014969	Bacteria	6143
716	Ga0157376_10063591	3300014969	Bacteria	3109
717	Ga0157376_10123035	3300014969	Bacteria	2303
718	Ga0157376_10191966	3300014969	Bacteria	1873
719	Ga0157376_10349352	3300014969	Bacteria	1415
720	Ga0182006_1000030	3300015261	Bacteria	242894
721	Ga0182006_1007284	3300015261	Bacteria	5077
722	Ga0182006_1013746	3300015261	Bacteria	3502
723	Ga0182006_1046308	3300015261	Bacteria	1689
724	Ga0182007_10000157	3300015262	Bacteria	46516
725	Ga0182007_10002338	3300015262	Bacteria	9493
726	Ga0182007_10142539	3300015262	Bacteria	811
727	Ga0182005_1000021	3300015265	Bacteria	272185
728	Ga0182005_1004672	3300015265	Bacteria	4379
729	Ga0182005_1067919	3300015265	Bacteria	977
730	Ga0183362_10007	3300015683	Bacteria	240101
731	Ga0183361_10012	3300016635	Bacteria	203395
732	Ga0163161_10000268	3300017792	Bacteria	45830
733	Ga0163161_10017896	3300017792	Bacteria	4965
734	Ga0163161_10049356	3300017792	Bacteria	3041
735	Ga0163161_10058829	3300017792	Bacteria	2794
736	Ga0163161_10067158	3300017792	Bacteria	2619
737	Ga0163161_10087771	3300017792	Bacteria	2298
738	Ga0163161_10097129	3300017792	Bacteria	2188
739	Ga0163161_10101954	3300017792	Bacteria	2137
740	Ga0163161_10125266	3300017792	Bacteria	1934
741	Ga0163161_10169727	3300017792	Bacteria	1667
742	Ga0163161_10211118	3300017792	Bacteria	1500
743	Ga0213872_10000007	3300021361	Bacteria	228206
744	Ga0213872_10000373	3300021361	Bacteria	37639
745	Ga0213872_10001048	3300021361	Bacteria	19244
746	Ga0213872_10001094	3300021361	Bacteria	18590
747	Ga0213872_10001180	3300021361	Bacteria	17725
748	Ga0213872_10126272	3300021361	Bacteria	1129
749	Ga0213876_10156627	3300021384	Bacteria	1212
750	Ga0209435_100018	3300025206	Bacteria	274625
751	Ga0209435_100019	3300025206	Bacteria	260989
752	Ga0209435_100437	3300025206	Bacteria	8595
753	Ga0209436_100539	3300025208	Bacteria	16421
754	Ga0209436_103173	3300025208	Bacteria	4494
755	Ga0209566_100216	3300025225	Bacteria	57945
756	Ga0209674_100005	3300025226	Bacteria	1708125
757	Ga0209674_100092	3300025226	Bacteria	172272
758	Ga0209674_107308	3300025226	Bacteria	1407
759	Ga0209672_100001	3300025228	Bacteria	2828210
760	Ga0209672_100028	3300025228	Bacteria	341962
761	Ga0209672_100038	3300025228	Bacteria	286731
762	Ga0209672_100539	3300025228	Bacteria	20575
763	Ga0209672_100952	3300025228	Bacteria	12904
764	Ga0209147_100001	3300025229	Bacteria	2384371
765	Ga0209147_100051	3300025229	Bacteria	274605
766	Ga0209147_100163	3300025229	Bacteria	90494
767	Ga0209147_100239	3300025229	Bacteria	53469
768	Ga0209147_100259	3300025229	Bacteria	49184
769	Ga0209147_101056	3300025229	Bacteria	11632
770	Ga0209563_100044	3300025230	Bacteria	396812
771	Ga0209563_108423	3300025230	Bacteria	1627
772	Ga0207427_100303	3300025231	Bacteria	34361
773	Ga0207427_102731	3300025231	Bacteria	4388
774	Ga0209437_100145	3300025233	Bacteria	163138
775	Ga0209258_100001	3300025242	Bacteria	2384269
776	Ga0209258_100109	3300025242	Bacteria	203881
777	Ga0209258_100112	3300025242	Bacteria	192884
778	Ga0209258_100147	3300025242	Bacteria	162823
779	Ga0209258_100760	3300025242	Bacteria	20234
780	Ga0207425_1000013	3300025245	Bacteria	497384
781	Ga0207425_1000145	3300025245	Bacteria	60718
782	Ga0207425_1000196	3300025245	Bacteria	48364
783	Ga0207425_1002051	3300025245	Bacteria	7496
784	Ga0207425_1002058	3300025245	Bacteria	7482
785	Ga0207425_1003998	3300025245	Bacteria	4533
786	Ga0207425_1023848	3300025245	Bacteria	1276
787	Ga0207425_1031696	3300025245	Bacteria	1051
788	Ga0209646_1000012	3300025246	Bacteria	573300
789	Ga0209646_1000038	3300025246	Bacteria	353982
790	Ga0209646_1000081	3300025246	Bacteria	201708
791	Ga0209646_1000090	3300025246	Bacteria	189912
792	Ga0209026_1000004	3300025250	Bacteria	949012
793	Ga0209026_1000042	3300025250	Bacteria	273111
794	Ga0209026_1000048	3300025250	Bacteria	257264
795	Ga0209026_1001990	3300025250	Bacteria	8151
796	Ga0209026_1009637	3300025250	Bacteria	1876
797	Ga0209148_1000003	3300025254	Bacteria	2384288
798	Ga0209148_1000081	3300025254	Bacteria	273676
799	Ga0209148_1000122	3300025254	Bacteria	186071
800	Ga0209148_1000844	3300025254	Bacteria	21726
801	Ga0209148_1009205	3300025254	Bacteria	1939
802	Ga0209148_1014233	3300025254	Bacteria	1410
803	Ga0209759_1000003	3300025256	Bacteria	792130
804	Ga0209759_1000038	3300025256	Bacteria	257264
805	Ga0209759_1000053	3300025256	Bacteria	212789
806	Ga0209759_1000074	3300025256	Bacteria	177152
807	Ga0209759_1000601	3300025256	Bacteria	34849
808	Ga0209759_1000933	3300025256	Bacteria	21089
809	Ga0209759_1000937	3300025256	Bacteria	21027
810	Ga0209759_1001475	3300025256	Bacteria	13110
811	Ga0209759_1002054	3300025256	Bacteria	9455
812	Ga0209759_1009561	3300025256	Bacteria	2921
813	Ga0209759_1014072	3300025256	Bacteria	2134
814	Ga0209129_1000035	3300025258	Bacteria	329303
815	Ga0209129_1000102	3300025258	Bacteria	161712
816	Ga0209129_1000177	3300025258	Bacteria	93081
817	Ga0209129_1002852	3300025258	Bacteria	7985
818	Ga0209129_1004470	3300025258	Bacteria	5440
819	Ga0209129_1027372	3300025258	Bacteria	976
820	Ga0209233_1000016	3300025261	Bacteria	907830
821	Ga0209565_1000035	3300025263	Bacteria	298125
822	Ga0209565_1000080	3300025263	Bacteria	156999
823	Ga0209565_1000129	3300025263	Bacteria	108787
824	Ga0209565_1000174	3300025263	Bacteria	82914
825	Ga0209565_1000205	3300025263	Bacteria	69314
826	Ga0209565_1000248	3300025263	Bacteria	57592
827	Ga0209565_1000797	3300025263	Bacteria	18163
828	Ga0209565_1001459	3300025263	Bacteria	10358
829	Ga0209455_1000001	3300025272	Bacteria	2384278
830	Ga0209455_1000030	3300025272	Bacteria	533479
831	Ga0209455_1000050	3300025272	Bacteria	373239
832	Ga0209673_1000006	3300025273	Bacteria	650600
833	Ga0209673_1000038	3300025273	Bacteria	312957
834	Ga0209673_1000088	3300025273	Bacteria	204629
835	Ga0209673_1000247	3300025273	Bacteria	102817
836	Ga0209673_1000377	3300025273	Bacteria	80360
837	Ga0209673_1000681	3300025273	Bacteria	48925
838	Ga0209673_1006321	3300025273	Bacteria	5748
839	Ga0209673_1009497	3300025273	Bacteria	4201
840	Ga0209673_1012677	3300025273	Bacteria	3380
841	Ga0209673_1013010	3300025273	Bacteria	3311
842	Ga0209130_1000103	3300025284	Bacteria	137115
843	Ga0209130_1000149	3300025284	Bacteria	108821
844	Ga0209130_1000218	3300025284	Bacteria	75339
845	Ga0209130_1000238	3300025284	Bacteria	70723
846	Ga0209130_1001037	3300025284	Bacteria	21228
847	Ga0209130_1006485	3300025284	Bacteria	3791
848	Ga0209130_1009910	3300025284	Bacteria	2669
849	Ga0209130_1032987	3300025284	Bacteria	1052
850	Ga0209675_1000005	3300025291	Bacteria	849192
851	Ga0209675_1000093	3300025291	Bacteria	140158
852	Ga0209675_1000100	3300025291	Bacteria	128565
853	Ga0209675_1000209	3300025291	Bacteria	61674
854	Ga0209675_1000619	3300025291	Bacteria	25376
855	Ga0209675_1000673	3300025291	Bacteria	23959
856	Ga0209675_1001146	3300025291	Bacteria	16153
857	Ga0209675_1001317	3300025291	Bacteria	14718
858	Ga0209675_1004221	3300025291	Bacteria	6486
859	Ga0209675_1010628	3300025291	Bacteria	3124
860	Ga0209675_1012417	3300025291	Bacteria	2746
861	Ga0209675_1022852	3300025291	Bacteria	1633
862	Ga0209676_1000073	3300025292	Bacteria	305947
863	Ga0209676_1000141	3300025292	Bacteria	175894
864	Ga0209676_1000202	3300025292	Bacteria	133078
865	Ga0209676_1000623	3300025292	Bacteria	51464
866	Ga0209676_1001463	3300025292	Bacteria	22075
867	Ga0209676_1002083	3300025292	Bacteria	15501
868	Ga0209676_1057990	3300025292	Bacteria	979
869	Ga0209025_1000145	3300025294	Bacteria	181436
870	Ga0209025_1000285	3300025294	Bacteria	114575
871	Ga0209025_1000322	3300025294	Bacteria	106667
872	Ga0209025_1000390	3300025294	Bacteria	90952
873	Ga0209025_1000755	3300025294	Bacteria	54059
874	Ga0209025_1001457	3300025294	Bacteria	30940
875	Ga0209025_1001808	3300025294	Bacteria	25331
876	Ga0209025_1005621	3300025294	Bacteria	10121
877	Ga0209025_1010341	3300025294	Bacteria	6335
878	Ga0209025_1011865	3300025294	Bacteria	5672
879	Ga0209025_1012464	3300025294	Bacteria	5443
880	Ga0209025_1024725	3300025294	Bacteria	3089
881	Ga0209025_1102363	3300025294	Bacteria	903
882	Ga0209564_1000008	3300025295	Bacteria	953227
883	Ga0209564_1000024	3300025295	Bacteria	535041
884	Ga0209564_1000083	3300025295	Bacteria	259272
885	Ga0209564_1000223	3300025295	Bacteria	128117
886	Ga0209564_1000226	3300025295	Bacteria	125693
887	Ga0209564_1001146	3300025295	Bacteria	31046
888	Ga0209564_1001462	3300025295	Bacteria	23992
889	Ga0209564_1001510	3300025295	Bacteria	23291
890	Ga0209564_1002539	3300025295	Bacteria	14074
891	Ga0209564_1003242	3300025295	Bacteria	11380
892	Ga0209564_1003294	3300025295	Bacteria	11224
893	Ga0209564_1012742	3300025295	Bacteria	3637
894	Ga0209564_1014361	3300025295	Bacteria	3301
895	Ga0209758_1000031	3300025297	Bacteria	497252
896	Ga0209758_1000142	3300025297	Bacteria	171779
897	Ga0209758_1000558	3300025297	Bacteria	58712
898	Ga0209758_1001090	3300025297	Bacteria	35155
899	Ga0209758_1006873	3300025297	Bacteria	7952
900	Ga0209758_1010892	3300025297	Bacteria	5358
901	Ga0209758_1035968	3300025297	Bacteria	1942
902	Ga0209050_1000008	3300025298	Bacteria	1144179
903	Ga0209050_1000078	3300025298	Bacteria	278409
904	Ga0209050_1000224	3300025298	Bacteria	125433
905	Ga0209050_1000246	3300025298	Bacteria	116721
906	Ga0209050_1000266	3300025298	Bacteria	111792
907	Ga0209050_1003947	3300025298	Bacteria	10483
908	Ga0209050_1005186	3300025298	Bacteria	8335
909	Ga0209050_1008421	3300025298	Bacteria	5516
910	Ga0209050_1013249	3300025298	Bacteria	3681
911	Ga0209050_1074607	3300025298	Bacteria	744
912	Ga0209256_1000019	3300025299	Bacteria	558627
913	Ga0209256_1000096	3300025299	Bacteria	204629
914	Ga0209256_1000114	3300025299	Bacteria	173999
915	Ga0209256_1000141	3300025299	Bacteria	152280
916	Ga0209256_1000174	3300025299	Bacteria	128117
917	Ga0209256_1000303	3300025299	Bacteria	86575
918	Ga0209256_1000434	3300025299	Bacteria	64801
919	Ga0209256_1000881	3300025299	Bacteria	37099
920	Ga0209256_1001596	3300025299	Bacteria	22189
921	Ga0209256_1017398	3300025299	Bacteria	2389
922	Ga0209256_1021167	3300025299	Bacteria	2006
923	Ga0209256_1027990	3300025299	Bacteria	1598
924	Ga0207426_1000037	3300025302	Bacteria	442735
925	Ga0207426_1000162	3300025302	Bacteria	172643
926	Ga0207426_1000232	3300025302	Bacteria	128117
927	Ga0207426_1000407	3300025302	Bacteria	72389
928	Ga0207426_1001678	3300025302	Bacteria	17107
929	Ga0207426_1002420	3300025302	Bacteria	11966
930	Ga0207426_1005734	3300025302	Bacteria	5595
931	Ga0209051_1000004	3300025303	Bacteria	1155596
932	Ga0209051_1000005	3300025303	Bacteria	1142353
933	Ga0209051_1000112	3300025303	Bacteria	152667
934	Ga0209051_1000497	3300025303	Bacteria	50521
935	Ga0209051_1000565	3300025303	Bacteria	44938
936	Ga0209051_1000899	3300025303	Bacteria	29695
937	Ga0209051_1020922	3300025303	Bacteria	2801
938	Ga0209051_1021757	3300025303	Bacteria	2718
939	Ga0209051_1022189	3300025303	Bacteria	2678
940	Ga0209257_1000031	3300025304	Bacteria	688770
941	Ga0209257_1000038	3300025304	Bacteria	609032
942	Ga0209257_1000044	3300025304	Bacteria	486709
943	Ga0209257_1000097	3300025304	Bacteria	259243
944	Ga0209257_1000163	3300025304	Bacteria	175355
945	Ga0209257_1000290	3300025304	Bacteria	110826
946	Ga0209257_1005598	3300025304	Bacteria	8710
947	Ga0209257_1008343	3300025304	Bacteria	5922
948	Ga0209257_1015558	3300025304	Bacteria	3155
949	Ga0209257_1018826	3300025304	Bacteria	2634
950	Ga0209257_1021000	3300025304	Bacteria	2389
951	Ga0207697_10004738	3300025315	Bacteria	6444
952	Ga0207697_10039977	3300025315	Bacteria	1925
953	Ga0207656_10002134	3300025321	Bacteria	6606
954	Ga0207656_10077782	3300025321	Bacteria	1486
955	Ga0207655_1000991	3300025728	Bacteria	28963
956	Ga0207713_1002908	3300025735	Bacteria	11990
957	Ga0207713_1122764	3300025735	Bacteria	869
958	Ga0207682_10006734	3300025893	Bacteria	4615
959	Ga0207682_10040435	3300025893	Bacteria	1900
960	Ga0207682_10063950	3300025893	Bacteria	1545
961	Ga0207682_10129087	3300025893	Bacteria	1127
962	Ga0207692_10023093	3300025898	Bacteria	2873
963	Ga0207710_10010077	3300025900	Unclassified	3976
964	Ga0207680_10018502	3300025903	Bacteria	3705
965	Ga0207680_10160682	3300025903	Bacteria	1506
966	Ga0207680_10220192	3300025903	Bacteria	1301
967	Ga0207680_10374674	3300025903	Bacteria	1003
968	Ga0207680_10380562	3300025903	Bacteria	995
969	Ga0207647_10000608	3300025904	Bacteria	27922
970	Ga0207647_10003231	3300025904	Bacteria	12223
971	Ga0207647_10032404	3300025904	Bacteria	3357
972	Ga0207647_10064765	3300025904	Bacteria	2220
973	Ga0207685_10056825	3300025905	Unclassified	1533
974	Ga0207645_10035578	3300025907	Bacteria	3197
975	Ga0207645_10059401	3300025907	Bacteria	2442
976	Ga0207645_10088910	3300025907	Bacteria	1986
977	Ga0207645_10211371	3300025907	Bacteria	1278
978	Ga0207643_10239896	3300025908	Bacteria	1114
979	Ga0207643_10239969	3300025908	Bacteria	1114
980	Ga0207705_10001908	3300025909	Bacteria	16298
981	Ga0207705_10336984	3300025909	Bacteria	1161
982	Ga0207684_10020826	3300025910	Bacteria	5602
983	Ga0207684_10076023	3300025910	Bacteria	2854
984	Ga0207654_10083057	3300025911	Bacteria	1933
985	Ga0207654_10092817	3300025911	Bacteria	1844
986	Ga0207654_10585158	3300025911	Bacteria	795
987	Ga0207707_10006346	3300025912	Bacteria	10327
988	Ga0207707_10008891	3300025912	Bacteria	8721
989	Ga0207707_10275866	3300025912	Bacteria	1457
990	Ga0207695_10005351	3300025913	Bacteria	17072
991	Ga0207695_10011211	3300025913	Bacteria	10873
992	Ga0207695_10023926	3300025913	Bacteria	6890
993	Ga0207695_10160657	3300025913	Bacteria	2179
994	Ga0207695_10196150	3300025913	Bacteria	1935
995	Ga0207695_10266448	3300025913	Bacteria	1609
996	Ga0207695_10299314	3300025913	Bacteria	1500
997	Ga0207695_10311643	3300025913	Bacteria	1464
998	Ga0207695_10501229	3300025913	Bacteria	1096
999	Ga0207671_10011829	3300025914	Bacteria	7061
1000	Ga0207671_10026082	3300025914	Bacteria	4384
1001	Ga0207671_10079525	3300025914	Bacteria	2457
1002	Ga0207671_10089104	3300025914	Bacteria	2322
1003	Ga0207671_10102895	3300025914	Bacteria	2165
1004	Ga0207671_10142458	3300025914	Bacteria	1848
1005	Ga0207671_10564974	3300025914	Bacteria	907
1006	Ga0207693_10122899	3300025915	Bacteria	2039
1007	Ga0207693_10202324	3300025915	Bacteria	1562
1008	Ga0207663_10031875	3300025916	Bacteria	3124
1009	Ga0207660_10031446	3300025917	Bacteria	3655
1010	Ga0207660_10069423	3300025917	Bacteria	2559
1011	Ga0207660_10084864	3300025917	Bacteria	2335
1012	Ga0207660_10107545	3300025917	Bacteria	2093
1013	Ga0207660_10247264	3300025917	Bacteria	1407
1014	Ga0207660_10291972	3300025917	Bacteria	1297
1015	Ga0207662_10067242	3300025918	Bacteria	2161
1016	Ga0207657_10000051	3300025919	Bacteria	109129
1017	Ga0207657_10000131	3300025919	Bacteria	75479
1018	Ga0207657_10010952	3300025919	Bacteria	9019
1019	Ga0207657_10017550	3300025919	Bacteria	6857
1020	Ga0207657_10076153	3300025919	Bacteria	2831
1021	Ga0207657_10263478	3300025919	Bacteria	1371
1022	Ga0207649_10000762	3300025920	Bacteria	20967
1023	Ga0207649_10029032	3300025920	Bacteria	3263
1024	Ga0207649_10036877	3300025920	Bacteria	2948
1025	Ga0207649_10134933	3300025920	Bacteria	1681
1026	Ga0207649_10199178	3300025920	Bacteria	1414
1027	Ga0207652_10157693	3300025921	Bacteria	2033
1028	Ga0207652_10476282	3300025921	Bacteria	1125
1029	Ga0207646_10254222	3300025922	Bacteria	1588
1030	Ga0207646_10290759	3300025922	Bacteria	1477
1031	Ga0207646_10446400	3300025922	Bacteria	1167
1032	Ga0207646_10507623	3300025922	Bacteria	1086
1033	Ga0207681_10045019	3300025923	Bacteria	2960
1034	Ga0207681_10056645	3300025923	Bacteria	2674
1035	Ga0207681_10068338	3300025923	Bacteria	2467
1036	Ga0207681_10424751	3300025923	Bacteria	1077
1037	Ga0207694_10012756	3300025924	Bacteria	6331
1038	Ga0207694_10032852	3300025924	Bacteria	3974
1039	Ga0207694_10065460	3300025924	Bacteria	2834
1040	Ga0207694_10156749	3300025924	Bacteria	1837
1041	Ga0207694_10324375	3300025924	Bacteria	1271
1042	Ga0207694_10358151	3300025924	Bacteria	1209
1043	Ga0207650_10000002	3300025925	Bacteria	1439222
1044	Ga0207650_10001270	3300025925	Bacteria	18314
1045	Ga0207650_10007494	3300025925	Bacteria	7441
1046	Ga0207650_10057794	3300025925	Bacteria	2886
1047	Ga0207659_10052239	3300025926	Bacteria	2910
1048	Ga0207659_10071985	3300025926	Bacteria	2526
1049	Ga0207687_10173957	3300025927	Bacteria	1663
1050	Ga0207687_10181653	3300025927	Bacteria	1630
1051	Ga0207687_10452675	3300025927	Bacteria	1065
1052	Ga0207687_10459143	3300025927	Bacteria	1057
1053	Ga0207700_10029879	3300025928	Bacteria	3851
1054	Ga0207644_10002682	3300025931	Bacteria	11463
1055	Ga0207644_10046289	3300025931	Bacteria	3098
1056	Ga0207690_10000034	3300025932	Bacteria	149574
1057	Ga0207690_10001689	3300025932	Bacteria	13605
1058	Ga0207690_10020033	3300025932	Bacteria	4127
1059	Ga0207690_10060157	3300025932	Bacteria	2577
1060	Ga0207706_10006818	3300025933	Bacteria	10561
1061	Ga0207706_10012164	3300025933	Bacteria	7841
1062	Ga0207706_10023931	3300025933	Bacteria	5479
1063	Ga0207706_10108326	3300025933	Bacteria	2445
1064	Ga0207706_10229875	3300025933	Bacteria	1623
1065	Ga0207706_10262904	3300025933	Bacteria	1506
1066	Ga0207706_10432687	3300025933	Bacteria	1139
1067	Ga0207706_10666490	3300025933	Bacteria	890
1068	Ga0207686_10019941	3300025934	Bacteria	3823
1069	Ga0207709_10000180	3300025935	Bacteria	84481
1070	Ga0207709_10000990	3300025935	Bacteria	21162
1071	Ga0207709_10001738	3300025935	Bacteria	14672
1072	Ga0207709_10001888	3300025935	Bacteria	13839
1073	Ga0207709_10014241	3300025935	Bacteria	4388
1074	Ga0207709_10123507	3300025935	Bacteria	1752
1075	Ga0207709_10167782	3300025935	Bacteria	1537
1076	Ga0207709_10192697	3300025935	Bacteria	1449
1077	Ga0207669_10043523	3300025937	Bacteria	2630
1078	Ga0207669_10092337	3300025937	Bacteria	1974
1079	Ga0207704_10021353	3300025938	Bacteria	3446
1080	Ga0207704_10023210	3300025938	Bacteria	3339
1081	Ga0207704_10235691	3300025938	Bacteria	1364
1082	Ga0207704_10257919	3300025938	Bacteria	1313
1083	Ga0207704_10562912	3300025938	Bacteria	928
1084	Ga0207665_10007944	3300025939	Bacteria	7004
1085	Ga0207691_10001181	3300025940	Bacteria	25967
1086	Ga0207691_10001429	3300025940	Bacteria	23835
1087	Ga0207691_10008694	3300025940	Bacteria	9741
1088	Ga0207691_10034256	3300025940	Bacteria	4724
1089	Ga0207691_10063522	3300025940	Bacteria	3348
1090	Ga0207691_10088040	3300025940	Bacteria	2785
1091	Ga0207691_10110989	3300025940	Bacteria	2439
1092	Ga0207691_10137651	3300025940	Bacteria	2153
1093	Ga0207691_10217308	3300025940	Bacteria	1658
1094	Ga0207711_10000140	3300025941	Bacteria	77222
1095	Ga0207711_10000204	3300025941	Bacteria	63234
1096	Ga0207711_10000253	3300025941	Bacteria	57791
1097	Ga0207711_10000273	3300025941	Bacteria	55775
1098	Ga0207711_10000621	3300025941	Bacteria	35608
1099	Ga0207711_10002516	3300025941	Bacteria	16336
1100	Ga0207711_10037525	3300025941	Bacteria	4117
1101	Ga0207711_10051558	3300025941	Bacteria	3524
1102	Ga0207711_10068117	3300025941	Bacteria	3082
1103	Ga0207689_10034153	3300025942	Bacteria	4224
1104	Ga0207689_10049399	3300025942	Bacteria	3470
1105	Ga0207679_10000202	3300025945	Bacteria	47795
1106	Ga0207679_10010506	3300025945	Bacteria	5964
1107	Ga0207679_10071990	3300025945	Bacteria	2610
1108	Ga0207679_10079356	3300025945	Bacteria	2502
1109	Ga0207679_10137702	3300025945	Bacteria	1968
1110	Ga0207679_10631160	3300025945	Bacteria	968
1111	Ga0207679_10833348	3300025945	Bacteria	842
1112	Ga0207667_10015405	3300025949	Bacteria	8690
1113	Ga0207667_10022705	3300025949	Bacteria	6922
1114	Ga0207667_10037973	3300025949	Bacteria	5146
1115	Ga0207667_10249570	3300025949	Bacteria	1815
1116	Ga0207667_10330926	3300025949	Bacteria	1555
1117	Ga0207651_10006363	3300025960	Bacteria	6173
1118	Ga0207651_10009479	3300025960	Bacteria	5335
1119	Ga0207651_10091694	3300025960	Bacteria	2226
1120	Ga0207651_10919877	3300025960	Bacteria	779
1121	Ga0207712_10086290	3300025961	Bacteria	2299
1122	Ga0207712_10179014	3300025961	Bacteria	1664
1123	Ga0207712_10193670	3300025961	Bacteria	1606
1124	Ga0207712_10356437	3300025961	Bacteria	1217
1125	Ga0207712_10510679	3300025961	Bacteria	1029
1126	Ga0207668_10010232	3300025972	Bacteria	5663
1127	Ga0207668_10055207	3300025972	Bacteria	2760
1128	Ga0207640_10136412	3300025981	Bacteria	1782
1129	Ga0207640_10177109	3300025981	Bacteria	1595
1130	Ga0207640_10179609	3300025981	Bacteria	1586
1131	Ga0207640_10489163	3300025981	Bacteria	1022
1132	Ga0207658_10000001	3300025986	Bacteria	1439333
1133	Ga0207658_10019871	3300025986	Bacteria	4648
1134	Ga0207658_10127912	3300025986	Bacteria	2036
1135	Ga0207658_10215928	3300025986	Bacteria	1610
1136	Ga0207658_10328289	3300025986	Bacteria	1326
1137	Ga0207658_10529487	3300025986	Bacteria	1052
1138	Ga0207658_10711708	3300025986	Bacteria	908
1139	Ga0207677_10137902	3300026023	Bacteria	1863
1140	Ga0207677_10176914	3300026023	Bacteria	1675
1141	Ga0207703_10406382	3300026035	Bacteria	1264
1142	Ga0207639_10030642	3300026041	Bacteria	3947
1143	Ga0207639_10033511	3300026041	Bacteria	3789
1144	Ga0207639_10203730	3300026041	Bacteria	1699
1145	Ga0207639_10363953	3300026041	Bacteria	1295
1146	Ga0207639_10496933	3300026041	Bacteria	1114
1147	Ga0207639_10539505	3300026041	Bacteria	1070
1148	Ga0207678_10001810	3300026067	Bacteria	19587
1149	Ga0207678_10008514	3300026067	Bacteria	9041
1150	Ga0207678_10026063	3300026067	Bacteria	5101
1151	Ga0207678_10031691	3300026067	Bacteria	4609
1152	Ga0207678_10088310	3300026067	Bacteria	2650
1153	Ga0207678_10175386	3300026067	Bacteria	1830
1154	Ga0207678_10250934	3300026067	Bacteria	1515
1155	Ga0207678_10340700	3300026067	Bacteria	1292
1156	Ga0207678_10560826	3300026067	Bacteria	999
1157	Ga0207708_10014096	3300026075	Bacteria	5973
1158	Ga0207708_10047211	3300026075	Bacteria	3279
1159	Ga0207708_10395071	3300026075	Bacteria	1142
1160	Ga0207702_10000253	3300026078	Bacteria	62073
1161	Ga0207702_10059298	3300026078	Bacteria	3260
1162	Ga0207702_10247416	3300026078	Bacteria	1673
1163	Ga0207702_10330108	3300026078	Bacteria	1455
1164	Ga0207702_10789895	3300026078	Bacteria	938
1165	Ga0207702_11145964	3300026078	Bacteria	772
1166	Ga0207641_10000328	3300026088	Bacteria	58148
1167	Ga0207641_10001944	3300026088	Bacteria	19833
1168	Ga0207641_10015326	3300026088	Bacteria	6282
1169	Ga0207641_10079598	3300026088	Bacteria	2841
1170	Ga0207641_10298970	3300026088	Bacteria	1520
1171	Ga0207641_10471152	3300026088	Bacteria	1216
1172	Ga0207641_10535810	3300026088	Bacteria	1140
1173	Ga0207648_10000002	3300026089	Bacteria	307909
1174	Ga0207648_10004678	3300026089	Bacteria	13995
1175	Ga0207648_10088066	3300026089	Bacteria	2710
1176	Ga0207648_10093990	3300026089	Bacteria	2622
1177	Ga0207648_10131776	3300026089	Bacteria	2200
1178	Ga0207648_10253533	3300026089	Bacteria	1569
1179	Ga0207648_10545081	3300026089	Bacteria	1065
1180	Ga0207676_10000001	3300026095	Bacteria	1439222
1181	Ga0207676_10017583	3300026095	Bacteria	5184
1182	Ga0207676_10024810	3300026095	Bacteria	4441
1183	Ga0207676_10074994	3300026095	Bacteria	2727
1184	Ga0207676_10120661	3300026095	Bacteria	2210
1185	Ga0207674_10015715	3300026116	Bacteria	8305
1186	Ga0207674_10063088	3300026116	Bacteria	3741
1187	Ga0207674_10063665	3300026116	Bacteria	3722
1188	Ga0207674_10075723	3300026116	Bacteria	3375
1189	Ga0207674_10241653	3300026116	Bacteria	1753
1190	Ga0207675_100010142	3300026118	Bacteria	8829
1191	Ga0207675_100024983	3300026118	Bacteria	5559
1192	Ga0207683_10020556	3300026121	Bacteria	5649
1193	Ga0207683_10032773	3300026121	Bacteria	4513
1194	Ga0207683_10343314	3300026121	Bacteria	1370
1195	Ga0207683_10534626	3300026121	Bacteria	1083
1196	Ga0207698_10004332	3300026142	Bacteria	8639
1197	Ga0207698_10031568	3300026142	Bacteria	3825
1198	Ga0207698_10036857	3300026142	Bacteria	3595
1199	Ga0207698_10067097	3300026142	Bacteria	2828
1200	Ga0207698_10085735	3300026142	Bacteria	2559
1201	Ga0207698_10216617	3300026142	Bacteria	1727
1202	Ga0207698_10320463	3300026142	Bacteria	1451
1203	Ga0207698_10350177	3300026142	Bacteria	1395
1204	Ga0207698_10465231	3300026142	Bacteria	1224
1205	Ga0207698_10574659	3300026142	Bacteria	1108
1206	Ga0209281_1000023	3300027111	Bacteria	519955
1207	Ga0209281_1003625	3300027111	Bacteria	4992
1208	Ga0209371_1000090	3300027312	Bacteria	173119
1209	Ga0209371_1005044	3300027312	Bacteria	5432
1210	Ga0209969_1000329	3300027360	Bacteria	6326
1211	Ga0209969_1002832	3300027360	Bacteria	2399
1212	Ga0209967_1001661	3300027364	Bacteria	2865
1213	Ga0209981_1003593	3300027378	Bacteria	2014
1214	Ga0209981_1011871	3300027378	Bacteria	1203
1215	Ga0209996_1002812	3300027395	Bacteria	2165
1216	Ga0210000_1003906	3300027462	Bacteria	2157
1217	Ga0209995_1000645	3300027471	Bacteria	5379
1218	Ga0209995_1001599	3300027471	Bacteria	3511
1219	Ga0209968_1000695	3300027526	Bacteria	5172
1220	Ga0209968_1002793	3300027526	Bacteria	2617
1221	Ga0209968_1009217	3300027526	Bacteria	1509
1222	Ga0209999_1005198	3300027543	Bacteria	2340
1223	Ga0209282_1000063	3300027666	Bacteria	93789
1224	Ga0209282_1000187	3300027666	Bacteria	32999
1225	Ga0209588_1013316	3300027671	Bacteria	2508
1226	Ga0209588_1021995	3300027671	Bacteria	2006
1227	Ga0209971_1000897	3300027682	Bacteria	7669
1228	Ga0209966_1000030	3300027695	Bacteria	63782
1229	Ga0209998_10010214	3300027717	Bacteria	1944
1230	Ga0209813_10002262	3300027866	Bacteria	4399
1231	Ga0209813_10036265	3300027866	Bacteria	1480
1232	Ga0209813_10037502	3300027866	Bacteria	1461
1233	Ga0209974_10062878	3300027876	Bacteria	1258
1234	Ga0207428_10048547	3300027907	Bacteria	3404
1235	Ga0207428_10060914	3300027907	Bacteria	2989
1236	Ga0207428_10110106	3300027907	Bacteria	2121
1237	Ga0207428_10117072	3300027907	Bacteria	2046
1238	Ga0207428_10232748	3300027907	Bacteria	1378
1239	Ga0268266_10003177	3300028379	Bacteria	16664
1240	Ga0268266_10005220	3300028379	Bacteria	12214
1241	Ga0268266_10123533	3300028379	Bacteria	2306
1242	Ga0268266_10242983	3300028379	Bacteria	1662
1243	Ga0268266_10245605	3300028379	Bacteria	1654
1244	Ga0268266_10407097	3300028379	Bacteria	1287
1245	Ga0268265_10000381	3300028380	Bacteria	47576
1246	Ga0268265_10001161	3300028380	Bacteria	23113
1247	Ga0268265_10002921	3300028380	Bacteria	12529
1248	Ga0268265_10065268	3300028380	Bacteria	2808
1249	Ga0268265_10256782	3300028380	Bacteria	1551
1250	Ga0268265_10685571	3300028380	Bacteria	988
1251	Ga0268265_10722061	3300028380	Bacteria	965
1252	Ga0268265_10743492	3300028380	Bacteria	951
1253	Ga0268264_10000004	3300028381	Bacteria	1116842
1254	Ga0268264_10000016	3300028381	Bacteria	502537
1255	Ga0268264_10009205	3300028381	Bacteria	8181
1256	Ga0268264_10021726	3300028381	Bacteria	5239
1257	Ga0268264_10056540	3300028381	Bacteria	3280
1258	Ga0268264_10225707	3300028381	Bacteria	1727
1259	Ga0268264_10460399	3300028381	Bacteria	1234
1260	Ga0268264_10756077	3300028381	Bacteria	969
1261	Ga0265326_10080191	3300028558	Bacteria	923
1262	Ga0265336_10000032	3300028666	Bacteria	167925
1263	Ga0307517_10091067	3300028786	Bacteria	2495
1264	Ga0307517_10127760	3300028786	Bacteria	1846
1265	Ga0307517_10138433	3300028786	Bacteria	1720
1266	Ga0307515_10000063	3300028794	Bacteria	245504
1267	Ga0307515_10000553	3300028794	Bacteria	88277
1268	Ga0307515_10017105	3300028794	Bacteria	13239
1269	Ga0307515_10093762	3300028794	Bacteria	3718
1270	Ga0307515_10259693	3300028794	Bacteria	1475
1271	Ga0265338_10000113	3300028800	Bacteria	150993
1272	Ga0265338_10000928	3300028800	Bacteria	49449
1273	Ga0265338_10111755	3300028800	Bacteria	2199
1274	Ga0265324_10001824	3300029957	Bacteria	11558
1275	Ga0268256_1000115	3300030500	Bacteria	116918
1276	Ga0268256_1004868	3300030500	Bacteria	5432
1277	Ga0268256_1052484	3300030500	Bacteria	852
1278	Ga0307511_10081887	3300030521	Bacteria	2261
1279	Ga0307512_10037055	3300030522	Bacteria	4125
1280	Ga0307512_10062296	3300030522	Bacteria	2863
1281	Ga0314311_1061190	3300030733	Bacteria	7419
1282	Ga0316183_1117584	3300030742	Bacteria	3181
1283	Ga0316181_1070832	3300030744	Bacteria	2677
1284	Ga0265330_10015527	3300031235	Bacteria	3521
1285	Ga0265332_10003830	3300031238	Bacteria	7186
1286	Ga0265332_10057986	3300031238	Bacteria	1658
1287	Ga0265332_10069749	3300031238	Bacteria	1498
1288	Ga0265328_10022581	3300031239	Bacteria	2393
1289	Ga0265328_10040030	3300031239	Bacteria	1728
1290	Ga0265328_10087393	3300031239	Bacteria	1151
1291	Ga0265325_10000160	3300031241	Bacteria	47271
1292	Ga0265340_10027421	3300031247	Bacteria	2872
1293	Ga0265340_10058541	3300031247	Bacteria	1850
1294	Ga0265331_10000961	3300031250	Bacteria	22915
1295	Ga0265331_10002813	3300031250	Bacteria	11537
1296	Ga0265331_10008642	3300031250	Bacteria	5773
1297	Ga0265331_10105141	3300031250	Bacteria	1297
1298	Ga0265327_10000085	3300031251	Bacteria	203068
1299	Ga0265327_10000136	3300031251	Bacteria	160868
1300	Ga0265327_10008072	3300031251	Bacteria	7931
1301	Ga0265327_10011118	3300031251	Bacteria	6244
1302	Ga0265316_10000201	3300031344	Bacteria	69415
1303	Ga0265316_10003730	3300031344	Bacteria	15309
1304	Ga0265316_10091606	3300031344	Bacteria	2319
1305	Ga0265316_10120263	3300031344	Bacteria	1984
1306	Ga0307513_10000653	3300031456	Bacteria	49874
1307	Ga0307513_10002530	3300031456	Bacteria	25277
1308	Ga0307513_10131893	3300031456	Bacteria	2443
1309	Ga0307513_10241848	3300031456	Bacteria	1609
1310	Ga0307509_10080923	3300031507	Bacteria	3358
1311	Ga0307408_100003318	3300031548	Bacteria	11065
1312	Ga0307408_100013506	3300031548	Bacteria	5421
1313	Ga0307408_100052341	3300031548	Bacteria	2944
1314	Ga0307408_100097508	3300031548	Bacteria	2233
1315	Ga0307408_100110830	3300031548	Bacteria	2108
1316	Ga0307408_100119150	3300031548	Bacteria	2042
1317	Ga0307408_100127271	3300031548	Bacteria	1982
1318	Ga0307408_100221486	3300031548	Bacteria	1544
1319	Ga0307408_100349620	3300031548	Bacteria	1254
1320	Ga0307408_100442500	3300031548	Bacteria	1125
1321	Ga0307408_100503625	3300031548	Bacteria	1060
1322	Ga0307408_100671778	3300031548	Bacteria	928
1323	Ga0307514_10000420	3300031649	Bacteria	94078
1324	Ga0307514_10000890	3300031649	Bacteria	46600
1325	Ga0316575_10019359	3300031665	Bacteria	2602
1326	Ga0316575_10077075	3300031665	Bacteria	1343
1327	Ga0316579_10000679	3300031691	Bacteria	11541
1328	Ga0316579_10000687	3300031691	Bacteria	11504
1329	Ga0316579_10123055	3300031691	Bacteria	1247
1330	Ga0265314_10004643	3300031711	Bacteria	12632
1331	Ga0265314_10096523	3300031711	Bacteria	1912
1332	Ga0265342_10019436	3300031712	Bacteria	4377
1333	Ga0316576_10004799	3300031727	Bacteria	8168
1334	Ga0316576_10102572	3300031727	Bacteria	2140
1335	Ga0316576_10163957	3300031727	Bacteria	1677
1336	Ga0316578_10011059	3300031728	Bacteria	4705
1337	Ga0307516_10000116	3300031730	Bacteria	92895
1338	Ga0307516_10000879	3300031730	Bacteria	41327
1339	Ga0307516_10089738	3300031730	Bacteria	2904
1340	Ga0307516_10191134	3300031730	Bacteria	1773
1341	Ga0307516_10315677	3300031730	Bacteria	1235
1342	Ga0307405_10033687	3300031731	Bacteria	3041
1343	Ga0307405_10074940	3300031731	Bacteria	2190
1344	Ga0307405_10079132	3300031731	Bacteria	2141
1345	Ga0307405_10139696	3300031731	Bacteria	1687
1346	Ga0307405_10162677	3300031731	Bacteria	1583
1347	Ga0307405_10204904	3300031731	Bacteria	1435
1348	Ga0307405_10390299	3300031731	Bacteria	1086
1349	Ga0307405_10559301	3300031731	Bacteria	927
1350	Ga0316577_10082869	3300031733	Bacteria	1794
1351	Ga0316577_10219546	3300031733	Bacteria	1075
1352	Ga0307413_10508827	3300031824	Bacteria	969
1353	Ga0307413_10512211	3300031824	Bacteria	966
1354	Ga0307518_10261252	3300031838	Bacteria	1091
1355	Ga0307410_10387958	3300031852	Bacteria	1125
1356	Ga0307406_10005175	3300031901	Bacteria	7121
1357	Ga0307406_10011186	3300031901	Bacteria	5085
1358	Ga0307406_10114349	3300031901	Bacteria	1864
1359	Ga0307406_10131731	3300031901	Bacteria	1756
1360	Ga0307406_10314973	3300031901	Bacteria	1208
1361	Ga0307407_10355334	3300031903	Bacteria	1039
1362	Ga0307412_10000014	3300031911	Bacteria	353795
1363	Ga0307412_10016057	3300031911	Bacteria	4450
1364	Ga0307412_10042635	3300031911	Bacteria	2950
1365	Ga0307412_10175207	3300031911	Bacteria	1607
1366	Ga0307412_10198955	3300031911	Bacteria	1520
1367	Ga0307412_10304056	3300031911	Bacteria	1262
1368	Ga0307412_10464858	3300031911	Bacteria	1045
1369	Ga0307412_10513262	3300031911	Bacteria	1000
1370	Ga0307412_10566114	3300031911	Bacteria	957
1371	Ga0307409_100076580	3300031995	Bacteria	2683
1372	Ga0307409_100157378	3300031995	Bacteria	1982
1373	Ga0307409_100236806	3300031995	Bacteria	1659
1374	Ga0307409_100581317	3300031995	Bacteria	1104
1375	Ga0307409_100778323	3300031995	Bacteria	963
1376	Ga0307409_100799225	3300031995	Bacteria	951
1377	Ga0307409_100896743	3300031995	Bacteria	900
1378	Ga0307416_100020224	3300032002	Bacteria	4744
1379	Ga0307416_100023250	3300032002	Bacteria	4494
1380	Ga0307416_100027108	3300032002	Bacteria	4236
1381	Ga0307416_100094276	3300032002	Bacteria	2581
1382	Ga0307416_100185406	3300032002	Bacteria	1955
1383	Ga0307416_100363427	3300032002	Bacteria	1470
1384	Ga0307414_10003103	3300032004	Bacteria	8825
1385	Ga0307414_10006829	3300032004	Bacteria	6384
1386	Ga0307414_10546170	3300032004	Bacteria	1032
1387	Ga0307411_10005306	3300032005	Bacteria	6310
1388	Ga0307411_10103104	3300032005	Bacteria	2023
1389	Ga0307411_10173850	3300032005	Bacteria	1627
1390	Ga0307411_10243460	3300032005	Bacteria	1409
1391	Ga0307411_10258250	3300032005	Bacteria	1374
1392	Ga0307411_10341578	3300032005	Bacteria	1217
1393	Ga0316583_10025451	3300032133	Bacteria	2114
1394	Ga0316585_10009273	3300032137	Bacteria	2867
1395	Ga0373934_0000369	3300035086	Bacteria	15752
1396	Ga0373934_0002073	3300035086	Bacteria	7355
1397	Ga0373923_0056450	3300035111	Bacteria	1658
1398	Ga0373923_0154171	3300035111	Bacteria	1045
1399	Ga0373936_0124612	3300035113	Bacteria	1103
1400	Ga0373941_0025646	3300035115	Bacteria	1705
1401	Ga0373953_0030254	3300035117	Bacteria	2098
1402	Ga0373953_0062081	3300035117	Bacteria	1529
1403	Ga0373954_0000002	3300035118	Bacteria	147478
1404	Ga0373954_0009026	3300035118	Bacteria	4386
1405	Ga0373954_0012500	3300035118	Bacteria	3774
1406	Ga0373954_0016225	3300035118	Bacteria	3332
1407	Ga0373954_0239151	3300035118	Bacteria	894
1408	Ga0373954_0329186	3300035118	Unclassified	754
1409	Ga0373956_0000006	3300035119	Bacteria	65782
1410	Ga0373956_0034328	3300035119	Bacteria	2234
1411	Ga0373956_0034465	3300035119	Bacteria	2229
1412	Ga0373956_0067256	3300035119	Bacteria	1631
1413	Ga0373956_0211205	3300035119	Bacteria	920
1414	Ga0373957_0001275	3300035120	Bacteria	6751
1415	Ga0373957_0079247	3300035120	Bacteria	1294
1416	Ga0373957_0190847	3300035120	Bacteria	851
1417	Ga0373955_0027701	3300035172	Bacteria	2932
1418	Ga0373955_0131523	3300035172	Bacteria	1461
1419	Ga0373955_0195149	3300035172	Bacteria	1204
1420	Ga0373955_0461727	3300035172	Bacteria	774
1421	Ga0373962_0038218	3300035242	Bacteria	1343
1422	Ga0316574_0001736	3300035398	Bacteria	10546
1423	Ga0316574_0007099	3300035398	Bacteria	6116
1424	Ga0316574_0205487	3300035398	Bacteria	1264
1425	Ga0316574_0233469	3300035398	Bacteria	1177
1426	Ga0316574_0261603	3300035398	Bacteria	1105
1427	Ga0373924_0015810	3300035410	Bacteria	2874
1428	Ga0373924_0062866	3300035410	Bacteria	1555
1429	Ga0373931_0004169	3300035691	Bacteria	6573
1430	Ga0373931_0036152	3300035691	Bacteria	2573
1431	Ga0373931_0186719	3300035691	Bacteria	1231
1432	Ga0373931_0340645	3300035691	Bacteria	936
1433	Ga0373935_0014451	3300035692	Bacteria	4763
1434	Ga0373927_0049334	3300035695	Bacteria	2722
1435	Ga0373927_0089958	3300035695	Bacteria	1993
1436	Ga0373933_0001076	3300035724	Bacteria	16453
1437	Ga0373933_0001148	3300035724	Bacteria	15721
1438	Ga0373933_0078549	3300035724	Bacteria	2019
1439	Ga0373933_0142558	3300035724	Bacteria	1513
1440	Ga0373933_0224980	3300035724	Bacteria	1204
1441	Ga0373933_0492096	3300035724	Unclassified	803
1442	Ga0373947_0152036	3300035725	Bacteria	1491
1443	Ga0373947_0246726	3300035725	Bacteria	1180
1444	Ga0373937_0000205	3300036401	Bacteria	57080
1445	Ga0373937_0010865	3300036401	Bacteria	7971
1446	Ga0373937_0041269	3300036401	Bacteria	4209
1447	Ga0373937_0294429	3300036401	Bacteria	1533
1448	Ga0373937_0468862	3300036401	Bacteria	1196
1449	Ga0316582_0006894	3300036647	Bacteria	6009
1450	Ga0316582_0015765	3300036647	Bacteria	4331
1451	Ga0316582_0020042	3300036647	Bacteria	3926
1452	Ga0316582_0119008	3300036647	Bacteria	1766
1453	Ga0316582_0162938	3300036647	Unclassified	1511
1454	Ga0316582_0273091	3300036647	Bacteria	1160
1455	Ga0316584_0003219	3300036712	Bacteria	10573
1456	Ga0316584_0109281	3300036712	Bacteria	2069
1457	Ga0316584_0318411	3300036712	Bacteria	1123
1458	Ga0373925_0018425	3300037068	Bacteria	5074
1459	Ga0373925_0023324	3300037068	Bacteria	4515
1460	Ga0373925_0117670	3300037068	Bacteria	2060
1461	Ga0373925_0282022	3300037068	Bacteria	1338
1462	Ga0373925_0551217	3300037068	Bacteria	948
1463	Ga0373925_0760992	3300037068	Bacteria	798
1464	Ga0395899_0000008	3300037312	Bacteria	567572
1465	Ga0395899_0003854	3300037312	Bacteria	11827
1466	Ga0395899_0004014	3300037312	Bacteria	11598
1467	Ga0395899_0011804	3300037312	Bacteria	6686
1468	Ga0395899_0022113	3300037312	Bacteria	4822
1469	Ga0395899_0027806	3300037312	Bacteria	4261
1470	Ga0395899_0040938	3300037312	Bacteria	3464
1471	Ga0395899_0296423	3300037312	Bacteria	1096
1472	Ga0395900_0000055	3300037418	Bacteria	219875
1473	Ga0395900_0001233	3300037418	Bacteria	31459
1474	Ga0395900_0002362	3300037418	Bacteria	20872
1475	Ga0395900_0002450	3300037418	Bacteria	20443
1476	Ga0395900_0009158	3300037418	Bacteria	10143
1477	Ga0395900_0023649	3300037418	Bacteria	6286
1478	Ga0395900_0078053	3300037418	Bacteria	3403
1479	Ga0395900_0088142	3300037418	Bacteria	3190
1480	Ga0395900_0110099	3300037418	Bacteria	2829
1481	Ga0395900_0196349	3300037418	Bacteria	2044
1482	Ga0395900_0210348	3300037418	Bacteria	1964
1483	Ga0395900_0228874	3300037418	Bacteria	1870
1484	Ga0395900_0434678	3300037418	Bacteria	1271
1485	Ga0395898_0000119	3300037466	Bacteria	209937
1486	Ga0395898_0001768	3300037466	Bacteria	28236
1487	Ga0395898_0008670	3300037466	Bacteria	10728
1488	Ga0395898_0021822	3300037466	Bacteria	6486
1489	Ga0395898_0086702	3300037466	Bacteria	3017
1490	Ga0395898_0155469	3300037466	Bacteria	2187
1491	Ga0395898_0259731	3300037466	Bacteria	1656
1492	Ga0395898_0472102	3300037466	Bacteria	1194
1493	Ga0395898_0634278	3300037466	Bacteria	1011
1494	Ga0395905_0000084	3300037471	Bacteria	158046
1495	Ga0395905_0000168	3300037471	Bacteria	107034
1496	Ga0395905_0000430	3300037471	Bacteria	58720
1497	Ga0395905_0006436	3300037471	Bacteria	11822
1498	Ga0395905_0011147	3300037471	Bacteria	8692
1499	Ga0395905_0013850	3300037471	Bacteria	7714
1500	Ga0395905_0041744	3300037471	Bacteria	4305
1501	Ga0395905_0047278	3300037471	Bacteria	4033
1502	Ga0395905_0050198	3300037471	Bacteria	3909
1503	Ga0395905_0071088	3300037471	Bacteria	3262
1504	Ga0395905_0071365	3300037471	Bacteria	3255
1505	Ga0395905_0076281	3300037471	Bacteria	3142
1506	Ga0395905_0081585	3300037471	Bacteria	3030
1507	Ga0395905_0106041	3300037471	Bacteria	2639
1508	Ga0395905_0141287	3300037471	Bacteria	2265
1509	Ga0395905_0305397	3300037471	Bacteria	1479
1510	Ga0395905_0381277	3300037471	Bacteria	1304
1511	Ga0395905_0382408	3300037471	Bacteria	1301
1512	Ga0395905_0551989	3300037471	Bacteria	1053
1513	Ga0395905_0786756	3300037471	Bacteria	854
1514	Ga0316581_0001369	3300037588	Bacteria	5436
1515	Ga0316581_0008003	3300037588	Bacteria	2859
1516	Ga0395901_0000003	3300038443	Bacteria	701538
1517	Ga0395901_0000180	3300038443	Bacteria	81881
1518	Ga0395901_0000887	3300038443	Bacteria	32901
1519	Ga0395901_0022795	3300038443	Bacteria	6419
1520	Ga0395901_0052602	3300038443	Bacteria	4232
1521	Ga0395901_0210846	3300038443	Bacteria	2033
1522	Ga0395901_0468890	3300038443	Bacteria	1286
1523	Ga0400483_025561	3300039062	Bacteria	1585
1524	Ga0400483_103888	3300039062	Bacteria	1353
1525	Ga0436365_0575929	3300039437	Bacteria	985
1526	Ga0436365_0935976	3300039437	Bacteria	1044
1527	Ga0436360_0091497	3300039438	Bacteria	1226
1528	Ga0436360_0929816	3300039438	Bacteria	9690
1529	Ga0436361_0019716	3300039447	Bacteria	1849
1530	Ga0436361_0239425	3300039447	Bacteria	40455
1531	Ga0436361_0348965	3300039447	Bacteria	1311
1532	Ga0436361_0401117	3300039447	Bacteria	988
1533	Ga0436361_0480442	3300039447	Bacteria	7614
1534	Ga0436361_0504982	3300039447	Bacteria	102576
1535	Ga0436361_0527797	3300039447	Bacteria	1465
1536	Ga0436361_0577732	3300039447	Bacteria	8123
1537	Ga0436361_0580915	3300039447	Bacteria	36900
1538	Ga0436361_0650737	3300039447	Bacteria	41996
1539	Ga0436361_0729073	3300039447	Bacteria	1088
1540	Ga0436361_0758695	3300039447	Bacteria	3829
1541	Ga0436361_1112657	3300039447	Bacteria	3961
1542	Ga0436361_1205905	3300039447	Bacteria	5520
1543	Ga0439436_0004348	3300041404	Bacteria	4340
1544	Ga0439436_0022976	3300041404	Bacteria	1846
1545	Ga0439436_0082950	3300041404	Bacteria	892
1546	Ga0439438_025294	3300041405	Bacteria	1619
1547	Ga0439447_027741	3300041407	Bacteria	1443
1548	Ga0439447_035388	3300041407	Bacteria	1238
1549	Ga0439453_0002751	3300041408	Bacteria	2462
1550	Ga0439453_0039779	3300041408	Bacteria	918
1551	Ga0439461_0024117	3300041410	Bacteria	1228
1552	Ga0439461_0024814	3300041410	Bacteria	1214
1553	Ga0439466_0010730	3300041411	Bacteria	3401
1554	Ga0439465_0003342	3300041413	Bacteria	5240
1555	Ga0439465_0117583	3300041413	Bacteria	930
1556	Ga0451789_0698048	3300041443	Bacteria	1500
1557	Ga0451791_1316654	3300041451	Bacteria	1745
1558	Ga0451793_0509386	3300041452	Bacteria	2505
1559	Ga0451800_1022359	3300041459	Bacteria	2326
1560	Ga0451804_0855014	3300041463	Bacteria	795
1561	Ga0451853_0206750	3300041512	Bacteria	863
1562	Ga0439431_0017524	3300041997	Bacteria	1685
1563	Ga0439433_0000690	3300041999	Bacteria	6541
1564	Ga0439433_0015833	3300041999	Bacteria	1667
1565	Ga0439433_0036310	3300041999	Bacteria	1138
1566	Ga0439441_002975	3300042001	Bacteria	2445
1567	Ga0439442_007715	3300042002	Bacteria	2170
1568	Ga0439442_010451	3300042002	Bacteria	1882
1569	Ga0439443_004699	3300042003	Bacteria	1794
1570	Ga0439443_034235	3300042003	Bacteria	848
1571	Ga0439445_0001982	3300042004	Bacteria	4518
1572	Ga0439445_0058874	3300042004	Bacteria	1048
1573	Ga0439448_0008954	3300042005	Bacteria	2940
1574	Ga0439448_0061901	3300042005	Bacteria	1238
1575	Ga0439432_005531	3300042006	Bacteria	4546
1576	Ga0439449_0000139	3300042007	Bacteria	24604
1577	Ga0439449_0002137	3300042007	Bacteria	7762
1578	Ga0439449_0013138	3300042007	Bacteria	3115
1579	Ga0439449_0036513	3300042007	Bacteria	1828
1580	Ga0439452_001806	3300042010	Bacteria	8321
1581	Ga0439452_034743	3300042010	Bacteria	1216
1582	Ga0439455_0041003	3300042012	Bacteria	1186
1583	Ga0439457_032159	3300042014	Bacteria	1164
1584	Ga0439462_0012010	3300042015	Bacteria	2209
1585	Ga0450911_000289	3300042115	Bacteria	18464
1586	Ga0450919_001789	3300042121	Bacteria	2801
1587	Ga0450921_001093	3300042123	Bacteria	1548
1588	Ga0450888_000293	3300042126	Bacteria	4719
1589	Ga0450890_006963	3300042127	Bacteria	1442
1590	Ga0450897_008736	3300042128	Bacteria	947
1591	Ga0450891_000536	3300042129	Bacteria	3945
1592	Ga0450896_015135	3300042133	Bacteria	1103
1593	Ga0450898_010462	3300042134	Bacteria	1502
1594	Ga0450898_031323	3300042134	Bacteria	977
1595	Ga0450899_009578	3300042135	Bacteria	1068
1596	Ga0450902_003065	3300042137	Bacteria	2413
1597	Ga0450902_015962	3300042137	Bacteria	1222
1598	Ga0450906_007877	3300042145	Bacteria	2087
1599	Ga0439446_0033558	3300042156	Bacteria	1491
1600	Ga0439446_0056129	3300042156	Bacteria	1183
1601	Ga0439446_0059468	3300042156	Bacteria	1153
1602	Ga0450908_005222	3300042184	Bacteria	2489
1603	Ga0450908_027615	3300042184	Bacteria	989
1604	Ga0450909_014491	3300042185	Bacteria	1161
1605	Ga0439434_0022953	3300042435	Bacteria	1877
1606	Ga0439434_0030719	3300042435	Bacteria	1631
1607	Ga0439434_0032877	3300042435	Bacteria	1579
1608	Ga0439434_0041967	3300042435	Bacteria	1406
1609	Ga0439434_0078078	3300042435	Bacteria	1048
1610	Ga0439435_0000860	3300042436	Bacteria	5203
1611	Ga0439444_0015981	3300042437	Bacteria	1272
1612	Ga0439459_0002928	3300042438	Bacteria	2671
1613	Ga0439459_0023362	3300042438	Bacteria	1204
1614	Ga0439460_0053400	3300042461	Bacteria	1217
1615	Ga0450918_000489	3300042531	Bacteria	8477
1616	Ga0450918_013703	3300042531	Bacteria	1410
1617	Ga0450918_014923	3300042531	Bacteria	1350
1618	Ga0450893_0002140	3300042532	Bacteria	3079
1619	Ga0450893_0024006	3300042532	Bacteria	1063
1620	Ga0450901_006717	3300042533	Bacteria	1185
1621	Ga0451577_0002302	3300042876	Bacteria	23086
1622	Ga0451577_0003569	3300042876	Bacteria	17145
1623	Ga0451577_0007096	3300042876	Bacteria	11048
1624	Ga0451577_0012834	3300042876	Bacteria	7864
1625	Ga0451577_0061464	3300042876	Bacteria	3350
1626	Ga0451577_0077921	3300042876	Bacteria	2955
1627	Ga0451577_0118844	3300042876	Bacteria	2367
1628	Ga0451577_0126587	3300042876	Bacteria	2289
1629	Ga0451577_0139176	3300042876	Bacteria	2180
1630	Ga0451577_0247481	3300042876	Bacteria	1613
1631	Ga0451577_0594807	3300042876	Bacteria	1004
1632	Ga0451577_0720849	3300042876	Bacteria	903
1633	Ga0451577_0954719	3300042876	Bacteria	771
1634	Ga0466969_0002150	3300044656	Bacteria	10514
1635	Ga0466969_0005354	3300044656	Bacteria	6828
1636	Ga0466969_0063454	3300044656	Bacteria	1790
1637	Ga0466969_0078172	3300044656	Bacteria	1582
1638	Ga0466969_0101520	3300044656	Bacteria	1353
1639	Ga0466972_0000045	3300044658	Bacteria	129244
1640	Ga0466972_0000283	3300044658	Bacteria	31634
1641	Ga0466972_0004525	3300044658	Bacteria	6960
1642	Ga0466972_0020392	3300044658	Bacteria	3313
1643	Ga0466972_0036391	3300044658	Bacteria	2409
1644	Ga0466972_0040305	3300044658	Bacteria	2276
1645	Ga0466972_0126730	3300044658	Bacteria	1203
1646	Ga0466973_0059855	3300044659	Bacteria	3456
1647	Ga0466977_0000526	3300044666	Bacteria	12771
1648	Ga0466982_0108454	3300044672	Bacteria	1718
1649	Ga0453683_0005183	3300044673	Bacteria	9126
1650	Ga0453683_0120896	3300044673	Bacteria	1649
1651	Ga0453683_0468595	3300044673	Bacteria	816
1652	Ga0453683_0603782	3300044673	Bacteria	716
1653	Ga0466965_0000148	3300044683	Bacteria	20625
1654	Ga0466965_0002026	3300044683	Bacteria	8488
1655	Ga0466965_0004127	3300044683	Bacteria	6457
1656	Ga0466965_0009586	3300044683	Bacteria	4501
1657	Ga0466965_0034584	3300044683	Bacteria	2472
1658	Ga0466965_0041605	3300044683	Bacteria	2264
1659	Ga0466965_0048810	3300044683	Bacteria	2098
1660	Ga0466965_0056940	3300044683	Bacteria	1947
1661	Ga0466965_0117696	3300044683	Bacteria	1370
1662	Ga0466965_0134415	3300044683	Bacteria	1284
1663	Ga0466965_0140625	3300044683	Bacteria	1256
1664	Ga0466965_0244552	3300044683	Bacteria	961
1665	Ga0466966_0005778	3300044684	Bacteria	8151
1666	Ga0466966_0006766	3300044684	Bacteria	7590
1667	Ga0466966_0007127	3300044684	Bacteria	7408
1668	Ga0466966_0017867	3300044684	Bacteria	4683
1669	Ga0466966_0030856	3300044684	Bacteria	3476
1670	Ga0466966_0040223	3300044684	Bacteria	3009
1671	Ga0466966_0061227	3300044684	Bacteria	2375
1672	Ga0466966_0072741	3300044684	Bacteria	2151
1673	Ga0466966_0128677	3300044684	Bacteria	1552
1674	Ga0466966_0371406	3300044684	Bacteria	859
1675	Ga0466961_0000063	3300044693	Bacteria	64438
1676	Ga0466961_0001718	3300044693	Bacteria	13622
1677	Ga0466961_0033067	3300044693	Bacteria	3324
1678	Ga0466961_0091515	3300044693	Bacteria	1920
1679	Ga0466961_0112383	3300044693	Bacteria	1713
1680	Ga0466961_0121497	3300044693	Bacteria	1640
1681	Ga0466961_0153617	3300044693	Bacteria	1436
1682	Ga0466963_0038491	3300044694	Bacteria	3127
1683	Ga0466963_0415685	3300044694	Bacteria	949
1684	Ga0466964_0000615	3300044706	Bacteria	11337
1685	Ga0466964_0039145	3300044706	Bacteria	1908
1686	Ga0466964_0049822	3300044706	Bacteria	1716
1687	Ga0466964_0107096	3300044706	Bacteria	1241
1688	Ga0466964_0160434	3300044706	Bacteria	1050
1689	Ga0466964_0227573	3300044706	Bacteria	908
1690	Ga0453684_0000273	3300044712	Bacteria	222658
1691	Ga0453684_0000638	3300044712	Bacteria	126432
1692	Ga0453684_0001714	3300044712	Bacteria	58939
1693	Ga0453684_0023372	3300044712	Bacteria	9113
1694	Ga0453684_0035983	3300044712	Bacteria	6831
1695	Ga0453684_0098138	3300044712	Bacteria	3593
1696	Ga0453684_0127173	3300044712	Bacteria	3065
1697	Ga0453684_0219066	3300044712	Bacteria	2206
1698	Ga0453684_0372736	3300044712	Bacteria	1604
1699	Ga0453684_0543791	3300044712	Bacteria	1280
1700	Ga0466971_0007812	3300044719	Bacteria	4660
1701	Ga0466971_0082048	3300044719	Bacteria	1471
1702	Ga0466971_0120642	3300044719	Bacteria	1213
1703	Ga0466971_0181509	3300044719	Bacteria	989
1704	Ga0466968_0042806	3300044735	Bacteria	1915
1705	Ga0466968_0050408	3300044735	Bacteria	1776
1706	Ga0466970_0046624	3300044765	Bacteria	2308
1707	Ga0466970_0047253	3300044765	Bacteria	2293
1708	Ga0466970_0065673	3300044765	Bacteria	1947
1709	Ga0466970_0098513	3300044765	Bacteria	1591
1710	Ga0466970_0104704	3300044765	Bacteria	1542
1711	Ga0466970_0169570	3300044765	Bacteria	1209
1712	Ga0466957_0000376	3300044842	Bacteria	21877
1713	Ga0466957_0003141	3300044842	Bacteria	9000
1714	Ga0466957_0004378	3300044842	Bacteria	7856
1715	Ga0466957_0007319	3300044842	Bacteria	6237
1716	Ga0466957_0025716	3300044842	Bacteria	3490
1717	Ga0466957_0039473	3300044842	Bacteria	2848
1718	Ga0466957_0041291	3300044842	Bacteria	2790
1719	Ga0466957_0062578	3300044842	Bacteria	2286
1720	Ga0466957_0125003	3300044842	Bacteria	1643
1721	Ga0466957_0320216	3300044842	Bacteria	1046
1722	Ga0466957_0530267	3300044842	Bacteria	819
1723	Ga0466960_0181315	3300044901	Bacteria	1141
1724	Ga0466960_0211192	3300044901	Bacteria	1064
1725	Ga0466959_0001563	3300045049	Bacteria	14094
1726	Ga0466959_0028313	3300045049	Bacteria	4155
1727	Ga0466959_0038216	3300045049	Bacteria	3546
1728	Ga0466959_0047263	3300045049	Bacteria	3165
1729	Ga0466959_0053715	3300045049	Bacteria	2944
1730	Ga0466959_0076128	3300045049	Bacteria	2423
1731	Ga0466959_0076619	3300045049	Bacteria	2414
1732	Ga0466959_0079312	3300045049	Bacteria	2367
1733	Ga0466959_0111329	3300045049	Bacteria	1953
1734	Ga0466959_0470289	3300045049	Bacteria	851
1735	Ga0451576_0000006	3300045051	Bacteria	949698
1736	Ga0451576_0001248	3300045051	Bacteria	44697
1737	Ga0451576_0008116	3300045051	Bacteria	12369
1738	Ga0451576_0051013	3300045051	Bacteria	4339
1739	Ga0451576_0055823	3300045051	Bacteria	4131
1740	Ga0451576_0086803	3300045051	Bacteria	3254
1741	Ga0451576_0126819	3300045051	Bacteria	2659
1742	Ga0451576_0157984	3300045051	Bacteria	2366
1743	Ga0451576_0257695	3300045051	Bacteria	1823
1744	Ga0451576_0644792	3300045051	Bacteria	1113
1745	Ga0466958_0016385	3300045836	Bacteria	4267
1746	Ga0466958_0064675	3300045836	Bacteria	2231
1747	Ga0466958_0073750	3300045836	Bacteria	2090
1748	Ga0466958_0158615	3300045836	Bacteria	1428
1749	Ga0466967_0151416	3300045976	Bacteria	2168
1750	Ga0466967_0192611	3300045976	Bacteria	1927
1751	Ga0466967_0207525	3300045976	Bacteria	1857
1752	Ga0466967_0375153	3300045976	Bacteria	1380
1753	Ga0495617_000011	3300046452	Bacteria	301936
1754	Ga0495617_000104	3300046452	Bacteria	61298
1755	Ga0495617_050437	3300046452	Bacteria	1384
1756	Ga0495627_006620	3300046453	Bacteria	4524
1757	Ga0495627_014124	3300046453	Bacteria	2795
1758	Ga0495627_118272	3300046453	Bacteria	749
1759	Ga0495592_0000711	3300046454	Bacteria	23301
1760	Ga0495592_0077143	3300046454	Bacteria	2416
1761	Ga0495592_0189930	3300046454	Bacteria	1393
1762	Ga0495603_0020388	3300046455	Bacteria	4018
1763	Ga0495603_0081118	3300046455	Bacteria	1901
1764	Ga0495603_0122174	3300046455	Bacteria	1517
1765	Ga0495603_0175937	3300046455	Bacteria	1239
1766	Ga0495603_0201617	3300046455	Bacteria	1150
1767	Ga0495590_0001091	3300046457	Bacteria	11939
1768	Ga0495590_0001195	3300046457	Bacteria	11354
1769	Ga0495590_0011111	3300046457	Bacteria	3374
1770	Ga0495590_0011558	3300046457	Bacteria	3296
1771	Ga0495590_0064317	3300046457	Bacteria	1284
1772	Ga0495590_0069523	3300046457	Bacteria	1234
1773	Ga0495591_018837	3300046458	Bacteria	2331
1774	Ga0495591_077923	3300046458	Bacteria	849
1775	Ga0495629_0001732	3300046459	Bacteria	17109
1776	Ga0495629_0058648	3300046459	Bacteria	2691
1777	Ga0495629_0069761	3300046459	Bacteria	2452
1778	Ga0495629_0084527	3300046459	Bacteria	2214
1779	Ga0495629_0123444	3300046459	Bacteria	1804
1780	Ga0495629_0289402	3300046459	Bacteria	1123
1781	Ga0495638_0032456	3300046460	Bacteria	3347
1782	Ga0495638_0048877	3300046460	Bacteria	2646
1783	Ga0495638_0066557	3300046460	Bacteria	2214
1784	Ga0495638_0083054	3300046460	Bacteria	1941
1785	Ga0495638_0106758	3300046460	Bacteria	1668
1786	Ga0495651_0000589	3300046462	Bacteria	28162
1787	Ga0495651_0008469	3300046462	Bacteria	7880
1788	Ga0495651_0029836	3300046462	Bacteria	4252
1789	Ga0495651_0339333	3300046462	Bacteria	996
1790	Ga0495653_0000029	3300046463	Bacteria	145049
1791	Ga0495653_0011660	3300046463	Bacteria	7173
1792	Ga0495653_0048434	3300046463	Bacteria	3280
1793	Ga0495653_0061473	3300046463	Bacteria	2842
1794	Ga0495653_0066805	3300046463	Bacteria	2703
1795	Ga0495653_0074416	3300046463	Bacteria	2530
1796	Ga0495653_0104455	3300046463	Bacteria	2047
1797	Ga0495653_0177758	3300046463	Bacteria	1463
1798	Ga0495650_0000633	3300046471	Bacteria	47224
1799	Ga0495650_0002944	3300046471	Bacteria	12897
1800	Ga0495650_0005605	3300046471	Bacteria	8093
1801	Ga0495650_0015598	3300046471	Bacteria	3889
1802	Ga0495650_0070054	3300046471	Bacteria	1378
1803	Ga0495650_0137785	3300046471	Bacteria	885
1804	Ga0495580_0004205	3300046472	Bacteria	12103
1805	Ga0495580_0014504	3300046472	Bacteria	5975
1806	Ga0495580_0020034	3300046472	Bacteria	4958
1807	Ga0495580_0026646	3300046472	Bacteria	4212
1808	Ga0495580_0032325	3300046472	Bacteria	3776
1809	Ga0495580_0075264	3300046472	Bacteria	2356
1810	Ga0495580_0079536	3300046472	Bacteria	2286
1811	Ga0495580_0088846	3300046472	Bacteria	2151
1812	Ga0495580_0236898	3300046472	Bacteria	1252
1813	Ga0495582_0000933	3300046473	Bacteria	16309
1814	Ga0495582_0018556	3300046473	Bacteria	3803
1815	Ga0495582_0035935	3300046473	Bacteria	2725
1816	Ga0495582_0059851	3300046473	Bacteria	2101
1817	Ga0495605_0006574	3300046474	Bacteria	6668
1818	Ga0495605_0009483	3300046474	Bacteria	5467
1819	Ga0495605_0023326	3300046474	Bacteria	3255
1820	Ga0495605_0037601	3300046474	Bacteria	2433
1821	Ga0495605_0043110	3300046474	Bacteria	2239
1822	Ga0495605_0049193	3300046474	Bacteria	2060
1823	Ga0495639_0015266	3300046475	Bacteria	3329
1824	Ga0495639_0019401	3300046475	Bacteria	2967
1825	Ga0495639_0093102	3300046475	Bacteria	1416
1826	Ga0495662_0008483	3300046476	Bacteria	5054
1827	Ga0495662_0021908	3300046476	Bacteria	3088
1828	Ga0495662_0022140	3300046476	Bacteria	3070
1829	Ga0495662_0217779	3300046476	Bacteria	941
1830	Ga0495664_0002023	3300046477	Bacteria	10827
1831	Ga0495664_0006606	3300046477	Bacteria	6412
1832	Ga0495664_0033623	3300046477	Bacteria	3013
1833	Ga0495664_0040261	3300046477	Bacteria	2762
1834	Ga0495664_0123153	3300046477	Bacteria	1568
1835	Ga0495584_0003945	3300046491	Bacteria	8018
1836	Ga0495584_0011925	3300046491	Bacteria	4443
1837	Ga0495584_0115008	3300046491	Bacteria	1361
1838	Ga0495584_0140154	3300046491	Bacteria	1228
1839	Ga0495585_0002115	3300046492	Bacteria	14511
1840	Ga0495585_0009756	3300046492	Bacteria	5746
1841	Ga0495585_0012673	3300046492	Bacteria	4962
1842	Ga0495585_0144931	3300046492	Bacteria	1242
1843	Ga0495585_0160645	3300046492	Bacteria	1166
1844	Ga0495585_0216752	3300046492	Bacteria	967
1845	Ga0495594_0059238	3300046499	Bacteria	2117
1846	Ga0495594_0291870	3300046499	Bacteria	929
1847	Ga0495596_0000845	3300046500	Bacteria	18533
1848	Ga0495596_0007556	3300046500	Bacteria	4898
1849	Ga0495596_0009585	3300046500	Bacteria	4255
1850	Ga0495596_0014132	3300046500	Bacteria	3367
1851	Ga0495596_0024335	3300046500	Bacteria	2452
1852	Ga0495596_0040971	3300046500	Bacteria	1827
1853	Ga0495596_0057656	3300046500	Bacteria	1515
1854	Ga0495607_0000168	3300046501	Bacteria	69682
1855	Ga0495607_0016273	3300046501	Bacteria	4802
1856	Ga0495607_0020331	3300046501	Bacteria	4199
1857	Ga0495607_0068897	3300046501	Bacteria	1982
1858	Ga0495607_0074484	3300046501	Bacteria	1884
1859	Ga0495607_0130132	3300046501	Bacteria	1310
1860	Ga0495583_0000018	3300046506	Bacteria	306541
1861	Ga0495583_0014665	3300046506	Bacteria	4310
1862	Ga0495583_0044054	3300046506	Bacteria	2074
1863	Ga0495583_0086662	3300046506	Bacteria	1354
1864	Ga0495583_0095299	3300046506	Bacteria	1276
1865	Ga0495606_0000870	3300046507	Bacteria	45205
1866	Ga0495606_0004009	3300046507	Bacteria	15019
1867	Ga0495606_0004958	3300046507	Bacteria	12997
1868	Ga0495606_0005194	3300046507	Bacteria	12587
1869	Ga0495606_0012481	3300046507	Bacteria	6805
1870	Ga0495606_0013647	3300046507	Bacteria	6404
1871	Ga0495606_0032246	3300046507	Bacteria	3631
1872	Ga0495606_0086745	3300046507	Bacteria	1933
1873	Ga0495606_0090518	3300046507	Bacteria	1883
1874	Ga0495606_0168202	3300046507	Bacteria	1274
1875	Ga0495606_0357389	3300046507	Bacteria	773
1876	Ga0495608_0013755	3300046511	Bacteria	5614
1877	Ga0495608_0079885	3300046511	Bacteria	2126
1878	Ga0495608_0276439	3300046511	Bacteria	1043
1879	Ga0495610_0000007	3300046512	Bacteria	820919
1880	Ga0495610_0003098	3300046512	Bacteria	13264
1881	Ga0495610_0004263	3300046512	Bacteria	10645
1882	Ga0495610_0080903	3300046512	Bacteria	1492
1883	Ga0495610_0102577	3300046512	Bacteria	1279
1884	Ga0495610_0111657	3300046512	Bacteria	1210
1885	Ga0495616_0000903	3300046513	Bacteria	21412
1886	Ga0495616_0005284	3300046513	Bacteria	7961
1887	Ga0495616_0008419	3300046513	Bacteria	6111
1888	Ga0495616_0008782	3300046513	Bacteria	5950
1889	Ga0495616_0016818	3300046513	Bacteria	4041
1890	Ga0495616_0107556	3300046513	Bacteria	1299
1891	Ga0495618_0016346	3300046514	Bacteria	4537
1892	Ga0495618_0073014	3300046514	Bacteria	2183
1893	Ga0495618_0305515	3300046514	Bacteria	988
1894	Ga0495618_0306688	3300046514	Bacteria	985
1895	Ga0495620_0017279	3300046515	Bacteria	3600
1896	Ga0495620_0025341	3300046515	Bacteria	2807
1897	Ga0495620_0026313	3300046515	Bacteria	2738
1898	Ga0495628_0000876	3300046516	Bacteria	27763
1899	Ga0495628_0018712	3300046516	Bacteria	5732
1900	Ga0495628_0059923	3300046516	Bacteria	2987
1901	Ga0495628_0069910	3300046516	Bacteria	2737
1902	Ga0495628_0088299	3300046516	Bacteria	2402
1903	Ga0495628_0179592	3300046516	Bacteria	1601
1904	Ga0495628_0219874	3300046516	Bacteria	1427
1905	Ga0495630_0004567	3300046517	Bacteria	9703
1906	Ga0495630_0009615	3300046517	Bacteria	6955
1907	Ga0495630_0011247	3300046517	Bacteria	6473
1908	Ga0495630_0088481	3300046517	Bacteria	2339
1909	Ga0495630_0089255	3300046517	Bacteria	2328
1910	Ga0495630_0222696	3300046517	Bacteria	1440
1911	Ga0495630_0229714	3300046517	Bacteria	1417
1912	Ga0495630_0587904	3300046517	Bacteria	853
1913	Ga0495631_0002440	3300046518	Bacteria	10485
1914	Ga0495631_0004517	3300046518	Bacteria	7394
1915	Ga0495631_0023835	3300046518	Bacteria	2832
1916	Ga0495631_0060599	3300046518	Bacteria	1641
1917	Ga0495632_0008425	3300046519	Bacteria	6328
1918	Ga0495632_0075097	3300046519	Bacteria	1618
1919	Ga0495632_0085308	3300046519	Bacteria	1502
1920	Ga0495637_0020974	3300046520	Bacteria	2997
1921	Ga0495637_0077408	3300046520	Bacteria	1331
1922	Ga0495637_0151903	3300046520	Bacteria	873
1923	Ga0495643_0006993	3300046522	Bacteria	7333
1924	Ga0495643_0007173	3300046522	Bacteria	7230
1925	Ga0495643_0043587	3300046522	Bacteria	2441
1926	Ga0495643_0100222	3300046522	Bacteria	1485
1927	Ga0495644_0003859	3300046523	Bacteria	5904
1928	Ga0495644_0006171	3300046523	Bacteria	4660
1929	Ga0495644_0044375	3300046523	Bacteria	1672
1930	Ga0495644_0079375	3300046523	Bacteria	1236
1931	Ga0495648_0005730	3300046524	Bacteria	10252
1932	Ga0495648_0008405	3300046524	Bacteria	8129
1933	Ga0495648_0013788	3300046524	Bacteria	5955
1934	Ga0495648_0018991	3300046524	Bacteria	4849
1935	Ga0495648_0029537	3300046524	Bacteria	3638
1936	Ga0495648_0037733	3300046524	Bacteria	3100
1937	Ga0495648_0098281	3300046524	Bacteria	1621
1938	Ga0495666_0003390	3300046526	Bacteria	8038
1939	Ga0495666_0006063	3300046526	Bacteria	6089
1940	Ga0495666_0011301	3300046526	Bacteria	4452
1941	Ga0495666_0046141	3300046526	Bacteria	2101
1942	Ga0495666_0048356	3300046526	Bacteria	2048
1943	Ga0495666_0051980	3300046526	Bacteria	1967
1944	Ga0495666_0230890	3300046526	Bacteria	846
1945	Ga0495642_0048149	3300046528	Bacteria	1747
1946	Ga0495642_0053905	3300046528	Bacteria	1658
1947	Ga0495642_0064280	3300046528	Bacteria	1526
1948	Ga0495642_0070471	3300046528	Bacteria	1462
1949	Ga0495642_0094164	3300046528	Bacteria	1270
1950	Ga0495642_0153593	3300046528	Bacteria	996
1951	Ga0495642_0177460	3300046528	Bacteria	926
1952	Ga0495652_0006135	3300046529	Bacteria	11231
1953	Ga0495652_0055823	3300046529	Bacteria	3357
1954	Ga0495652_0114799	3300046529	Bacteria	2159
1955	Ga0495652_0162793	3300046529	Bacteria	1730
1956	Ga0495652_0174094	3300046529	Bacteria	1658
1957	Ga0495652_0272737	3300046529	Bacteria	1242
1958	Ga0495652_0292309	3300046529	Bacteria	1188
1959	Ga0495654_0045337	3300046530	Bacteria	2170
1960	Ga0495654_0047789	3300046530	Bacteria	2102
1961	Ga0495654_0062536	3300046530	Bacteria	1784
1962	Ga0495654_0092410	3300046530	Bacteria	1402
1963	Ga0495654_0098598	3300046530	Bacteria	1348
1964	Ga0495654_0101711	3300046530	Bacteria	1322
1965	Ga0495665_0027376	3300046531	Bacteria	3059
1966	Ga0495665_0052260	3300046531	Bacteria	2163
1967	Ga0495665_0062196	3300046531	Bacteria	1971
1968	Ga0495665_0116975	3300046531	Bacteria	1396
1969	Ga0495665_0285495	3300046531	Bacteria	846
1970	Ga0495640_0014334	3300046533	Bacteria	6000
1971	Ga0495640_0018995	3300046533	Bacteria	5083
1972	Ga0495640_0064794	3300046533	Bacteria	2469
1973	Ga0495640_0210708	3300046533	Bacteria	1228
1974	Ga0495640_0302291	3300046533	Bacteria	993
1975	Ga0495586_0009305	3300046535	Bacteria	5225
1976	Ga0495586_0041683	3300046535	Bacteria	2472
1977	Ga0495586_0050156	3300046535	Bacteria	2258
1978	Ga0495586_0192978	3300046535	Bacteria	1153
1979	Ga0495587_0014035	3300046536	Bacteria	5030
1980	Ga0495587_0039146	3300046536	Bacteria	2839
1981	Ga0495598_0060516	3300046537	Bacteria	1167
1982	Ga0495609_0000686	3300046538	Bacteria	26127
1983	Ga0495609_0003487	3300046538	Bacteria	8991
1984	Ga0495609_0007032	3300046538	Bacteria	5668
1985	Ga0495609_0059215	3300046538	Bacteria	1693
1986	Ga0495621_0009797	3300046539	Bacteria	2921
1987	Ga0495621_0047271	3300046539	Bacteria	1529
1988	Ga0495621_0061218	3300046539	Bacteria	1367
1989	Ga0495621_0071221	3300046539	Bacteria	1281
1990	Ga0495621_0098236	3300046539	Bacteria	1111
1991	Ga0495597_0003431	3300046542	Bacteria	9258
1992	Ga0495597_0017028	3300046542	Bacteria	3426
1993	Ga0495597_0042628	3300046542	Bacteria	2023
1994	Ga0495597_0076849	3300046542	Bacteria	1432
1995	Ga0495645_0001397	3300046543	Bacteria	16319
1996	Ga0495645_0008663	3300046543	Bacteria	7104
1997	Ga0495645_0011392	3300046543	Bacteria	6256
1998	Ga0495645_0013555	3300046543	Bacteria	5768
1999	Ga0495622_0029959	3300046557	Bacteria	2542
2000	Ga0495622_0057576	3300046557	Bacteria	1801
2001	Ga0495622_0215337	3300046557	Bacteria	852
2002	Ga0495633_0000392	3300046558	Bacteria	46091
2003	Ga0495633_0037323	3300046558	Bacteria	2325
2004	Ga0495633_0049653	3300046558	Bacteria	1979
2005	Ga0495667_0010270	3300046559	Bacteria	6334
2006	Ga0495667_0026023	3300046559	Bacteria	3941
2007	Ga0495667_0047461	3300046559	Bacteria	2838
2008	Ga0495667_0191193	3300046559	Bacteria	1311
2009	Ga0495656_0002260	3300046615	Bacteria	6367
2010	Ga0495656_0075482	3300046615	Bacteria	1508
2011	Ga0495656_0088407	3300046615	Bacteria	1412
2012	Ga0495656_0259440	3300046615	Bacteria	880
2013	Ga0495668_0000385	3300046616	Bacteria	58130
2014	Ga0495668_0012069	3300046616	Bacteria	5140
2015	Ga0495668_0030384	3300046616	Bacteria	3050
2016	Ga0495668_0083453	3300046616	Bacteria	1752
2017	Ga0495634_0004751	3300046642	Bacteria	10569
2018	Ga0495634_0019305	3300046642	Bacteria	4844
2019	Ga0495634_0021628	3300046642	Bacteria	4543
2020	Ga0495611_0002366	3300046648	Bacteria	8685
2021	Ga0495611_0050014	3300046648	Bacteria	1882
2022	Ga0495611_0057220	3300046648	Bacteria	1767
2023	Ga0495611_0105376	3300046648	Bacteria	1311
2024	Ga0495611_0163716	3300046648	Bacteria	1039
2025	Ga0495611_0211535	3300046648	Bacteria	903
2026	Ga0495625_0000585	3300046660	Bacteria	52865
2027	Ga0495625_0012083	3300046660	Bacteria	7006
2028	Ga0495625_0034643	3300046660	Bacteria	3725
2029	Ga0495625_0049799	3300046660	Bacteria	3009
2030	Ga0495625_0056717	3300046660	Bacteria	2787
2031	Ga0495625_0081824	3300046660	Bacteria	2246
2032	Ga0495625_0084325	3300046660	Bacteria	2207
2033	Ga0495625_0160171	3300046660	Bacteria	1508
2034	Ga0495635_0002889	3300046663	Bacteria	11796
2035	Ga0495635_0006014	3300046663	Bacteria	8463
2036	Ga0495635_0028794	3300046663	Bacteria	3860
2037	Ga0495635_0080020	3300046663	Bacteria	2236
2038	Ga0495635_0087783	3300046663	Bacteria	2128
2039	Ga0495635_0236829	3300046663	Bacteria	1232
2040	Ga0495661_0009375	3300046665	Bacteria	6719
2041	Ga0495661_0017791	3300046665	Bacteria	4685
2042	Ga0495661_0040350	3300046665	Bacteria	2895
2043	Ga0495661_0052405	3300046665	Bacteria	2459
2044	Ga0495661_0088426	3300046665	Bacteria	1768
2045	Ga0495588_0018661	3300046674	Bacteria	3386
2046	Ga0495588_0105549	3300046674	Bacteria	1482
2047	Ga0495657_0055766	3300046675	Bacteria	2635
2048	Ga0495657_0076858	3300046675	Bacteria	2168
2049	Ga0495657_0118379	3300046675	Bacteria	1671
2050	Ga0495657_0146200	3300046675	Bacteria	1470
2051	Ga0495599_0000352	3300046678	Bacteria	27161
2052	Ga0495599_0016212	3300046678	Bacteria	4624
2053	Ga0495599_0043581	3300046678	Bacteria	2816
2054	Ga0495599_0067725	3300046678	Bacteria	2229
2055	Ga0495599_0125704	3300046678	Bacteria	1593
2056	Ga0495623_0012550	3300046679	Bacteria	5482
2057	Ga0495623_0024300	3300046679	Bacteria	3905
2058	Ga0495623_0031020	3300046679	Bacteria	3438
2059	Ga0495623_0032456	3300046679	Bacteria	3356
2060	Ga0495623_0144650	3300046679	Bacteria	1411
2061	Ga0495623_0144980	3300046679	Bacteria	1409
2062	Ga0495646_0017810	3300046680	Bacteria	4502
2063	Ga0495646_0028330	3300046680	Bacteria	3508
2064	Ga0495646_0067368	3300046680	Bacteria	2116
2065	Ga0495647_0000261	3300046681	Bacteria	14540
2066	Ga0495647_0059087	3300046681	Bacteria	1509
2067	Ga0495658_0068089	3300046683	Bacteria	2060
2068	Ga0495658_0147578	3300046683	Bacteria	1442
2069	Ga0495658_0246536	3300046683	Bacteria	1123
2070	Ga0495658_0476935	3300046683	Bacteria	797
2071	Ga0495669_0001185	3300046684	Bacteria	10834
2072	Ga0495669_0007918	3300046684	Bacteria	4461
2073	Ga0495669_0018358	3300046684	Bacteria	3007
2074	Ga0495669_0026273	3300046684	Bacteria	2544
2075	Ga0495669_0079593	3300046684	Bacteria	1503
2076	Ga0495669_0109555	3300046684	Bacteria	1288
2077	Ga0495669_0180784	3300046684	Bacteria	1005
2078	Ga0495613_0003301	3300046689	Bacteria	12074
2079	Ga0495613_0038340	3300046689	Bacteria	3552
2080	Ga0495624_0002339	3300046690	Bacteria	14388
2081	Ga0495624_0057583	3300046690	Bacteria	2443
2082	Ga0495624_0084778	3300046690	Bacteria	1957
2083	Ga0495624_0158801	3300046690	Bacteria	1381
2084	Ga0495624_0169467	3300046690	Bacteria	1332
2085	Ga0495624_0196397	3300046690	Bacteria	1226
2086	Ga0495670_0006062	3300046691	Bacteria	5925
2087	Ga0495670_0013551	3300046691	Bacteria	4010
2088	Ga0495671_0000033	3300046692	Bacteria	197509
2089	Ga0495671_0002939	3300046692	Bacteria	10605
2090	Ga0495671_0013316	3300046692	Bacteria	4458
2091	Ga0495671_0044412	3300046692	Bacteria	2228
2092	Ga0495671_0061244	3300046692	Bacteria	1856
2093	Ga0495671_0061454	3300046692	Bacteria	1853
2094	Ga0495671_0066489	3300046692	Bacteria	1774
2095	Ga0495671_0098945	3300046692	Bacteria	1426
2096	Ga0495649_0003133	3300046694	Bacteria	11331
2097	Ga0495649_0004251	3300046694	Bacteria	9392
2098	Ga0495649_0008565	3300046694	Bacteria	6143
2099	Ga0495649_0013831	3300046694	Bacteria	4642
2100	Ga0495649_0052106	3300046694	Bacteria	2218
2101	Ga0495649_0080831	3300046694	Bacteria	1738
2102	Ga0495649_0215099	3300046694	Bacteria	995
2103	Ga0495589_0007292	3300046794	Bacteria	5791
2104	Ga0495589_0012547	3300046794	Bacteria	4386
2105	Ga0495589_0015997	3300046794	Bacteria	3856
2106	Ga0495589_0030012	3300046794	Bacteria	2740
2107	Ga0495589_0051167	3300046794	Bacteria	2043
2108	Ga0495589_0102125	3300046794	Bacteria	1387
2109	Ga0495589_0117416	3300046794	Bacteria	1282
2110	Ga0495589_0123860	3300046794	Bacteria	1244
2111	Ga0495589_0154242	3300046794	Bacteria	1096
2112	Ga0495589_0220803	3300046794	Bacteria	890
2113	Ga0495600_0003792	3300046809	Bacteria	8951
2114	Ga0495600_0004196	3300046809	Bacteria	8599
2115	Ga0495600_0041073	3300046809	Bacteria	3014
2116	Ga0495600_0044689	3300046809	Bacteria	2889
2117	Ga0495600_0182518	3300046809	Bacteria	1352
2118	Ga0495660_0000596	3300046810	Bacteria	28573
2119	Ga0495660_0054253	3300046810	Bacteria	2172
2120	Ga0495660_0080310	3300046810	Bacteria	1711
2121	Ga0495660_0104500	3300046810	Bacteria	1453
2122	Ga0495660_0108381	3300046810	Bacteria	1420
2123	Ga0495660_0175418	3300046810	Bacteria	1041
2124	Ga0495581_0001681	3300047315	Bacteria	12324
2125	Ga0495581_0168226	3300047315	Bacteria	1282
2126	Ga0495604_0003651	3300047317	Bacteria	12263
2127	Ga0495604_0004077	3300047317	Bacteria	11614
2128	Ga0495604_0057154	3300047317	Bacteria	3000
2129	Ga0495604_0064528	3300047317	Bacteria	2790
2130	Ga0495604_0079342	3300047317	Bacteria	2461
2131	Ga0495604_0257776	3300047317	Bacteria	1186
2132	Ga0495604_0404437	3300047317	Bacteria	898
2133	Ga0495636_0042821	3300047318	Bacteria	1882
2134	Ga0495636_0211778	3300047318	Bacteria	887
2135	Ga0495674_0008133	3300047319	Bacteria	10007
2136	Ga0495674_0025486	3300047319	Bacteria	5421
2137	Ga0495674_0038211	3300047319	Bacteria	4310
2138	Ga0495674_0050476	3300047319	Bacteria	3671
2139	Ga0495674_0058202	3300047319	Bacteria	3379
2140	Ga0495674_0162093	3300047319	Bacteria	1870
2141	Ga0495674_0180842	3300047319	Bacteria	1756
2142	Ga0495672_0000005	3300047320	Bacteria	593294
2143	Ga0495672_0002512	3300047320	Bacteria	16771
2144	Ga0495672_0004982	3300047320	Bacteria	10651
2145	Ga0495672_0057760	3300047320	Bacteria	2252
2146	Ga0495672_0136769	3300047320	Bacteria	1284
2147	Ga0495672_0138311	3300047320	Bacteria	1274
2148	Ga0495676_0012834	3300047321	Bacteria	7534
2149	Ga0495676_0040016	3300047321	Bacteria	3874
2150	Ga0495676_0042815	3300047321	Bacteria	3713
2151	Ga0495676_0079455	3300047321	Bacteria	2493
2152	Ga0495676_0086397	3300047321	Bacteria	2360
2153	Ga0495676_0363615	3300047321	Bacteria	965
2154	Ga0495680_0009587	3300047322	Bacteria	8698
2155	Ga0495680_0011461	3300047322	Bacteria	7849
2156	Ga0495680_0013518	3300047322	Bacteria	7118
2157	Ga0495680_0054836	3300047322	Bacteria	3093
2158	Ga0495680_0073705	3300047322	Bacteria	2594
2159	Ga0495680_0106328	3300047322	Bacteria	2085
2160	Ga0495680_0108373	3300047322	Bacteria	2061
2161	Ga0495680_0131421	3300047322	Bacteria	1839
2162	Ga0495680_0264549	3300047322	Bacteria	1216
2163	Ga0495683_0001290	3300047323	Bacteria	16939
2164	Ga0495683_0003262	3300047323	Bacteria	9479
2165	Ga0495683_0008621	3300047323	Bacteria	5446
2166	Ga0495683_0013122	3300047323	Bacteria	4338
2167	Ga0495683_0013822	3300047323	Bacteria	4213
2168	Ga0495683_0015323	3300047323	Bacteria	3991
2169	Ga0495683_0083025	3300047323	Bacteria	1560
2170	Ga0495683_0110068	3300047323	Bacteria	1315
2171	Ga0495687_000011	3300047443	Bacteria	397225
2172	Ga0495687_000161	3300047443	Bacteria	100635
2173	Ga0495687_008243	3300047443	Bacteria	5997
2174	Ga0495687_017129	3300047443	Bacteria	3625
2175	Ga0495687_022331	3300047443	Bacteria	3039
2176	Ga0495687_023163	3300047443	Bacteria	2970
2177	Ga0495675_0004950	3300047444	Bacteria	8115
2178	Ga0495675_0006753	3300047444	Bacteria	7036
2179	Ga0495675_0008340	3300047444	Bacteria	6414
2180	Ga0495675_0105070	3300047444	Bacteria	1765
2181	Ga0495675_0369768	3300047444	Bacteria	840
2182	Ga0495677_0000159	3300047445	Bacteria	32329
2183	Ga0495677_0034592	3300047445	Bacteria	1843
2184	Ga0495679_000109	3300047446	Bacteria	74134
2185	Ga0495679_001329	3300047446	Bacteria	14342
2186	Ga0495679_002198	3300047446	Bacteria	10186
2187	Ga0495679_009000	3300047446	Bacteria	4025
2188	Ga0495679_026951	3300047446	Bacteria	1901
2189	Ga0495679_061995	3300047446	Bacteria	1095
2190	Ga0495679_083896	3300047446	Bacteria	901
2191	Ga0495685_000337	3300047447	Bacteria	15070
2192	Ga0495673_0000166	3300047469	Bacteria	112730
2193	Ga0495673_0009082	3300047469	Bacteria	5524
2194	Ga0495673_0017809	3300047469	Bacteria	3595
2195	Ga0495673_0027225	3300047469	Bacteria	2723
2196	Ga0495673_0074581	3300047469	Bacteria	1419
2197	Ga0495681_0002756	3300047470	Bacteria	12440
2198	Ga0495681_0014372	3300047470	Bacteria	4541
2199	Ga0495681_0022078	3300047470	Bacteria	3414
2200	Ga0495681_0038570	3300047470	Bacteria	2340
2201	Ga0495681_0067578	3300047470	Bacteria	1628
2202	Ga0495684_0130192	3300047471	Bacteria	1890
2203	Ga0495684_0177522	3300047471	Bacteria	1580
2204	Ga0495684_0213557	3300047471	Bacteria	1417
2205	Ga0495684_0339072	3300047471	Bacteria	1070
2206	Ga0495686_0000014	3300047472	Bacteria	474014
2207	Ga0495686_0000240	3300047472	Bacteria	99258
2208	Ga0495686_0000336	3300047472	Bacteria	77282
2209	Ga0495686_0011137	3300047472	Bacteria	6350
2210	Ga0495686_0015577	3300047472	Bacteria	5185
2211	Ga0495686_0070664	3300047472	Bacteria	2150
2212	Ga0495686_0123456	3300047472	Bacteria	1541
2213	Ga0495686_0153789	3300047472	Bacteria	1349
2214	Ga0495686_0156325	3300047472	Bacteria	1335
2215	Ga0495686_0203076	3300047472	Bacteria	1136
2216	Ga0495593_0022587	3300047673	Bacteria	3503
2217	Ga0495593_0025711	3300047673	Bacteria	3257
2218	Ga0495593_0026717	3300047673	Bacteria	3184
2219	Ga0495593_0036264	3300047673	Bacteria	2674
2220	Ga0495593_0054746	3300047673	Bacteria	2102
2221	Ga0495593_0069601	3300047673	Bacteria	1829
2222	Ga0495593_0072986	3300047673	Bacteria	1780
2223	Ga0495593_0145392	3300047673	Bacteria	1200
2224	Ga0495602_0029648	3300048088	Bacteria	5203
2225	Ga0495602_0031305	3300048088	Bacteria	5031
2226	Ga0495602_0051795	3300048088	Bacteria	3652
2227	Ga0495602_0067827	3300048088	Bacteria	3066
2228	Ga0495602_0444940	3300048088	Bacteria	915
2229	Ga0495602_0446631	3300048088	Bacteria	913
2230	Ga0495602_0461722	3300048088	Bacteria	894
2231	Ga0495614_0000434	3300048089	Bacteria	17195
2232	Ga0495614_0025950	3300048089	Bacteria	2525
2233	Ga0495614_0045750	3300048089	Bacteria	1876
2234	Ga0495614_0048060	3300048089	Bacteria	1830
2235	Ga0495614_0075273	3300048089	Bacteria	1458
2236	Ga0495614_0116443	3300048089	Bacteria	1176
2237	Ga0495615_0034381	3300048090	Bacteria	1233
2238	Ga0495626_0009963	3300048091	Bacteria	5105
2239	Ga0495626_0010485	3300048091	Bacteria	4939
2240	Ga0495626_0013761	3300048091	Bacteria	4196
2241	Ga0495626_0018106	3300048091	Bacteria	3545
2242	Ga0495626_0028328	3300048091	Bacteria	2717
2243	Ga0495626_0046304	3300048091	Bacteria	2027
2244	Ga0495626_0059813	3300048091	Bacteria	1738
2245	Ga0496100_0008832	3300048903	Bacteria	5637
2246	Ga0496100_0110919	3300048903	Bacteria	1905
2247	Ga0496100_0113446	3300048903	Bacteria	1886
2248	Ga0496100_0134570	3300048903	Bacteria	1745
2249	Ga0496100_0157674	3300048903	Bacteria	1624
2250	Ga0496100_0186025	3300048903	Bacteria	1505
2251	Ga0496100_0275178	3300048903	Bacteria	1253
2252	Ga0496100_0289320	3300048903	Bacteria	1224
2253	Ga0496101_0002582	3300048904	Bacteria	11124
2254	Ga0496101_0002730	3300048904	Bacteria	10832
2255	Ga0496101_0016356	3300048904	Bacteria	5009
2256	Ga0496101_0078988	3300048904	Bacteria	2428
2257	Ga0496102_0000661	3300048905	Bacteria	34418
2258	Ga0496102_0003762	3300048905	Bacteria	12830
2259	Ga0496102_0027627	3300048905	Bacteria	5067
2260	Ga0496102_0028843	3300048905	Bacteria	4961
2261	Ga0496102_0119234	3300048905	Bacteria	2463
2262	Ga0496102_0223712	3300048905	Bacteria	1774
2263	Ga0496102_0253468	3300048905	Bacteria	1659
2264	Ga0496102_0361009	3300048905	Bacteria	1368
2265	Ga0496102_0367842	3300048905	Bacteria	1353
2266	Ga0496103_0005308	3300048906	Bacteria	7731
2267	Ga0496103_0006555	3300048906	Bacteria	6942
2268	Ga0496103_0077876	3300048906	Bacteria	2082
2269	Ga0496103_0083316	3300048906	Bacteria	2013
2270	Ga0496103_0380955	3300048906	Bacteria	906
2271	Ga0496104_0002687	3300048907	Bacteria	15314
2272	Ga0496104_0152220	3300048907	Bacteria	2220
2273	Ga0496104_0301114	3300048907	Bacteria	1515
2274	Ga0496104_0565938	3300048907	Bacteria	1047
2275	Ga0496105_0056758	3300048908	Bacteria	3232
2276	Ga0496105_0063144	3300048908	Bacteria	3056
2277	Ga0496105_0203481	3300048908	Bacteria	1616
2278	Ga0496105_0248038	3300048908	Bacteria	1443
2279	Ga0496105_0270314	3300048908	Bacteria	1373
2280	Ga0496105_0667884	3300048908	Bacteria	800
2281	Ga0496106_0007666	3300048909	Bacteria	7985
2282	Ga0496106_0136904	3300048909	Bacteria	1924
2283	Ga0496106_0142296	3300048909	Bacteria	1887
2284	Ga0496106_0239341	3300048909	Bacteria	1450
2285	Ga0496106_0567590	3300048909	Bacteria	910
2286	Ga0496107_0010382	3300048910	Bacteria	6471
2287	Ga0496107_0040410	3300048910	Bacteria	3348
2288	Ga0496107_0236263	3300048910	Bacteria	1360
2289	Ga0496108_0120800	3300048911	Bacteria	2247
2290	Ga0496108_0131094	3300048911	Bacteria	2155
2291	Ga0496108_0435502	3300048911	Bacteria	1145
2292	Ga0496108_0519211	3300048911	Bacteria	1040
2293	Ga0496108_0605824	3300048911	Bacteria	954
2294	Ga0496109_0141105	3300048912	Bacteria	2253
2295	Ga0496109_0179297	3300048912	Bacteria	1989
2296	Ga0496109_0357751	3300048912	Bacteria	1379
2297	Ga0496109_0540795	3300048912	Bacteria	1099
2298	Ga0496110_0030214	3300048913	Bacteria	4668
2299	Ga0496110_0050013	3300048913	Bacteria	3669
2300	Ga0496110_0198348	3300048913	Bacteria	1823
2301	Ga0496110_0368299	3300048913	Bacteria	1309
2302	Ga0496110_0386432	3300048913	Bacteria	1275
2303	Ga0496111_0073059	3300048914	Bacteria	2497
2304	Ga0496111_0110505	3300048914	Bacteria	2024
2305	Ga0496111_0112344	3300048914	Bacteria	2007
2306	Ga0496111_0125695	3300048914	Bacteria	1895
2307	Ga0496111_0241485	3300048914	Bacteria	1341
2308	Ga0496111_0529171	3300048914	Bacteria	866
2309	Ga0496112_0136175	3300048915	Bacteria	2426
2310	Ga0496113_0073295	3300048916	Bacteria	2608
2311	Ga0496114_0005374	3300048917	Bacteria	10016
2312	Ga0496114_0034471	3300048917	Bacteria	4177
2313	Ga0496114_0057390	3300048917	Bacteria	3250
2314	Ga0496114_0077684	3300048917	Bacteria	2799
2315	Ga0496114_0128222	3300048917	Bacteria	2189
2316	Ga0496114_0192982	3300048917	Bacteria	1782
2317	Ga0496114_0220663	3300048917	Bacteria	1664
2318	Ga0496114_0453386	3300048917	Bacteria	1136
2319	Ga0496115_0049418	3300048918	Bacteria	3367
2320	Ga0496115_0239005	3300048918	Bacteria	1497
2321	Ga0496115_0482456	3300048918	Bacteria	998
2322	Ga0496116_0002257	3300048919	Bacteria	20446
2323	Ga0496116_0004499	3300048919	Bacteria	13275
2324	Ga0496116_0008615	3300048919	Bacteria	8825
2325	Ga0496116_0013320	3300048919	Bacteria	6640
2326	Ga0496116_0017083	3300048919	Bacteria	5650
2327	Ga0496116_0026135	3300048919	Bacteria	4276
2328	Ga0496116_0028188	3300048919	Bacteria	4073
2329	Ga0496116_0090926	3300048919	Bacteria	1856
2330	Ga0496117_0000056	3300048920	Bacteria	271417
2331	Ga0496117_0000870	3300048920	Bacteria	46570
2332	Ga0496117_0007212	3300048920	Bacteria	10952
2333	Ga0496117_0010091	3300048920	Bacteria	8669
2334	Ga0496117_0018857	3300048920	Bacteria	5693
2335	Ga0496117_0027188	3300048920	Bacteria	4463
2336	Ga0496117_0043327	3300048920	Bacteria	3273
2337	Ga0496117_0055388	3300048920	Bacteria	2771
2338	Ga0496117_0057237	3300048920	Bacteria	2709
2339	Ga0496117_0068144	3300048920	Bacteria	2404
2340	Ga0496117_0098872	3300048920	Bacteria	1853
2341	Ga0496117_0146888	3300048920	Bacteria	1402
2342	Ga0496117_0179640	3300048920	Bacteria	1218
2343	Ga0496118_0000047	3300048921	Bacteria	271417
2344	Ga0496118_0005972	3300048921	Bacteria	13584
2345	Ga0496118_0008809	3300048921	Bacteria	10339
2346	Ga0496118_0013882	3300048921	Bacteria	7581
2347	Ga0496118_0014297	3300048921	Bacteria	7442
2348	Ga0496118_0022751	3300048921	Bacteria	5465
2349	Ga0496118_0037524	3300048921	Bacteria	3898
2350	Ga0496118_0038148	3300048921	Bacteria	3855
2351	Ga0496118_0063380	3300048921	Bacteria	2720
2352	Ga0496118_0067561	3300048921	Bacteria	2601
2353	Ga0496118_0075099	3300048921	Bacteria	2412
2354	Ga0496118_0140459	3300048921	Bacteria	1532
2355	Ga0496118_0226917	3300048921	Bacteria	1081
2356	Ga0496118_0271042	3300048921	Bacteria	951
2357	Ga0496120_0123083	3300048923	Bacteria	1338
2358	Ga0496121_0017999	3300048924	Bacteria	7159
2359	Ga0496121_0027352	3300048924	Bacteria	5338
2360	Ga0496121_0029861	3300048924	Bacteria	5023
2361	Ga0496121_0031139	3300048924	Bacteria	4882
2362	Ga0496121_0031220	3300048924	Bacteria	4872
2363	Ga0496121_0031409	3300048924	Bacteria	4852
2364	Ga0496121_0033530	3300048924	Bacteria	4645
2365	Ga0496121_0042351	3300048924	Bacteria	3962
2366	Ga0496121_0079343	3300048924	Bacteria	2606
2367	Ga0496121_0081049	3300048924	Bacteria	2570
2368	Ga0496121_0118423	3300048924	Bacteria	2004
2369	Ga0496121_0134452	3300048924	Bacteria	1844
2370	Ga0496121_0208086	3300048924	Bacteria	1388
2371	Ga0496121_0305963	3300048924	Bacteria	1076
2372	Ga0496121_0312140	3300048924	Bacteria	1062
2373	Ga0496122_0000317	3300048925	Bacteria	105883
2374	Ga0496122_0001889	3300048925	Bacteria	31699
2375	Ga0496122_0006768	3300048925	Bacteria	13040
2376	Ga0496122_0021375	3300048925	Bacteria	5795
2377	Ga0496122_0026404	3300048925	Bacteria	5007
2378	Ga0496122_0082332	3300048925	Bacteria	2236
2379	Ga0496122_0168349	3300048925	Bacteria	1325
2380	Ga0496122_0212546	3300048925	Bacteria	1119
2381	Ga0496122_0232964	3300048925	Bacteria	1045
2382	Ga0496123_0000264	3300048926	Bacteria	105015
2383	Ga0496123_0001035	3300048926	Bacteria	42221
2384	Ga0496123_0003718	3300048926	Bacteria	16784
2385	Ga0496123_0005043	3300048926	Bacteria	13508
2386	Ga0496123_0007413	3300048926	Bacteria	10343
2387	Ga0496123_0008663	3300048926	Bacteria	9299
2388	Ga0496123_0115607	3300048926	Bacteria	1522
2389	Ga0496123_0144085	3300048926	Bacteria	1297
2390	Ga0496123_0183896	3300048926	Bacteria	1088
2391	Ga0496123_0194923	3300048926	Bacteria	1044
2392	Ga0496123_0195566	3300048926	Bacteria	1042
2393	Ga0496124_0000273	3300048927	Bacteria	99505
2394	Ga0496124_0003745	3300048927	Bacteria	18320
2395	Ga0496124_0015990	3300048927	Bacteria	7161
2396	Ga0496124_0024341	3300048927	Bacteria	5509
2397	Ga0496124_0137867	3300048927	Bacteria	1929
2398	Ga0496124_0154682	3300048927	Bacteria	1795
2399	Ga0496124_0174442	3300048927	Bacteria	1661
2400	Ga0496125_0001627	3300048928	Bacteria	31652
2401	Ga0496125_0005367	3300048928	Bacteria	14295
2402	Ga0496125_0005937	3300048928	Bacteria	13381
2403	Ga0496125_0011361	3300048928	Bacteria	8915
2404	Ga0496125_0015249	3300048928	Bacteria	7438
2405	Ga0496125_0035265	3300048928	Bacteria	4393
2406	Ga0496125_0073868	3300048928	Bacteria	2648
2407	Ga0496125_0101081	3300048928	Bacteria	2123
2408	Ga0496125_0238469	3300048928	Bacteria	1157
2409	Ga0496126_0000088	3300048929	Bacteria	212256
2410	Ga0496126_0003165	3300048929	Bacteria	21194
2411	Ga0496126_0004283	3300048929	Bacteria	17159
2412	Ga0496126_0007888	3300048929	Bacteria	11593
2413	Ga0496126_0029341	3300048929	Bacteria	5226
2414	Ga0496126_0147082	3300048929	Bacteria	2022
2415	Ga0496126_0187178	3300048929	Bacteria	1755
2416	Ga0496126_0399186	3300048929	Bacteria	1116
2417	Ga0496126_0407036	3300048929	Bacteria	1102
2418	Ga0496126_0425384	3300048929	Bacteria	1073
2419	Ga0495678_001844	3300049459	Bacteria	15508
2420	Ga0495678_012028	3300049459	Bacteria	4118
2421	Ga0495678_014546	3300049459	Bacteria	3655
2422	Ga0495678_026548	3300049459	Bacteria	2470
2423	Ga0495678_043358	3300049459	Bacteria	1787
2424	Ga0495682_0004684	3300049460	Bacteria	5791
2425	Ga0495682_0008343	3300049460	Bacteria	4083
2426	Ga0495682_0018157	3300049460	Bacteria	2650
2427	Ga0495682_0019518	3300049460	Bacteria	2548
2428	Ga0495682_0055475	3300049460	Bacteria	1437
2429	Ga0501300_011112	3300049523	Bacteria	1313
2430	Ga0501314_013263	3300049530	Bacteria	797
2431	Ga0501031_0148665	3300049568	Bacteria	1531
2432	Ga0501032_0051940	3300049569	Bacteria	2763
2433	Ga0501033_0108673	3300049570	Bacteria	2020
2434	Ga0501033_0229546	3300049570	Bacteria	1319
2435	Ga0501033_0463526	3300049570	Bacteria	879
2436	Ga0501034_0001631	3300049571	Bacteria	29046
2437	Ga0501034_0001676	3300049571	Bacteria	28558
2438	Ga0501034_0028006	3300049571	Bacteria	5730
2439	Ga0501036_0054711	3300049572	Bacteria	3381
2440	Ga0501037_0006245	3300049573	Bacteria	8714
2441	Ga0501037_0043890	3300049573	Bacteria	3285
2442	Ga0501037_0059922	3300049573	Bacteria	2776
2443	Ga0501037_0176946	3300049573	Bacteria	1515
2444	Ga0501038_0014079	3300049574	Bacteria	7286
2445	Ga0501038_0048153	3300049574	Bacteria	3690
2446	Ga0501038_0104641	3300049574	Bacteria	2352
2447	Ga0501039_0014549	3300049575	Bacteria	6025
2448	Ga0501039_0029242	3300049575	Bacteria	4243
2449	Ga0501039_0227108	3300049575	Bacteria	1467
2450	Ga0501039_0362247	3300049575	Bacteria	1139
2451	Ga0501039_0392583	3300049575	Bacteria	1090
2452	Ga0501040_0006428	3300049576	Bacteria	7633
2453	Ga0501040_0041983	3300049576	Bacteria	3115
2454	Ga0501040_0044472	3300049576	Bacteria	3027
2455	Ga0501040_0098003	3300049576	Bacteria	2043
2456	Ga0501040_0135879	3300049576	Unclassified	1731
2457	Ga0501040_0478250	3300049576	Bacteria	897
2458	Ga0501041_0002581	3300049577	Bacteria	10334
2459	Ga0501041_0020473	3300049577	Bacteria	3956
2460	Ga0501041_0050257	3300049577	Bacteria	2540
2461	Ga0501041_0290940	3300049577	Bacteria	1029
2462	Ga0501042_0008536	3300049578	Bacteria	6770
2463	Ga0501042_0077425	3300049578	Bacteria	2381
2464	Ga0501042_0536414	3300049578	Bacteria	850
2465	Ga0501043_0038123	3300049579	Bacteria	3780
2466	Ga0501043_0253512	3300049579	Bacteria	1355
2467	Ga0501043_0274830	3300049579	Bacteria	1293
2468	Ga0501046_0056464	3300049580	Bacteria	3082
2469	Ga0501046_0075519	3300049580	Bacteria	2613
2470	Ga0501046_0082950	3300049580	Bacteria	2475
2471	Ga0501046_0320517	3300049580	Bacteria	1129
2472	Ga0501047_0037331	3300049581	Bacteria	4698
2473	Ga0501047_0078460	3300049581	Bacteria	3175
2474	Ga0501047_0192725	3300049581	Bacteria	1901
2475	Ga0501048_0078877	3300049582	Bacteria	2324
2476	Ga0501048_0090909	3300049582	Bacteria	2153
2477	Ga0501048_0286514	3300049582	Bacteria	1171
2478	Ga0501068_0117452	3300049584	Bacteria	1657
2479	Ga0501069_0049492	3300049585	Bacteria	2336
2480	Ga0501070_0009094	3300049586	Bacteria	8402
2481	Ga0501070_0014083	3300049586	Bacteria	6733
2482	Ga0501070_0070149	3300049586	Bacteria	2902
2483	Ga0501070_0072416	3300049586	Bacteria	2853
2484	Ga0501070_0350879	3300049586	Bacteria	1197
2485	Ga0501070_0498252	3300049586	Bacteria	979
2486	Ga0501071_0014842	3300049587	Bacteria	5336
2487	Ga0501071_0020988	3300049587	Bacteria	4546
2488	Ga0501071_0074361	3300049587	Bacteria	2479
2489	Ga0501071_0118217	3300049587	Bacteria	1964
2490	Ga0501071_0138462	3300049587	Bacteria	1812
2491	Ga0501071_0138561	3300049587	Bacteria	1811
2492	Ga0501072_0018660	3300049588	Bacteria	5347
2493	Ga0501072_0024005	3300049588	Bacteria	4741
2494	Ga0501072_0027112	3300049588	Bacteria	4470
2495	Ga0501072_0027786	3300049588	Bacteria	4414
2496	Ga0501072_0073156	3300049588	Bacteria	2710
2497	Ga0501072_0093811	3300049588	Bacteria	2384
2498	Ga0501073_0006814	3300049589	Bacteria	8496
2499	Ga0501073_0177549	3300049589	Bacteria	1474
2500	Ga0501073_0272425	3300049589	Bacteria	1168
2501	Ga0501074_0024606	3300049590	Bacteria	4375
2502	Ga0501074_0096559	3300049590	Bacteria	2116
2503	Ga0501075_0008024	3300049591	Bacteria	7338
2504	Ga0501075_0008928	3300049591	Bacteria	6994
2505	Ga0501075_0059609	3300049591	Bacteria	2875
2506	Ga0501075_0113159	3300049591	Bacteria	2063
2507	Ga0501075_0425349	3300049591	Bacteria	1013
2508	Ga0501076_0006925	3300049592	Bacteria	8235
2509	Ga0501076_0052164	3300049592	Bacteria	3240
2510	Ga0501076_0162172	3300049592	Bacteria	1821
2511	Ga0501076_0454637	3300049592	Bacteria	1054
2512	Ga0501076_0644208	3300049592	Bacteria	874
2513	Ga0501077_0019514	3300049593	Bacteria	4288
2514	Ga0501077_0029839	3300049593	Bacteria	3468
2515	Ga0501198_000009	3300049649	Bacteria	122302
2516	Ga0501198_038473	3300049649	Bacteria	822
2517	Ga0501199_005148	3300049650	Bacteria	1308
2518	Ga0501211_005096	3300049658	Bacteria	1322
2519	Ga0501222_000001	3300049662	Bacteria	307689
2520	Ga0501222_004534	3300049662	Bacteria	1887
2521	Ga0501223_009291	3300049663	Bacteria	1994
2522	Ga0501227_019055	3300049665	Bacteria	1562
2523	Ga0501249_004794	3300049679	Bacteria	2754
2524	Ga0501261_035841	3300049690	Bacteria	766
2525	Ga0501221_010594	3300049704	Bacteria	1641
2526	Ga0501229_005043	3300049706	Bacteria	1612
2527	Ga0501079_0001863	3300049741	Bacteria	15121
2528	Ga0501079_0005531	3300049741	Bacteria	9422
2529	Ga0501079_0057728	3300049741	Bacteria	2994
2530	Ga0501079_0172379	3300049741	Bacteria	1687
2531	Ga0501079_0689701	3300049741	Bacteria	804
2532	Ga0501080_0000702	3300049742	Bacteria	26939
2533	Ga0501080_0020804	3300049742	Bacteria	6074
2534	Ga0501080_0030757	3300049742	Bacteria	5002
2535	Ga0501080_0050396	3300049742	Bacteria	3875
2536	Ga0501080_0067450	3300049742	Bacteria	3327
2537	Ga0501080_0070855	3300049742	Bacteria	3242
2538	Ga0501080_0180115	3300049742	Bacteria	1945
2539	Ga0501080_0497143	3300049742	Bacteria	1090
2540	Ga0501080_0525873	3300049742	Bacteria	1055
2541	Ga0501081_0003496	3300049743	Bacteria	10044
2542	Ga0501081_0017180	3300049743	Bacteria	4785
2543	Ga0501081_0037338	3300049743	Bacteria	3314
2544	Ga0501081_0060829	3300049743	Bacteria	2617
2545	Ga0501081_0082361	3300049743	Bacteria	2254
2546	Ga0501081_0504343	3300049743	Bacteria	902
2547	Ga0501083_0037499	3300049744	Bacteria	3301
2548	Ga0501083_0319445	3300049744	Bacteria	1010
2549	Ga0501262_000188	3300049759	Bacteria	7690
2550	Ga0501262_002416	3300049759	Bacteria	2117
2551	Ga0501267_003431	3300049764	Bacteria	1444
2552	Ga0501279_011262	3300049775	Bacteria	1207
2553	Ga0501280_000216	3300049776	Bacteria	14425
2554	Ga0501282_002378	3300049778	Bacteria	2050
2555	Ga0501283_025486	3300049779	Bacteria	969
2556	Ga0501035_0013777	3300049822	Bacteria	7464
2557	Ga0501035_0108976	3300049822	Bacteria	2427
2558	Ga0501035_0485988	3300049822	Bacteria	1018
2559	Ga0501035_0512493	3300049822	Bacteria	986
2560	Ga0501044_0000059	3300049823	Bacteria	134132
2561	Ga0501044_0076202	3300049823	Bacteria	3405
2562	Ga0501044_0632605	3300049823	Bacteria	960
2563	Ga0501045_0113201	3300049824	Bacteria	2012
2564	Ga0501045_0188252	3300049824	Bacteria	1538
2565	nmdc:mga03683_20528_c2	3300050489	Bacteria	1661
2566	nmdc:mga03683_2201_c2	3300050489	Bacteria	5687
2567	nmdc:mga03683_49742_c1	3300050489	Bacteria	1746
2568	nmdc:mga03683_5149_c1	3300050489	Bacteria	4395
2569	nmdc:mga03683_6374_c1	3300050489	Bacteria	4035
2570	nmdc:mga03683_70388_c1	3300050489	Bacteria	1494
2571	nmdc:mga03683_7192_c1	3300050489	Bacteria	3853
2572	nmdc:mga03683_78429_c1	3300050489	Bacteria	1422
2573	nmdc:mga03683_92418_c1	3300050489	Bacteria	1321
2574	nmdc:mga03n38_16230_c1	3300050490	Bacteria	2894
2575	nmdc:mga03n38_65141_c1	3300050490	Bacteria	1670
2576	nmdc:mga03n38_66398_c1	3300050490	Bacteria	1657
2577	nmdc:mga03n38_66632_c1	3300050490	Bacteria	1655
2578	nmdc:mga00v17_3630_c1	3300050491	Bacteria	7974
2579	nmdc:mga00v17_55686_c1	3300050491	Bacteria	2416
2580	nmdc:mga00v17_68850_c1	3300050491	Bacteria	2188
2581	nmdc:mga00v17_71453_c1	3300050491	Bacteria	2151
2582	nmdc:mga0yw44_109204_c1	3300050492	Bacteria	1771
2583	nmdc:mga0yw44_178662_c1	3300050492	Bacteria	1396
2584	nmdc:mga0k408_108385_c1	3300050493	Bacteria	1641
2585	nmdc:mga0k408_128616_c1	3300050493	Bacteria	1503
2586	nmdc:mga0k408_13276_c1	3300050493	Bacteria	4513
2587	nmdc:mga0k408_160956_c1	3300050493	Bacteria	1337
2588	nmdc:mga0k408_21699_c1	3300050493	Bacteria	3609
2589	nmdc:mga0k408_4002_c1	3300050493	Bacteria	7816
2590	nmdc:mga0k408_47512_c1	3300050493	Bacteria	2481
2591	nmdc:mga0k408_49481_c1	3300050493	Bacteria	2433
2592	nmdc:mga0k408_57278_c1	3300050493	Bacteria	2262
2593	nmdc:mga0k408_65310_c1	3300050493	Bacteria	2118
2594	nmdc:mga0k408_6588_c1	3300050493	Bacteria	6187
2595	nmdc:mga0k408_80342_c1	3300050493	Bacteria	1908
2596	nmdc:mga06z11_10777_c1	3300050494	Bacteria	3911
2597	nmdc:mga06z11_305297_c1	3300050494	Bacteria	947
2598	nmdc:mga06z11_34173_c1	3300050494	Bacteria	2494
2599	nmdc:mga06z11_35814_c1	3300050494	Bacteria	2013
2600	nmdc:mga06z11_66264_c1	3300050494	Bacteria	1898
2601	nmdc:mga06z11_93122_c1	3300050494	Bacteria	1640
2602	nmdc:mga06z11_94301_c1	3300050494	Bacteria	1631
2603	nmdc:mga04h51_2462_c1	3300050495	Bacteria	4400
2604	nmdc:mga04h51_56993_c1	3300050495	Bacteria	1328
2605	nmdc:mga07m45_1005_c1	3300050496	Bacteria	12464
2606	nmdc:mga07m45_1322_c1	3300050496	Bacteria	11291
2607	nmdc:mga07m45_17508_c1	3300050496	Bacteria	3850
2608	nmdc:mga07m45_19020_c1	3300050496	Bacteria	3717
2609	nmdc:mga07m45_198507_c1	3300050496	Bacteria	1167
2610	nmdc:mga07m45_2098_c1	3300050496	Bacteria	9263
2611	nmdc:mga07m45_21894_c1	3300050496	Bacteria	3486
2612	nmdc:mga07m45_34165_c1	3300050496	Bacteria	2826
2613	nmdc:mga07m45_3985_c1	3300050496	Bacteria	7180
2614	nmdc:mga07m45_502_c1	3300050496	Bacteria	16574
2615	nmdc:mga07m45_51325_c1	3300050496	Bacteria	2326
2616	nmdc:mga07m45_52956_c1	3300050496	Bacteria	2293
2617	nmdc:mga07m45_58834_c1	3300050496	Bacteria	2174
2618	nmdc:mga07m45_70046_c1	3300050496	Bacteria	1995
2619	nmdc:mga07m45_76778_c1	3300050496	Bacteria	1905
2620	nmdc:mga05p37_378729_c1	3300050507	Bacteria	1659
2621	nmdc:mga05p37_51960_c1	3300050507	Bacteria	5040
2622	nmdc:mga09592_1720_c1	3300050508	Bacteria	17616
2623	nmdc:mga09592_27300_c1	3300050508	Bacteria	4737
2624	nmdc:mga09592_6607_c1	3300050508	Bacteria	9448
2625	nmdc:mga09592_753_c1	3300050508	Bacteria	24879
2626	nmdc:mga0qj67_16316_c1	3300050509	Bacteria	5630
2627	nmdc:mga0qj67_184136_c1	3300050509	Bacteria	1697
2628	nmdc:mga0qj67_21351_c1	3300050509	Bacteria	4967
2629	nmdc:mga0qj67_28165_c1	3300050509	Bacteria	4359
2630	nmdc:mga0qj67_84180_c1	3300050509	Bacteria	2550
2631	nmdc:mga0qj67_86934_c1	3300050509	Bacteria	2508
2632	nmdc:mga06r32_136863_c1	3300050510	Bacteria	2424
2633	nmdc:mga06r32_4702_c1	3300050510	Bacteria	12267
2634	nmdc:mga08y16_141210_c1	3300050511	Bacteria	2504
2635	nmdc:mga08y16_229513_c1	3300050511	Bacteria	1920
2636	nmdc:mga08y16_27822_c1	3300050511	Bacteria	5959
2637	nmdc:mga08y16_813_c1	3300050511	Bacteria	29890
2638	nmdc:mga0n895_1437941_c1	3300050512	Bacteria	657
2639	nmdc:mga0n895_370304_c1	3300050512	Bacteria	1450
2640	nmdc:mga0n895_673899_c1	3300050512	Bacteria	1031
2641	nmdc:mga0n895_837102_c1	3300050512	Bacteria	909
2642	nmdc:mga0rr50_21245_c1	3300050513	Bacteria	4427
2643	nmdc:mga0rr50_374617_c1	3300050513	Bacteria	1200
2644	nmdc:mga0rr50_51417_c1	3300050513	Bacteria	3057
2645	nmdc:mga08x19_131280_c1	3300050514	Bacteria	1685
2646	nmdc:mga08x19_207337_c1	3300050514	Bacteria	1345
2647	nmdc:mga08x19_49784_c1	3300050514	Bacteria	2688
2648	nmdc:mga08x19_55_c1	3300050514	Bacteria	120851
2649	nmdc:mga0a205_124786_c1	3300050515	Bacteria	2474
2650	nmdc:mga0a205_51010_c1	3300050515	Bacteria	3994
2651	nmdc:mga0a205_540230_c1	3300050515	Bacteria	1021
2652	nmdc:mga0sz30_15569_c1	3300050516	Bacteria	3007
2653	Ga0495601_0003165	3300053077	Bacteria	9428
2654	Ga0495601_0022068	3300053077	Bacteria	3906
2655	Ga0495601_0032123	3300053077	Bacteria	3266
2656	Ga0500610_0118470	3300053079	Bacteria	1355
2657	Ga0500610_0121786	3300053079	Bacteria	1333
2658	Ga0500635_0000137	3300053080	Bacteria	42016
2659	Ga0495619_0008316	3300053085	Bacteria	6560
2660	Ga0495619_0258775	3300053085	Bacteria	1206
2661	Ga0500578_0029698	3300053086	Bacteria	3512
2662	Ga0500643_008921	3300053087	Bacteria	3884
2663	Ga0500644_0003520	3300053088	Bacteria	3882
2664	Ga0500646_0028302	3300053090	Bacteria	1529
2665	Ga0500646_0130090	3300053090	Bacteria	817
2666	Ga0500651_0000157	3300053093	Bacteria	43590
2667	Ga0500651_0053585	3300053093	Bacteria	2529
2668	Ga0500651_0143889	3300053093	Bacteria	1435
2669	Ga0500641_0002189	3300053096	Bacteria	6920
2670	Ga0500650_0131739	3300053098	Bacteria	1162
2671	Ga0500571_040087	3300053110	Bacteria	2519
2672	Ga0500592_018307	3300053116	Bacteria	1124
2673	Ga0500593_002074	3300053117	Bacteria	7278
2674	Ga0500593_017189	3300053117	Bacteria	3142
2675	Ga0500594_0034026	3300053118	Bacteria	1358
2676	Ga0500595_110898	3300053119	Bacteria	780
2677	Ga0500607_024529	3300053121	Bacteria	3366
2678	Ga0500607_147162	3300053121	Bacteria	1098
2679	Ga0500608_044493	3300053122	Bacteria	2131
2680	Ga0500618_002180	3300053125	Bacteria	7680
2681	Ga0500621_142653	3300053126	Bacteria	907
2682	Ga0500628_025682	3300053129	Bacteria	1234
2683	Ga0500642_0013320	3300053130	Bacteria	3018
2684	Ga0500652_001291	3300053131	Bacteria	7933
2685	Ga0500655_003895	3300053133	Bacteria	2692
2686	Ga0500655_008316	3300053133	Bacteria	1867
2687	Ga0500658_0004924	3300053134	Bacteria	4982
2688	Ga0500658_0006791	3300053134	Bacteria	4232
2689	Ga0500658_0015713	3300053134	Bacteria	2813
2690	Ga0500559_0002776	3300053136	Bacteria	8864
2691	Ga0500559_0010151	3300053136	Bacteria	4051
2692	Ga0500559_0026633	3300053136	Bacteria	2464
2693	Ga0500561_0061691	3300053137	Bacteria	1052
2694	Ga0500568_0009066	3300053139	Bacteria	4746
2695	Ga0500568_0019333	3300053139	Bacteria	2962
2696	Ga0500568_0067711	3300053139	Bacteria	1371
2697	Ga0500573_0011721	3300053140	Bacteria	4912
2698	Ga0500574_038089	3300053141	Bacteria	1329
2699	Ga0500577_0119400	3300053142	Bacteria	1096
2700	Ga0500586_001375	3300053145	Bacteria	5121
2701	Ga0500616_0049064	3300053153	Bacteria	2235
2702	Ga0500622_0000530	3300053156	Bacteria	35364
2703	Ga0500622_0003050	3300053156	Bacteria	11576
2704	Ga0500622_0148329	3300053156	Bacteria	1111
2705	Ga0500624_015760	3300053157	Bacteria	1159
2706	Ga0500627_0015511	3300053158	Bacteria	2947
2707	Ga0500634_0020707	3300053161	Bacteria	3560
2708	Ga0500634_0115971	3300053161	Bacteria	1312
2709	Ga0500638_036619	3300053162	Bacteria	2379
2710	Ga0500636_0046449	3300053177	Bacteria	2560
2711	Ga0500645_000530	3300053730	Bacteria	25576
2712	Ga0500645_009421	3300053730	Bacteria	3280
2713	Ga0500645_018692	3300053730	Bacteria	2162
2714	Ga0500645_037748	3300053730	Bacteria	1434
2715	Ga0500596_018543	3300053735	Bacteria	1044
2716	Ga0501084_0029439	3300054114	Bacteria	4593
2717	Ga0501084_0064079	3300054114	Bacteria	3076
2718	Ga0501084_0110600	3300054114	Bacteria	2309
2719	Ga0501084_0321949	3300054114	Bacteria	1306
2720	Ga0501084_0586303	3300054114	Bacteria	942
2721	Ga0500661_002524	3300055283	Bacteria	3456
2722	Ga0590074_020651	3300059423	Bacteria	1133
2723	Ga0501082_0016576	3300060353	Bacteria	6344
2724	Ga0501082_0030878	3300060353	Bacteria	4619
2725	Ga0501082_0052129	3300060353	Bacteria	3527
2726	Ga0501082_0332667	3300060353	Bacteria	1323
2727	Ga0466962_0015206	3300061719	Bacteria	3711
2728	Ga0466962_0023534	3300061719	Bacteria	2960
2729	Ga0466962_0061622	3300061719	Bacteria	1790
2730	Ga0530510_0007214	3300061734	Bacteria	7735
2731	Ga0530510_0029339	3300061734	Bacteria	3948
2732	Ga0530510_0073953	3300061734	Bacteria	2474
2733	Ga0530510_0679755	3300061734	Unclassified	784

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300046507	Ga0495606_0357389	Ga0495606_0357389_20_595	189
2	3300003316	rootH1_10034976	rootH1_100349761	190
3	3300005327	Ga0070658_10070959	Ga0070658_100709595	190
4	3300005366	Ga0070659_100325450	Ga0070659_1003254502	190
5	3300005563	Ga0068855_100199007	Ga0068855_1001990074	190
6	3300025960	Ga0207651_10009479	Ga0207651_100094793	190
7	3300048918	Ga0496115_0482456	Ga0496115_0482456_241_816	190
8	3300053080	Ga0500635_0000137	Ga0500635_0000137_32343_32927	190
9	3300031548	Ga0307408_100671778	Ga0307408_1006717781	192
10	3300032002	Ga0307416_100363427	Ga0307416_1003634272	192
11	3300050512	nmdc:mga0n895_1437941_c1	nmdc:mga0n895_1437941_c1_14_619	193
12	3300035086	Ga0373934_0000369	Ga0373934_0000369_11943_12530	194
13	3300035117	Ga0373953_0030254	Ga0373953_0030254_506_1093	194
14	3300035118	Ga0373954_0329186	Ga0373954_0329186_131_718	194
15	3300035119	Ga0373956_0000006	Ga0373956_0000006_22419_23006	194
16	3300035120	Ga0373957_0001275	Ga0373957_0001275_1569_2156	194
17	3300035724	Ga0373933_0001076	Ga0373933_0001076_3807_4394	194
18	3300036401	Ga0373937_0000205	Ga0373937_0000205_45313_45900	194
19	3300046462	Ga0495651_0000589	Ga0495651_0000589_24775_25362	194
20	3300046511	Ga0495608_0276439	Ga0495608_0276439_122_709	194
21	3300046679	Ga0495623_0144980	Ga0495623_0144980_421_1008	194
22	3300050515	nmdc:mga0a205_124786_c1	nmdc:mga0a205_124786_c1_1094_1681	194
23	3300049823	Ga0501044_0632605	Ga0501044_0632605_12_602	196
24	3300035172	Ga0373955_0461727	Ga0373955_0461727_166_762	197
25	3300049587	Ga0501071_0118217	Ga0501071_0118217_1026_1688	197
26	3300050512	nmdc:mga0n895_673899_c1	nmdc:mga0n895_673899_c1_402_998	197
27	3300050514	nmdc:mga08x19_49784_c1	nmdc:mga08x19_49784_c1_470_1066	197
28	3300046524	Ga0495648_0013788	Ga0495648_0013788_36_638	198
29	3300049591	Ga0501075_0425349	Ga0501075_0425349_22_621	198
30	3300005327	Ga0070658_10017290	Ga0070658_100172905	199
31	3300005549	Ga0070704_100024510	Ga0070704_1000245102	199
32	3300006173	Ga0070716_100002165	Ga0070716_10000216510	199
33	3300006914	Ga0075436_100019841	Ga0075436_1000198416	199
34	3300025939	Ga0207665_10007944	Ga0207665_1000794410	199
35	3300044673	Ga0453683_0603782	Ga0453683_0603782_28_651	199
36	3300046454	Ga0495592_0000711	Ga0495592_0000711_2816_3418	199
37	3300046516	Ga0495628_0069910	Ga0495628_0069910_1679_2281	199
38	3300046529	Ga0495652_0006135	Ga0495652_0006135_1503_2105	199
39	3300046543	Ga0495645_0001397	Ga0495645_0001397_15103_15705	199
40	3300046678	Ga0495599_0000352	Ga0495599_0000352_3183_3785	199
41	3300047318	Ga0495636_0211778	Ga0495636_0211778_258_860	199
42	3300053077	Ga0495601_0022068	Ga0495601_0022068_1907_2509	199
43	3300005544	Ga0070686_100588718	Ga0070686_1005887181	200
44	3300005616	Ga0068852_100009555	Ga0068852_1000095557	200
45	3300005834	Ga0068851_10002342	Ga0068851_100023423	200
46	3300006237	Ga0097621_100089138	Ga0097621_1000891382	200
47	3300006847	Ga0075431_100000817	Ga0075431_10000081716	200
48	3300006880	Ga0075429_100003041	Ga0075429_1000030415	200
49	3300025321	Ga0207656_10002134	Ga0207656_100021342	200
50	3300025913	Ga0207695_10311643	Ga0207695_103116431	200
51	3300025924	Ga0207694_10358151	Ga0207694_103581512	200
52	3300025927	Ga0207687_10459143	Ga0207687_104591431	200
53	3300025941	Ga0207711_10068117	Ga0207711_100681174	200
54	3300026142	Ga0207698_10031568	Ga0207698_100315683	200
55	3300032002	Ga0307416_100185406	Ga0307416_1001854063	200
56	3300048925	Ga0496122_0212546	Ga0496122_0212546_414_1043	200
57	3300049649	Ga0501198_038473	Ga0501198_038473_196_798	200
58	3300025933	Ga0207706_10432687	Ga0207706_104326872	201
59	3300046542	Ga0495597_0003431	Ga0495597_0003431_33_644	201
60	3300031727	Ga0316576_10102572	Ga0316576_101025722	202
61	3300002705	JGI25156J39149_1024306	JGI25156J39149_10243061	203
62	3300003761	Ga0055535_1001544	Ga0055535_10015444	203
63	3300003763	Ga0055529_1000103	Ga0055529_100010388	203
64	3300025254	Ga0209148_1009205	Ga0209148_10092052	203
65	3300046518	Ga0495631_0002440	Ga0495631_0002440_56_673	203
66	3300046539	Ga0495621_0098236	Ga0495621_0098236_50_673	203
67	3300002705	JGI25156J39149_1001225	JGI25156J39149_100122511	204
68	3300002738	JGI25154J39366_1000806	JGI25154J39366_10008068	204
69	3300002741	JGI25157J39369_1000038	JGI25157J39369_100003818	204
70	3300003752	Ga0055539_1001512	Ga0055539_10015124	204
71	3300003752	Ga0055539_1003062	Ga0055539_10030624	204
72	3300003756	Ga0055533_1000026	Ga0055533_1000026197	204
73	3300003759	Ga0055525_1000783	Ga0055525_10007838	204
74	3300005339	Ga0070660_100198856	Ga0070660_1001988562	204
75	3300005539	Ga0068853_100200382	Ga0068853_1002003822	204
76	3300005543	Ga0070672_100137734	Ga0070672_1001377343	204
77	3300006353	Ga0075370_10002746	Ga0075370_100027465	204
78	3300025940	Ga0207691_10137651	Ga0207691_101376512	204
79	3300030521	Ga0307511_10081887	Ga0307511_100818873	204
80	3300031728	Ga0316578_10011059	Ga0316578_100110594	204
81	3300031733	Ga0316577_10219546	Ga0316577_102195461	204
82	3300035111	Ga0373923_0154171	Ga0373923_0154171_390_1016	204
83	3300044842	Ga0466957_0041291	Ga0466957_0041291_906_1535	204
84	3300046499	Ga0495594_0059238	Ga0495594_0059238_1012_1629	204
85	3300046506	Ga0495583_0000018	Ga0495583_0000018_26150_26767	204
86	3300046507	Ga0495606_0000870	Ga0495606_0000870_25634_26251	204
87	3300046616	Ga0495668_0030384	Ga0495668_0030384_328_945	204
88	3300046660	Ga0495625_0034643	Ga0495625_0034643_2443_3060	204
89	3300046794	Ga0495589_0012547	Ga0495589_0012547_2714_3331	204
90	3300047323	Ga0495683_0110068	Ga0495683_0110068_241_858	204
91	3300047444	Ga0495675_0369768	Ga0495675_0369768_134_763	204
92	3300050496	nmdc:mga07m45_502_c1	nmdc:mga07m45_502_c1_7717_8343	204
93	3300048913	Ga0496110_0368299	Ga0496110_0368299_559_1257	206
94	3300006844	Ga0075428_100810590	Ga0075428_1008105902	208
95	3300025933	Ga0207706_10262904	Ga0207706_102629042	208
96	3300039437	Ga0436365_0575929	Ga0436365_0575929_155_841	208
97	3300005458	Ga0070681_10109880	Ga0070681_101098802	210
98	3300025961	Ga0207712_10510679	Ga0207712_105106791	211
99	3300037418	Ga0395900_0110099	Ga0395900_0110099_2168_2809	211
100	3300005530	Ga0070679_100201503	Ga0070679_1002015032	212
101	3300005545	Ga0070695_100103007	Ga0070695_1001030071	212
102	3300005547	Ga0070693_100046476	Ga0070693_1000464763	212
103	3300005563	Ga0068855_100018523	Ga0068855_1000185238	212
104	3300005577	Ga0068857_100015708	Ga0068857_1000157083	212
105	3300005615	Ga0070702_100282970	Ga0070702_1002829702	212
106	3300005844	Ga0068862_100752271	Ga0068862_1007522711	212
107	3300009545	Ga0105237_10017534	Ga0105237_100175342	212
108	3300009553	Ga0105249_10166338	Ga0105249_101663383	212
109	3300010375	Ga0105239_10030442	Ga0105239_100304426	212
110	3300025914	Ga0207671_10102895	Ga0207671_101028952	212
111	3300025924	Ga0207694_10065460	Ga0207694_100654602	212
112	3300026078	Ga0207702_11145964	Ga0207702_111459641	212
113	3300026116	Ga0207674_10015715	Ga0207674_100157158	212
114	3300009551	Ga0105238_10227611	Ga0105238_102276112	213
115	3300005336	Ga0070680_100399234	Ga0070680_1003992342	215
116	3300005343	Ga0070687_100498676	Ga0070687_1004986761	215
117	3300005345	Ga0070692_10152695	Ga0070692_101526952	215
118	3300005545	Ga0070695_100423938	Ga0070695_1004239382	215
119	3300005549	Ga0070704_100408996	Ga0070704_1004089962	215
120	3300006844	Ga0075428_100013267	Ga0075428_1000132676	215
121	3300006847	Ga0075431_100230893	Ga0075431_1002308932	215
122	3300009147	Ga0114129_10098472	Ga0114129_100984724	215
123	3300013307	Ga0157372_10264130	Ga0157372_102641302	215
124	3300025917	Ga0207660_10291972	Ga0207660_102919722	215
125	3300026089	Ga0207648_10545081	Ga0207648_105450812	215
126	3300027360	Ga0209969_1000329	Ga0209969_10003294	215
127	3300027395	Ga0209996_1002812	Ga0209996_10028123	215
128	3300027462	Ga0210000_1003906	Ga0210000_10039062	215
129	3300027471	Ga0209995_1000645	Ga0209995_10006452	215
130	3300027526	Ga0209968_1002793	Ga0209968_10027933	215
131	3300027526	Ga0209968_1009217	Ga0209968_10092172	215
132	3300027682	Ga0209971_1000897	Ga0209971_10008973	215
133	3300027717	Ga0209998_10010214	Ga0209998_100102142	215
134	3300028380	Ga0268265_10743492	Ga0268265_107434921	215
135	3300035111	Ga0373923_0056450	Ga0373923_0056450_39_698	215
136	3300035117	Ga0373953_0062081	Ga0373953_0062081_415_1074	215
137	3300035118	Ga0373954_0000002	Ga0373954_0000002_35350_36009	215
138	3300035410	Ga0373924_0015810	Ga0373924_0015810_1798_2457	215
139	3300035724	Ga0373933_0001148	Ga0373933_0001148_8886_9545	215
140	3300036401	Ga0373937_0010865	Ga0373937_0010865_1571_2230	215
141	3300041408	Ga0439453_0002751	Ga0439453_0002751_1696_2352	215
142	3300042003	Ga0439443_004699	Ga0439443_004699_371_1027	215
143	3300042436	Ga0439435_0000860	Ga0439435_0000860_2683_3339	215
144	3300042437	Ga0439444_0015981	Ga0439444_0015981_365_1021	215
145	3300046675	Ga0495657_0146200	Ga0495657_0146200_98_757	215
146	3300049570	Ga0501033_0463526	Ga0501033_0463526_25_702	215
147	3300049574	Ga0501038_0048153	Ga0501038_0048153_2809_3465	215
148	3300049576	Ga0501040_0041983	Ga0501040_0041983_277_933	215
149	3300049577	Ga0501041_0020473	Ga0501041_0020473_1909_2565	215
150	3300049578	Ga0501042_0077425	Ga0501042_0077425_712_1368	215
151	3300049579	Ga0501043_0274830	Ga0501043_0274830_217_873	215
152	3300049580	Ga0501046_0320517	Ga0501046_0320517_445_1101	215
153	3300049582	Ga0501048_0090909	Ga0501048_0090909_1016_1672	215
154	3300049582	Ga0501048_0286514	Ga0501048_0286514_269_925	215
155	3300049587	Ga0501071_0020988	Ga0501071_0020988_592_1248	215
156	3300049588	Ga0501072_0027112	Ga0501072_0027112_3404_4060	215
157	3300049589	Ga0501073_0272425	Ga0501073_0272425_311_967	215
158	3300049591	Ga0501075_0008024	Ga0501075_0008024_3683_4339	215
159	3300049592	Ga0501076_0006925	Ga0501076_0006925_6050_6706	215
160	3300049593	Ga0501077_0029839	Ga0501077_0029839_1346_2002	215
161	3300049741	Ga0501079_0057728	Ga0501079_0057728_1754_2410	215
162	3300049741	Ga0501079_0689701	Ga0501079_0689701_53_709	215
163	3300049742	Ga0501080_0050396	Ga0501080_0050396_706_1362	215
164	3300049743	Ga0501081_0017180	Ga0501081_0017180_585_1241	215
165	3300049743	Ga0501081_0504343	Ga0501081_0504343_70_726	215
166	3300049824	Ga0501045_0113201	Ga0501045_0113201_964_1620	215
167	3300049824	Ga0501045_0188252	Ga0501045_0188252_377_1033	215
168	3300050507	nmdc:mga05p37_378729_c1	nmdc:mga05p37_378729_c1_379_1035	215
169	3300050509	nmdc:mga0qj67_184136_c1	nmdc:mga0qj67_184136_c1_616_1272	215
170	3300060353	Ga0501082_0030878	Ga0501082_0030878_3534_4190	215
171	3300061734	Ga0530510_0007214	Ga0530510_0007214_1867_2523	215
172	3300009094	Ga0111539_10003897	Ga0111539_100038973	216
173	3300014969	Ga0157376_10123035	Ga0157376_101230352	216
174	3300037068	Ga0373925_0760992	Ga0373925_0760992_12_671	216
175	3300049576	Ga0501040_0135879	Ga0501040_0135879_1064_1720	216
176	3300049587	Ga0501071_0138462	Ga0501071_0138462_360_1016	216
177	3300049822	Ga0501035_0485988	Ga0501035_0485988_27_683	216
178	3300050511	nmdc:mga08y16_27822_c1	nmdc:mga08y16_27822_c1_2042_2698	216
179	3300054114	Ga0501084_0321949	Ga0501084_0321949_68_724	216
180	3300061734	Ga0530510_0679755	Ga0530510_0679755_58_714	216
181	3300042876	Ga0451577_0594807	Ga0451577_0594807_250_984	217
182	3300049823	Ga0501044_0076202	Ga0501044_0076202_458_1159	217
183	3300006175	Ga0070712_100094913	Ga0070712_1000949132	218
184	3300027543	Ga0209999_1005198	Ga0209999_10051982	218
185	3300044693	Ga0466961_0033067	Ga0466961_0033067_1325_2038	218
186	3300046475	Ga0495639_0093102	Ga0495639_0093102_728_1396	218
187	3300046476	Ga0495662_0022140	Ga0495662_0022140_456_1124	218
188	3300046517	Ga0495630_0088481	Ga0495630_0088481_27_803	218
189	3300046533	Ga0495640_0018995	Ga0495640_0018995_495_1163	218
190	3300047318	Ga0495636_0042821	Ga0495636_0042821_546_1214	218
191	3300049779	Ga0501283_025486	Ga0501283_025486_218_886	218
192	3300006880	Ga0075429_100002986	Ga0075429_10000298613	219
193	3300025250	Ga0209026_1001990	Ga0209026_10019907	219
194	3300039438	Ga0436360_0929816	Ga0436360_0929816_3700_4425	219
195	3300050508	nmdc:mga09592_753_c1	nmdc:mga09592_753_c1_1816_2583	219
196	3300050509	nmdc:mga0qj67_84180_c1	nmdc:mga0qj67_84180_c1_123_890	219
197	3300042876	Ga0451577_0012834	Ga0451577_0012834_4261_4953	220
198	3300044712	Ga0453684_0001714	Ga0453684_0001714_4313_5005	220
199	3300046472	Ga0495580_0079536	Ga0495580_0079536_739_1416	220
200	3300046474	Ga0495605_0006574	Ga0495605_0006574_901_1602	220
201	3300046491	Ga0495584_0115008	Ga0495584_0115008_474_1175	220
202	3300046492	Ga0495585_0160645	Ga0495585_0160645_171_872	220
203	3300046500	Ga0495596_0007556	Ga0495596_0007556_87_788	220
204	3300046518	Ga0495631_0004517	Ga0495631_0004517_5755_6456	220
205	3300046522	Ga0495643_0006993	Ga0495643_0006993_5979_6680	220
206	3300046523	Ga0495644_0003859	Ga0495644_0003859_2871_3572	220
207	3300046528	Ga0495642_0053905	Ga0495642_0053905_292_993	220
208	3300046538	Ga0495609_0003487	Ga0495609_0003487_4822_5523	220
209	3300046557	Ga0495622_0057576	Ga0495622_0057576_252_953	220
210	3300046616	Ga0495668_0083453	Ga0495668_0083453_750_1451	220
211	3300046648	Ga0495611_0002366	Ga0495611_0002366_4772_5473	220
212	3300046794	Ga0495589_0102125	Ga0495589_0102125_12_713	220
213	3300047320	Ga0495672_0138311	Ga0495672_0138311_435_1136	220
214	3300047469	Ga0495673_0017809	Ga0495673_0017809_2581_3282	220
215	3300048091	Ga0495626_0010485	Ga0495626_0010485_2690_3391	220
216	3300049588	Ga0501072_0073156	Ga0501072_0073156_449_1168	220
217	iso_pu_bacteria	2839094727	2839099325	220
218	3300044683	Ga0466965_0009586	Ga0466965_0009586_508_1218	221
219	3300044712	Ga0453684_0023372	Ga0453684_0023372_1278_2033	221
220	3300045049	Ga0466959_0053715	Ga0466959_0053715_1983_2693	221
221	3300046501	Ga0495607_0074484	Ga0495607_0074484_229_948	221
222	3300046507	Ga0495606_0032246	Ga0495606_0032246_1763_2482	221
223	3300046538	Ga0495609_0059215	Ga0495609_0059215_318_1037	221
224	3300046810	Ga0495660_0000596	Ga0495660_0000596_21240_21959	221
225	3300005344	Ga0070661_100011585	Ga0070661_1000115854	222
226	3300005366	Ga0070659_100040351	Ga0070659_1000403513	222
227	3300025919	Ga0207657_10010952	Ga0207657_100109529	222
228	3300025986	Ga0207658_10127912	Ga0207658_101279122	222
229	3300027907	Ga0207428_10232748	Ga0207428_102327482	222
230	3300031727	Ga0316576_10163957	Ga0316576_101639572	222
231	3300031824	Ga0307413_10508827	Ga0307413_105088272	222
232	3300031901	Ga0307406_10314973	Ga0307406_103149731	222
233	3300031995	Ga0307409_100896743	Ga0307409_1008967431	222
234	3300037471	Ga0395905_0041744	Ga0395905_0041744_2465_3145	222
235	3300039062	Ga0400483_103888	Ga0400483_103888_257_946	222
236	3300044673	Ga0453683_0468595	Ga0453683_0468595_127_804	222
237	iso_pu_bacteria	2721755763	2723879429	222
238	3300003203	JGI25406J46586_10049226	JGI25406J46586_100492261	223
239	3300005331	Ga0070670_100000002	Ga0070670_100000002181	223
240	3300005335	Ga0070666_10102211	Ga0070666_101022112	223
241	3300005336	Ga0070680_100310628	Ga0070680_1003106282	223
242	3300005336	Ga0070680_100314760	Ga0070680_1003147602	223
243	3300005353	Ga0070669_100000774	Ga0070669_10000077424	223
244	3300005355	Ga0070671_100000023	Ga0070671_100000023101	223
245	3300005365	Ga0070688_100009510	Ga0070688_1000095101	223
246	3300005367	Ga0070667_100000018	Ga0070667_100000018180	223
247	3300005436	Ga0070713_100208834	Ga0070713_1002088342	223
248	3300005444	Ga0070694_100015912	Ga0070694_1000159126	223
249	3300005458	Ga0070681_10006361	Ga0070681_100063618	223
250	3300005466	Ga0070685_10000011	Ga0070685_1000001174	223
251	3300005518	Ga0070699_100006048	Ga0070699_1000060488	223
252	3300005530	Ga0070679_100478437	Ga0070679_1004784372	223
253	3300005536	Ga0070697_100497000	Ga0070697_1004970001	223
254	3300005544	Ga0070686_100437451	Ga0070686_1004374511	223
255	3300005545	Ga0070695_100033798	Ga0070695_1000337982	223
256	3300005545	Ga0070695_100037387	Ga0070695_1000373874	223
257	3300005546	Ga0070696_100047259	Ga0070696_1000472592	223
258	3300005548	Ga0070665_100039387	Ga0070665_1000393872	223
259	3300005617	Ga0068859_100005235	Ga0068859_1000052355	223
260	3300005843	Ga0068860_100001007	Ga0068860_1000010073	223
261	3300005844	Ga0068862_100002195	Ga0068862_1000021955	223
262	3300005985	Ga0081539_10000686	Ga0081539_1000068628	223
263	3300006852	Ga0075433_10120292	Ga0075433_101202922	223
264	3300006871	Ga0075434_100000011	Ga0075434_10000001175	223
265	3300006914	Ga0075436_100000048	Ga0075436_10000004829	223
266	3300006914	Ga0075436_100176839	Ga0075436_1001768392	223
267	3300006931	Ga0097620_100005235	Ga0097620_1000052355	223
268	3300007076	Ga0075435_100028979	Ga0075435_1000289792	223
269	3300009094	Ga0111539_10956705	Ga0111539_109567052	223
270	3300009101	Ga0105247_10220457	Ga0105247_102204571	223
271	3300014325	Ga0163163_10000132	Ga0163163_1000013213	223
272	3300014497	Ga0182008_10339451	Ga0182008_103394511	223
273	3300014968	Ga0157379_10303066	Ga0157379_103030661	223
274	3300025908	Ga0207643_10239969	Ga0207643_102399692	223
275	3300025912	Ga0207707_10008891	Ga0207707_100088916	223
276	3300025917	Ga0207660_10084864	Ga0207660_100848642	223
277	3300025917	Ga0207660_10247264	Ga0207660_102472642	223
278	3300025921	Ga0207652_10476282	Ga0207652_104762821	223
279	3300025941	Ga0207711_10002516	Ga0207711_100025164	223
280	3300026035	Ga0207703_10406382	Ga0207703_104063821	223
281	3300028379	Ga0268266_10005220	Ga0268266_100052203	223
282	3300028380	Ga0268265_10001161	Ga0268265_100011614	223
283	3300028381	Ga0268264_10000016	Ga0268264_10000016231	223
284	3300031247	Ga0265340_10027421	Ga0265340_100274212	223
285	3300031731	Ga0307405_10139696	Ga0307405_101396961	223
286	3300031911	Ga0307412_10304056	Ga0307412_103040562	223
287	3300032002	Ga0307416_100020224	Ga0307416_1000202242	223
288	3300035118	Ga0373954_0239151	Ga0373954_0239151_147_827	223
289	3300035119	Ga0373956_0034328	Ga0373956_0034328_546_1226	223
290	3300035692	Ga0373935_0014451	Ga0373935_0014451_2045_2725	223
291	3300035695	Ga0373927_0049334	Ga0373927_0049334_1713_2393	223
292	3300042003	Ga0439443_034235	Ga0439443_034235_55_735	223
293	3300044683	Ga0466965_0117696	Ga0466965_0117696_108_788	223
294	3300044706	Ga0466964_0160434	Ga0466964_0160434_261_941	223
295	3300045051	Ga0451576_0644792	Ga0451576_0644792_147_827	223
296	3300045976	Ga0466967_0192611	Ga0466967_0192611_209_889	223
297	3300046537	Ga0495598_0060516	Ga0495598_0060516_423_1103	223
298	3300048929	Ga0496126_0407036	Ga0496126_0407036_335_1036	223
299	3300050509	nmdc:mga0qj67_16316_c1	nmdc:mga0qj67_16316_c1_2934_3611	223
300	3300050512	nmdc:mga0n895_837102_c1	nmdc:mga0n895_837102_c1_155_835	223
301	3300050513	nmdc:mga0rr50_21245_c1	nmdc:mga0rr50_21245_c1_2649_3329	223
302	3300050513	nmdc:mga0rr50_374617_c1	nmdc:mga0rr50_374617_c1_507_1187	223
303	3300050514	nmdc:mga08x19_131280_c1	nmdc:mga08x19_131280_c1_697_1377	223
304	3300050514	nmdc:mga08x19_207337_c1	nmdc:mga08x19_207337_c1_539_1219	223
305	3300050514	nmdc:mga08x19_55_c1	nmdc:mga08x19_55_c1_110039_110719	223
306	3300050515	nmdc:mga0a205_51010_c1	nmdc:mga0a205_51010_c1_2598_3278	223
307	iso_pu_bacteria	2511231002	2511246456	223
308	3300003322	rootL2_10052331	rootL2_100523312	224
309	3300003794	Ga0055531_10000179	Ga0055531_1000017968	224
310	3300005336	Ga0070680_100440302	Ga0070680_1004403022	224
311	3300005337	Ga0070682_100045456	Ga0070682_1000454561	224
312	3300005364	Ga0070673_100104635	Ga0070673_1001046352	224
313	3300005458	Ga0070681_10137088	Ga0070681_101370881	224
314	3300005530	Ga0070679_100090249	Ga0070679_1000902492	224
315	3300005543	Ga0070672_100155240	Ga0070672_1001552402	224
316	3300005617	Ga0068859_100058580	Ga0068859_1000585804	224
317	3300006353	Ga0075370_10368608	Ga0075370_103686081	224
318	3300006931	Ga0097620_100058579	Ga0097620_1000585792	224
319	3300009174	Ga0105241_10718696	Ga0105241_107186962	224
320	3300013308	Ga0157375_10108862	Ga0157375_101088623	224
321	3300014325	Ga0163163_10161302	Ga0163163_101613023	224
322	3300014326	Ga0157380_10996175	Ga0157380_109961752	224
323	3300025917	Ga0207660_10107545	Ga0207660_101075452	224
324	3300025921	Ga0207652_10157693	Ga0207652_101576932	224
325	3300031344	Ga0265316_10120263	Ga0265316_101202632	224
326	3300031548	Ga0307408_100097508	Ga0307408_1000975082	224
327	3300031711	Ga0265314_10096523	Ga0265314_100965232	224
328	3300035398	Ga0316574_0233469	Ga0316574_0233469_438_1148	224
329	3300042137	Ga0450902_015962	Ga0450902_015962_502_1185	224
330	3300049568	Ga0501031_0148665	Ga0501031_0148665_88_768	224
331	3300049581	Ga0501047_0078460	Ga0501047_0078460_467_1141	224
332	3300049822	Ga0501035_0013777	Ga0501035_0013777_5974_6660	224
333	3300049823	Ga0501044_0000059	Ga0501044_0000059_17608_18294	224
334	3300053096	Ga0500641_0002189	Ga0500641_0002189_4237_4914	224
335	iso_pu_bacteria	2842747753	2842752834	224
336	3300005331	Ga0070670_100000001	Ga0070670_100000001108	225
337	3300005335	Ga0070666_10000278	Ga0070666_1000027814	225
338	3300005365	Ga0070688_100023257	Ga0070688_1000232572	225
339	3300005367	Ga0070667_100000181	Ga0070667_10000018113	225
340	3300005466	Ga0070685_10000002	Ga0070685_10000002152	225
341	3300005547	Ga0070693_100052030	Ga0070693_1000520304	225
342	3300005548	Ga0070665_100004037	Ga0070665_10000403718	225
343	3300005614	Ga0068856_100280149	Ga0068856_1002801492	225
344	3300005617	Ga0068859_100052357	Ga0068859_1000523573	225
345	3300005618	Ga0068864_100000006	Ga0068864_100000006110	225
346	3300005841	Ga0068863_100139283	Ga0068863_1001392833	225
347	3300005842	Ga0068858_100081348	Ga0068858_1000813482	225
348	3300005843	Ga0068860_100000294	Ga0068860_10000029441	225
349	3300005844	Ga0068862_100000156	Ga0068862_10000015644	225
350	3300006844	Ga0075428_100248657	Ga0075428_1002486572	225
351	3300006846	Ga0075430_100003577	Ga0075430_1000035776	225
352	3300006852	Ga0075433_10237879	Ga0075433_102378792	225
353	3300006931	Ga0097620_100052358	Ga0097620_1000523582	225
354	3300006931	Ga0097620_100171845	Ga0097620_1001718452	225
355	3300009093	Ga0105240_10087625	Ga0105240_100876251	225
356	3300009098	Ga0105245_10228342	Ga0105245_102283422	225
357	3300009098	Ga0105245_10434876	Ga0105245_104348762	225
358	3300009101	Ga0105247_10002331	Ga0105247_1000233116	225
359	3300009147	Ga0114129_10167312	Ga0114129_101673123	225
360	3300009177	Ga0105248_10000933	Ga0105248_1000093317	225
361	3300009177	Ga0105248_10071386	Ga0105248_100713862	225
362	3300009551	Ga0105238_10563736	Ga0105238_105637362	225
363	3300009553	Ga0105249_10020323	Ga0105249_100203236	225
364	3300013296	Ga0157374_10503019	Ga0157374_105030192	225
365	3300014325	Ga0163163_10000032	Ga0163163_10000032128	225
366	3300025900	Ga0207710_10010077	Ga0207710_100100773	225
367	3300025903	Ga0207680_10018502	Ga0207680_100185023	225
368	3300025922	Ga0207646_10290759	Ga0207646_102907592	225
369	3300025925	Ga0207650_10000002	Ga0207650_10000002787	225
370	3300025941	Ga0207711_10000140	Ga0207711_1000014050	225
371	3300025941	Ga0207711_10000204	Ga0207711_1000020411	225
372	3300025941	Ga0207711_10000253	Ga0207711_1000025311	225
373	3300025941	Ga0207711_10000273	Ga0207711_1000027329	225
374	3300025941	Ga0207711_10000621	Ga0207711_1000062111	225
375	3300025961	Ga0207712_10179014	Ga0207712_101790142	225
376	3300025986	Ga0207658_10000001	Ga0207658_10000001566	225
377	3300026088	Ga0207641_10000328	Ga0207641_100003289	225
378	3300026088	Ga0207641_10001944	Ga0207641_100019449	225
379	3300026095	Ga0207676_10000001	Ga0207676_10000001787	225
380	3300028379	Ga0268266_10003177	Ga0268266_100031771	225
381	3300028379	Ga0268266_10123533	Ga0268266_101235333	225
382	3300028380	Ga0268265_10000381	Ga0268265_1000038120	225
383	3300028381	Ga0268264_10000004	Ga0268264_10000004787	225
384	3300028381	Ga0268264_10460399	Ga0268264_104603992	225
385	3300031239	Ga0265328_10087393	Ga0265328_100873931	225
386	3300031250	Ga0265331_10008642	Ga0265331_100086423	225
387	3300031251	Ga0265327_10011118	Ga0265327_100111184	225
388	3300031727	Ga0316576_10004799	Ga0316576_1000479910	225
389	3300031911	Ga0307412_10175207	Ga0307412_101752072	225
390	3300032004	Ga0307414_10006829	Ga0307414_100068296	225
391	3300032005	Ga0307411_10005306	Ga0307411_100053067	225
392	3300035115	Ga0373941_0025646	Ga0373941_0025646_215_901	225
393	3300035398	Ga0316574_0205487	Ga0316574_0205487_114_800	225
394	3300036647	Ga0316582_0273091	Ga0316582_0273091_422_1120	225
395	3300036712	Ga0316584_0318411	Ga0316584_0318411_197_886	225
396	3300037068	Ga0373925_0282022	Ga0373925_0282022_375_1055	225
397	3300037312	Ga0395899_0003854	Ga0395899_0003854_2117_2806	225
398	3300037312	Ga0395899_0296423	Ga0395899_0296423_40_744	225
399	3300037418	Ga0395900_0001233	Ga0395900_0001233_29589_30293	225
400	3300037418	Ga0395900_0023649	Ga0395900_0023649_3047_3736	225
401	3300037466	Ga0395898_0001768	Ga0395898_0001768_27223_27927	225
402	3300037471	Ga0395905_0013850	Ga0395905_0013850_5448_6125	225
403	3300042001	Ga0439441_002975	Ga0439441_002975_1497_2195	225
404	3300042126	Ga0450888_000293	Ga0450888_000293_2420_3097	225
405	3300042137	Ga0450902_003065	Ga0450902_003065_485_1162	225
406	3300042435	Ga0439434_0078078	Ga0439434_0078078_164_865	225
407	3300042532	Ga0450893_0002140	Ga0450893_0002140_1970_2647	225
408	3300046528	Ga0495642_0070471	Ga0495642_0070471_158_844	225
409	3300046684	Ga0495669_0079593	Ga0495669_0079593_146_832	225
410	3300048908	Ga0496105_0248038	Ga0496105_0248038_225_905	225
411	3300048912	Ga0496109_0540795	Ga0496109_0540795_133_813	225
412	3300048914	Ga0496111_0241485	Ga0496111_0241485_301_981	225
413	3300048928	Ga0496125_0073868	Ga0496125_0073868_1523_2242	225
414	3300048929	Ga0496126_0187178	Ga0496126_0187178_296_1015	225
415	3300049523	Ga0501300_011112	Ga0501300_011112_189_866	225
416	3300049530	Ga0501314_013263	Ga0501314_013263_87_764	225
417	3300049575	Ga0501039_0227108	Ga0501039_0227108_106_792	225
418	3300049575	Ga0501039_0362247	Ga0501039_0362247_304_990	225
419	3300049576	Ga0501040_0478250	Ga0501040_0478250_144_830	225
420	3300049579	Ga0501043_0253512	Ga0501043_0253512_236_922	225
421	3300049587	Ga0501071_0074361	Ga0501071_0074361_1059_1745	225
422	3300049588	Ga0501072_0024005	Ga0501072_0024005_372_1058	225
423	3300049591	Ga0501075_0059609	Ga0501075_0059609_486_1172	225
424	3300049592	Ga0501076_0644208	Ga0501076_0644208_75_761	225
425	3300049650	Ga0501199_005148	Ga0501199_005148_456_1133	225
426	3300049658	Ga0501211_005096	Ga0501211_005096_494_1171	225
427	3300049662	Ga0501222_004534	Ga0501222_004534_724_1401	225
428	3300049663	Ga0501223_009291	Ga0501223_009291_376_1053	225
429	3300049690	Ga0501261_035841	Ga0501261_035841_37_714	225
430	3300049704	Ga0501221_010594	Ga0501221_010594_390_1067	225
431	3300049706	Ga0501229_005043	Ga0501229_005043_486_1163	225
432	3300049742	Ga0501080_0000702	Ga0501080_0000702_12722_13408	225
433	3300049744	Ga0501083_0319445	Ga0501083_0319445_98_784	225
434	3300049759	Ga0501262_002416	Ga0501262_002416_76_753	225
435	3300049764	Ga0501267_003431	Ga0501267_003431_318_995	225
436	3300050509	nmdc:mga0qj67_21351_c1	nmdc:mga0qj67_21351_c1_588_1274	225
437	3300050510	nmdc:mga06r32_136863_c1	nmdc:mga06r32_136863_c1_267_953	225
438	3300050511	nmdc:mga08y16_141210_c1	nmdc:mga08y16_141210_c1_352_1053	225
439	3300050515	nmdc:mga0a205_540230_c1	nmdc:mga0a205_540230_c1_98_799	225
440	3300054114	Ga0501084_0110600	Ga0501084_0110600_1481_2167	225
441	iso_pu_bacteria	2511231003	2511248777	225
442	iso_pu_bacteria	2513237150	2513954354	225
443	iso_pu_bacteria	2513237165	2514040954	225
444	iso_pu_bacteria	2547132103	2547372399	225
445	iso_pu_bacteria	2818991445	2819594813	225
446	iso_pu_bacteria	2838054893	2838060977	225
447	iso_pu_bacteria	2843690924	2843695441	225
448	iso_pu_bacteria	2860339153	2860341619	225
449	iso_pu_bacteria	2884811622	2884811691	225
450	iso_pu_bacteria	2884836552	2884841323	225
451	iso_pu_bacteria	2884852848	2884856197	225
452	iso_pu_bacteria	2885198086	2885199934	225
453	iso_pu_bacteria	2885211737	2885213545	225
454	iso_pu_bacteria	2896154374	2896156877	225
455	iso_pu_bacteria	2904541872	2904546471	225
456	iso_pu_bacteria	2919462493	2919463463	225
457	iso_pu_bacteria	2928037797	2928039819	225
458	iso_pu_bacteria	2928051484	2928058593	225
459	iso_pu_bacteria	2929160207	2929165916	225
460	iso_pu_bacteria	2931396565	2931397980	225
461	iso_pu_bacteria	639633007	639788633	225
462	iso_pu_bacteria	644736347	644748896	225
463	3300002773	JGI25152J39213_1008611	JGI25152J39213_10086113	226
464	3300003215	JGI25153J46596_10001554	JGI25153J46596_100015547	226
465	3300003215	JGI25153J46596_10002204	JGI25153J46596_100022042	226
466	3300003323	rootH1_10015799	rootH1_100157991	226
467	3300003771	Ga0055526_1008505	Ga0055526_10085053	226
468	3300005335	Ga0070666_10191338	Ga0070666_101913381	226
469	3300005543	Ga0070672_100994270	Ga0070672_1009942701	226
470	3300005578	Ga0068854_100188537	Ga0068854_1001885372	226
471	3300005617	Ga0068859_100172225	Ga0068859_1001722252	226
472	3300006042	Ga0075368_10033324	Ga0075368_100333242	226
473	3300006048	Ga0075363_100115188	Ga0075363_1001151882	226
474	3300006177	Ga0075362_10023972	Ga0075362_100239724	226
475	3300006178	Ga0075367_10079627	Ga0075367_100796272	226
476	3300006195	Ga0075366_10006979	Ga0075366_100069793	226
477	3300006195	Ga0075366_10218361	Ga0075366_102183612	226
478	3300006353	Ga0075370_10027442	Ga0075370_100274422	226
479	3300006931	Ga0097620_100172228	Ga0097620_1001722282	226
480	3300013296	Ga0157374_10084611	Ga0157374_100846112	226
481	3300014325	Ga0163163_10055871	Ga0163163_100558713	226
482	3300014326	Ga0157380_10185061	Ga0157380_101850613	226
483	3300015683	Ga0183362_10007	Ga0183362_10007138	226
484	3300025245	Ga0207425_1000196	Ga0207425_100019627	226
485	3300025258	Ga0209129_1000035	Ga0209129_100003528	226
486	3300025295	Ga0209564_1000024	Ga0209564_1000024222	226
487	3300025297	Ga0209758_1000558	Ga0209758_10005586	226
488	3300025297	Ga0209758_1001090	Ga0209758_100109026	226
489	3300025893	Ga0207682_10129087	Ga0207682_101290872	226
490	3300025907	Ga0207645_10088910	Ga0207645_100889102	226
491	3300025907	Ga0207645_10211371	Ga0207645_102113712	226
492	3300025935	Ga0207709_10123507	Ga0207709_101235072	226
493	3300025938	Ga0207704_10235691	Ga0207704_102356911	226
494	3300025940	Ga0207691_10088040	Ga0207691_100880402	226
495	3300027866	Ga0209813_10037502	Ga0209813_100375022	226
496	3300028786	Ga0307517_10127760	Ga0307517_101277602	226
497	3300028786	Ga0307517_10138433	Ga0307517_101384331	226
498	3300028794	Ga0307515_10000063	Ga0307515_1000006311	226
499	3300028794	Ga0307515_10259693	Ga0307515_102596932	226
500	3300031456	Ga0307513_10241848	Ga0307513_102418482	226
501	3300031548	Ga0307408_100052341	Ga0307408_1000523413	226
502	3300031548	Ga0307408_100110830	Ga0307408_1001108302	226
503	3300031691	Ga0316579_10000687	Ga0316579_100006874	226
504	3300031691	Ga0316579_10123055	Ga0316579_101230551	226
505	3300031730	Ga0307516_10089738	Ga0307516_100897381	226
506	3300031731	Ga0307405_10559301	Ga0307405_105593012	226
507	3300031901	Ga0307406_10114349	Ga0307406_101143492	226
508	3300032137	Ga0316585_10009273	Ga0316585_100092733	226
509	3300036401	Ga0373937_0041269	Ga0373937_0041269_1864_2547	226
510	3300036647	Ga0316582_0015765	Ga0316582_0015765_1673_2356	226
511	3300036647	Ga0316582_0020042	Ga0316582_0020042_1643_2329	226
512	3300036712	Ga0316584_0003219	Ga0316584_0003219_9784_10467	226
513	3300037588	Ga0316581_0001369	Ga0316581_0001369_4390_5076	226
514	3300037588	Ga0316581_0008003	Ga0316581_0008003_1222_1905	226
515	3300039062	Ga0400483_025561	Ga0400483_025561_265_954	226
516	3300042876	Ga0451577_0126587	Ga0451577_0126587_761_1444	226
517	3300046458	Ga0495591_018837	Ga0495591_018837_1498_2211	226
518	3300046459	Ga0495629_0289402	Ga0495629_0289402_324_1037	226
519	3300046523	Ga0495644_0006171	Ga0495644_0006171_3627_4340	226
520	3300046530	Ga0495654_0047789	Ga0495654_0047789_903_1616	226
521	3300046539	Ga0495621_0047271	Ga0495621_0047271_537_1250	226
522	3300046558	Ga0495633_0037323	Ga0495633_0037323_648_1361	226
523	3300046615	Ga0495656_0075482	Ga0495656_0075482_706_1419	226
524	3300046681	Ga0495647_0000261	Ga0495647_0000261_7387_8100	226
525	3300046683	Ga0495658_0068089	Ga0495658_0068089_1302_2015	226
526	3300046692	Ga0495671_0098945	Ga0495671_0098945_88_801	226
527	3300046794	Ga0495589_0123860	Ga0495589_0123860_420_1133	226
528	3300047322	Ga0495680_0073705	Ga0495680_0073705_1141_1824	226
529	3300047470	Ga0495681_0038570	Ga0495681_0038570_411_1124	226
530	3300048920	Ga0496117_0000870	Ga0496117_0000870_11716_12408	226
531	3300049586	Ga0501070_0498252	Ga0501070_0498252_243_929	226
532	iso_pu_bacteria	2588253510	2588290370	226
533	iso_pu_bacteria	2738541276	2738714476	226
534	iso_pu_bacteria	2738543018	2739275908	226
535	iso_pu_bacteria	2738543030	2739344952	226
536	3300002774	JGI25150J39212_1001600	JGI25150J39212_10016005	227
537	3300002987	JGI25159J45721_1001210	JGI25159J45721_10012107	227
538	3300003187	JGI25151J46595_10013403	JGI25151J46595_100134034	227
539	3300003187	JGI25151J46595_10018149	JGI25151J46595_100181492	227
540	3300003354	JGI25160J50197_1000122	JGI25160J50197_100012248	227
541	3300003354	JGI25160J50197_1035637	JGI25160J50197_10356371	227
542	3300003374	JGI25161J50226_1000021	JGI25161J50226_100002157	227
543	3300003771	Ga0055526_1003865	Ga0055526_10038656	227
544	3300003771	Ga0055526_1004127	Ga0055526_10041275	227
545	3300003773	Ga0055537_1000399	Ga0055537_100039914	227
546	3300003773	Ga0055537_1004404	Ga0055537_10044043	227
547	3300003775	Ga0055524_1000039	Ga0055524_100003996	227
548	3300003781	Ga0055536_1005814	Ga0055536_10058145	227
549	3300003784	Ga0055534_1000649	Ga0055534_100064916	227
550	3300003790	Ga0055528_1000517	Ga0055528_100051716	227
551	3300003791	Ga0055530_10001364	Ga0055530_1000136413	227
552	3300003792	Ga0055540_1000047	Ga0055540_100004786	227
553	3300003794	Ga0055531_10002477	Ga0055531_100024779	227
554	3300004625	Ga0055543_1000107	Ga0055543_100010765	227
555	3300005262	Ga0065165_1011702	Ga0065165_10117024	227
556	3300005328	Ga0070676_10050322	Ga0070676_100503223	227
557	3300005333	Ga0070677_10008659	Ga0070677_100086594	227
558	3300005333	Ga0070677_10021062	Ga0070677_100210622	227
559	3300005336	Ga0070680_100207165	Ga0070680_1002071652	227
560	3300005336	Ga0070680_100286276	Ga0070680_1002862761	227
561	3300005337	Ga0070682_100388402	Ga0070682_1003884022	227
562	3300005338	Ga0068868_100023163	Ga0068868_1000231632	227
563	3300005338	Ga0068868_100084267	Ga0068868_1000842671	227
564	3300005344	Ga0070661_100014151	Ga0070661_1000141513	227
565	3300005353	Ga0070669_100053480	Ga0070669_1000534802	227
566	3300005354	Ga0070675_100001142	Ga0070675_10000114218	227
567	3300005355	Ga0070671_100070394	Ga0070671_1000703941	227
568	3300005355	Ga0070671_100210614	Ga0070671_1002106142	227
569	3300005355	Ga0070671_100503188	Ga0070671_1005031881	227
570	3300005356	Ga0070674_100122309	Ga0070674_1001223092	227
571	3300005356	Ga0070674_100515967	Ga0070674_1005159671	227
572	3300005364	Ga0070673_100021682	Ga0070673_1000216823	227
573	3300005367	Ga0070667_100620101	Ga0070667_1006201011	227
574	3300005436	Ga0070713_100002610	Ga0070713_1000026103	227
575	3300005437	Ga0070710_10121112	Ga0070710_101211122	227
576	3300005439	Ga0070711_100426892	Ga0070711_1004268921	227
577	3300005444	Ga0070694_100007242	Ga0070694_1000072426	227
578	3300005444	Ga0070694_100064215	Ga0070694_1000642153	227
579	3300005455	Ga0070663_100362043	Ga0070663_1003620432	227
580	3300005456	Ga0070678_100262398	Ga0070678_1002623982	227
581	3300005456	Ga0070678_100358706	Ga0070678_1003587062	227
582	3300005457	Ga0070662_100146445	Ga0070662_1001464452	227
583	3300005458	Ga0070681_10005152	Ga0070681_1000515210	227
584	3300005459	Ga0068867_100039288	Ga0068867_1000392884	227
585	3300005459	Ga0068867_100055869	Ga0068867_1000558693	227
586	3300005459	Ga0068867_100111816	Ga0068867_1001118163	227
587	3300005536	Ga0070697_100001878	Ga0070697_10000187811	227
588	3300005539	Ga0068853_100015329	Ga0068853_1000153297	227
589	3300005543	Ga0070672_100027555	Ga0070672_1000275553	227
590	3300005547	Ga0070693_100018797	Ga0070693_1000187973	227
591	3300005548	Ga0070665_100447037	Ga0070665_1004470371	227
592	3300005549	Ga0070704_100021568	Ga0070704_1000215684	227
593	3300005549	Ga0070704_100026759	Ga0070704_1000267593	227
594	3300005564	Ga0070664_100245338	Ga0070664_1002453382	227
595	3300005564	Ga0070664_100493559	Ga0070664_1004935592	227
596	3300005577	Ga0068857_100221346	Ga0068857_1002213462	227
597	3300005578	Ga0068854_100165833	Ga0068854_1001658333	227
598	3300005578	Ga0068854_100330537	Ga0068854_1003305372	227
599	3300005614	Ga0068856_100197908	Ga0068856_1001979083	227
600	3300005615	Ga0070702_100019738	Ga0070702_1000197384	227
601	3300005618	Ga0068864_100130397	Ga0068864_1001303971	227
602	3300005718	Ga0068866_10174665	Ga0068866_101746652	227
603	3300005840	Ga0068870_10015252	Ga0068870_100152522	227
604	3300005985	Ga0081539_10114676	Ga0081539_101146762	227
605	3300006028	Ga0070717_10015243	Ga0070717_100152433	227
606	3300006038	Ga0075365_10112714	Ga0075365_101127144	227
607	3300006038	Ga0075365_10347973	Ga0075365_103479732	227
608	3300006042	Ga0075368_10007224	Ga0075368_100072242	227
609	3300006048	Ga0075363_100013364	Ga0075363_1000133644	227
610	3300006048	Ga0075363_100237905	Ga0075363_1002379051	227
611	3300006051	Ga0075364_10092354	Ga0075364_100923542	227
612	3300006175	Ga0070712_100249017	Ga0070712_1002490172	227
613	3300006177	Ga0075362_10040268	Ga0075362_100402682	227
614	3300006177	Ga0075362_10063106	Ga0075362_100631062	227
615	3300006178	Ga0075367_10011437	Ga0075367_100114372	227
616	3300006186	Ga0075369_10106133	Ga0075369_101061332	227
617	3300006195	Ga0075366_10026556	Ga0075366_100265563	227
618	3300006195	Ga0075366_10081597	Ga0075366_100815972	227
619	3300006237	Ga0097621_100066894	Ga0097621_1000668944	227
620	3300006353	Ga0075370_10001288	Ga0075370_100012887	227
621	3300006353	Ga0075370_10068461	Ga0075370_100684611	227
622	3300006358	Ga0068871_100005051	Ga0068871_1000050519	227
623	3300006871	Ga0075434_100223306	Ga0075434_1002233062	227
624	3300006914	Ga0075436_100153259	Ga0075436_1001532592	227
625	3300007076	Ga0075435_100050006	Ga0075435_1000500062	227
626	3300007076	Ga0075435_100222984	Ga0075435_1002229841	227
627	3300007265	Ga0099794_10047118	Ga0099794_100471182	227
628	3300007788	Ga0099795_10066637	Ga0099795_100666372	227
629	3300009094	Ga0111539_10202028	Ga0111539_102020282	227
630	3300009148	Ga0105243_10000415	Ga0105243_1000041530	227
631	3300009174	Ga0105241_10415706	Ga0105241_104157061	227
632	3300009176	Ga0105242_10028289	Ga0105242_100282894	227
633	3300009177	Ga0105248_10595375	Ga0105248_105953751	227
634	3300010375	Ga0105239_10318305	Ga0105239_103183052	227
635	3300012513	Ga0157326_1002135	Ga0157326_10021352	227
636	3300013104	Ga0157370_10116723	Ga0157370_101167233	227
637	3300013296	Ga0157374_10210186	Ga0157374_102101862	227
638	3300013297	Ga0157378_10345802	Ga0157378_103458022	227
639	3300013297	Ga0157378_10372070	Ga0157378_103720701	227
640	3300013306	Ga0163162_10210889	Ga0163162_102108892	227
641	3300013307	Ga0157372_10114126	Ga0157372_101141262	227
642	3300013308	Ga0157375_10283866	Ga0157375_102838662	227
643	3300014969	Ga0157376_10013277	Ga0157376_100132772	227
644	3300014969	Ga0157376_10063591	Ga0157376_100635912	227
645	3300017792	Ga0163161_10017896	Ga0163161_100178962	227
646	3300021384	Ga0213876_10156627	Ga0213876_101566272	227
647	3300025208	Ga0209436_103173	Ga0209436_1031733	227
648	3300025245	Ga0207425_1002051	Ga0207425_100205110	227
649	3300025245	Ga0207425_1003998	Ga0207425_10039983	227
650	3300025258	Ga0209129_1004470	Ga0209129_10044705	227
651	3300025258	Ga0209129_1027372	Ga0209129_10273721	227
652	3300025263	Ga0209565_1000080	Ga0209565_100008091	227
653	3300025263	Ga0209565_1000797	Ga0209565_10007972	227
654	3300025273	Ga0209673_1000088	Ga0209673_100008855	227
655	3300025284	Ga0209130_1000103	Ga0209130_1000103107	227
656	3300025284	Ga0209130_1000238	Ga0209130_100023836	227
657	3300025284	Ga0209130_1032987	Ga0209130_10329871	227
658	3300025291	Ga0209675_1000209	Ga0209675_100020942	227
659	3300025291	Ga0209675_1004221	Ga0209675_10042212	227
660	3300025291	Ga0209675_1012417	Ga0209675_10124172	227
661	3300025292	Ga0209676_1000073	Ga0209676_1000073165	227
662	3300025292	Ga0209676_1002083	Ga0209676_10020838	227
663	3300025294	Ga0209025_1001808	Ga0209025_10018087	227
664	3300025294	Ga0209025_1005621	Ga0209025_10056214	227
665	3300025294	Ga0209025_1010341	Ga0209025_10103418	227
666	3300025294	Ga0209025_1102363	Ga0209025_11023631	227
667	3300025295	Ga0209564_1002539	Ga0209564_10025396	227
668	3300025295	Ga0209564_1003242	Ga0209564_10032425	227
669	3300025295	Ga0209564_1012742	Ga0209564_10127422	227
670	3300025297	Ga0209758_1010892	Ga0209758_10108922	227
671	3300025298	Ga0209050_1000008	Ga0209050_1000008898	227
672	3300025298	Ga0209050_1003947	Ga0209050_10039472	227
673	3300025298	Ga0209050_1005186	Ga0209050_10051862	227
674	3300025299	Ga0209256_1000096	Ga0209256_1000096152	227
675	3300025299	Ga0209256_1017398	Ga0209256_10173982	227
676	3300025302	Ga0207426_1000407	Ga0207426_100040751	227
677	3300025302	Ga0207426_1001678	Ga0207426_10016787	227
678	3300025303	Ga0209051_1000005	Ga0209051_1000005898	227
679	3300025304	Ga0209257_1000031	Ga0209257_1000031488	227
680	3300025304	Ga0209257_1005598	Ga0209257_10055988	227
681	3300025315	Ga0207697_10004738	Ga0207697_100047386	227
682	3300025893	Ga0207682_10006734	Ga0207682_100067344	227
683	3300025898	Ga0207692_10023093	Ga0207692_100230932	227
684	3300025903	Ga0207680_10160682	Ga0207680_101606822	227
685	3300025907	Ga0207645_10035578	Ga0207645_100355784	227
686	3300025907	Ga0207645_10059401	Ga0207645_100594013	227
687	3300025915	Ga0207693_10202324	Ga0207693_102023242	227
688	3300025916	Ga0207663_10031875	Ga0207663_100318753	227
689	3300025917	Ga0207660_10069423	Ga0207660_100694232	227
690	3300025920	Ga0207649_10036877	Ga0207649_100368772	227
691	3300025920	Ga0207649_10199178	Ga0207649_101991782	227
692	3300025922	Ga0207646_10254222	Ga0207646_102542222	227
693	3300025923	Ga0207681_10045019	Ga0207681_100450193	227
694	3300025925	Ga0207650_10001270	Ga0207650_1000127013	227
695	3300025926	Ga0207659_10052239	Ga0207659_100522393	227
696	3300025927	Ga0207687_10452675	Ga0207687_104526752	227
697	3300025928	Ga0207700_10029879	Ga0207700_100298792	227
698	3300025931	Ga0207644_10046289	Ga0207644_100462894	227
699	3300025933	Ga0207706_10229875	Ga0207706_102298752	227
700	3300025934	Ga0207686_10019941	Ga0207686_100199412	227
701	3300025935	Ga0207709_10001888	Ga0207709_100018881	227
702	3300025937	Ga0207669_10043523	Ga0207669_100435233	227
703	3300025937	Ga0207669_10092337	Ga0207669_100923372	227
704	3300025938	Ga0207704_10257919	Ga0207704_102579192	227
705	3300025938	Ga0207704_10562912	Ga0207704_105629122	227
706	3300025940	Ga0207691_10001429	Ga0207691_1000142918	227
707	3300025942	Ga0207689_10034153	Ga0207689_100341534	227
708	3300025945	Ga0207679_10079356	Ga0207679_100793563	227
709	3300025945	Ga0207679_10631160	Ga0207679_106311602	227
710	3300025960	Ga0207651_10006363	Ga0207651_100063635	227
711	3300026023	Ga0207677_10137902	Ga0207677_101379023	227
712	3300026023	Ga0207677_10176914	Ga0207677_101769142	227
713	3300026041	Ga0207639_10030642	Ga0207639_100306423	227
714	3300026067	Ga0207678_10340700	Ga0207678_103407002	227
715	3300026067	Ga0207678_10560826	Ga0207678_105608261	227
716	3300026078	Ga0207702_10789895	Ga0207702_107898951	227
717	3300026089	Ga0207648_10088066	Ga0207648_100880663	227
718	3300026089	Ga0207648_10093990	Ga0207648_100939903	227
719	3300026089	Ga0207648_10253533	Ga0207648_102535332	227
720	3300026095	Ga0207676_10120661	Ga0207676_101206611	227
721	3300026116	Ga0207674_10241653	Ga0207674_102416532	227
722	3300026121	Ga0207683_10020556	Ga0207683_100205562	227
723	3300027671	Ga0209588_1013316	Ga0209588_10133163	227
724	3300027671	Ga0209588_1021995	Ga0209588_10219952	227
725	3300027866	Ga0209813_10002262	Ga0209813_100022622	227
726	3300027866	Ga0209813_10036265	Ga0209813_100362652	227
727	3300028380	Ga0268265_10722061	Ga0268265_107220612	227
728	3300031456	Ga0307513_10000653	Ga0307513_1000065323	227
729	3300031548	Ga0307408_100013506	Ga0307408_1000135064	227
730	3300031901	Ga0307406_10005175	Ga0307406_100051756	227
731	3300031995	Ga0307409_100157378	Ga0307409_1001573782	227
732	3300032002	Ga0307416_100094276	Ga0307416_1000942762	227
733	3300032004	Ga0307414_10546170	Ga0307414_105461701	227
734	3300032005	Ga0307411_10258250	Ga0307411_102582502	227
735	3300035086	Ga0373934_0002073	Ga0373934_0002073_4810_5496	227
736	3300035113	Ga0373936_0124612	Ga0373936_0124612_392_1078	227
737	3300035118	Ga0373954_0009026	Ga0373954_0009026_1178_1864	227
738	3300035118	Ga0373954_0012500	Ga0373954_0012500_204_890	227
739	3300035118	Ga0373954_0016225	Ga0373954_0016225_240_929	227
740	3300035119	Ga0373956_0034465	Ga0373956_0034465_134_820	227
741	3300035119	Ga0373956_0067256	Ga0373956_0067256_419_1105	227
742	3300035119	Ga0373956_0211205	Ga0373956_0211205_134_820	227
743	3300035120	Ga0373957_0079247	Ga0373957_0079247_508_1194	227
744	3300035120	Ga0373957_0190847	Ga0373957_0190847_101_787	227
745	3300035172	Ga0373955_0027701	Ga0373955_0027701_2113_2799	227
746	3300035172	Ga0373955_0131523	Ga0373955_0131523_182_868	227
747	3300035172	Ga0373955_0195149	Ga0373955_0195149_134_820	227
748	3300035398	Ga0316574_0261603	Ga0316574_0261603_223_918	227
749	3300035410	Ga0373924_0062866	Ga0373924_0062866_362_1048	227
750	3300035695	Ga0373927_0089958	Ga0373927_0089958_1288_1974	227
751	3300035724	Ga0373933_0078549	Ga0373933_0078549_1002_1691	227
752	3300035724	Ga0373933_0142558	Ga0373933_0142558_775_1461	227
753	3300035724	Ga0373933_0492096	Ga0373933_0492096_26_712	227
754	3300035725	Ga0373947_0152036	Ga0373947_0152036_73_759	227
755	3300036401	Ga0373937_0294429	Ga0373937_0294429_730_1416	227
756	3300037068	Ga0373925_0023324	Ga0373925_0023324_180_866	227
757	3300041408	Ga0439453_0039779	Ga0439453_0039779_63_746	227
758	3300041512	Ga0451853_0206750	Ga0451853_0206750_58_759	227
759	3300042438	Ga0439459_0023362	Ga0439459_0023362_261_962	227
760	3300044684	Ga0466966_0371406	Ga0466966_0371406_161_844	227
761	3300046454	Ga0495592_0077143	Ga0495592_0077143_571_1311	227
762	3300046459	Ga0495629_0084527	Ga0495629_0084527_985_1671	227
763	3300046463	Ga0495653_0011660	Ga0495653_0011660_1409_2095	227
764	3300046463	Ga0495653_0104455	Ga0495653_0104455_720_1406	227
765	3300046473	Ga0495582_0059851	Ga0495582_0059851_820_1506	227
766	3300046475	Ga0495639_0015266	Ga0495639_0015266_1923_2609	227
767	3300046476	Ga0495662_0008483	Ga0495662_0008483_3029_3715	227
768	3300046477	Ga0495664_0006606	Ga0495664_0006606_4472_5158	227
769	3300046514	Ga0495618_0306688	Ga0495618_0306688_122_808	227
770	3300046516	Ga0495628_0179592	Ga0495628_0179592_784_1470	227
771	3300046517	Ga0495630_0229714	Ga0495630_0229714_416_1102	227
772	3300046517	Ga0495630_0587904	Ga0495630_0587904_127_813	227
773	3300046526	Ga0495666_0048356	Ga0495666_0048356_1167_1853	227
774	3300046529	Ga0495652_0055823	Ga0495652_0055823_1757_2443	227
775	3300046529	Ga0495652_0292309	Ga0495652_0292309_356_1096	227
776	3300046531	Ga0495665_0052260	Ga0495665_0052260_69_755	227
777	3300046533	Ga0495640_0210708	Ga0495640_0210708_490_1176	227
778	3300046535	Ga0495586_0009305	Ga0495586_0009305_2199_2885	227
779	3300046535	Ga0495586_0192978	Ga0495586_0192978_243_929	227
780	3300046557	Ga0495622_0215337	Ga0495622_0215337_22_708	227
781	3300046559	Ga0495667_0010270	Ga0495667_0010270_4982_5668	227
782	3300046559	Ga0495667_0191193	Ga0495667_0191193_508_1194	227
783	3300046663	Ga0495635_0028794	Ga0495635_0028794_831_1517	227
784	3300046678	Ga0495599_0016212	Ga0495599_0016212_1998_2684	227
785	3300046683	Ga0495658_0147578	Ga0495658_0147578_704_1390	227
786	3300046690	Ga0495624_0196397	Ga0495624_0196397_489_1175	227
787	3300046809	Ga0495600_0004196	Ga0495600_0004196_5079_5765	227
788	3300047315	Ga0495581_0168226	Ga0495581_0168226_401_1087	227
789	3300047317	Ga0495604_0404437	Ga0495604_0404437_112_798	227
790	3300047319	Ga0495674_0025486	Ga0495674_0025486_2651_3337	227
791	3300047322	Ga0495680_0011461	Ga0495680_0011461_2085_2771	227
792	3300047322	Ga0495680_0131421	Ga0495680_0131421_136_822	227
793	3300047444	Ga0495675_0006753	Ga0495675_0006753_1771_2457	227
794	3300047471	Ga0495684_0130192	Ga0495684_0130192_134_820	227
795	3300047471	Ga0495684_0177522	Ga0495684_0177522_730_1416	227
796	3300048089	Ga0495614_0048060	Ga0495614_0048060_728_1414	227
797	3300048927	Ga0496124_0003745	Ga0496124_0003745_6235_6954	227
798	3300049570	Ga0501033_0108673	Ga0501033_0108673_855_1565	227
799	3300049571	Ga0501034_0028006	Ga0501034_0028006_1045_1791	227
800	3300049572	Ga0501036_0054711	Ga0501036_0054711_1187_1891	227
801	3300049573	Ga0501037_0059922	Ga0501037_0059922_1031_1717	227
802	3300049574	Ga0501038_0104641	Ga0501038_0104641_198_908	227
803	3300049575	Ga0501039_0014549	Ga0501039_0014549_783_1469	227
804	3300049575	Ga0501039_0029242	Ga0501039_0029242_2857_3567	227
805	3300049576	Ga0501040_0006428	Ga0501040_0006428_5260_5970	227
806	3300049576	Ga0501040_0044472	Ga0501040_0044472_1682_2386	227
807	3300049576	Ga0501040_0098003	Ga0501040_0098003_573_1259	227
808	3300049577	Ga0501041_0002581	Ga0501041_0002581_4016_4702	227
809	3300049577	Ga0501041_0050257	Ga0501041_0050257_837_1547	227
810	3300049578	Ga0501042_0008536	Ga0501042_0008536_5815_6525	227
811	3300049578	Ga0501042_0536414	Ga0501042_0536414_68_754	227
812	3300049579	Ga0501043_0038123	Ga0501043_0038123_2089_2799	227
813	3300049580	Ga0501046_0056464	Ga0501046_0056464_1595_2305	227
814	3300049580	Ga0501046_0082950	Ga0501046_0082950_457_1143	227
815	3300049581	Ga0501047_0037331	Ga0501047_0037331_2155_2877	227
816	3300049582	Ga0501048_0078877	Ga0501048_0078877_413_1117	227
817	3300049584	Ga0501068_0117452	Ga0501068_0117452_167_853	227
818	3300049585	Ga0501069_0049492	Ga0501069_0049492_174_896	227
819	3300049586	Ga0501070_0009094	Ga0501070_0009094_818_1540	227
820	3300049586	Ga0501070_0070149	Ga0501070_0070149_557_1267	227
821	3300049587	Ga0501071_0014842	Ga0501071_0014842_4105_4791	227
822	3300049587	Ga0501071_0138561	Ga0501071_0138561_842_1552	227
823	3300049588	Ga0501072_0018660	Ga0501072_0018660_660_1370	227
824	3300049588	Ga0501072_0027786	Ga0501072_0027786_1977_2681	227
825	3300049588	Ga0501072_0093811	Ga0501072_0093811_1556_2242	227
826	3300049589	Ga0501073_0006814	Ga0501073_0006814_6735_7457	227
827	3300049591	Ga0501075_0008928	Ga0501075_0008928_882_1568	227
828	3300049591	Ga0501075_0113159	Ga0501075_0113159_984_1694	227
829	3300049592	Ga0501076_0052164	Ga0501076_0052164_1906_2592	227
830	3300049592	Ga0501076_0162172	Ga0501076_0162172_561_1271	227
831	3300049592	Ga0501076_0454637	Ga0501076_0454637_278_982	227
832	3300049593	Ga0501077_0019514	Ga0501077_0019514_2588_3274	227
833	3300049665	Ga0501227_019055	Ga0501227_019055_208_966	227
834	3300049741	Ga0501079_0001863	Ga0501079_0001863_12672_13382	227
835	3300049741	Ga0501079_0005531	Ga0501079_0005531_6967_7653	227
836	3300049741	Ga0501079_0172379	Ga0501079_0172379_685_1389	227
837	3300049742	Ga0501080_0020804	Ga0501080_0020804_43_729	227
838	3300049742	Ga0501080_0030757	Ga0501080_0030757_2649_3371	227
839	3300049742	Ga0501080_0070855	Ga0501080_0070855_568_1278	227
840	3300049742	Ga0501080_0180115	Ga0501080_0180115_224_934	227
841	3300049742	Ga0501080_0525873	Ga0501080_0525873_283_1038	227
842	3300049743	Ga0501081_0003496	Ga0501081_0003496_2928_3614	227
843	3300049743	Ga0501081_0037338	Ga0501081_0037338_2512_3222	227
844	3300049743	Ga0501081_0060829	Ga0501081_0060829_187_897	227
845	3300049743	Ga0501081_0082361	Ga0501081_0082361_519_1205	227
846	3300049744	Ga0501083_0037499	Ga0501083_0037499_518_1240	227
847	3300049822	Ga0501035_0108976	Ga0501035_0108976_781_1467	227
848	3300050489	nmdc:mga03683_6374_c1	nmdc:mga03683_6374_c1_270_971	227
849	3300050491	nmdc:mga00v17_68850_c1	nmdc:mga00v17_68850_c1_1247_1948	227
850	3300050492	nmdc:mga0yw44_178662_c1	nmdc:mga0yw44_178662_c1_347_1030	227
851	3300050493	nmdc:mga0k408_80342_c1	nmdc:mga0k408_80342_c1_1003_1725	227
852	3300050512	nmdc:mga0n895_370304_c1	nmdc:mga0n895_370304_c1_336_1046	227
853	3300050513	nmdc:mga0rr50_51417_c1	nmdc:mga0rr50_51417_c1_1977_2666	227
854	3300053077	Ga0495601_0003165	Ga0495601_0003165_369_1109	227
855	3300053077	Ga0495601_0032123	Ga0495601_0032123_705_1391	227
856	3300053085	Ga0495619_0008316	Ga0495619_0008316_4892_5578	227
857	3300053085	Ga0495619_0258775	Ga0495619_0258775_192_878	227
858	3300053088	Ga0500644_0003520	Ga0500644_0003520_2193_2891	227
859	3300053117	Ga0500593_002074	Ga0500593_002074_5970_6671	227
860	3300053730	Ga0500645_000530	Ga0500645_000530_24729_25430	227
861	3300053730	Ga0500645_009421	Ga0500645_009421_2432_3133	227
862	3300053730	Ga0500645_018692	Ga0500645_018692_391_1092	227
863	3300054114	Ga0501084_0029439	Ga0501084_0029439_3432_4142	227
864	3300054114	Ga0501084_0064079	Ga0501084_0064079_774_1460	227
865	3300054114	Ga0501084_0586303	Ga0501084_0586303_184_906	227
866	3300055283	Ga0500661_002524	Ga0500661_002524_349_1050	227
867	3300060353	Ga0501082_0016576	Ga0501082_0016576_1322_2008	227
868	3300060353	Ga0501082_0052129	Ga0501082_0052129_198_908	227
869	3300060353	Ga0501082_0332667	Ga0501082_0332667_319_1029	227
870	3300061734	Ga0530510_0029339	Ga0530510_0029339_2229_2939	227
871	3300061734	Ga0530510_0073953	Ga0530510_0073953_36_740	227
872	iso_pu_bacteria	2513020051	2513229199	227
873	iso_pu_bacteria	2599185214	2599626800	227
874	iso_pu_bacteria	2599185226	2599676046	227
875	iso_pu_bacteria	2599185227	2599684337	227
876	iso_pu_bacteria	2599185229	2599696351	227
877	iso_pu_bacteria	2600255292	2601672009	227
878	iso_pu_bacteria	2643221628	2644163901	227
879	iso_pu_bacteria	2643221658	2644326083	227
880	iso_pu_bacteria	2643221672	2644398148	227
881	iso_pu_bacteria	2643221683	2644466249	227
882	iso_pu_bacteria	2738541307	2738885511	227
883	iso_pu_bacteria	2738543013	2739251055	227
884	iso_pu_bacteria	2765235838	2765570983	227
885	iso_pu_bacteria	2818991446	2819601877	227
886	iso_pu_bacteria	2842718218	2842722266	227
887	iso_pu_bacteria	2857547612	2857552371	227
888	iso_pu_bacteria	2857576091	2857579867	227
889	iso_pu_bacteria	2885080285	2885086113	227
890	iso_pu_bacteria	2899924645	2899926485	227
891	iso_pu_bacteria	2928044640	2928047432	227
892	iso_pu_bacteria	2928064002	2928070395	227
893	iso_pu_bacteria	2928084124	2928090536	227
894	iso_pu_bacteria	2932410948	2932415195	227
895	iso_pu_bacteria	2932416698	2932421157	227
896	iso_pu_bacteria	2945909444	2945916003	227
897	iso_pu_bacteria	2945984333	2945988619	227
898	3300002704	JGI25155J39150_1000031	JGI25155J39150_1000031112	228
899	3300002705	JGI25156J39149_1000040	JGI25156J39149_10000405	228
900	3300002738	JGI25154J39366_1000060	JGI25154J39366_1000060113	228
901	3300002741	JGI25157J39369_1000058	JGI25157J39369_1000058113	228
902	3300003790	Ga0055528_1035444	Ga0055528_10354441	228
903	3300003791	Ga0055530_10026077	Ga0055530_100260772	228
904	3300003792	Ga0055540_1001430	Ga0055540_100143011	228
905	3300005262	Ga0065165_1001186	Ga0065165_100118617	228
906	3300005328	Ga0070676_10099427	Ga0070676_100994272	228
907	3300005333	Ga0070677_10104546	Ga0070677_101045462	228
908	3300005353	Ga0070669_100206576	Ga0070669_1002065762	228
909	3300005367	Ga0070667_100193977	Ga0070667_1001939772	228
910	3300005445	Ga0070708_100496173	Ga0070708_1004961731	228
911	3300005458	Ga0070681_10032614	Ga0070681_100326142	228
912	3300005467	Ga0070706_100024975	Ga0070706_1000249754	228
913	3300005468	Ga0070707_100004600	Ga0070707_1000046008	228
914	3300005539	Ga0068853_100011938	Ga0068853_1000119383	228
915	3300005543	Ga0070672_100054159	Ga0070672_1000541593	228
916	3300005543	Ga0070672_100214819	Ga0070672_1002148191	228
917	3300005548	Ga0070665_100063282	Ga0070665_1000632822	228
918	3300005548	Ga0070665_100360983	Ga0070665_1003609833	228
919	3300005616	Ga0068852_100735644	Ga0068852_1007356442	228
920	3300006038	Ga0075365_10449064	Ga0075365_104490642	228
921	3300006048	Ga0075363_100044740	Ga0075363_1000447403	228
922	3300006051	Ga0075364_10111843	Ga0075364_101118432	228
923	3300006058	Ga0075432_10030763	Ga0075432_100307632	228
924	3300006177	Ga0075362_10004345	Ga0075362_100043451	228
925	3300006177	Ga0075362_10016867	Ga0075362_100168672	228
926	3300006178	Ga0075367_10060649	Ga0075367_100606492	228
927	3300006195	Ga0075366_10011890	Ga0075366_100118903	228
928	3300009093	Ga0105240_10008881	Ga0105240_1000888116	228
929	3300009093	Ga0105240_10047998	Ga0105240_100479984	228
930	3300009094	Ga0111539_10061605	Ga0111539_100616053	228
931	3300009148	Ga0105243_10308947	Ga0105243_103089472	228
932	3300009148	Ga0105243_10557383	Ga0105243_105573832	228
933	3300009545	Ga0105237_10000080	Ga0105237_10000080114	228
934	3300009545	Ga0105237_10169229	Ga0105237_101692292	228
935	3300009551	Ga0105238_10006950	Ga0105238_100069509	228
936	3300010375	Ga0105239_10006415	Ga0105239_100064158	228
937	3300010375	Ga0105239_11260483	Ga0105239_112604831	228
938	3300013104	Ga0157370_10379175	Ga0157370_103791752	228
939	3300013306	Ga0163162_10695941	Ga0163162_106959412	228
940	3300013308	Ga0157375_10623964	Ga0157375_106239642	228
941	3300014326	Ga0157380_10091080	Ga0157380_100910802	228
942	3300014497	Ga0182008_10000626	Ga0182008_1000062614	228
943	3300014497	Ga0182008_10002185	Ga0182008_100021854	228
944	3300015261	Ga0182006_1007284	Ga0182006_10072845	228
945	3300015262	Ga0182007_10002338	Ga0182007_1000233810	228
946	3300017792	Ga0163161_10101954	Ga0163161_101019543	228
947	3300017792	Ga0163161_10169727	Ga0163161_101697272	228
948	3300017792	Ga0163161_10211118	Ga0163161_102111183	228
949	3300021361	Ga0213872_10000373	Ga0213872_1000037334	228
950	3300025206	Ga0209435_100019	Ga0209435_100019112	228
951	3300025230	Ga0209563_100044	Ga0209563_10004461	228
952	3300025246	Ga0209646_1000038	Ga0209646_1000038113	228
953	3300025250	Ga0209026_1000048	Ga0209026_1000048112	228
954	3300025256	Ga0209759_1000038	Ga0209759_1000038132	228
955	3300025273	Ga0209673_1013010	Ga0209673_10130103	228
956	3300025298	Ga0209050_1000266	Ga0209050_100026627	228
957	3300025303	Ga0209051_1000899	Ga0209051_10008992	228
958	3300025893	Ga0207682_10063950	Ga0207682_100639501	228
959	3300025903	Ga0207680_10374674	Ga0207680_103746742	228
960	3300025912	Ga0207707_10006346	Ga0207707_100063469	228
961	3300025912	Ga0207707_10275866	Ga0207707_102758662	228
962	3300025913	Ga0207695_10196150	Ga0207695_101961502	228
963	3300025914	Ga0207671_10011829	Ga0207671_100118296	228
964	3300025914	Ga0207671_10564974	Ga0207671_105649742	228
965	3300025919	Ga0207657_10263478	Ga0207657_102634781	228
966	3300025923	Ga0207681_10068338	Ga0207681_100683383	228
967	3300025940	Ga0207691_10008694	Ga0207691_100086943	228
968	3300025940	Ga0207691_10110989	Ga0207691_101109892	228
969	3300025960	Ga0207651_10919877	Ga0207651_109198771	228
970	3300025986	Ga0207658_10215928	Ga0207658_102159282	228
971	3300025986	Ga0207658_10529487	Ga0207658_105294872	228
972	3300025986	Ga0207658_10711708	Ga0207658_107117082	228
973	3300026041	Ga0207639_10033511	Ga0207639_100335113	228
974	3300026041	Ga0207639_10496933	Ga0207639_104969332	228
975	3300026088	Ga0207641_10298970	Ga0207641_102989703	228
976	3300026121	Ga0207683_10032773	Ga0207683_100327735	228
977	3300026121	Ga0207683_10534626	Ga0207683_105346262	228
978	3300026142	Ga0207698_10465231	Ga0207698_104652312	228
979	3300027360	Ga0209969_1002832	Ga0209969_10028322	228
980	3300027907	Ga0207428_10117072	Ga0207428_101170722	228
981	3300028379	Ga0268266_10242983	Ga0268266_102429832	228
982	3300028379	Ga0268266_10407097	Ga0268266_104070972	228
983	3300028558	Ga0265326_10080191	Ga0265326_100801912	228
984	3300028794	Ga0307515_10093762	Ga0307515_100937622	228
985	3300028800	Ga0265338_10111755	Ga0265338_101117553	228
986	3300031238	Ga0265332_10003830	Ga0265332_100038306	228
987	3300031238	Ga0265332_10057986	Ga0265332_100579863	228
988	3300031239	Ga0265328_10022581	Ga0265328_100225813	228
989	3300031239	Ga0265328_10040030	Ga0265328_100400302	228
990	3300031250	Ga0265331_10002813	Ga0265331_100028135	228
991	3300031250	Ga0265331_10105141	Ga0265331_101051412	228
992	3300031251	Ga0265327_10000085	Ga0265327_1000008510	228
993	3300031344	Ga0265316_10000201	Ga0265316_1000020130	228
994	3300031344	Ga0265316_10003730	Ga0265316_1000373014	228
995	3300031548	Ga0307408_100127271	Ga0307408_1001272712	228
996	3300031665	Ga0316575_10077075	Ga0316575_100770752	228
997	3300031691	Ga0316579_10000679	Ga0316579_100006798	228
998	3300031711	Ga0265314_10004643	Ga0265314_100046437	228
999	3300031712	Ga0265342_10019436	Ga0265342_100194365	228
1000	3300031730	Ga0307516_10000879	Ga0307516_100008795	228
1001	3300031730	Ga0307516_10191134	Ga0307516_101911342	228
1002	3300031730	Ga0307516_10315677	Ga0307516_103156772	228
1003	3300031731	Ga0307405_10074940	Ga0307405_100749404	228
1004	3300031731	Ga0307405_10204904	Ga0307405_102049042	228
1005	3300031733	Ga0316577_10082869	Ga0316577_100828692	228
1006	3300031824	Ga0307413_10512211	Ga0307413_105122112	228
1007	3300031901	Ga0307406_10011186	Ga0307406_100111865	228
1008	3300031903	Ga0307407_10355334	Ga0307407_103553341	228
1009	3300031911	Ga0307412_10566114	Ga0307412_105661141	228
1010	3300031995	Ga0307409_100236806	Ga0307409_1002368062	228
1011	3300032005	Ga0307411_10341578	Ga0307411_103415782	228
1012	3300035398	Ga0316574_0001736	Ga0316574_0001736_9068_9769	228
1013	3300035725	Ga0373947_0246726	Ga0373947_0246726_228_917	228
1014	3300036401	Ga0373937_0468862	Ga0373937_0468862_197_886	228
1015	3300036647	Ga0316582_0006894	Ga0316582_0006894_4754_5536	228
1016	3300036647	Ga0316582_0119008	Ga0316582_0119008_509_1234	228
1017	3300036647	Ga0316582_0162938	Ga0316582_0162938_54_836	228
1018	3300036712	Ga0316584_0109281	Ga0316584_0109281_957_1739	228
1019	3300037068	Ga0373925_0551217	Ga0373925_0551217_17_706	228
1020	3300037466	Ga0395898_0634278	Ga0395898_0634278_154_846	228
1021	3300037471	Ga0395905_0000084	Ga0395905_0000084_101565_102251	228
1022	3300037471	Ga0395905_0050198	Ga0395905_0050198_248_940	228
1023	3300039447	Ga0436361_0580915	Ga0436361_0580915_3400_4086	228
1024	3300041404	Ga0439436_0004348	Ga0439436_0004348_589_1275	228
1025	3300041405	Ga0439438_025294	Ga0439438_025294_533_1219	228
1026	3300041407	Ga0439447_027741	Ga0439447_027741_272_958	228
1027	3300041407	Ga0439447_035388	Ga0439447_035388_334_1020	228
1028	3300041410	Ga0439461_0024814	Ga0439461_0024814_237_923	228
1029	3300041411	Ga0439466_0010730	Ga0439466_0010730_946_1632	228
1030	3300041413	Ga0439465_0003342	Ga0439465_0003342_4039_4725	228
1031	3300041413	Ga0439465_0117583	Ga0439465_0117583_70_756	228
1032	3300041443	Ga0451789_0698048	Ga0451789_0698048_594_1280	228
1033	3300041451	Ga0451791_1316654	Ga0451791_1316654_630_1361	228
1034	3300041452	Ga0451793_0509386	Ga0451793_0509386_1310_1996	228
1035	3300041459	Ga0451800_1022359	Ga0451800_1022359_1129_1815	228
1036	3300041999	Ga0439433_0000690	Ga0439433_0000690_1879_2565	228
1037	3300041999	Ga0439433_0015833	Ga0439433_0015833_669_1355	228
1038	3300042002	Ga0439442_007715	Ga0439442_007715_422_1108	228
1039	3300042002	Ga0439442_010451	Ga0439442_010451_1011_1697	228
1040	3300042004	Ga0439445_0001982	Ga0439445_0001982_1314_2000	228
1041	3300042004	Ga0439445_0058874	Ga0439445_0058874_148_834	228
1042	3300042006	Ga0439432_005531	Ga0439432_005531_2301_2987	228
1043	3300042007	Ga0439449_0000139	Ga0439449_0000139_440_1126	228
1044	3300042007	Ga0439449_0002137	Ga0439449_0002137_1643_2329	228
1045	3300042007	Ga0439449_0013138	Ga0439449_0013138_776_1462	228
1046	3300042010	Ga0439452_001806	Ga0439452_001806_3990_4676	228
1047	3300042010	Ga0439452_034743	Ga0439452_034743_424_1110	228
1048	3300042014	Ga0439457_032159	Ga0439457_032159_378_1064	228
1049	3300042015	Ga0439462_0012010	Ga0439462_0012010_1272_1958	228
1050	3300042115	Ga0450911_000289	Ga0450911_000289_17280_17993	228
1051	3300042123	Ga0450921_001093	Ga0450921_001093_490_1176	228
1052	3300042133	Ga0450896_015135	Ga0450896_015135_339_1025	228
1053	3300042145	Ga0450906_007877	Ga0450906_007877_272_958	228
1054	3300042156	Ga0439446_0033558	Ga0439446_0033558_220_906	228
1055	3300042156	Ga0439446_0056129	Ga0439446_0056129_52_738	228
1056	3300042184	Ga0450908_005222	Ga0450908_005222_520_1206	228
1057	3300042185	Ga0450909_014491	Ga0450909_014491_317_1003	228
1058	3300042435	Ga0439434_0030719	Ga0439434_0030719_272_958	228
1059	3300042435	Ga0439434_0032877	Ga0439434_0032877_84_770	228
1060	3300042531	Ga0450918_013703	Ga0450918_013703_417_1103	228
1061	3300042531	Ga0450918_014923	Ga0450918_014923_172_858	228
1062	3300042876	Ga0451577_0002302	Ga0451577_0002302_13363_14055	228
1063	3300042876	Ga0451577_0061464	Ga0451577_0061464_2481_3170	228
1064	3300042876	Ga0451577_0720849	Ga0451577_0720849_165_854	228
1065	3300042876	Ga0451577_0954719	Ga0451577_0954719_49_738	228
1066	3300044683	Ga0466965_0034584	Ga0466965_0034584_1346_2032	228
1067	3300044712	Ga0453684_0000273	Ga0453684_0000273_124281_124976	228
1068	3300044712	Ga0453684_0035983	Ga0453684_0035983_5764_6450	228
1069	3300044712	Ga0453684_0098138	Ga0453684_0098138_366_1052	228
1070	3300044712	Ga0453684_0219066	Ga0453684_0219066_829_1518	228
1071	3300045051	Ga0451576_0257695	Ga0451576_0257695_1099_1785	228
1072	3300046457	Ga0495590_0069523	Ga0495590_0069523_452_1138	228
1073	3300046475	Ga0495639_0019401	Ga0495639_0019401_312_1004	228
1074	3300046506	Ga0495583_0044054	Ga0495583_0044054_357_1043	228
1075	3300046507	Ga0495606_0168202	Ga0495606_0168202_297_983	228
1076	3300046512	Ga0495610_0102577	Ga0495610_0102577_556_1242	228
1077	3300046514	Ga0495618_0305515	Ga0495618_0305515_204_896	228
1078	3300046519	Ga0495632_0008425	Ga0495632_0008425_1936_2622	228
1079	3300046522	Ga0495643_0100222	Ga0495643_0100222_213_899	228
1080	3300046524	Ga0495648_0008405	Ga0495648_0008405_2786_3478	228
1081	3300046615	Ga0495656_0002260	Ga0495656_0002260_1608_2294	228
1082	3300046615	Ga0495656_0259440	Ga0495656_0259440_151_837	228
1083	3300046648	Ga0495611_0057220	Ga0495611_0057220_471_1157	228
1084	3300046660	Ga0495625_0160171	Ga0495625_0160171_499_1185	228
1085	3300046663	Ga0495635_0236829	Ga0495635_0236829_255_947	228
1086	3300046683	Ga0495658_0246536	Ga0495658_0246536_363_1052	228
1087	3300046694	Ga0495649_0004251	Ga0495649_0004251_814_1500	228
1088	3300047472	Ga0495686_0156325	Ga0495686_0156325_409_1095	228
1089	3300048090	Ga0495615_0034381	Ga0495615_0034381_419_1105	228
1090	3300048091	Ga0495626_0059813	Ga0495626_0059813_438_1124	228
1091	3300048903	Ga0496100_0134570	Ga0496100_0134570_658_1362	228
1092	3300048903	Ga0496100_0157674	Ga0496100_0157674_195_887	228
1093	3300048904	Ga0496101_0016356	Ga0496101_0016356_218_910	228
1094	3300048905	Ga0496102_0119234	Ga0496102_0119234_453_1145	228
1095	3300048906	Ga0496103_0083316	Ga0496103_0083316_820_1512	228
1096	3300048907	Ga0496104_0002687	Ga0496104_0002687_4772_5464	228
1097	3300048908	Ga0496105_0056758	Ga0496105_0056758_1030_1722	228
1098	3300048908	Ga0496105_0270314	Ga0496105_0270314_257_961	228
1099	3300048909	Ga0496106_0136904	Ga0496106_0136904_1142_1834	228
1100	3300048909	Ga0496106_0567590	Ga0496106_0567590_38_742	228
1101	3300048910	Ga0496107_0040410	Ga0496107_0040410_2175_2867	228
1102	3300048911	Ga0496108_0435502	Ga0496108_0435502_307_999	228
1103	3300048912	Ga0496109_0141105	Ga0496109_0141105_832_1536	228
1104	3300048912	Ga0496109_0179297	Ga0496109_0179297_989_1675	228
1105	3300048912	Ga0496109_0357751	Ga0496109_0357751_401_1087	228
1106	3300048913	Ga0496110_0030214	Ga0496110_0030214_463_1155	228
1107	3300048913	Ga0496110_0198348	Ga0496110_0198348_320_1006	228
1108	3300048913	Ga0496110_0386432	Ga0496110_0386432_306_998	228
1109	3300048914	Ga0496111_0125695	Ga0496111_0125695_1088_1780	228
1110	3300048917	Ga0496114_0057390	Ga0496114_0057390_78_764	228
1111	3300048917	Ga0496114_0192982	Ga0496114_0192982_737_1429	228
1112	3300048917	Ga0496114_0220663	Ga0496114_0220663_412_1116	228
1113	3300048924	Ga0496121_0031220	Ga0496121_0031220_318_1031	228
1114	3300048925	Ga0496122_0000317	Ga0496122_0000317_58450_59142	228
1115	3300048926	Ga0496123_0000264	Ga0496123_0000264_11995_12687	228
1116	3300048927	Ga0496124_0000273	Ga0496124_0000273_13769_14455	228
1117	3300048928	Ga0496125_0005367	Ga0496125_0005367_578_1291	228
1118	3300048928	Ga0496125_0005937	Ga0496125_0005937_12421_13134	228
1119	3300048928	Ga0496125_0015249	Ga0496125_0015249_6323_7009	228
1120	3300048929	Ga0496126_0029341	Ga0496126_0029341_4288_5001	228
1121	3300049575	Ga0501039_0392583	Ga0501039_0392583_271_987	228
1122	3300049776	Ga0501280_000216	Ga0501280_000216_1778_2467	228
1123	3300049778	Ga0501282_002378	Ga0501282_002378_1003_1692	228
1124	3300049822	Ga0501035_0512493	Ga0501035_0512493_110_826	228
1125	3300050489	nmdc:mga03683_2201_c2	nmdc:mga03683_2201_c2_255_941	228
1126	3300050489	nmdc:mga03683_5149_c1	nmdc:mga03683_5149_c1_2931_3617	228
1127	3300050490	nmdc:mga03n38_16230_c1	nmdc:mga03n38_16230_c1_2167_2853	228
1128	3300050491	nmdc:mga00v17_3630_c1	nmdc:mga00v17_3630_c1_6640_7326	228
1129	3300050492	nmdc:mga0yw44_109204_c1	nmdc:mga0yw44_109204_c1_802_1488	228
1130	3300050493	nmdc:mga0k408_108385_c1	nmdc:mga0k408_108385_c1_283_969	228
1131	3300050493	nmdc:mga0k408_128616_c1	nmdc:mga0k408_128616_c1_597_1283	228
1132	3300050493	nmdc:mga0k408_21699_c1	nmdc:mga0k408_21699_c1_413_1099	228
1133	3300050493	nmdc:mga0k408_4002_c1	nmdc:mga0k408_4002_c1_1940_2626	228
1134	3300050493	nmdc:mga0k408_47512_c1	nmdc:mga0k408_47512_c1_645_1331	228
1135	3300050493	nmdc:mga0k408_49481_c1	nmdc:mga0k408_49481_c1_523_1209	228
1136	3300050493	nmdc:mga0k408_65310_c1	nmdc:mga0k408_65310_c1_11_697	228
1137	3300050494	nmdc:mga06z11_305297_c1	nmdc:mga06z11_305297_c1_220_906	228
1138	3300050494	nmdc:mga06z11_94301_c1	nmdc:mga06z11_94301_c1_277_963	228
1139	3300050495	nmdc:mga04h51_56993_c1	nmdc:mga04h51_56993_c1_413_1099	228
1140	3300050496	nmdc:mga07m45_1322_c1	nmdc:mga07m45_1322_c1_764_1450	228
1141	3300050496	nmdc:mga07m45_34165_c1	nmdc:mga07m45_34165_c1_1160_1846	228
1142	3300050496	nmdc:mga07m45_70046_c1	nmdc:mga07m45_70046_c1_266_952	228
1143	3300050511	nmdc:mga08y16_229513_c1	nmdc:mga08y16_229513_c1_1147_1836	228
1144	3300053086	Ga0500578_0029698	Ga0500578_0029698_2316_3002	228
1145	3300053090	Ga0500646_0028302	Ga0500646_0028302_381_1067	228
1146	3300053093	Ga0500651_0053585	Ga0500651_0053585_816_1502	228
1147	3300053093	Ga0500651_0143889	Ga0500651_0143889_398_1111	228
1148	3300053098	Ga0500650_0131739	Ga0500650_0131739_254_940	228
1149	3300053126	Ga0500621_142653	Ga0500621_142653_12_698	228
1150	3300053129	Ga0500628_025682	Ga0500628_025682_193_879	228
1151	3300053130	Ga0500642_0013320	Ga0500642_0013320_2172_2858	228
1152	3300053131	Ga0500652_001291	Ga0500652_001291_933_1619	228
1153	3300053133	Ga0500655_008316	Ga0500655_008316_369_1055	228
1154	3300053134	Ga0500658_0004924	Ga0500658_0004924_3735_4421	228
1155	3300053139	Ga0500568_0067711	Ga0500568_0067711_519_1205	228
1156	3300053156	Ga0500622_0000530	Ga0500622_0000530_11334_12020	228
1157	3300053156	Ga0500622_0003050	Ga0500622_0003050_7640_8371	228
1158	3300053156	Ga0500622_0148329	Ga0500622_0148329_179_865	228
1159	3300053730	Ga0500645_037748	Ga0500645_037748_173_859	228
1160	iso_pu_bacteria	2501025501	2501070973	228
1161	iso_pu_bacteria	2501025502	2501078877	228
1162	iso_pu_bacteria	2501025504	2501413804	228
1163	iso_pu_bacteria	2508501125	2509129368	228
1164	iso_pu_bacteria	2510917013	2511089515	228
1165	iso_pu_bacteria	2510917014	2511094927	228
1166	iso_pu_bacteria	2510917015	2511104586	228
1167	iso_pu_bacteria	2511231026	2511387361	228
1168	iso_pu_bacteria	2512047030	2512347502	228
1169	iso_pu_bacteria	2513237082	2513551554	228
1170	iso_pu_bacteria	2513237083	2513560205	228
1171	iso_pu_bacteria	2513237151	2513962477	228
1172	iso_pu_bacteria	2513237166	2514046268	228
1173	iso_pu_bacteria	2519103095	2519457873	228
1174	iso_pu_bacteria	2526164713	2527079122	228
1175	iso_pu_bacteria	2562617112	2563061884	228
1176	iso_pu_bacteria	2582581311	2585295177	228
1177	iso_pu_bacteria	2600255067	2600814640	228
1178	iso_pu_bacteria	2643221603	2644027980	228
1179	iso_pu_bacteria	2643221638	2644214403	228
1180	iso_pu_bacteria	2643221645	2644249752	228
1181	iso_pu_bacteria	2687453129	2687580673	228
1182	iso_pu_bacteria	2711768613	2713478280	228
1183	iso_pu_bacteria	2734482258	2735816193	228
1184	iso_pu_bacteria	2738541277	2738723185	228
1185	iso_pu_bacteria	2738541296	2738820133	228
1186	iso_pu_bacteria	2738541297	2738827760	228
1187	iso_pu_bacteria	2738541298	2738832613	228
1188	iso_pu_bacteria	2738541306	2738874140	228
1189	iso_pu_bacteria	2738541357	2739151556	228
1190	iso_pu_bacteria	2738543002	2739185770	228
1191	iso_pu_bacteria	2738543003	2739193476	228
1192	iso_pu_bacteria	2738543008	2739220738	228
1193	iso_pu_bacteria	2738543019	2739283916	228
1194	iso_pu_bacteria	2738543026	2739319952	228
1195	iso_pu_bacteria	2738543029	2739338193	228
1196	iso_pu_bacteria	2744054900	2746092246	228
1197	iso_pu_bacteria	2744054901	2746095287	228
1198	iso_pu_bacteria	2751185846	2753568807	228
1199	iso_pu_bacteria	2816332253	2817260055	228
1200	iso_pu_bacteria	2816332256	2817277719	228
1201	iso_pu_bacteria	2816332286	2817456868	228
1202	iso_pu_bacteria	2818991450	2819620855	228
1203	iso_pu_bacteria	2834641062	2834645578	228
1204	iso_pu_bacteria	2842324504	2842331349	228
1205	iso_pu_bacteria	2842348783	2842355689	228
1206	iso_pu_bacteria	2842454564	2842462007	228
1207	iso_pu_bacteria	2856287931	2856289179	228
1208	iso_pu_bacteria	2857357740	2857363450	228
1209	iso_pu_bacteria	2863421361	2863421548	228
1210	iso_pu_bacteria	2870068957	2870069025	228
1211	iso_pu_bacteria	2883087390	2883094716	228
1212	iso_pu_bacteria	2900634093	2900636259	228
1213	iso_pu_bacteria	2904483920	2904483950	228
1214	iso_pu_bacteria	2904564687	2904565730	228
1215	iso_pu_bacteria	2904571731	2904572773	228
1216	iso_pu_bacteria	2904615490	2904618899	228
1217	iso_pu_bacteria	2919527303	2919529898	228
1218	iso_pu_bacteria	2928108538	2928109657	228
1219	iso_pu_bacteria	2928135762	2928136889	228
1220	iso_pu_bacteria	2928157003	2928159873	228
1221	iso_pu_bacteria	2928163908	2928164086	228
1222	iso_pu_bacteria	2928170801	2928173383	228
1223	iso_pu_bacteria	2928503688	2928506417	228
1224	iso_pu_bacteria	2928536128	2928538704	228
1225	iso_pu_bacteria	2945934425	2945935408	228
1226	iso_pu_bacteria	2990703756	2990704043	228
1227	iso_pu_bacteria	641736151	642422200	228
1228	iso_pu_bacteria	641736154	642419224	228
1229	iso_pu_bacteria	642555112	642594306	228
1230	iso_pu_bacteria	642555113	642620281	228
1231	iso_pu_bacteria	8003400568	8003400790	228
1232	iso_pu_bacteria	8003955200	8003957472	228
1233	iso_pu_bacteria	8020807995	8020812268	228
1234	iso_pu_bacteria	8020938398	8020943937	228
1235	iso_pu_bacteria	8020953355	8020958995	228
1236	iso_pu_bacteria	8039098773	8039099187	228
1237	iso_pu_bacteria	8040167225	8040172277	228
1238	iso_pu_bacteria	8040173305	8040175772	228
1239	iso_pu_bacteria	8055266321	8055266721	228
1240	iso_pu_bacteria	8055301274	8055303938	228
1241	3300002704	JGI25155J39150_1000658	JGI25155J39150_10006584	229
1242	3300002705	JGI25156J39149_1002411	JGI25156J39149_10024115	229
1243	3300002705	JGI25156J39149_1002930	JGI25156J39149_10029304	229
1244	3300002737	JGI25162J39368_1004129	JGI25162J39368_10041292	229
1245	3300002738	JGI25154J39366_1001739	JGI25154J39366_10017395	229
1246	3300002738	JGI25154J39366_1001868	JGI25154J39366_10018684	229
1247	3300002741	JGI25157J39369_1000747	JGI25157J39369_100074717	229
1248	3300002773	JGI25152J39213_1026506	JGI25152J39213_10265062	229
1249	3300003187	JGI25151J46595_10003753	JGI25151J46595_100037537	229
1250	3300003187	JGI25151J46595_10017357	JGI25151J46595_100173573	229
1251	3300003187	JGI25151J46595_10063915	JGI25151J46595_100639152	229
1252	3300003187	JGI25151J46595_10080416	JGI25151J46595_100804161	229
1253	3300003215	JGI25153J46596_10067081	JGI25153J46596_100670811	229
1254	3300003374	JGI25161J50226_1012947	JGI25161J50226_10129471	229
1255	3300003758	Ga0055532_1000271	Ga0055532_100027129	229
1256	3300003771	Ga0055526_1007909	Ga0055526_10079092	229
1257	3300003771	Ga0055526_1048836	Ga0055526_10488361	229
1258	3300003773	Ga0055537_1008513	Ga0055537_10085133	229
1259	3300003773	Ga0055537_1020931	Ga0055537_10209311	229
1260	3300003775	Ga0055524_1000382	Ga0055524_100038229	229
1261	3300003775	Ga0055524_1001130	Ga0055524_100113015	229
1262	3300003775	Ga0055524_1017778	Ga0055524_10177783	229
1263	3300003775	Ga0055524_1048849	Ga0055524_10488491	229
1264	3300003781	Ga0055536_1000044	Ga0055536_1000044123	229
1265	3300003781	Ga0055536_1001124	Ga0055536_10011243	229
1266	3300003784	Ga0055534_1000584	Ga0055534_10005845	229
1267	3300003784	Ga0055534_1004500	Ga0055534_10045003	229
1268	3300003784	Ga0055534_1024346	Ga0055534_10243461	229
1269	3300003790	Ga0055528_1043292	Ga0055528_10432921	229
1270	3300003792	Ga0055540_1001164	Ga0055540_100116418	229
1271	3300003794	Ga0055531_10001612	Ga0055531_1000161218	229
1272	3300005288	Ga0065714_10083798	Ga0065714_100837982	229
1273	3300005330	Ga0070690_100299544	Ga0070690_1002995441	229
1274	3300005333	Ga0070677_10171528	Ga0070677_101715281	229
1275	3300005334	Ga0068869_100034778	Ga0068869_1000347784	229
1276	3300005336	Ga0070680_100051006	Ga0070680_1000510062	229
1277	3300005353	Ga0070669_100108805	Ga0070669_1001088052	229
1278	3300005355	Ga0070671_100015764	Ga0070671_1000157642	229
1279	3300005356	Ga0070674_100359019	Ga0070674_1003590192	229
1280	3300005364	Ga0070673_100875911	Ga0070673_1008759111	229
1281	3300005367	Ga0070667_100393677	Ga0070667_1003936772	229
1282	3300005438	Ga0070701_10246944	Ga0070701_102469442	229
1283	3300005441	Ga0070700_100007531	Ga0070700_1000075313	229
1284	3300005441	Ga0070700_100308926	Ga0070700_1003089261	229
1285	3300005444	Ga0070694_100180608	Ga0070694_1001806082	229
1286	3300005445	Ga0070708_100054926	Ga0070708_1000549262	229
1287	3300005445	Ga0070708_100625930	Ga0070708_1006259301	229
1288	3300005455	Ga0070663_100334208	Ga0070663_1003342081	229
1289	3300005456	Ga0070678_100320795	Ga0070678_1003207952	229
1290	3300005459	Ga0068867_100002905	Ga0068867_1000029053	229
1291	3300005467	Ga0070706_100000789	Ga0070706_1000007893	229
1292	3300005467	Ga0070706_100057302	Ga0070706_1000573024	229
1293	3300005468	Ga0070707_100230797	Ga0070707_1002307973	229
1294	3300005471	Ga0070698_100071857	Ga0070698_1000718571	229
1295	3300005518	Ga0070699_100028575	Ga0070699_1000285751	229
1296	3300005518	Ga0070699_100123173	Ga0070699_1001231732	229
1297	3300005536	Ga0070697_100160601	Ga0070697_1001606011	229
1298	3300005539	Ga0068853_100540543	Ga0068853_1005405431	229
1299	3300005539	Ga0068853_100610611	Ga0068853_1006106112	229
1300	3300005545	Ga0070695_100010565	Ga0070695_1000105652	229
1301	3300005546	Ga0070696_100061761	Ga0070696_1000617612	229
1302	3300005549	Ga0070704_100012313	Ga0070704_1000123134	229
1303	3300005549	Ga0070704_100093944	Ga0070704_1000939442	229
1304	3300005563	Ga0068855_100045477	Ga0068855_1000454775	229
1305	3300005564	Ga0070664_100093161	Ga0070664_1000931612	229
1306	3300005578	Ga0068854_100426659	Ga0068854_1004266592	229
1307	3300005614	Ga0068856_100063778	Ga0068856_1000637784	229
1308	3300005616	Ga0068852_100011356	Ga0068852_1000113562	229
1309	3300005616	Ga0068852_100125761	Ga0068852_1001257612	229
1310	3300005617	Ga0068859_100189146	Ga0068859_1001891462	229
1311	3300005618	Ga0068864_100003860	Ga0068864_10000386015	229
1312	3300005718	Ga0068866_10011655	Ga0068866_100116554	229
1313	3300005719	Ga0068861_100076722	Ga0068861_1000767221	229
1314	3300005841	Ga0068863_100654750	Ga0068863_1006547502	229
1315	3300005843	Ga0068860_100013362	Ga0068860_1000133624	229
1316	3300005843	Ga0068860_100040211	Ga0068860_1000402112	229
1317	3300005843	Ga0068860_100351830	Ga0068860_1003518302	229
1318	3300005844	Ga0068862_100002168	Ga0068862_10000216812	229
1319	3300005844	Ga0068862_100017481	Ga0068862_1000174813	229
1320	3300006058	Ga0075432_10024378	Ga0075432_100243782	229
1321	3300006177	Ga0075362_10016346	Ga0075362_100163462	229
1322	3300006177	Ga0075362_10063427	Ga0075362_100634272	229
1323	3300006178	Ga0075367_10025207	Ga0075367_100252072	229
1324	3300006195	Ga0075366_10003486	Ga0075366_100034862	229
1325	3300006195	Ga0075366_10036835	Ga0075366_100368352	229
1326	3300006195	Ga0075366_10040251	Ga0075366_100402512	229
1327	3300006195	Ga0075366_10071419	Ga0075366_100714192	229
1328	3300006237	Ga0097621_100016015	Ga0097621_1000160156	229
1329	3300006353	Ga0075370_10048121	Ga0075370_100481212	229
1330	3300006353	Ga0075370_10098230	Ga0075370_100982302	229
1331	3300006844	Ga0075428_100002569	Ga0075428_1000025694	229
1332	3300006846	Ga0075430_100033481	Ga0075430_1000334814	229
1333	3300006846	Ga0075430_100117866	Ga0075430_1001178662	229
1334	3300006880	Ga0075429_100007197	Ga0075429_1000071979	229
1335	3300006881	Ga0068865_100105505	Ga0068865_1001055053	229
1336	3300006931	Ga0097620_100189133	Ga0097620_1001891332	229
1337	3300006946	Ga0079104_1000009	Ga0079104_1000009107	229
1338	3300006948	Ga0099826_10000018	Ga0099826_10000018136	229
1339	3300007265	Ga0099794_10121460	Ga0099794_101214602	229
1340	3300009011	Ga0105251_10018515	Ga0105251_100185152	229
1341	3300009092	Ga0105250_10048672	Ga0105250_100486722	229
1342	3300009093	Ga0105240_10003800	Ga0105240_100038005	229
1343	3300009093	Ga0105240_10018026	Ga0105240_100180265	229
1344	3300009094	Ga0111539_10000584	Ga0111539_1000058416	229
1345	3300009148	Ga0105243_10038253	Ga0105243_100382532	229
1346	3300009176	Ga0105242_10134329	Ga0105242_101343292	229
1347	3300009177	Ga0105248_10035412	Ga0105248_100354124	229
1348	3300009545	Ga0105237_10255689	Ga0105237_102556892	229
1349	3300009545	Ga0105237_10359290	Ga0105237_103592902	229
1350	3300009551	Ga0105238_10481222	Ga0105238_104812222	229
1351	3300009553	Ga0105249_10036576	Ga0105249_100365762	229
1352	3300013104	Ga0157370_10002979	Ga0157370_100029794	229
1353	3300013297	Ga0157378_10113935	Ga0157378_101139352	229
1354	3300013297	Ga0157378_10465646	Ga0157378_104656461	229
1355	3300013306	Ga0163162_10019505	Ga0163162_100195053	229
1356	3300013306	Ga0163162_10692291	Ga0163162_106922912	229
1357	3300013308	Ga0157375_10017180	Ga0157375_100171802	229
1358	3300014326	Ga0157380_10077701	Ga0157380_100777012	229
1359	3300014497	Ga0182008_10093780	Ga0182008_100937802	229
1360	3300014968	Ga0157379_10005215	Ga0157379_1000521511	229
1361	3300014968	Ga0157379_10114952	Ga0157379_101149523	229
1362	3300015261	Ga0182006_1013746	Ga0182006_10137464	229
1363	3300015261	Ga0182006_1046308	Ga0182006_10463082	229
1364	3300017792	Ga0163161_10087771	Ga0163161_100877712	229
1365	3300021361	Ga0213872_10001094	Ga0213872_1000109416	229
1366	3300025206	Ga0209435_100018	Ga0209435_10001886	229
1367	3300025206	Ga0209435_100437	Ga0209435_1004376	229
1368	3300025229	Ga0209147_100051	Ga0209147_10005186	229
1369	3300025233	Ga0209437_100145	Ga0209437_1001455	229
1370	3300025242	Ga0209258_100760	Ga0209258_1007605	229
1371	3300025245	Ga0207425_1023848	Ga0207425_10238482	229
1372	3300025246	Ga0209646_1000081	Ga0209646_1000081186	229
1373	3300025246	Ga0209646_1000090	Ga0209646_10000905	229
1374	3300025250	Ga0209026_1000042	Ga0209026_1000042160	229
1375	3300025250	Ga0209026_1009637	Ga0209026_10096372	229
1376	3300025254	Ga0209148_1014233	Ga0209148_10142332	229
1377	3300025256	Ga0209759_1000933	Ga0209759_10009337	229
1378	3300025256	Ga0209759_1002054	Ga0209759_10020547	229
1379	3300025263	Ga0209565_1000174	Ga0209565_10001743	229
1380	3300025273	Ga0209673_1012677	Ga0209673_10126772	229
1381	3300025291	Ga0209675_1000100	Ga0209675_100010050	229
1382	3300025291	Ga0209675_1001317	Ga0209675_100131713	229
1383	3300025291	Ga0209675_1022852	Ga0209675_10228522	229
1384	3300025292	Ga0209676_1000141	Ga0209676_10001419	229
1385	3300025294	Ga0209025_1000390	Ga0209025_100039012	229
1386	3300025294	Ga0209025_1000755	Ga0209025_10007559	229
1387	3300025294	Ga0209025_1001457	Ga0209025_10014577	229
1388	3300025294	Ga0209025_1011865	Ga0209025_10118652	229
1389	3300025295	Ga0209564_1001462	Ga0209564_10014629	229
1390	3300025295	Ga0209564_1001510	Ga0209564_10015104	229
1391	3300025295	Ga0209564_1003294	Ga0209564_10032943	229
1392	3300025297	Ga0209758_1035968	Ga0209758_10359682	229
1393	3300025298	Ga0209050_1013249	Ga0209050_10132493	229
1394	3300025299	Ga0209256_1000019	Ga0209256_1000019163	229
1395	3300025299	Ga0209256_1000434	Ga0209256_100043414	229
1396	3300025299	Ga0209256_1001596	Ga0209256_10015969	229
1397	3300025303	Ga0209051_1021757	Ga0209051_10217573	229
1398	3300025321	Ga0207656_10077782	Ga0207656_100777822	229
1399	3300025735	Ga0207713_1122764	Ga0207713_11227641	229
1400	3300025905	Ga0207685_10056825	Ga0207685_100568251	229
1401	3300025910	Ga0207684_10020826	Ga0207684_100208264	229
1402	3300025910	Ga0207684_10076023	Ga0207684_100760233	229
1403	3300025913	Ga0207695_10005351	Ga0207695_100053519	229
1404	3300025913	Ga0207695_10023926	Ga0207695_100239262	229
1405	3300025917	Ga0207660_10031446	Ga0207660_100314463	229
1406	3300025922	Ga0207646_10507623	Ga0207646_105076232	229
1407	3300025924	Ga0207694_10156749	Ga0207694_101567492	229
1408	3300025931	Ga0207644_10002682	Ga0207644_100026825	229
1409	3300025938	Ga0207704_10023210	Ga0207704_100232102	229
1410	3300025940	Ga0207691_10034256	Ga0207691_100342564	229
1411	3300025945	Ga0207679_10833348	Ga0207679_108333481	229
1412	3300025949	Ga0207667_10022705	Ga0207667_100227053	229
1413	3300025961	Ga0207712_10086290	Ga0207712_100862902	229
1414	3300025972	Ga0207668_10055207	Ga0207668_100552073	229
1415	3300025981	Ga0207640_10136412	Ga0207640_101364123	229
1416	3300025986	Ga0207658_10328289	Ga0207658_103282892	229
1417	3300026041	Ga0207639_10539505	Ga0207639_105395052	229
1418	3300026075	Ga0207708_10014096	Ga0207708_100140965	229
1419	3300026075	Ga0207708_10395071	Ga0207708_103950711	229
1420	3300026078	Ga0207702_10059298	Ga0207702_100592982	229
1421	3300026088	Ga0207641_10079598	Ga0207641_100795982	229
1422	3300026088	Ga0207641_10471152	Ga0207641_104711522	229
1423	3300026089	Ga0207648_10004678	Ga0207648_1000467814	229
1424	3300026095	Ga0207676_10074994	Ga0207676_100749942	229
1425	3300026118	Ga0207675_100010142	Ga0207675_1000101427	229
1426	3300026121	Ga0207683_10343314	Ga0207683_103433142	229
1427	3300026142	Ga0207698_10004332	Ga0207698_100043327	229
1428	3300026142	Ga0207698_10216617	Ga0207698_102166172	229
1429	3300027111	Ga0209281_1000023	Ga0209281_1000023280	229
1430	3300027364	Ga0209967_1001661	Ga0209967_10016612	229
1431	3300027378	Ga0209981_1003593	Ga0209981_10035932	229
1432	3300027378	Ga0209981_1011871	Ga0209981_10118712	229
1433	3300027471	Ga0209995_1001599	Ga0209995_10015992	229
1434	3300027526	Ga0209968_1000695	Ga0209968_10006954	229
1435	3300027666	Ga0209282_1000063	Ga0209282_100006354	229
1436	3300027695	Ga0209966_1000030	Ga0209966_100003047	229
1437	3300027876	Ga0209974_10062878	Ga0209974_100628782	229
1438	3300027907	Ga0207428_10048547	Ga0207428_100485472	229
1439	3300027907	Ga0207428_10110106	Ga0207428_101101062	229
1440	3300028380	Ga0268265_10002921	Ga0268265_100029213	229
1441	3300028380	Ga0268265_10065268	Ga0268265_100652683	229
1442	3300028381	Ga0268264_10009205	Ga0268264_100092055	229
1443	3300028381	Ga0268264_10021726	Ga0268264_100217263	229
1444	3300028381	Ga0268264_10225707	Ga0268264_102257072	229
1445	3300028794	Ga0307515_10017105	Ga0307515_100171052	229
1446	3300031235	Ga0265330_10015527	Ga0265330_100155275	229
1447	3300031241	Ga0265325_10000160	Ga0265325_1000016028	229
1448	3300031251	Ga0265327_10008072	Ga0265327_100080727	229
1449	3300031344	Ga0265316_10091606	Ga0265316_100916062	229
1450	3300031649	Ga0307514_10000420	Ga0307514_1000042071	229
1451	3300031730	Ga0307516_10000116	Ga0307516_1000011638	229
1452	3300031731	Ga0307405_10162677	Ga0307405_101626772	229
1453	3300031838	Ga0307518_10261252	Ga0307518_102612521	229
1454	3300031911	Ga0307412_10198955	Ga0307412_101989552	229
1455	3300032133	Ga0316583_10025451	Ga0316583_100254513	229
1456	3300035242	Ga0373962_0038218	Ga0373962_0038218_37_783	229
1457	3300035691	Ga0373931_0340645	Ga0373931_0340645_60_752	229
1458	3300037068	Ga0373925_0018425	Ga0373925_0018425_2590_3279	229
1459	3300037068	Ga0373925_0117670	Ga0373925_0117670_983_1675	229
1460	3300037471	Ga0395905_0047278	Ga0395905_0047278_1640_2365	229
1461	3300039447	Ga0436361_0480442	Ga0436361_0480442_1289_1978	229
1462	3300039447	Ga0436361_0577732	Ga0436361_0577732_6111_6800	229
1463	3300039447	Ga0436361_0729073	Ga0436361_0729073_244_939	229
1464	3300039447	Ga0436361_0758695	Ga0436361_0758695_2991_3680	229
1465	3300041404	Ga0439436_0022976	Ga0439436_0022976_661_1365	229
1466	3300042134	Ga0450898_031323	Ga0450898_031323_88_777	229
1467	3300042184	Ga0450908_027615	Ga0450908_027615_262_951	229
1468	3300042876	Ga0451577_0003569	Ga0451577_0003569_7924_8649	229
1469	3300042876	Ga0451577_0007096	Ga0451577_0007096_8610_9305	229
1470	3300044656	Ga0466969_0005354	Ga0466969_0005354_4760_5470	229
1471	3300044683	Ga0466965_0244552	Ga0466965_0244552_95_799	229
1472	3300044684	Ga0466966_0040223	Ga0466966_0040223_1416_2126	229
1473	3300044693	Ga0466961_0000063	Ga0466961_0000063_940_1650	229
1474	3300044706	Ga0466964_0107096	Ga0466964_0107096_448_1158	229
1475	3300044712	Ga0453684_0000638	Ga0453684_0000638_40546_41244	229
1476	3300044712	Ga0453684_0127173	Ga0453684_0127173_1711_2406	229
1477	3300044712	Ga0453684_0372736	Ga0453684_0372736_171_860	229
1478	3300045049	Ga0466959_0076619	Ga0466959_0076619_252_962	229
1479	3300045051	Ga0451576_0000006	Ga0451576_0000006_298199_298897	229
1480	3300045051	Ga0451576_0086803	Ga0451576_0086803_2194_2883	229
1481	3300046459	Ga0495629_0123444	Ga0495629_0123444_740_1435	229
1482	3300046463	Ga0495653_0048434	Ga0495653_0048434_1302_2000	229
1483	3300046474	Ga0495605_0023326	Ga0495605_0023326_905_1594	229
1484	3300046491	Ga0495584_0140154	Ga0495584_0140154_245_934	229
1485	3300046492	Ga0495585_0002115	Ga0495585_0002115_9853_10560	229
1486	3300046500	Ga0495596_0000845	Ga0495596_0000845_14356_15045	229
1487	3300046501	Ga0495607_0000168	Ga0495607_0000168_51893_52597	229
1488	3300046501	Ga0495607_0016273	Ga0495607_0016273_3307_3996	229
1489	3300046512	Ga0495610_0003098	Ga0495610_0003098_11477_12166	229
1490	3300046512	Ga0495610_0111657	Ga0495610_0111657_281_976	229
1491	3300046513	Ga0495616_0008782	Ga0495616_0008782_4559_5248	229
1492	3300046516	Ga0495628_0219874	Ga0495628_0219874_567_1265	229
1493	3300046517	Ga0495630_0011247	Ga0495630_0011247_1650_2348	229
1494	3300046520	Ga0495637_0020974	Ga0495637_0020974_1589_2284	229
1495	3300046526	Ga0495666_0011301	Ga0495666_0011301_3495_4193	229
1496	3300046538	Ga0495609_0007032	Ga0495609_0007032_1622_2311	229
1497	3300046539	Ga0495621_0061218	Ga0495621_0061218_442_1137	229
1498	3300046615	Ga0495656_0088407	Ga0495656_0088407_241_930	229
1499	3300046642	Ga0495634_0021628	Ga0495634_0021628_559_1257	229
1500	3300046660	Ga0495625_0012083	Ga0495625_0012083_3684_4385	229
1501	3300046663	Ga0495635_0006014	Ga0495635_0006014_2991_3689	229
1502	3300046665	Ga0495661_0017791	Ga0495661_0017791_338_1027	229
1503	3300046681	Ga0495647_0059087	Ga0495647_0059087_668_1399	229
1504	3300046684	Ga0495669_0180784	Ga0495669_0180784_104_793	229
1505	3300046692	Ga0495671_0002939	Ga0495671_0002939_9312_10001	229
1506	3300046794	Ga0495589_0117416	Ga0495589_0117416_280_969	229
1507	3300046810	Ga0495660_0080310	Ga0495660_0080310_847_1554	229
1508	3300047317	Ga0495604_0057154	Ga0495604_0057154_900_1598	229
1509	3300047319	Ga0495674_0038211	Ga0495674_0038211_626_1324	229
1510	3300047320	Ga0495672_0057760	Ga0495672_0057760_1313_2002	229
1511	3300047322	Ga0495680_0009587	Ga0495680_0009587_3046_3744	229
1512	3300047322	Ga0495680_0264549	Ga0495680_0264549_57_746	229
1513	3300047673	Ga0495593_0025711	Ga0495593_0025711_1361_2059	229
1514	3300048091	Ga0495626_0046304	Ga0495626_0046304_359_1063	229
1515	3300048905	Ga0496102_0003762	Ga0496102_0003762_7154_7852	229
1516	3300048905	Ga0496102_0361009	Ga0496102_0361009_590_1279	229
1517	3300048906	Ga0496103_0005308	Ga0496103_0005308_3069_3767	229
1518	3300048907	Ga0496104_0152220	Ga0496104_0152220_1210_1902	229
1519	3300048911	Ga0496108_0131094	Ga0496108_0131094_661_1353	229
1520	3300048916	Ga0496113_0073295	Ga0496113_0073295_644_1336	229
1521	3300048917	Ga0496114_0077684	Ga0496114_0077684_90_779	229
1522	3300048917	Ga0496114_0453386	Ga0496114_0453386_252_950	229
1523	3300048918	Ga0496115_0239005	Ga0496115_0239005_572_1270	229
1524	3300048919	Ga0496116_0008615	Ga0496116_0008615_5624_6325	229
1525	3300048919	Ga0496116_0017083	Ga0496116_0017083_3331_4020	229
1526	3300048919	Ga0496116_0026135	Ga0496116_0026135_2877_3575	229
1527	3300048920	Ga0496117_0027188	Ga0496117_0027188_596_1294	229
1528	3300048921	Ga0496118_0013882	Ga0496118_0013882_2886_3584	229
1529	3300048921	Ga0496118_0037524	Ga0496118_0037524_799_1500	229
1530	3300048921	Ga0496118_0271042	Ga0496118_0271042_22_717	229
1531	3300048924	Ga0496121_0027352	Ga0496121_0027352_3454_4143	229
1532	3300048924	Ga0496121_0033530	Ga0496121_0033530_1447_2145	229
1533	3300048924	Ga0496121_0079343	Ga0496121_0079343_1507_2202	229
1534	3300048924	Ga0496121_0134452	Ga0496121_0134452_342_1040	229
1535	3300048925	Ga0496122_0001889	Ga0496122_0001889_2472_3173	229
1536	3300048925	Ga0496122_0021375	Ga0496122_0021375_1836_2525	229
1537	3300048926	Ga0496123_0001035	Ga0496123_0001035_13055_13756	229
1538	3300048926	Ga0496123_0005043	Ga0496123_0005043_3327_4016	229
1539	3300048926	Ga0496123_0144085	Ga0496123_0144085_266_976	229
1540	3300048927	Ga0496124_0154682	Ga0496124_0154682_435_1136	229
1541	3300048928	Ga0496125_0001627	Ga0496125_0001627_28414_29115	229
1542	3300048928	Ga0496125_0035265	Ga0496125_0035265_2696_3397	229
1543	3300048929	Ga0496126_0147082	Ga0496126_0147082_647_1345	229
1544	3300048929	Ga0496126_0399186	Ga0496126_0399186_87_776	229
1545	3300049569	Ga0501032_0051940	Ga0501032_0051940_1918_2613	229
1546	3300049570	Ga0501033_0229546	Ga0501033_0229546_29_718	229
1547	3300049571	Ga0501034_0001631	Ga0501034_0001631_1816_2520	229
1548	3300049571	Ga0501034_0001676	Ga0501034_0001676_25975_26664	229
1549	3300049573	Ga0501037_0006245	Ga0501037_0006245_3216_3917	229
1550	3300049573	Ga0501037_0043890	Ga0501037_0043890_752_1447	229
1551	3300049573	Ga0501037_0176946	Ga0501037_0176946_789_1478	229
1552	3300049574	Ga0501038_0014079	Ga0501038_0014079_1795_2490	229
1553	3300049577	Ga0501041_0290940	Ga0501041_0290940_124_819	229
1554	3300049580	Ga0501046_0075519	Ga0501046_0075519_1730_2425	229
1555	3300049581	Ga0501047_0192725	Ga0501047_0192725_560_1261	229
1556	3300049586	Ga0501070_0014083	Ga0501070_0014083_1785_2480	229
1557	3300049586	Ga0501070_0072416	Ga0501070_0072416_1625_2326	229
1558	3300049586	Ga0501070_0350879	Ga0501070_0350879_305_1000	229
1559	3300049589	Ga0501073_0177549	Ga0501073_0177549_501_1202	229
1560	3300049590	Ga0501074_0024606	Ga0501074_0024606_991_1692	229
1561	3300049590	Ga0501074_0096559	Ga0501074_0096559_1251_1946	229
1562	3300049679	Ga0501249_004794	Ga0501249_004794_422_1117	229
1563	3300049742	Ga0501080_0067450	Ga0501080_0067450_1186_1887	229
1564	3300049742	Ga0501080_0497143	Ga0501080_0497143_364_1080	229
1565	3300050489	nmdc:mga03683_20528_c2	nmdc:mga03683_20528_c2_386_1075	229
1566	3300050489	nmdc:mga03683_49742_c1	nmdc:mga03683_49742_c1_590_1279	229
1567	3300050489	nmdc:mga03683_78429_c1	nmdc:mga03683_78429_c1_491_1225	229
1568	3300050490	nmdc:mga03n38_65141_c1	nmdc:mga03n38_65141_c1_668_1357	229
1569	3300050490	nmdc:mga03n38_66398_c1	nmdc:mga03n38_66398_c1_341_1030	229
1570	3300050491	nmdc:mga00v17_71453_c1	nmdc:mga00v17_71453_c1_1340_2029	229
1571	3300050493	nmdc:mga0k408_160956_c1	nmdc:mga0k408_160956_c1_268_957	229
1572	3300050493	nmdc:mga0k408_57278_c1	nmdc:mga0k408_57278_c1_155_844	229
1573	3300050494	nmdc:mga06z11_34173_c1	nmdc:mga06z11_34173_c1_204_893	229
1574	3300050496	nmdc:mga07m45_3985_c1	nmdc:mga07m45_3985_c1_50_739	229
1575	3300050496	nmdc:mga07m45_52956_c1	nmdc:mga07m45_52956_c1_750_1475	229
1576	3300050508	nmdc:mga09592_27300_c1	nmdc:mga09592_27300_c1_718_1410	229
1577	3300050508	nmdc:mga09592_6607_c1	nmdc:mga09592_6607_c1_2953_3672	229
1578	3300050509	nmdc:mga0qj67_28165_c1	nmdc:mga0qj67_28165_c1_1931_2650	229
1579	3300050509	nmdc:mga0qj67_86934_c1	nmdc:mga0qj67_86934_c1_582_1313	229
1580	3300050510	nmdc:mga06r32_4702_c1	nmdc:mga06r32_4702_c1_4173_4892	229
1581	3300050511	nmdc:mga08y16_813_c1	nmdc:mga08y16_813_c1_12273_12965	229
1582	3300053090	Ga0500646_0130090	Ga0500646_0130090_21_722	229
1583	3300003792	Ga0055540_1005861	Ga0055540_10058615	230
1584	3300005327	Ga0070658_10020398	Ga0070658_100203984	230
1585	3300005334	Ga0068869_100090348	Ga0068869_1000903483	230
1586	3300005338	Ga0068868_100158985	Ga0068868_1001589852	230
1587	3300005354	Ga0070675_100574570	Ga0070675_1005745701	230
1588	3300005367	Ga0070667_100258079	Ga0070667_1002580792	230
1589	3300005455	Ga0070663_100047832	Ga0070663_1000478322	230
1590	3300005457	Ga0070662_100024237	Ga0070662_1000242372	230
1591	3300005539	Ga0068853_100106151	Ga0068853_1001061511	230
1592	3300005577	Ga0068857_100121119	Ga0068857_1001211192	230
1593	3300005614	Ga0068856_100132625	Ga0068856_1001326253	230
1594	3300006051	Ga0075364_10006815	Ga0075364_100068157	230
1595	3300006177	Ga0075362_10024655	Ga0075362_100246552	230
1596	3300006177	Ga0075362_10042559	Ga0075362_100425592	230
1597	3300006178	Ga0075367_10021384	Ga0075367_100213843	230
1598	3300006186	Ga0075369_10004388	Ga0075369_100043884	230
1599	3300006186	Ga0075369_10043813	Ga0075369_100438132	230
1600	3300006353	Ga0075370_10008903	Ga0075370_100089034	230
1601	3300006353	Ga0075370_10065203	Ga0075370_100652032	230
1602	3300006353	Ga0075370_10092804	Ga0075370_100928041	230
1603	3300006844	Ga0075428_100851493	Ga0075428_1008514932	230
1604	3300009093	Ga0105240_11061240	Ga0105240_110612401	230
1605	3300021361	Ga0213872_10001048	Ga0213872_100010484	230
1606	3300025304	Ga0209257_1018826	Ga0209257_10188263	230
1607	3300025903	Ga0207680_10380562	Ga0207680_103805621	230
1608	3300025908	Ga0207643_10239896	Ga0207643_102398962	230
1609	3300025914	Ga0207671_10026082	Ga0207671_100260823	230
1610	3300025942	Ga0207689_10049399	Ga0207689_100493994	230
1611	3300026041	Ga0207639_10203730	Ga0207639_102037302	230
1612	3300026067	Ga0207678_10026063	Ga0207678_100260635	230
1613	3300026078	Ga0207702_10330108	Ga0207702_103301082	230
1614	3300026116	Ga0207674_10063088	Ga0207674_100630882	230
1615	3300026142	Ga0207698_10350177	Ga0207698_103501772	230
1616	3300028786	Ga0307517_10091067	Ga0307517_100910673	230
1617	3300028794	Ga0307515_10000553	Ga0307515_1000055374	230
1618	3300030522	Ga0307512_10037055	Ga0307512_100370554	230
1619	3300031250	Ga0265331_10000961	Ga0265331_100009619	230
1620	3300031251	Ga0265327_10000136	Ga0265327_1000013654	230
1621	3300031456	Ga0307513_10002530	Ga0307513_1000253014	230
1622	3300031456	Ga0307513_10131893	Ga0307513_101318933	230
1623	3300031649	Ga0307514_10000890	Ga0307514_1000089039	230
1624	3300031911	Ga0307412_10513262	Ga0307412_105132622	230
1625	3300037312	Ga0395899_0011804	Ga0395899_0011804_5150_5869	230
1626	3300037312	Ga0395899_0027806	Ga0395899_0027806_3376_4068	230
1627	3300037418	Ga0395900_0002450	Ga0395900_0002450_14727_15419	230
1628	3300037418	Ga0395900_0434678	Ga0395900_0434678_256_975	230
1629	3300037466	Ga0395898_0008670	Ga0395898_0008670_10008_10700	230
1630	3300037471	Ga0395905_0000430	Ga0395905_0000430_20816_21508	230
1631	3300037471	Ga0395905_0011147	Ga0395905_0011147_2050_2742	230
1632	3300037471	Ga0395905_0071088	Ga0395905_0071088_572_1267	230
1633	3300037471	Ga0395905_0076281	Ga0395905_0076281_727_1440	230
1634	3300037471	Ga0395905_0081585	Ga0395905_0081585_1898_2608	230
1635	3300037471	Ga0395905_0305397	Ga0395905_0305397_514_1206	230
1636	3300038443	Ga0395901_0210846	Ga0395901_0210846_278_973	230
1637	3300041404	Ga0439436_0082950	Ga0439436_0082950_18_719	230
1638	3300041410	Ga0439461_0024117	Ga0439461_0024117_46_747	230
1639	3300042005	Ga0439448_0061901	Ga0439448_0061901_397_1089	230
1640	3300042012	Ga0439455_0041003	Ga0439455_0041003_90_782	230
1641	3300042127	Ga0450890_006963	Ga0450890_006963_643_1335	230
1642	3300042134	Ga0450898_010462	Ga0450898_010462_33_734	230
1643	3300042156	Ga0439446_0059468	Ga0439446_0059468_217_918	230
1644	3300042461	Ga0439460_0053400	Ga0439460_0053400_71_766	230
1645	3300042876	Ga0451577_0077921	Ga0451577_0077921_255_1001	230
1646	3300044656	Ga0466969_0078172	Ga0466969_0078172_535_1251	230
1647	3300044673	Ga0453683_0005183	Ga0453683_0005183_2791_3552	230
1648	3300044712	Ga0453684_0543791	Ga0453684_0543791_304_1020	230
1649	3300044842	Ga0466957_0320216	Ga0466957_0320216_334_1026	230
1650	3300045051	Ga0451576_0008116	Ga0451576_0008116_10927_11688	230
1651	3300046507	Ga0495606_0086745	Ga0495606_0086745_376_1098	230
1652	3300046660	Ga0495625_0081824	Ga0495625_0081824_861_1583	230
1653	3300049649	Ga0501198_000009	Ga0501198_000009_16037_16732	230
1654	3300049662	Ga0501222_000001	Ga0501222_000001_168227_168922	230
1655	3300050489	nmdc:mga03683_70388_c1	nmdc:mga03683_70388_c1_28_834	230
1656	3300050489	nmdc:mga03683_7192_c1	nmdc:mga03683_7192_c1_786_1526	230
1657	3300050490	nmdc:mga03n38_66632_c1	nmdc:mga03n38_66632_c1_52_792	230
1658	3300050491	nmdc:mga00v17_55686_c1	nmdc:mga00v17_55686_c1_342_1082	230
1659	3300050494	nmdc:mga06z11_10777_c1	nmdc:mga06z11_10777_c1_2827_3567	230
1660	3300050495	nmdc:mga04h51_2462_c1	nmdc:mga04h51_2462_c1_3343_4083	230
1661	3300050496	nmdc:mga07m45_17508_c1	nmdc:mga07m45_17508_c1_577_1317	230
1662	3300053136	Ga0500559_0002776	Ga0500559_0002776_5344_6045	230
1663	3300053136	Ga0500559_0010151	Ga0500559_0010151_3259_3960	230
1664	3300053140	Ga0500573_0011721	Ga0500573_0011721_1207_1908	230
1665	3300001979	JGI24740J21852_10003346	JGI24740J21852_100033462	231
1666	3300001989	JGI24739J22299_10035783	JGI24739J22299_100357832	231
1667	3300001990	JGI24737J22298_10014452	JGI24737J22298_100144522	231
1668	3300002067	JGI24735J21928_10001085	JGI24735J21928_100010856	231
1669	3300002739	JGI25158J39367_1002379	JGI25158J39367_10023793	231
1670	3300002774	JGI25150J39212_1000950	JGI25150J39212_10009502	231
1671	3300002987	JGI25159J45721_1021163	JGI25159J45721_10211632	231
1672	3300003187	JGI25151J46595_10000618	JGI25151J46595_100006185	231
1673	3300003187	JGI25151J46595_10004874	JGI25151J46595_100048743	231
1674	3300003354	JGI25160J50197_1016798	JGI25160J50197_10167983	231
1675	3300003374	JGI25161J50226_1012958	JGI25161J50226_10129581	231
1676	3300003578	Ga0006562J51391_1049265	Ga0006562J51391_10492654	231
1677	3300003578	Ga0006562J51391_1049268	Ga0006562J51391_10492681	231
1678	3300003760	Ga0055527_1004273	Ga0055527_10042732	231
1679	3300003761	Ga0055535_1000192	Ga0055535_100019220	231
1680	3300003762	Ga0055542_1000058	Ga0055542_100005863	231
1681	3300003771	Ga0055526_1048857	Ga0055526_10488571	231
1682	3300003773	Ga0055537_1000117	Ga0055537_100011738	231
1683	3300003775	Ga0055524_1048229	Ga0055524_10482292	231
1684	3300003781	Ga0055536_1008554	Ga0055536_10085542	231
1685	3300003784	Ga0055534_1000160	Ga0055534_10001602	231
1686	3300003784	Ga0055534_1012283	Ga0055534_10122832	231
1687	3300003790	Ga0055528_1006002	Ga0055528_10060022	231
1688	3300003790	Ga0055528_1015417	Ga0055528_10154172	231
1689	3300003791	Ga0055530_10000386	Ga0055530_1000038622	231
1690	3300003791	Ga0055530_10003883	Ga0055530_100038831	231
1691	3300003792	Ga0055540_1006933	Ga0055540_10069335	231
1692	3300004625	Ga0055543_1000922	Ga0055543_100092216	231
1693	3300005262	Ga0065165_1001411	Ga0065165_100141120	231
1694	3300005262	Ga0065165_1002803	Ga0065165_100280316	231
1695	3300005262	Ga0065165_1022031	Ga0065165_10220311	231
1696	3300005331	Ga0070670_100006483	Ga0070670_1000064835	231
1697	3300005331	Ga0070670_100145152	Ga0070670_1001451522	231
1698	3300005336	Ga0070680_100554496	Ga0070680_1005544961	231
1699	3300005344	Ga0070661_100210599	Ga0070661_1002105992	231
1700	3300005347	Ga0070668_100001632	Ga0070668_10000163210	231
1701	3300005353	Ga0070669_100003551	Ga0070669_1000035513	231
1702	3300005354	Ga0070675_100010453	Ga0070675_1000104535	231
1703	3300005355	Ga0070671_100104101	Ga0070671_1001041012	231
1704	3300005355	Ga0070671_100622227	Ga0070671_1006222271	231
1705	3300005364	Ga0070673_100046760	Ga0070673_1000467604	231
1706	3300005367	Ga0070667_100437669	Ga0070667_1004376692	231
1707	3300005438	Ga0070701_10319519	Ga0070701_103195191	231
1708	3300005455	Ga0070663_100027249	Ga0070663_1000272493	231
1709	3300005457	Ga0070662_100452784	Ga0070662_1004527841	231
1710	3300005539	Ga0068853_100018334	Ga0068853_1000183345	231
1711	3300005539	Ga0068853_100491673	Ga0068853_1004916732	231
1712	3300005543	Ga0070672_100000122	Ga0070672_10000012225	231
1713	3300005548	Ga0070665_100210128	Ga0070665_1002101282	231
1714	3300005564	Ga0070664_100041429	Ga0070664_1000414295	231
1715	3300005578	Ga0068854_100084139	Ga0068854_1000841393	231
1716	3300005616	Ga0068852_100102318	Ga0068852_1001023183	231
1717	3300005618	Ga0068864_100006357	Ga0068864_1000063575	231
1718	3300005618	Ga0068864_100044978	Ga0068864_1000449784	231
1719	3300005618	Ga0068864_100366429	Ga0068864_1003664291	231
1720	3300005719	Ga0068861_100014337	Ga0068861_1000143377	231
1721	3300005834	Ga0068851_10001286	Ga0068851_1000128610	231
1722	3300005841	Ga0068863_100012954	Ga0068863_1000129549	231
1723	3300005843	Ga0068860_100037173	Ga0068860_1000371732	231
1724	3300006048	Ga0075363_100077803	Ga0075363_1000778032	231
1725	3300006048	Ga0075363_100098934	Ga0075363_1000989342	231
1726	3300006051	Ga0075364_10273717	Ga0075364_102737172	231
1727	3300006051	Ga0075364_10326001	Ga0075364_103260012	231
1728	3300006178	Ga0075367_10021045	Ga0075367_100210452	231
1729	3300006178	Ga0075367_10055447	Ga0075367_100554473	231
1730	3300006186	Ga0075369_10012626	Ga0075369_100126262	231
1731	3300006195	Ga0075366_10047540	Ga0075366_100475402	231
1732	3300006237	Ga0097621_100171388	Ga0097621_1001713882	231
1733	3300006353	Ga0075370_10007818	Ga0075370_100078182	231
1734	3300006353	Ga0075370_10079394	Ga0075370_100793944	231
1735	3300006353	Ga0075370_10083347	Ga0075370_100833471	231
1736	3300006353	Ga0075370_10091803	Ga0075370_100918032	231
1737	3300006881	Ga0068865_100138926	Ga0068865_1001389262	231
1738	3300006948	Ga0099826_10001010	Ga0099826_100010107	231
1739	3300006948	Ga0099826_10315145	Ga0099826_103151451	231
1740	3300009011	Ga0105251_10001090	Ga0105251_1000109011	231
1741	3300009036	Ga0105244_10011233	Ga0105244_100112333	231
1742	3300009036	Ga0105244_10084025	Ga0105244_100840252	231
1743	3300009036	Ga0105244_10110196	Ga0105244_101101962	231
1744	3300009093	Ga0105240_10030539	Ga0105240_100305397	231
1745	3300009098	Ga0105245_10698759	Ga0105245_106987591	231
1746	3300009148	Ga0105243_10000294	Ga0105243_1000029428	231
1747	3300009148	Ga0105243_10002909	Ga0105243_1000290916	231
1748	3300009174	Ga0105241_10090716	Ga0105241_100907162	231
1749	3300009174	Ga0105241_10134536	Ga0105241_101345362	231
1750	3300009551	Ga0105238_10346813	Ga0105238_103468132	231
1751	3300010375	Ga0105239_10345836	Ga0105239_103458362	231
1752	3300012502	Ga0157347_1000091	Ga0157347_10000915	231
1753	3300013100	Ga0157373_10034000	Ga0157373_100340003	231
1754	3300013105	Ga0157369_10087925	Ga0157369_100879252	231
1755	3300013296	Ga0157374_10045419	Ga0157374_100454194	231
1756	3300013297	Ga0157378_10907238	Ga0157378_109072382	231
1757	3300013306	Ga0163162_10113653	Ga0163162_101136532	231
1758	3300013306	Ga0163162_10380431	Ga0163162_103804312	231
1759	3300013308	Ga0157375_10002705	Ga0157375_1000270514	231
1760	3300014325	Ga0163163_10005378	Ga0163163_100053782	231
1761	3300014325	Ga0163163_11358933	Ga0163163_113589331	231
1762	3300014326	Ga0157380_10112756	Ga0157380_101127562	231
1763	3300014497	Ga0182008_10000056	Ga0182008_1000005676	231
1764	3300014497	Ga0182008_10058687	Ga0182008_100586872	231
1765	3300014745	Ga0157377_10000010	Ga0157377_10000010230	231
1766	3300014969	Ga0157376_10349352	Ga0157376_103493522	231
1767	3300015261	Ga0182006_1000030	Ga0182006_1000030111	231
1768	3300015262	Ga0182007_10000157	Ga0182007_1000015727	231
1769	3300015262	Ga0182007_10142539	Ga0182007_101425391	231
1770	3300015265	Ga0182005_1000021	Ga0182005_1000021121	231
1771	3300015265	Ga0182005_1067919	Ga0182005_10679191	231
1772	3300017792	Ga0163161_10000268	Ga0163161_1000026826	231
1773	3300017792	Ga0163161_10049356	Ga0163161_100493564	231
1774	3300017792	Ga0163161_10058829	Ga0163161_100588293	231
1775	3300017792	Ga0163161_10067158	Ga0163161_100671582	231
1776	3300017792	Ga0163161_10097129	Ga0163161_100971291	231
1777	3300021361	Ga0213872_10001180	Ga0213872_1000118014	231
1778	3300025228	Ga0209672_100539	Ga0209672_1005395	231
1779	3300025229	Ga0209147_101056	Ga0209147_1010563	231
1780	3300025242	Ga0209258_100147	Ga0209258_10014792	231
1781	3300025245	Ga0207425_1002058	Ga0207425_100205810	231
1782	3300025254	Ga0209148_1000122	Ga0209148_100012263	231
1783	3300025256	Ga0209759_1000937	Ga0209759_100093721	231
1784	3300025258	Ga0209129_1000177	Ga0209129_10001772	231
1785	3300025263	Ga0209565_1000129	Ga0209565_100012940	231
1786	3300025263	Ga0209565_1000248	Ga0209565_10002482	231
1787	3300025263	Ga0209565_1001459	Ga0209565_10014592	231
1788	3300025272	Ga0209455_1000030	Ga0209455_1000030273	231
1789	3300025273	Ga0209673_1000247	Ga0209673_100024740	231
1790	3300025273	Ga0209673_1000377	Ga0209673_100037727	231
1791	3300025273	Ga0209673_1000681	Ga0209673_10006811	231
1792	3300025273	Ga0209673_1006321	Ga0209673_10063213	231
1793	3300025284	Ga0209130_1000218	Ga0209130_100021819	231
1794	3300025284	Ga0209130_1006485	Ga0209130_10064855	231
1795	3300025291	Ga0209675_1000093	Ga0209675_100009340	231
1796	3300025291	Ga0209675_1000673	Ga0209675_100067312	231
1797	3300025291	Ga0209675_1001146	Ga0209675_100114619	231
1798	3300025291	Ga0209675_1010628	Ga0209675_10106283	231
1799	3300025292	Ga0209676_1000202	Ga0209676_100020264	231
1800	3300025292	Ga0209676_1000623	Ga0209676_100062323	231
1801	3300025292	Ga0209676_1001463	Ga0209676_10014634	231
1802	3300025292	Ga0209676_1057990	Ga0209676_10579901	231
1803	3300025294	Ga0209025_1000145	Ga0209025_100014556	231
1804	3300025294	Ga0209025_1000285	Ga0209025_100028551	231
1805	3300025294	Ga0209025_1000322	Ga0209025_10003222	231
1806	3300025294	Ga0209025_1012464	Ga0209025_10124642	231
1807	3300025294	Ga0209025_1024725	Ga0209025_10247252	231
1808	3300025295	Ga0209564_1000223	Ga0209564_1000223111	231
1809	3300025295	Ga0209564_1000226	Ga0209564_100022621	231
1810	3300025297	Ga0209758_1000142	Ga0209758_100014259	231
1811	3300025297	Ga0209758_1006873	Ga0209758_10068734	231
1812	3300025298	Ga0209050_1000224	Ga0209050_100022422	231
1813	3300025298	Ga0209050_1008421	Ga0209050_10084213	231
1814	3300025298	Ga0209050_1074607	Ga0209050_10746071	231
1815	3300025299	Ga0209256_1000114	Ga0209256_100011459	231
1816	3300025299	Ga0209256_1000174	Ga0209256_1000174111	231
1817	3300025299	Ga0209256_1027990	Ga0209256_10279903	231
1818	3300025302	Ga0207426_1000162	Ga0207426_100016258	231
1819	3300025302	Ga0207426_1000232	Ga0207426_1000232111	231
1820	3300025302	Ga0207426_1005734	Ga0207426_10057344	231
1821	3300025303	Ga0209051_1000112	Ga0209051_100011284	231
1822	3300025303	Ga0209051_1000497	Ga0209051_100049734	231
1823	3300025303	Ga0209051_1000565	Ga0209051_100056522	231
1824	3300025303	Ga0209051_1020922	Ga0209051_10209223	231
1825	3300025304	Ga0209257_1000163	Ga0209257_1000163110	231
1826	3300025304	Ga0209257_1000290	Ga0209257_100029053	231
1827	3300025304	Ga0209257_1015558	Ga0209257_10155583	231
1828	3300025304	Ga0209257_1021000	Ga0209257_10210001	231
1829	3300025315	Ga0207697_10039977	Ga0207697_100399772	231
1830	3300025728	Ga0207655_1000991	Ga0207655_100099115	231
1831	3300025735	Ga0207713_1002908	Ga0207713_10029085	231
1832	3300025904	Ga0207647_10064765	Ga0207647_100647653	231
1833	3300025911	Ga0207654_10092817	Ga0207654_100928172	231
1834	3300025913	Ga0207695_10299314	Ga0207695_102993142	231
1835	3300025914	Ga0207671_10089104	Ga0207671_100891042	231
1836	3300025923	Ga0207681_10056645	Ga0207681_100566453	231
1837	3300025925	Ga0207650_10007494	Ga0207650_100074946	231
1838	3300025925	Ga0207650_10057794	Ga0207650_100577944	231
1839	3300025926	Ga0207659_10071985	Ga0207659_100719853	231
1840	3300025933	Ga0207706_10012164	Ga0207706_100121641	231
1841	3300025933	Ga0207706_10023931	Ga0207706_100239314	231
1842	3300025933	Ga0207706_10108326	Ga0207706_101083262	231
1843	3300025935	Ga0207709_10000180	Ga0207709_1000018053	231
1844	3300025935	Ga0207709_10000990	Ga0207709_1000099017	231
1845	3300025935	Ga0207709_10001738	Ga0207709_1000173810	231
1846	3300025935	Ga0207709_10014241	Ga0207709_100142412	231
1847	3300025938	Ga0207704_10021353	Ga0207704_100213534	231
1848	3300025940	Ga0207691_10001181	Ga0207691_100011811	231
1849	3300025940	Ga0207691_10217308	Ga0207691_102173082	231
1850	3300025945	Ga0207679_10010506	Ga0207679_100105063	231
1851	3300025960	Ga0207651_10091694	Ga0207651_100916942	231
1852	3300025961	Ga0207712_10356437	Ga0207712_103564372	231
1853	3300025972	Ga0207668_10010232	Ga0207668_100102322	231
1854	3300025981	Ga0207640_10179609	Ga0207640_101796092	231
1855	3300025981	Ga0207640_10489163	Ga0207640_104891632	231
1856	3300026067	Ga0207678_10088310	Ga0207678_100883102	231
1857	3300026067	Ga0207678_10250934	Ga0207678_102509341	231
1858	3300026088	Ga0207641_10015326	Ga0207641_100153268	231
1859	3300026089	Ga0207648_10000002	Ga0207648_10000002167	231
1860	3300026095	Ga0207676_10017583	Ga0207676_100175832	231
1861	3300026095	Ga0207676_10024810	Ga0207676_100248104	231
1862	3300026116	Ga0207674_10075723	Ga0207674_100757232	231
1863	3300026118	Ga0207675_100024983	Ga0207675_1000249832	231
1864	3300026142	Ga0207698_10067097	Ga0207698_100670974	231
1865	3300026142	Ga0207698_10320463	Ga0207698_103204632	231
1866	3300026142	Ga0207698_10574659	Ga0207698_105746591	231
1867	3300027666	Ga0209282_1000187	Ga0209282_10001874	231
1868	3300028379	Ga0268266_10245605	Ga0268266_102456052	231
1869	3300028381	Ga0268264_10056540	Ga0268264_100565404	231
1870	3300028381	Ga0268264_10756077	Ga0268264_107560772	231
1871	3300030522	Ga0307512_10062296	Ga0307512_100622963	231
1872	3300030733	Ga0314311_1061190	Ga0314311_10611902	231
1873	3300030742	Ga0316183_1117584	Ga0316183_11175843	231
1874	3300030744	Ga0316181_1070832	Ga0316181_10708322	231
1875	3300031548	Ga0307408_100442500	Ga0307408_1004425002	231
1876	3300031548	Ga0307408_100503625	Ga0307408_1005036252	231
1877	3300031731	Ga0307405_10079132	Ga0307405_100791322	231
1878	3300031731	Ga0307405_10390299	Ga0307405_103902992	231
1879	3300031852	Ga0307410_10387958	Ga0307410_103879581	231
1880	3300031901	Ga0307406_10131731	Ga0307406_101317312	231
1881	3300031911	Ga0307412_10042635	Ga0307412_100426354	231
1882	3300031911	Ga0307412_10464858	Ga0307412_104648581	231
1883	3300031995	Ga0307409_100778323	Ga0307409_1007783232	231
1884	3300032002	Ga0307416_100027108	Ga0307416_1000271083	231
1885	3300032004	Ga0307414_10003103	Ga0307414_100031032	231
1886	3300032005	Ga0307411_10173850	Ga0307411_101738502	231
1887	3300032005	Ga0307411_10243460	Ga0307411_102434603	231
1888	3300035691	Ga0373931_0004169	Ga0373931_0004169_3351_4049	231
1889	3300035691	Ga0373931_0036152	Ga0373931_0036152_18_713	231
1890	3300035691	Ga0373931_0186719	Ga0373931_0186719_400_1110	231
1891	3300037471	Ga0395905_0381277	Ga0395905_0381277_51_746	231
1892	3300037471	Ga0395905_0382408	Ga0395905_0382408_561_1262	231
1893	3300039447	Ga0436361_0239425	Ga0436361_0239425_39020_39721	231
1894	3300039447	Ga0436361_0401117	Ga0436361_0401117_74_781	231
1895	3300039447	Ga0436361_1205905	Ga0436361_1205905_1968_2675	231
1896	3300041463	Ga0451804_0855014	Ga0451804_0855014_14_712	231
1897	3300042007	Ga0439449_0036513	Ga0439449_0036513_237_938	231
1898	3300042129	Ga0450891_000536	Ga0450891_000536_2085_2789	231
1899	3300042876	Ga0451577_0118844	Ga0451577_0118844_739_1476	231
1900	3300044656	Ga0466969_0002150	Ga0466969_0002150_9104_9799	231
1901	3300044673	Ga0453683_0120896	Ga0453683_0120896_608_1321	231
1902	3300044693	Ga0466961_0112383	Ga0466961_0112383_425_1120	231
1903	3300044693	Ga0466961_0153617	Ga0466961_0153617_323_1018	231
1904	3300045049	Ga0466959_0047263	Ga0466959_0047263_1700_2395	231
1905	3300045051	Ga0451576_0001248	Ga0451576_0001248_32582_33319	231
1906	3300045051	Ga0451576_0157984	Ga0451576_0157984_1568_2266	231
1907	3300045976	Ga0466967_0375153	Ga0466967_0375153_455_1150	231
1908	3300046452	Ga0495617_000104	Ga0495617_000104_17975_18676	231
1909	3300046453	Ga0495627_006620	Ga0495627_006620_1743_2444	231
1910	3300046453	Ga0495627_014124	Ga0495627_014124_1606_2316	231
1911	3300046453	Ga0495627_118272	Ga0495627_118272_16_717	231
1912	3300046457	Ga0495590_0001195	Ga0495590_0001195_2945_3640	231
1913	3300046460	Ga0495638_0048877	Ga0495638_0048877_376_1077	231
1914	3300046463	Ga0495653_0066805	Ga0495653_0066805_1540_2235	231
1915	3300046476	Ga0495662_0217779	Ga0495662_0217779_34_729	231
1916	3300046491	Ga0495584_0011925	Ga0495584_0011925_2451_3146	231
1917	3300046492	Ga0495585_0009756	Ga0495585_0009756_490_1191	231
1918	3300046500	Ga0495596_0014132	Ga0495596_0014132_1608_2309	231
1919	3300046506	Ga0495583_0095299	Ga0495583_0095299_325_1026	231
1920	3300046512	Ga0495610_0080903	Ga0495610_0080903_449_1150	231
1921	3300046513	Ga0495616_0000903	Ga0495616_0000903_589_1290	231
1922	3300046513	Ga0495616_0016818	Ga0495616_0016818_769_1470	231
1923	3300046513	Ga0495616_0107556	Ga0495616_0107556_60_761	231
1924	3300046515	Ga0495620_0025341	Ga0495620_0025341_1547_2248	231
1925	3300046515	Ga0495620_0026313	Ga0495620_0026313_1297_1992	231
1926	3300046518	Ga0495631_0023835	Ga0495631_0023835_1808_2509	231
1927	3300046518	Ga0495631_0060599	Ga0495631_0060599_275_976	231
1928	3300046519	Ga0495632_0075097	Ga0495632_0075097_311_1012	231
1929	3300046519	Ga0495632_0085308	Ga0495632_0085308_68_769	231
1930	3300046520	Ga0495637_0077408	Ga0495637_0077408_169_870	231
1931	3300046520	Ga0495637_0151903	Ga0495637_0151903_24_725	231
1932	3300046522	Ga0495643_0007173	Ga0495643_0007173_687_1388	231
1933	3300046523	Ga0495644_0079375	Ga0495644_0079375_261_962	231
1934	3300046524	Ga0495648_0029537	Ga0495648_0029537_297_998	231
1935	3300046526	Ga0495666_0230890	Ga0495666_0230890_116_811	231
1936	3300046528	Ga0495642_0064280	Ga0495642_0064280_237_938	231
1937	3300046528	Ga0495642_0177460	Ga0495642_0177460_41_742	231
1938	3300046530	Ga0495654_0045337	Ga0495654_0045337_624_1325	231
1939	3300046530	Ga0495654_0062536	Ga0495654_0062536_377_1078	231
1940	3300046530	Ga0495654_0092410	Ga0495654_0092410_152_853	231
1941	3300046530	Ga0495654_0098598	Ga0495654_0098598_50_751	231
1942	3300046531	Ga0495665_0285495	Ga0495665_0285495_83_778	231
1943	3300046542	Ga0495597_0017028	Ga0495597_0017028_2719_3414	231
1944	3300046557	Ga0495622_0029959	Ga0495622_0029959_982_1683	231
1945	3300046558	Ga0495633_0000392	Ga0495633_0000392_15859_16560	231
1946	3300046648	Ga0495611_0163716	Ga0495611_0163716_275_976	231
1947	3300046648	Ga0495611_0211535	Ga0495611_0211535_107_808	231
1948	3300046660	Ga0495625_0000585	Ga0495625_0000585_48782_49483	231
1949	3300046660	Ga0495625_0049799	Ga0495625_0049799_1616_2317	231
1950	3300046660	Ga0495625_0056717	Ga0495625_0056717_1621_2322	231
1951	3300046665	Ga0495661_0088426	Ga0495661_0088426_793_1494	231
1952	3300046674	Ga0495588_0018661	Ga0495588_0018661_2223_2924	231
1953	3300046674	Ga0495588_0105549	Ga0495588_0105549_96_797	231
1954	3300046680	Ga0495646_0067368	Ga0495646_0067368_871_1566	231
1955	3300046683	Ga0495658_0476935	Ga0495658_0476935_49_750	231
1956	3300046684	Ga0495669_0007918	Ga0495669_0007918_3283_3984	231
1957	3300046690	Ga0495624_0057583	Ga0495624_0057583_950_1645	231
1958	3300046690	Ga0495624_0169467	Ga0495624_0169467_409_1110	231
1959	3300046692	Ga0495671_0044412	Ga0495671_0044412_495_1196	231
1960	3300046694	Ga0495649_0013831	Ga0495649_0013831_3405_4106	231
1961	3300046694	Ga0495649_0080831	Ga0495649_0080831_375_1070	231
1962	3300046810	Ga0495660_0054253	Ga0495660_0054253_70_771	231
1963	3300047317	Ga0495604_0257776	Ga0495604_0257776_45_740	231
1964	3300047321	Ga0495676_0079455	Ga0495676_0079455_143_844	231
1965	3300047323	Ga0495683_0001290	Ga0495683_0001290_2437_3132	231
1966	3300047443	Ga0495687_000011	Ga0495687_000011_267698_268393	231
1967	3300047443	Ga0495687_008243	Ga0495687_008243_4891_5589	231
1968	3300047445	Ga0495677_0000159	Ga0495677_0000159_3520_4221	231
1969	3300047445	Ga0495677_0034592	Ga0495677_0034592_533_1234	231
1970	3300047470	Ga0495681_0067578	Ga0495681_0067578_262_963	231
1971	3300047472	Ga0495686_0000336	Ga0495686_0000336_37741_38442	231
1972	3300047472	Ga0495686_0070664	Ga0495686_0070664_1260_1961	231
1973	3300047673	Ga0495593_0026717	Ga0495593_0026717_1919_2620	231
1974	3300047673	Ga0495593_0069601	Ga0495593_0069601_646_1341	231
1975	3300047673	Ga0495593_0072986	Ga0495593_0072986_156_851	231
1976	3300047673	Ga0495593_0145392	Ga0495593_0145392_410_1105	231
1977	3300048088	Ga0495602_0446631	Ga0495602_0446631_146_847	231
1978	3300048089	Ga0495614_0025950	Ga0495614_0025950_1433_2134	231
1979	3300048091	Ga0495626_0013761	Ga0495626_0013761_3235_3936	231
1980	3300048903	Ga0496100_0113446	Ga0496100_0113446_431_1126	231
1981	3300048903	Ga0496100_0289320	Ga0496100_0289320_117_815	231
1982	3300048904	Ga0496101_0002730	Ga0496101_0002730_7422_8117	231
1983	3300048905	Ga0496102_0028843	Ga0496102_0028843_2040_2735	231
1984	3300048905	Ga0496102_0253468	Ga0496102_0253468_838_1536	231
1985	3300048905	Ga0496102_0367842	Ga0496102_0367842_227_922	231
1986	3300048906	Ga0496103_0077876	Ga0496103_0077876_340_1038	231
1987	3300048908	Ga0496105_0063144	Ga0496105_0063144_1768_2466	231
1988	3300048908	Ga0496105_0667884	Ga0496105_0667884_11_706	231
1989	3300048909	Ga0496106_0007666	Ga0496106_0007666_2928_3623	231
1990	3300048910	Ga0496107_0010382	Ga0496107_0010382_5146_5841	231
1991	3300048911	Ga0496108_0120800	Ga0496108_0120800_745_1443	231
1992	3300048911	Ga0496108_0605824	Ga0496108_0605824_91_789	231
1993	3300048913	Ga0496110_0050013	Ga0496110_0050013_1225_1920	231
1994	3300048914	Ga0496111_0073059	Ga0496111_0073059_938_1633	231
1995	3300048914	Ga0496111_0110505	Ga0496111_0110505_550_1248	231
1996	3300048914	Ga0496111_0112344	Ga0496111_0112344_45_746	231
1997	3300048914	Ga0496111_0529171	Ga0496111_0529171_104_808	231
1998	3300048917	Ga0496114_0034471	Ga0496114_0034471_774_1472	231
1999	3300048918	Ga0496115_0049418	Ga0496115_0049418_362_1147	231
2000	3300048919	Ga0496116_0002257	Ga0496116_0002257_16681_17376	231
2001	3300048919	Ga0496116_0004499	Ga0496116_0004499_10225_10926	231
2002	3300048919	Ga0496116_0013320	Ga0496116_0013320_5675_6376	231
2003	3300048919	Ga0496116_0028188	Ga0496116_0028188_1482_2186	231
2004	3300048919	Ga0496116_0090926	Ga0496116_0090926_543_1244	231
2005	3300048920	Ga0496117_0000056	Ga0496117_0000056_118354_119055	231
2006	3300048920	Ga0496117_0057237	Ga0496117_0057237_386_1090	231
2007	3300048920	Ga0496117_0098872	Ga0496117_0098872_367_1071	231
2008	3300048920	Ga0496117_0146888	Ga0496117_0146888_13_708	231
2009	3300048920	Ga0496117_0179640	Ga0496117_0179640_271_972	231
2010	3300048921	Ga0496118_0000047	Ga0496118_0000047_152363_153064	231
2011	3300048921	Ga0496118_0038148	Ga0496118_0038148_357_1052	231
2012	3300048921	Ga0496118_0063380	Ga0496118_0063380_1768_2469	231
2013	3300048921	Ga0496118_0067561	Ga0496118_0067561_1624_2328	231
2014	3300048921	Ga0496118_0140459	Ga0496118_0140459_616_1326	231
2015	3300048924	Ga0496121_0029861	Ga0496121_0029861_2040_2735	231
2016	3300048924	Ga0496121_0031139	Ga0496121_0031139_2883_3584	231
2017	3300048924	Ga0496121_0042351	Ga0496121_0042351_1639_2340	231
2018	3300048924	Ga0496121_0305963	Ga0496121_0305963_181_882	231
2019	3300048924	Ga0496121_0312140	Ga0496121_0312140_205_909	231
2020	3300048925	Ga0496122_0006768	Ga0496122_0006768_8219_8926	231
2021	3300048925	Ga0496122_0026404	Ga0496122_0026404_3903_4598	231
2022	3300048925	Ga0496122_0082332	Ga0496122_0082332_41_751	231
2023	3300048925	Ga0496122_0168349	Ga0496122_0168349_588_1289	231
2024	3300048925	Ga0496122_0232964	Ga0496122_0232964_40_741	231
2025	3300048926	Ga0496123_0007413	Ga0496123_0007413_5848_6555	231
2026	3300048926	Ga0496123_0008663	Ga0496123_0008663_6789_7484	231
2027	3300048926	Ga0496123_0115607	Ga0496123_0115607_143_844	231
2028	3300048926	Ga0496123_0183896	Ga0496123_0183896_276_986	231
2029	3300048926	Ga0496123_0194923	Ga0496123_0194923_290_994	231
2030	3300048927	Ga0496124_0015990	Ga0496124_0015990_584_1372	231
2031	3300048927	Ga0496124_0024341	Ga0496124_0024341_2937_3632	231
2032	3300048927	Ga0496124_0137867	Ga0496124_0137867_182_886	231
2033	3300048928	Ga0496125_0011361	Ga0496125_0011361_2939_3634	231
2034	3300048928	Ga0496125_0101081	Ga0496125_0101081_213_914	231
2035	3300048928	Ga0496125_0238469	Ga0496125_0238469_31_741	231
2036	3300049460	Ga0495682_0018157	Ga0495682_0018157_1252_1953	231
2037	3300049759	Ga0501262_000188	Ga0501262_000188_6771_7472	231
2038	3300050489	nmdc:mga03683_92418_c1	nmdc:mga03683_92418_c1_331_1032	231
2039	3300050493	nmdc:mga0k408_13276_c1	nmdc:mga0k408_13276_c1_3738_4433	231
2040	3300050494	nmdc:mga06z11_35814_c1	nmdc:mga06z11_35814_c1_345_1049	231
2041	3300050494	nmdc:mga06z11_93122_c1	nmdc:mga06z11_93122_c1_382_1092	231
2042	3300050496	nmdc:mga07m45_1005_c1	nmdc:mga07m45_1005_c1_4123_4818	231
2043	3300050496	nmdc:mga07m45_19020_c1	nmdc:mga07m45_19020_c1_956_1657	231
2044	3300050496	nmdc:mga07m45_198507_c1	nmdc:mga07m45_198507_c1_88_792	231
2045	3300050496	nmdc:mga07m45_2098_c1	nmdc:mga07m45_2098_c1_8514_9215	231
2046	3300050496	nmdc:mga07m45_21894_c1	nmdc:mga07m45_21894_c1_1695_2399	231
2047	3300050496	nmdc:mga07m45_51325_c1	nmdc:mga07m45_51325_c1_742_1440	231
2048	3300050496	nmdc:mga07m45_76778_c1	nmdc:mga07m45_76778_c1_912_1616	231
2049	3300053079	Ga0500610_0118470	Ga0500610_0118470_499_1344	231
2050	3300053079	Ga0500610_0121786	Ga0500610_0121786_202_903	231
2051	3300053087	Ga0500643_008921	Ga0500643_008921_1490_2191	231
2052	3300053093	Ga0500651_0000157	Ga0500651_0000157_41216_41917	231
2053	3300053110	Ga0500571_040087	Ga0500571_040087_1604_2305	231
2054	3300053116	Ga0500592_018307	Ga0500592_018307_352_1053	231
2055	3300053117	Ga0500593_017189	Ga0500593_017189_517_1218	231
2056	3300053118	Ga0500594_0034026	Ga0500594_0034026_301_1002	231
2057	3300053119	Ga0500595_110898	Ga0500595_110898_24_725	231
2058	3300053121	Ga0500607_024529	Ga0500607_024529_2177_2878	231
2059	3300053121	Ga0500607_147162	Ga0500607_147162_136_837	231
2060	3300053122	Ga0500608_044493	Ga0500608_044493_1001_1702	231
2061	3300053133	Ga0500655_003895	Ga0500655_003895_327_1028	231
2062	3300053134	Ga0500658_0006791	Ga0500658_0006791_2014_2715	231
2063	3300053134	Ga0500658_0015713	Ga0500658_0015713_1553_2254	231
2064	3300053136	Ga0500559_0026633	Ga0500559_0026633_126_827	231
2065	3300053137	Ga0500561_0061691	Ga0500561_0061691_125_826	231
2066	3300053139	Ga0500568_0009066	Ga0500568_0009066_431_1132	231
2067	3300053141	Ga0500574_038089	Ga0500574_038089_57_758	231
2068	3300053153	Ga0500616_0049064	Ga0500616_0049064_482_1183	231
2069	3300053157	Ga0500624_015760	Ga0500624_015760_314_1015	231
2070	3300053158	Ga0500627_0015511	Ga0500627_0015511_92_793	231
2071	3300053161	Ga0500634_0115971	Ga0500634_0115971_188_889	231
2072	3300053162	Ga0500638_036619	Ga0500638_036619_1295_1996	231
2073	3300053177	Ga0500636_0046449	Ga0500636_0046449_211_912	231
2074	3300053735	Ga0500596_018543	Ga0500596_018543_32_841	231
2075	iso_pu_bacteria	2831265667	2831269457	231
2076	iso_pu_bacteria	2945972063	2945974040	231
2077	3300001979	JGI24740J21852_10001524	JGI24740J21852_100015245	232
2078	3300001979	JGI24740J21852_10027159	JGI24740J21852_100271592	232
2079	3300001989	JGI24739J22299_10002337	JGI24739J22299_100023378	232
2080	3300001989	JGI24739J22299_10002468	JGI24739J22299_100024683	232
2081	3300001990	JGI24737J22298_10064773	JGI24737J22298_100647732	232
2082	3300002067	JGI24735J21928_10009375	JGI24735J21928_100093753	232
2083	3300002067	JGI24735J21928_10019460	JGI24735J21928_100194602	232
2084	3300002067	JGI24735J21928_10019885	JGI24735J21928_100198854	232
2085	3300002705	JGI25156J39149_1001322	JGI25156J39149_10013225	232
2086	3300002705	JGI25156J39149_1002033	JGI25156J39149_10020338	232
2087	3300002739	JGI25158J39367_1000991	JGI25158J39367_10009914	232
2088	3300002773	JGI25152J39213_1000152	JGI25152J39213_100015220	232
2089	3300002773	JGI25152J39213_1017287	JGI25152J39213_10172871	232
2090	3300002987	JGI25159J45721_1002607	JGI25159J45721_10026074	232
2091	3300002987	JGI25159J45721_1005461	JGI25159J45721_10054612	232
2092	3300003214	JGI25165J46597_1001003	JGI25165J46597_100100311	232
2093	3300003215	JGI25153J46596_10008024	JGI25153J46596_100080242	232
2094	3300003316	rootH1_10013764	rootH1_100137643	232
2095	3300003322	rootL2_10034186	rootL2_100341862	232
2096	3300003323	rootH1_10174403	rootH1_101744032	232
2097	3300003354	JGI25160J50197_1000171	JGI25160J50197_100017134	232
2098	3300003354	JGI25160J50197_1001086	JGI25160J50197_10010866	232
2099	3300003374	JGI25161J50226_1000635	JGI25161J50226_10006356	232
2100	3300003756	Ga0055533_1000557	Ga0055533_10005572	232
2101	3300003758	Ga0055532_1000001	Ga0055532_1000001974	232
2102	3300003760	Ga0055527_1000014	Ga0055527_100001430	232
2103	3300003760	Ga0055527_1000415	Ga0055527_10004157	232
2104	3300003760	Ga0055527_1002231	Ga0055527_10022315	232
2105	3300003761	Ga0055535_1000001	Ga0055535_100000130	232
2106	3300003761	Ga0055535_1000986	Ga0055535_10009869	232
2107	3300003761	Ga0055535_1001029	Ga0055535_10010297	232
2108	3300003762	Ga0055542_1000001	Ga0055542_1000001973	232
2109	3300003762	Ga0055542_1000984	Ga0055542_100098410	232
2110	3300003762	Ga0055542_1001409	Ga0055542_10014096	232
2111	3300003763	Ga0055529_1000001	Ga0055529_100000130	232
2112	3300003763	Ga0055529_1000791	Ga0055529_100079111	232
2113	3300003771	Ga0055526_1001230	Ga0055526_100123015	232
2114	3300003771	Ga0055526_1009528	Ga0055526_10095284	232
2115	3300003773	Ga0055537_1000040	Ga0055537_100004014	232
2116	3300003773	Ga0055537_1008407	Ga0055537_10084073	232
2117	3300003775	Ga0055524_1016214	Ga0055524_10162142	232
2118	3300003775	Ga0055524_1016660	Ga0055524_10166602	232
2119	3300003784	Ga0055534_1000315	Ga0055534_100031513	232
2120	3300003790	Ga0055528_1000031	Ga0055528_100003199	232
2121	3300003790	Ga0055528_1002137	Ga0055528_100213710	232
2122	3300003790	Ga0055528_1006806	Ga0055528_10068065	232
2123	3300003791	Ga0055530_10002767	Ga0055530_1000276710	232
2124	3300003791	Ga0055530_10007810	Ga0055530_100078102	232
2125	3300003792	Ga0055540_1000007	Ga0055540_1000007193	232
2126	3300003794	Ga0055531_10006757	Ga0055531_100067574	232
2127	3300003794	Ga0055531_10014710	Ga0055531_100147102	232
2128	3300003794	Ga0055531_10034347	Ga0055531_100343472	232
2129	3300003856	Ga0058692_1005548	Ga0058692_10055482	232
2130	3300003856	Ga0058692_1020145	Ga0058692_10201452	232
2131	3300004625	Ga0055543_1006104	Ga0055543_10061043	232
2132	3300005262	Ga0065165_1000466	Ga0065165_100046667	232
2133	3300005262	Ga0065165_1001400	Ga0065165_100140010	232
2134	3300005293	Ga0065715_10182275	Ga0065715_101822752	232
2135	3300005295	Ga0065707_10274740	Ga0065707_102747401	232
2136	3300005327	Ga0070658_10020322	Ga0070658_100203224	232
2137	3300005337	Ga0070682_100005788	Ga0070682_1000057887	232
2138	3300005339	Ga0070660_100000032	Ga0070660_10000003254	232
2139	3300005339	Ga0070660_100006752	Ga0070660_1000067525	232
2140	3300005339	Ga0070660_100012152	Ga0070660_1000121524	232
2141	3300005343	Ga0070687_100117303	Ga0070687_1001173032	232
2142	3300005344	Ga0070661_100077141	Ga0070661_1000771412	232
2143	3300005353	Ga0070669_100224106	Ga0070669_1002241062	232
2144	3300005364	Ga0070673_100119792	Ga0070673_1001197923	232
2145	3300005366	Ga0070659_100000035	Ga0070659_10000003587	232
2146	3300005366	Ga0070659_100001539	Ga0070659_10000153911	232
2147	3300005366	Ga0070659_100024164	Ga0070659_1000241643	232
2148	3300005367	Ga0070667_100004868	Ga0070667_1000048683	232
2149	3300005440	Ga0070705_100292699	Ga0070705_1002926992	232
2150	3300005440	Ga0070705_100457142	Ga0070705_1004571421	232
2151	3300005444	Ga0070694_100143518	Ga0070694_1001435182	232
2152	3300005455	Ga0070663_100000222	Ga0070663_10000022213	232
2153	3300005455	Ga0070663_100060728	Ga0070663_1000607282	232
2154	3300005455	Ga0070663_100267449	Ga0070663_1002674492	232
2155	3300005457	Ga0070662_100100347	Ga0070662_1001003472	232
2156	3300005457	Ga0070662_100583474	Ga0070662_1005834741	232
2157	3300005467	Ga0070706_100158670	Ga0070706_1001586702	232
2158	3300005468	Ga0070707_100454405	Ga0070707_1004544052	232
2159	3300005471	Ga0070698_100065470	Ga0070698_1000654703	232
2160	3300005518	Ga0070699_100315818	Ga0070699_1003158182	232
2161	3300005543	Ga0070672_100047269	Ga0070672_1000472692	232
2162	3300005544	Ga0070686_100348962	Ga0070686_1003489622	232
2163	3300005546	Ga0070696_100142217	Ga0070696_1001422171	232
2164	3300005547	Ga0070693_100036619	Ga0070693_1000366192	232
2165	3300005549	Ga0070704_100000704	Ga0070704_10000070415	232
2166	3300005549	Ga0070704_100068682	Ga0070704_1000686823	232
2167	3300005563	Ga0068855_100031855	Ga0068855_1000318556	232
2168	3300005564	Ga0070664_100001967	Ga0070664_1000019678	232
2169	3300005564	Ga0070664_100013666	Ga0070664_1000136667	232
2170	3300005577	Ga0068857_100163964	Ga0068857_1001639642	232
2171	3300005614	Ga0068856_100069165	Ga0068856_1000691654	232
2172	3300005616	Ga0068852_100049197	Ga0068852_1000491974	232
2173	3300005616	Ga0068852_100105674	Ga0068852_1001056742	232
2174	3300005617	Ga0068859_100010733	Ga0068859_1000107331	232
2175	3300005617	Ga0068859_100310386	Ga0068859_1003103862	232
2176	3300005844	Ga0068862_100020833	Ga0068862_1000208332	232
2177	3300005844	Ga0068862_100216477	Ga0068862_1002164771	232
2178	3300005844	Ga0068862_100554182	Ga0068862_1005541822	232
2179	3300006844	Ga0075428_100059086	Ga0075428_1000590865	232
2180	3300006847	Ga0075431_100109412	Ga0075431_1001094123	232
2181	3300006880	Ga0075429_100000175	Ga0075429_10000017513	232
2182	3300006931	Ga0097620_100010733	Ga0097620_1000107331	232
2183	3300006931	Ga0097620_100310397	Ga0097620_1003103972	232
2184	3300009011	Ga0105251_10080243	Ga0105251_100802432	232
2185	3300009093	Ga0105240_10005167	Ga0105240_1000516711	232
2186	3300009093	Ga0105240_10017231	Ga0105240_100172316	232
2187	3300009093	Ga0105240_10039409	Ga0105240_100394097	232
2188	3300009093	Ga0105240_10043049	Ga0105240_100430493	232
2189	3300009093	Ga0105240_10115118	Ga0105240_101151181	232
2190	3300009093	Ga0105240_10194877	Ga0105240_101948772	232
2191	3300009093	Ga0105240_10724171	Ga0105240_107241712	232
2192	3300009094	Ga0111539_10089797	Ga0111539_100897974	232
2193	3300009098	Ga0105245_10862516	Ga0105245_108625161	232
2194	3300009147	Ga0114129_10064378	Ga0114129_100643783	232
2195	3300009148	Ga0105243_10431552	Ga0105243_104315522	232
2196	3300009174	Ga0105241_10131890	Ga0105241_101318902	232
2197	3300009174	Ga0105241_10466269	Ga0105241_104662691	232
2198	3300009176	Ga0105242_10750250	Ga0105242_107502502	232
2199	3300009177	Ga0105248_10027054	Ga0105248_100270543	232
2200	3300009177	Ga0105248_10112439	Ga0105248_101124393	232
2201	3300009177	Ga0105248_10132467	Ga0105248_101324671	232
2202	3300009545	Ga0105237_10012408	Ga0105237_100124087	232
2203	3300009545	Ga0105237_10025475	Ga0105237_100254754	232
2204	3300009545	Ga0105237_10025973	Ga0105237_100259737	232
2205	3300009545	Ga0105237_10098438	Ga0105237_100984384	232
2206	3300009551	Ga0105238_10085510	Ga0105238_100855102	232
2207	3300009551	Ga0105238_10211673	Ga0105238_102116732	232
2208	3300009551	Ga0105238_10219750	Ga0105238_102197502	232
2209	3300009551	Ga0105238_10240334	Ga0105238_102403342	232
2210	3300009553	Ga0105249_10529736	Ga0105249_105297362	232
2211	3300010375	Ga0105239_10010789	Ga0105239_100107892	232
2212	3300010375	Ga0105239_10012464	Ga0105239_100124647	232
2213	3300010375	Ga0105239_10015571	Ga0105239_100155718	232
2214	3300010375	Ga0105239_10063670	Ga0105239_100636705	232
2215	3300010375	Ga0105239_10712292	Ga0105239_107122921	232
2216	3300013100	Ga0157373_10047398	Ga0157373_100473983	232
2217	3300013104	Ga0157370_10004029	Ga0157370_1000402914	232
2218	3300013104	Ga0157370_10160440	Ga0157370_101604402	232
2219	3300013104	Ga0157370_10582198	Ga0157370_105821981	232
2220	3300013105	Ga0157369_10010368	Ga0157369_100103687	232
2221	3300013105	Ga0157369_10099577	Ga0157369_100995773	232
2222	3300013105	Ga0157369_10165343	Ga0157369_101653434	232
2223	3300013105	Ga0157369_10247535	Ga0157369_102475351	232
2224	3300013105	Ga0157369_10397664	Ga0157369_103976642	232
2225	3300013105	Ga0157369_10421727	Ga0157369_104217272	232
2226	3300013296	Ga0157374_10000721	Ga0157374_1000072121	232
2227	3300013306	Ga0163162_10005686	Ga0163162_100056863	232
2228	3300013306	Ga0163162_10086063	Ga0163162_100860634	232
2229	3300013306	Ga0163162_10170792	Ga0163162_101707922	232
2230	3300013306	Ga0163162_10534955	Ga0163162_105349552	232
2231	3300013307	Ga0157372_10001379	Ga0157372_100013792	232
2232	3300013307	Ga0157372_10277810	Ga0157372_102778102	232
2233	3300013307	Ga0157372_10348538	Ga0157372_103485382	232
2234	3300013307	Ga0157372_10758571	Ga0157372_107585711	232
2235	3300014326	Ga0157380_10474524	Ga0157380_104745242	232
2236	3300014497	Ga0182008_10052764	Ga0182008_100527642	232
2237	3300014969	Ga0157376_10191966	Ga0157376_101919662	232
2238	3300015265	Ga0182005_1004672	Ga0182005_10046724	232
2239	3300016635	Ga0183361_10012	Ga0183361_1001235	232
2240	3300017792	Ga0163161_10125266	Ga0163161_101252662	232
2241	3300021361	Ga0213872_10000007	Ga0213872_1000000723	232
2242	3300021361	Ga0213872_10126272	Ga0213872_101262721	232
2243	3300025208	Ga0209436_100539	Ga0209436_10053912	232
2244	3300025225	Ga0209566_100216	Ga0209566_10021627	232
2245	3300025226	Ga0209674_100005	Ga0209674_1000051406	232
2246	3300025226	Ga0209674_100092	Ga0209674_10009242	232
2247	3300025226	Ga0209674_107308	Ga0209674_1073082	232
2248	3300025228	Ga0209672_100001	Ga0209672_1000011803	232
2249	3300025228	Ga0209672_100028	Ga0209672_100028159	232
2250	3300025228	Ga0209672_100038	Ga0209672_100038164	232
2251	3300025228	Ga0209672_100952	Ga0209672_1009529	232
2252	3300025229	Ga0209147_100001	Ga0209147_1000011803	232
2253	3300025229	Ga0209147_100163	Ga0209147_10016329	232
2254	3300025229	Ga0209147_100239	Ga0209147_10023910	232
2255	3300025229	Ga0209147_100259	Ga0209147_1002598	232
2256	3300025230	Ga0209563_108423	Ga0209563_1084232	232
2257	3300025231	Ga0207427_100303	Ga0207427_10030328	232
2258	3300025231	Ga0207427_102731	Ga0207427_1027313	232
2259	3300025242	Ga0209258_100001	Ga0209258_1000011803	232
2260	3300025242	Ga0209258_100109	Ga0209258_10010912	232
2261	3300025242	Ga0209258_100112	Ga0209258_10011213	232
2262	3300025245	Ga0207425_1000013	Ga0207425_1000013198	232
2263	3300025245	Ga0207425_1000145	Ga0207425_10001453	232
2264	3300025245	Ga0207425_1031696	Ga0207425_10316961	232
2265	3300025246	Ga0209646_1000012	Ga0209646_1000012401	232
2266	3300025250	Ga0209026_1000004	Ga0209026_1000004219	232
2267	3300025254	Ga0209148_1000003	Ga0209148_10000031803	232
2268	3300025254	Ga0209148_1000081	Ga0209148_100008179	232
2269	3300025254	Ga0209148_1000844	Ga0209148_100084412	232
2270	3300025256	Ga0209759_1000003	Ga0209759_1000003509	232
2271	3300025256	Ga0209759_1000053	Ga0209759_1000053114	232
2272	3300025256	Ga0209759_1000074	Ga0209759_100007442	232
2273	3300025256	Ga0209759_1000601	Ga0209759_10006018	232
2274	3300025256	Ga0209759_1001475	Ga0209759_10014755	232
2275	3300025256	Ga0209759_1009561	Ga0209759_10095613	232
2276	3300025256	Ga0209759_1014072	Ga0209759_10140722	232
2277	3300025258	Ga0209129_1000102	Ga0209129_100010272	232
2278	3300025258	Ga0209129_1002852	Ga0209129_10028525	232
2279	3300025261	Ga0209233_1000016	Ga0209233_1000016763	232
2280	3300025263	Ga0209565_1000035	Ga0209565_100003582	232
2281	3300025263	Ga0209565_1000205	Ga0209565_100020518	232
2282	3300025272	Ga0209455_1000001	Ga0209455_10000011803	232
2283	3300025272	Ga0209455_1000050	Ga0209455_1000050161	232
2284	3300025273	Ga0209673_1000006	Ga0209673_1000006172	232
2285	3300025273	Ga0209673_1000038	Ga0209673_100003897	232
2286	3300025273	Ga0209673_1009497	Ga0209673_10094973	232
2287	3300025284	Ga0209130_1000149	Ga0209130_100014973	232
2288	3300025284	Ga0209130_1001037	Ga0209130_10010376	232
2289	3300025284	Ga0209130_1009910	Ga0209130_10099102	232
2290	3300025291	Ga0209675_1000005	Ga0209675_1000005600	232
2291	3300025291	Ga0209675_1000619	Ga0209675_10006198	232
2292	3300025295	Ga0209564_1000008	Ga0209564_1000008196	232
2293	3300025295	Ga0209564_1000083	Ga0209564_100008336	232
2294	3300025295	Ga0209564_1001146	Ga0209564_100114610	232
2295	3300025295	Ga0209564_1014361	Ga0209564_10143612	232
2296	3300025297	Ga0209758_1000031	Ga0209758_1000031266	232
2297	3300025298	Ga0209050_1000078	Ga0209050_100007837	232
2298	3300025298	Ga0209050_1000246	Ga0209050_1000246109	232
2299	3300025299	Ga0209256_1000141	Ga0209256_100014175	232
2300	3300025299	Ga0209256_1000303	Ga0209256_100030331	232
2301	3300025299	Ga0209256_1000881	Ga0209256_10008813	232
2302	3300025299	Ga0209256_1021167	Ga0209256_10211673	232
2303	3300025302	Ga0207426_1000037	Ga0207426_1000037176	232
2304	3300025302	Ga0207426_1002420	Ga0207426_10024207	232
2305	3300025303	Ga0209051_1000004	Ga0209051_1000004247	232
2306	3300025303	Ga0209051_1022189	Ga0209051_10221893	232
2307	3300025304	Ga0209257_1000038	Ga0209257_1000038381	232
2308	3300025304	Ga0209257_1000044	Ga0209257_1000044178	232
2309	3300025304	Ga0209257_1000097	Ga0209257_100009715	232
2310	3300025304	Ga0209257_1008343	Ga0209257_10083433	232
2311	3300025893	Ga0207682_10040435	Ga0207682_100404352	232
2312	3300025903	Ga0207680_10220192	Ga0207680_102201922	232
2313	3300025904	Ga0207647_10000608	Ga0207647_1000060818	232
2314	3300025904	Ga0207647_10003231	Ga0207647_1000323111	232
2315	3300025904	Ga0207647_10032404	Ga0207647_100324043	232
2316	3300025909	Ga0207705_10001908	Ga0207705_100019083	232
2317	3300025909	Ga0207705_10336984	Ga0207705_103369842	232
2318	3300025911	Ga0207654_10083057	Ga0207654_100830572	232
2319	3300025911	Ga0207654_10585158	Ga0207654_105851581	232
2320	3300025913	Ga0207695_10011211	Ga0207695_100112112	232
2321	3300025913	Ga0207695_10160657	Ga0207695_101606572	232
2322	3300025913	Ga0207695_10266448	Ga0207695_102664482	232
2323	3300025913	Ga0207695_10501229	Ga0207695_105012292	232
2324	3300025914	Ga0207671_10079525	Ga0207671_100795252	232
2325	3300025914	Ga0207671_10142458	Ga0207671_101424582	232
2326	3300025915	Ga0207693_10122899	Ga0207693_101228993	232
2327	3300025918	Ga0207662_10067242	Ga0207662_100672423	232
2328	3300025919	Ga0207657_10000051	Ga0207657_1000005151	232
2329	3300025919	Ga0207657_10000131	Ga0207657_100001315	232
2330	3300025919	Ga0207657_10017550	Ga0207657_100175507	232
2331	3300025919	Ga0207657_10076153	Ga0207657_100761532	232
2332	3300025920	Ga0207649_10000762	Ga0207649_100007629	232
2333	3300025920	Ga0207649_10029032	Ga0207649_100290324	232
2334	3300025920	Ga0207649_10134933	Ga0207649_101349332	232
2335	3300025922	Ga0207646_10446400	Ga0207646_104464002	232
2336	3300025923	Ga0207681_10424751	Ga0207681_104247512	232
2337	3300025924	Ga0207694_10012756	Ga0207694_100127562	232
2338	3300025924	Ga0207694_10032852	Ga0207694_100328523	232
2339	3300025924	Ga0207694_10324375	Ga0207694_103243751	232
2340	3300025927	Ga0207687_10173957	Ga0207687_101739572	232
2341	3300025927	Ga0207687_10181653	Ga0207687_101816532	232
2342	3300025932	Ga0207690_10000034	Ga0207690_1000003486	232
2343	3300025932	Ga0207690_10001689	Ga0207690_100016895	232
2344	3300025932	Ga0207690_10020033	Ga0207690_100200332	232
2345	3300025932	Ga0207690_10060157	Ga0207690_100601571	232
2346	3300025933	Ga0207706_10006818	Ga0207706_100068188	232
2347	3300025933	Ga0207706_10666490	Ga0207706_106664902	232
2348	3300025935	Ga0207709_10167782	Ga0207709_101677822	232
2349	3300025935	Ga0207709_10192697	Ga0207709_101926972	232
2350	3300025940	Ga0207691_10063522	Ga0207691_100635224	232
2351	3300025941	Ga0207711_10037525	Ga0207711_100375253	232
2352	3300025941	Ga0207711_10051558	Ga0207711_100515582	232
2353	3300025945	Ga0207679_10000202	Ga0207679_1000020218	232
2354	3300025945	Ga0207679_10071990	Ga0207679_100719901	232
2355	3300025945	Ga0207679_10137702	Ga0207679_101377022	232
2356	3300025949	Ga0207667_10015405	Ga0207667_100154055	232
2357	3300025949	Ga0207667_10037973	Ga0207667_100379734	232
2358	3300025949	Ga0207667_10249570	Ga0207667_102495702	232
2359	3300025949	Ga0207667_10330926	Ga0207667_103309262	232
2360	3300025961	Ga0207712_10193670	Ga0207712_101936702	232
2361	3300025981	Ga0207640_10177109	Ga0207640_101771092	232
2362	3300025986	Ga0207658_10019871	Ga0207658_100198712	232
2363	3300026041	Ga0207639_10363953	Ga0207639_103639532	232
2364	3300026067	Ga0207678_10001810	Ga0207678_100018103	232
2365	3300026067	Ga0207678_10008514	Ga0207678_100085144	232
2366	3300026067	Ga0207678_10031691	Ga0207678_100316913	232
2367	3300026067	Ga0207678_10175386	Ga0207678_101753863	232
2368	3300026075	Ga0207708_10047211	Ga0207708_100472113	232
2369	3300026078	Ga0207702_10000253	Ga0207702_1000025337	232
2370	3300026078	Ga0207702_10247416	Ga0207702_102474162	232
2371	3300026088	Ga0207641_10535810	Ga0207641_105358101	232
2372	3300026089	Ga0207648_10131776	Ga0207648_101317762	232
2373	3300026116	Ga0207674_10063665	Ga0207674_100636652	232
2374	3300026142	Ga0207698_10036857	Ga0207698_100368572	232
2375	3300026142	Ga0207698_10085735	Ga0207698_100857352	232
2376	3300027111	Ga0209281_1003625	Ga0209281_10036256	232
2377	3300027312	Ga0209371_1000090	Ga0209371_1000090152	232
2378	3300027312	Ga0209371_1005044	Ga0209371_10050442	232
2379	3300027907	Ga0207428_10060914	Ga0207428_100609142	232
2380	3300028380	Ga0268265_10256782	Ga0268265_102567822	232
2381	3300028380	Ga0268265_10685571	Ga0268265_106855712	232
2382	3300028666	Ga0265336_10000032	Ga0265336_1000003280	232
2383	3300028800	Ga0265338_10000113	Ga0265338_1000011367	232
2384	3300028800	Ga0265338_10000928	Ga0265338_1000092811	232
2385	3300029957	Ga0265324_10001824	Ga0265324_100018241	232
2386	3300030500	Ga0268256_1000115	Ga0268256_100011599	232
2387	3300030500	Ga0268256_1004868	Ga0268256_10048682	232
2388	3300030500	Ga0268256_1052484	Ga0268256_10524842	232
2389	3300031238	Ga0265332_10069749	Ga0265332_100697492	232
2390	3300031247	Ga0265340_10058541	Ga0265340_100585413	232
2391	3300031507	Ga0307509_10080923	Ga0307509_100809234	232
2392	3300031548	Ga0307408_100003318	Ga0307408_1000033182	232
2393	3300031548	Ga0307408_100119150	Ga0307408_1001191502	232
2394	3300031548	Ga0307408_100221486	Ga0307408_1002214862	232
2395	3300031548	Ga0307408_100349620	Ga0307408_1003496202	232
2396	3300031665	Ga0316575_10019359	Ga0316575_100193592	232
2397	3300031731	Ga0307405_10033687	Ga0307405_100336872	232
2398	3300031911	Ga0307412_10000014	Ga0307412_100000145	232
2399	3300031911	Ga0307412_10016057	Ga0307412_100160573	232
2400	3300031995	Ga0307409_100076580	Ga0307409_1000765802	232
2401	3300031995	Ga0307409_100581317	Ga0307409_1005813172	232
2402	3300031995	Ga0307409_100799225	Ga0307409_1007992251	232
2403	3300032002	Ga0307416_100023250	Ga0307416_1000232502	232
2404	3300032005	Ga0307411_10103104	Ga0307411_101031042	232
2405	3300035398	Ga0316574_0007099	Ga0316574_0007099_3378_4094	232
2406	3300035724	Ga0373933_0224980	Ga0373933_0224980_364_1077	232
2407	3300037312	Ga0395899_0000008	Ga0395899_0000008_386643_387353	232
2408	3300037312	Ga0395899_0004014	Ga0395899_0004014_10277_11023	232
2409	3300037312	Ga0395899_0022113	Ga0395899_0022113_3076_3774	232
2410	3300037312	Ga0395899_0040938	Ga0395899_0040938_2621_3319	232
2411	3300037418	Ga0395900_0000055	Ga0395900_0000055_38946_39656	232
2412	3300037418	Ga0395900_0002362	Ga0395900_0002362_10985_11683	232
2413	3300037418	Ga0395900_0009158	Ga0395900_0009158_348_1094	232
2414	3300037418	Ga0395900_0078053	Ga0395900_0078053_609_1307	232
2415	3300037418	Ga0395900_0088142	Ga0395900_0088142_2392_3090	232
2416	3300037418	Ga0395900_0196349	Ga0395900_0196349_884_1582	232
2417	3300037418	Ga0395900_0210348	Ga0395900_0210348_560_1264	232
2418	3300037418	Ga0395900_0228874	Ga0395900_0228874_1085_1831	232
2419	3300037466	Ga0395898_0000119	Ga0395898_0000119_69425_70135	232
2420	3300037466	Ga0395898_0021822	Ga0395898_0021822_857_1555	232
2421	3300037466	Ga0395898_0086702	Ga0395898_0086702_1866_2570	232
2422	3300037466	Ga0395898_0155469	Ga0395898_0155469_1074_1820	232
2423	3300037466	Ga0395898_0259731	Ga0395898_0259731_597_1295	232
2424	3300037466	Ga0395898_0472102	Ga0395898_0472102_331_1077	232
2425	3300037471	Ga0395905_0000168	Ga0395905_0000168_45204_45902	232
2426	3300037471	Ga0395905_0006436	Ga0395905_0006436_624_1328	232
2427	3300037471	Ga0395905_0071365	Ga0395905_0071365_364_1062	232
2428	3300037471	Ga0395905_0106041	Ga0395905_0106041_1662_2360	232
2429	3300037471	Ga0395905_0141287	Ga0395905_0141287_994_1701	232
2430	3300037471	Ga0395905_0551989	Ga0395905_0551989_13_723	232
2431	3300037471	Ga0395905_0786756	Ga0395905_0786756_70_777	232
2432	3300038443	Ga0395901_0000003	Ga0395901_0000003_512231_512929	232
2433	3300038443	Ga0395901_0000180	Ga0395901_0000180_60188_60886	232
2434	3300038443	Ga0395901_0000887	Ga0395901_0000887_21075_21773	232
2435	3300038443	Ga0395901_0022795	Ga0395901_0022795_309_1055	232
2436	3300038443	Ga0395901_0052602	Ga0395901_0052602_1931_2629	232
2437	3300038443	Ga0395901_0468890	Ga0395901_0468890_415_1113	232
2438	3300039437	Ga0436365_0935976	Ga0436365_0935976_190_963	232
2439	3300039438	Ga0436360_0091497	Ga0436360_0091497_412_1110	232
2440	3300039447	Ga0436361_0019716	Ga0436361_0019716_36_734	232
2441	3300039447	Ga0436361_0348965	Ga0436361_0348965_235_981	232
2442	3300039447	Ga0436361_0504982	Ga0436361_0504982_66201_66917	232
2443	3300039447	Ga0436361_0527797	Ga0436361_0527797_652_1350	232
2444	3300039447	Ga0436361_0650737	Ga0436361_0650737_37543_38271	232
2445	3300039447	Ga0436361_1112657	Ga0436361_1112657_906_1610	232
2446	3300041997	Ga0439431_0017524	Ga0439431_0017524_447_1157	232
2447	3300041999	Ga0439433_0036310	Ga0439433_0036310_154_852	232
2448	3300042005	Ga0439448_0008954	Ga0439448_0008954_984_1682	232
2449	3300042121	Ga0450919_001789	Ga0450919_001789_1198_1899	232
2450	3300042128	Ga0450897_008736	Ga0450897_008736_107_817	232
2451	3300042135	Ga0450899_009578	Ga0450899_009578_90_800	232
2452	3300042435	Ga0439434_0022953	Ga0439434_0022953_423_1130	232
2453	3300042435	Ga0439434_0041967	Ga0439434_0041967_263_973	232
2454	3300042438	Ga0439459_0002928	Ga0439459_0002928_1063_1776	232
2455	3300042531	Ga0450918_000489	Ga0450918_000489_2891_3592	232
2456	3300042532	Ga0450893_0024006	Ga0450893_0024006_29_739	232
2457	3300042533	Ga0450901_006717	Ga0450901_006717_22_729	232
2458	3300042876	Ga0451577_0139176	Ga0451577_0139176_1390_2115	232
2459	3300042876	Ga0451577_0247481	Ga0451577_0247481_640_1362	232
2460	3300044656	Ga0466969_0063454	Ga0466969_0063454_271_969	232
2461	3300044656	Ga0466969_0101520	Ga0466969_0101520_219_917	232
2462	3300044658	Ga0466972_0000045	Ga0466972_0000045_84754_85497	232
2463	3300044658	Ga0466972_0000283	Ga0466972_0000283_8314_9030	232
2464	3300044658	Ga0466972_0004525	Ga0466972_0004525_6025_6729	232
2465	3300044658	Ga0466972_0020392	Ga0466972_0020392_2024_2722	232
2466	3300044658	Ga0466972_0036391	Ga0466972_0036391_1224_1928	232
2467	3300044658	Ga0466972_0040305	Ga0466972_0040305_119_820	232
2468	3300044658	Ga0466972_0126730	Ga0466972_0126730_220_927	232
2469	3300044659	Ga0466973_0059855	Ga0466973_0059855_1784_2491	232
2470	3300044666	Ga0466977_0000526	Ga0466977_0000526_6126_6839	232
2471	3300044672	Ga0466982_0108454	Ga0466982_0108454_259_975	232
2472	3300044683	Ga0466965_0000148	Ga0466965_0000148_8207_8923	232
2473	3300044683	Ga0466965_0002026	Ga0466965_0002026_3636_4343	232
2474	3300044683	Ga0466965_0004127	Ga0466965_0004127_750_1454	232
2475	3300044683	Ga0466965_0041605	Ga0466965_0041605_402_1100	232
2476	3300044683	Ga0466965_0048810	Ga0466965_0048810_139_837	232
2477	3300044683	Ga0466965_0056940	Ga0466965_0056940_165_863	232
2478	3300044683	Ga0466965_0134415	Ga0466965_0134415_489_1196	232
2479	3300044683	Ga0466965_0140625	Ga0466965_0140625_229_933	232
2480	3300044684	Ga0466966_0005778	Ga0466966_0005778_2157_2855	232
2481	3300044684	Ga0466966_0006766	Ga0466966_0006766_5998_6714	232
2482	3300044684	Ga0466966_0007127	Ga0466966_0007127_6688_7395	232
2483	3300044684	Ga0466966_0017867	Ga0466966_0017867_3162_3860	232
2484	3300044684	Ga0466966_0030856	Ga0466966_0030856_2329_3033	232
2485	3300044684	Ga0466966_0061227	Ga0466966_0061227_1258_1956	232
2486	3300044684	Ga0466966_0072741	Ga0466966_0072741_1239_1937	232
2487	3300044684	Ga0466966_0128677	Ga0466966_0128677_134_832	232
2488	3300044693	Ga0466961_0001718	Ga0466961_0001718_1992_2690	232
2489	3300044693	Ga0466961_0091515	Ga0466961_0091515_508_1206	232
2490	3300044693	Ga0466961_0121497	Ga0466961_0121497_703_1401	232
2491	3300044694	Ga0466963_0038491	Ga0466963_0038491_1920_2618	232
2492	3300044694	Ga0466963_0415685	Ga0466963_0415685_137_853	232
2493	3300044706	Ga0466964_0000615	Ga0466964_0000615_5486_6202	232
2494	3300044706	Ga0466964_0039145	Ga0466964_0039145_629_1333	232
2495	3300044706	Ga0466964_0049822	Ga0466964_0049822_823_1527	232
2496	3300044706	Ga0466964_0227573	Ga0466964_0227573_64_762	232
2497	3300044719	Ga0466971_0007812	Ga0466971_0007812_3497_4213	232
2498	3300044719	Ga0466971_0082048	Ga0466971_0082048_424_1122	232
2499	3300044719	Ga0466971_0120642	Ga0466971_0120642_66_770	232
2500	3300044719	Ga0466971_0181509	Ga0466971_0181509_96_794	232
2501	3300044735	Ga0466968_0042806	Ga0466968_0042806_600_1304	232
2502	3300044735	Ga0466968_0050408	Ga0466968_0050408_76_783	232
2503	3300044765	Ga0466970_0046624	Ga0466970_0046624_880_1596	232
2504	3300044765	Ga0466970_0047253	Ga0466970_0047253_438_1145	232
2505	3300044765	Ga0466970_0065673	Ga0466970_0065673_955_1671	232
2506	3300044765	Ga0466970_0098513	Ga0466970_0098513_77_781	232
2507	3300044765	Ga0466970_0104704	Ga0466970_0104704_338_1042	232
2508	3300044765	Ga0466970_0169570	Ga0466970_0169570_275_973	232
2509	3300044842	Ga0466957_0000376	Ga0466957_0000376_17152_17859	232
2510	3300044842	Ga0466957_0003141	Ga0466957_0003141_2492_3190	232
2511	3300044842	Ga0466957_0004378	Ga0466957_0004378_2160_2876	232
2512	3300044842	Ga0466957_0007319	Ga0466957_0007319_5090_5794	232
2513	3300044842	Ga0466957_0025716	Ga0466957_0025716_1631_2329	232
2514	3300044842	Ga0466957_0039473	Ga0466957_0039473_1707_2405	232
2515	3300044842	Ga0466957_0062578	Ga0466957_0062578_967_1665	232
2516	3300044842	Ga0466957_0125003	Ga0466957_0125003_620_1318	232
2517	3300044842	Ga0466957_0530267	Ga0466957_0530267_46_750	232
2518	3300044901	Ga0466960_0181315	Ga0466960_0181315_315_1016	232
2519	3300044901	Ga0466960_0211192	Ga0466960_0211192_89_796	232
2520	3300045049	Ga0466959_0001563	Ga0466959_0001563_1749_2453	232
2521	3300045049	Ga0466959_0028313	Ga0466959_0028313_3121_3837	232
2522	3300045049	Ga0466959_0038216	Ga0466959_0038216_1465_2172	232
2523	3300045049	Ga0466959_0076128	Ga0466959_0076128_779_1477	232
2524	3300045049	Ga0466959_0079312	Ga0466959_0079312_861_1559	232
2525	3300045049	Ga0466959_0111329	Ga0466959_0111329_183_881	232
2526	3300045049	Ga0466959_0470289	Ga0466959_0470289_96_794	232
2527	3300045051	Ga0451576_0051013	Ga0451576_0051013_1742_2464	232
2528	3300045051	Ga0451576_0055823	Ga0451576_0055823_1877_2599	232
2529	3300045051	Ga0451576_0126819	Ga0451576_0126819_1730_2452	232
2530	3300045836	Ga0466958_0016385	Ga0466958_0016385_159_857	232
2531	3300045836	Ga0466958_0064675	Ga0466958_0064675_621_1337	232
2532	3300045836	Ga0466958_0073750	Ga0466958_0073750_1337_2044	232
2533	3300045836	Ga0466958_0158615	Ga0466958_0158615_277_975	232
2534	3300045976	Ga0466967_0151416	Ga0466967_0151416_1263_1979	232
2535	3300045976	Ga0466967_0207525	Ga0466967_0207525_875_1591	232
2536	3300046452	Ga0495617_000011	Ga0495617_000011_98867_99580	232
2537	3300046452	Ga0495617_050437	Ga0495617_050437_554_1270	232
2538	3300046454	Ga0495592_0189930	Ga0495592_0189930_100_798	232
2539	3300046455	Ga0495603_0020388	Ga0495603_0020388_1154_1852	232
2540	3300046455	Ga0495603_0081118	Ga0495603_0081118_1057_1761	232
2541	3300046455	Ga0495603_0122174	Ga0495603_0122174_781_1479	232
2542	3300046455	Ga0495603_0175937	Ga0495603_0175937_460_1158	232
2543	3300046455	Ga0495603_0201617	Ga0495603_0201617_323_1042	232
2544	3300046457	Ga0495590_0001091	Ga0495590_0001091_6058_6762	232
2545	3300046457	Ga0495590_0011111	Ga0495590_0011111_1830_2528	232
2546	3300046457	Ga0495590_0011558	Ga0495590_0011558_432_1130	232
2547	3300046457	Ga0495590_0064317	Ga0495590_0064317_23_730	232
2548	3300046458	Ga0495591_077923	Ga0495591_077923_117_821	232
2549	3300046459	Ga0495629_0001732	Ga0495629_0001732_9208_9912	232
2550	3300046459	Ga0495629_0058648	Ga0495629_0058648_1419_2117	232
2551	3300046459	Ga0495629_0069761	Ga0495629_0069761_452_1150	232
2552	3300046460	Ga0495638_0032456	Ga0495638_0032456_726_1430	232
2553	3300046460	Ga0495638_0066557	Ga0495638_0066557_1501_2199	232
2554	3300046460	Ga0495638_0083054	Ga0495638_0083054_101_808	232
2555	3300046460	Ga0495638_0106758	Ga0495638_0106758_711_1424	232
2556	3300046462	Ga0495651_0008469	Ga0495651_0008469_2464_3162	232
2557	3300046462	Ga0495651_0029836	Ga0495651_0029836_1351_2049	232
2558	3300046462	Ga0495651_0339333	Ga0495651_0339333_148_846	232
2559	3300046463	Ga0495653_0000029	Ga0495653_0000029_85069_85788	232
2560	3300046463	Ga0495653_0061473	Ga0495653_0061473_1018_1716	232
2561	3300046463	Ga0495653_0074416	Ga0495653_0074416_501_1199	232
2562	3300046463	Ga0495653_0177758	Ga0495653_0177758_379_1092	232
2563	3300046471	Ga0495650_0000633	Ga0495650_0000633_18482_19195	232
2564	3300046471	Ga0495650_0002944	Ga0495650_0002944_3563_4267	232
2565	3300046471	Ga0495650_0005605	Ga0495650_0005605_4577_5275	232
2566	3300046471	Ga0495650_0015598	Ga0495650_0015598_2810_3508	232
2567	3300046471	Ga0495650_0070054	Ga0495650_0070054_451_1155	232
2568	3300046471	Ga0495650_0137785	Ga0495650_0137785_69_767	232
2569	3300046472	Ga0495580_0004205	Ga0495580_0004205_1354_2052	232
2570	3300046472	Ga0495580_0014504	Ga0495580_0014504_848_1546	232
2571	3300046472	Ga0495580_0020034	Ga0495580_0020034_1237_1935	232
2572	3300046472	Ga0495580_0026646	Ga0495580_0026646_1356_2054	232
2573	3300046472	Ga0495580_0032325	Ga0495580_0032325_628_1326	232
2574	3300046472	Ga0495580_0075264	Ga0495580_0075264_1028_1726	232
2575	3300046472	Ga0495580_0088846	Ga0495580_0088846_1356_2054	232
2576	3300046472	Ga0495580_0236898	Ga0495580_0236898_136_834	232
2577	3300046473	Ga0495582_0000933	Ga0495582_0000933_1153_1851	232
2578	3300046473	Ga0495582_0018556	Ga0495582_0018556_1693_2391	232
2579	3300046473	Ga0495582_0035935	Ga0495582_0035935_1756_2454	232
2580	3300046474	Ga0495605_0009483	Ga0495605_0009483_3548_4246	232
2581	3300046474	Ga0495605_0037601	Ga0495605_0037601_1257_1955	232
2582	3300046474	Ga0495605_0043110	Ga0495605_0043110_1099_1803	232
2583	3300046474	Ga0495605_0049193	Ga0495605_0049193_563_1261	232
2584	3300046476	Ga0495662_0021908	Ga0495662_0021908_1801_2499	232
2585	3300046477	Ga0495664_0002023	Ga0495664_0002023_1371_2069	232
2586	3300046477	Ga0495664_0033623	Ga0495664_0033623_1433_2131	232
2587	3300046477	Ga0495664_0040261	Ga0495664_0040261_192_890	232
2588	3300046477	Ga0495664_0123153	Ga0495664_0123153_857_1555	232
2589	3300046491	Ga0495584_0003945	Ga0495584_0003945_3215_3931	232
2590	3300046492	Ga0495585_0012673	Ga0495585_0012673_3872_4585	232
2591	3300046492	Ga0495585_0144931	Ga0495585_0144931_184_888	232
2592	3300046492	Ga0495585_0216752	Ga0495585_0216752_115_831	232
2593	3300046499	Ga0495594_0291870	Ga0495594_0291870_131_829	232
2594	3300046500	Ga0495596_0009585	Ga0495596_0009585_739_1437	232
2595	3300046500	Ga0495596_0024335	Ga0495596_0024335_612_1310	232
2596	3300046500	Ga0495596_0040971	Ga0495596_0040971_452_1150	232
2597	3300046500	Ga0495596_0057656	Ga0495596_0057656_10_714	232
2598	3300046501	Ga0495607_0020331	Ga0495607_0020331_828_1535	232
2599	3300046501	Ga0495607_0068897	Ga0495607_0068897_220_936	232
2600	3300046501	Ga0495607_0130132	Ga0495607_0130132_41_757	232
2601	3300046506	Ga0495583_0014665	Ga0495583_0014665_381_1079	232
2602	3300046506	Ga0495583_0086662	Ga0495583_0086662_258_962	232
2603	3300046507	Ga0495606_0004009	Ga0495606_0004009_7951_8655	232
2604	3300046507	Ga0495606_0004958	Ga0495606_0004958_10438_11136	232
2605	3300046507	Ga0495606_0005194	Ga0495606_0005194_5730_6428	232
2606	3300046507	Ga0495606_0012481	Ga0495606_0012481_6089_6787	232
2607	3300046507	Ga0495606_0013647	Ga0495606_0013647_1474_2172	232
2608	3300046507	Ga0495606_0090518	Ga0495606_0090518_348_1046	232
2609	3300046511	Ga0495608_0013755	Ga0495608_0013755_3288_3986	232
2610	3300046511	Ga0495608_0079885	Ga0495608_0079885_1177_1875	232
2611	3300046512	Ga0495610_0000007	Ga0495610_0000007_612379_613092	232
2612	3300046512	Ga0495610_0004263	Ga0495610_0004263_927_1673	232
2613	3300046513	Ga0495616_0005284	Ga0495616_0005284_7051_7758	232
2614	3300046513	Ga0495616_0008419	Ga0495616_0008419_2121_2837	232
2615	3300046514	Ga0495618_0016346	Ga0495618_0016346_1183_1881	232
2616	3300046514	Ga0495618_0073014	Ga0495618_0073014_1437_2135	232
2617	3300046515	Ga0495620_0017279	Ga0495620_0017279_839_1537	232
2618	3300046516	Ga0495628_0000876	Ga0495628_0000876_26770_27468	232
2619	3300046516	Ga0495628_0018712	Ga0495628_0018712_3093_3791	232
2620	3300046516	Ga0495628_0059923	Ga0495628_0059923_384_1085	232
2621	3300046516	Ga0495628_0088299	Ga0495628_0088299_501_1199	232
2622	3300046517	Ga0495630_0004567	Ga0495630_0004567_4985_5683	232
2623	3300046517	Ga0495630_0009615	Ga0495630_0009615_1432_2130	232
2624	3300046517	Ga0495630_0089255	Ga0495630_0089255_1236_1934	232
2625	3300046517	Ga0495630_0222696	Ga0495630_0222696_579_1283	232
2626	3300046522	Ga0495643_0043587	Ga0495643_0043587_635_1333	232
2627	3300046523	Ga0495644_0044375	Ga0495644_0044375_605_1309	232
2628	3300046524	Ga0495648_0005730	Ga0495648_0005730_9335_10081	232
2629	3300046524	Ga0495648_0018991	Ga0495648_0018991_753_1451	232
2630	3300046524	Ga0495648_0037733	Ga0495648_0037733_1744_2442	232
2631	3300046524	Ga0495648_0098281	Ga0495648_0098281_627_1340	232
2632	3300046526	Ga0495666_0003390	Ga0495666_0003390_5338_6036	232
2633	3300046526	Ga0495666_0006063	Ga0495666_0006063_5134_5832	232
2634	3300046526	Ga0495666_0046141	Ga0495666_0046141_808_1506	232
2635	3300046526	Ga0495666_0051980	Ga0495666_0051980_1094_1810	232
2636	3300046528	Ga0495642_0048149	Ga0495642_0048149_933_1631	232
2637	3300046528	Ga0495642_0094164	Ga0495642_0094164_60_767	232
2638	3300046528	Ga0495642_0153593	Ga0495642_0153593_233_937	232
2639	3300046529	Ga0495652_0114799	Ga0495652_0114799_1054_1752	232
2640	3300046529	Ga0495652_0162793	Ga0495652_0162793_393_1091	232
2641	3300046529	Ga0495652_0174094	Ga0495652_0174094_61_759	232
2642	3300046529	Ga0495652_0272737	Ga0495652_0272737_165_863	232
2643	3300046530	Ga0495654_0101711	Ga0495654_0101711_582_1286	232
2644	3300046531	Ga0495665_0027376	Ga0495665_0027376_1678_2376	232
2645	3300046531	Ga0495665_0062196	Ga0495665_0062196_1257_1955	232
2646	3300046531	Ga0495665_0116975	Ga0495665_0116975_534_1232	232
2647	3300046533	Ga0495640_0014334	Ga0495640_0014334_452_1150	232
2648	3300046533	Ga0495640_0064794	Ga0495640_0064794_1572_2270	232
2649	3300046533	Ga0495640_0302291	Ga0495640_0302291_225_923	232
2650	3300046535	Ga0495586_0041683	Ga0495586_0041683_1241_1939	232
2651	3300046535	Ga0495586_0050156	Ga0495586_0050156_1327_2031	232
2652	3300046536	Ga0495587_0014035	Ga0495587_0014035_1455_2153	232
2653	3300046536	Ga0495587_0039146	Ga0495587_0039146_1453_2151	232
2654	3300046538	Ga0495609_0000686	Ga0495609_0000686_16158_16865	232
2655	3300046539	Ga0495621_0009797	Ga0495621_0009797_418_1119	232
2656	3300046539	Ga0495621_0071221	Ga0495621_0071221_454_1176	232
2657	3300046542	Ga0495597_0042628	Ga0495597_0042628_928_1650	232
2658	3300046542	Ga0495597_0076849	Ga0495597_0076849_488_1195	232
2659	3300046543	Ga0495645_0008663	Ga0495645_0008663_1420_2118	232
2660	3300046543	Ga0495645_0011392	Ga0495645_0011392_5187_5885	232
2661	3300046543	Ga0495645_0013555	Ga0495645_0013555_3505_4209	232
2662	3300046558	Ga0495633_0049653	Ga0495633_0049653_561_1277	232
2663	3300046559	Ga0495667_0026023	Ga0495667_0026023_1665_2369	232
2664	3300046559	Ga0495667_0047461	Ga0495667_0047461_642_1343	232
2665	3300046616	Ga0495668_0000385	Ga0495668_0000385_46146_46853	232
2666	3300046616	Ga0495668_0012069	Ga0495668_0012069_551_1264	232
2667	3300046642	Ga0495634_0004751	Ga0495634_0004751_7606_8304	232
2668	3300046642	Ga0495634_0019305	Ga0495634_0019305_4054_4752	232
2669	3300046648	Ga0495611_0050014	Ga0495611_0050014_480_1196	232
2670	3300046648	Ga0495611_0105376	Ga0495611_0105376_272_970	232
2671	3300046660	Ga0495625_0084325	Ga0495625_0084325_1409_2107	232
2672	3300046663	Ga0495635_0002889	Ga0495635_0002889_3258_3956	232
2673	3300046663	Ga0495635_0080020	Ga0495635_0080020_955_1653	232
2674	3300046663	Ga0495635_0087783	Ga0495635_0087783_1295_1993	232
2675	3300046665	Ga0495661_0009375	Ga0495661_0009375_818_1516	232
2676	3300046665	Ga0495661_0040350	Ga0495661_0040350_751_1449	232
2677	3300046665	Ga0495661_0052405	Ga0495661_0052405_1023_1721	232
2678	3300046675	Ga0495657_0055766	Ga0495657_0055766_747_1445	232
2679	3300046675	Ga0495657_0076858	Ga0495657_0076858_1334_2032	232
2680	3300046675	Ga0495657_0118379	Ga0495657_0118379_709_1407	232
2681	3300046678	Ga0495599_0043581	Ga0495599_0043581_1509_2207	232
2682	3300046678	Ga0495599_0067725	Ga0495599_0067725_226_924	232
2683	3300046678	Ga0495599_0125704	Ga0495599_0125704_188_886	232
2684	3300046679	Ga0495623_0012550	Ga0495623_0012550_2122_2820	232
2685	3300046679	Ga0495623_0024300	Ga0495623_0024300_1556_2254	232
2686	3300046679	Ga0495623_0031020	Ga0495623_0031020_863_1561	232
2687	3300046679	Ga0495623_0032456	Ga0495623_0032456_1364_2062	232
2688	3300046679	Ga0495623_0144650	Ga0495623_0144650_511_1209	232
2689	3300046680	Ga0495646_0017810	Ga0495646_0017810_2449_3147	232
2690	3300046680	Ga0495646_0028330	Ga0495646_0028330_1409_2107	232
2691	3300046684	Ga0495669_0001185	Ga0495669_0001185_598_1305	232
2692	3300046684	Ga0495669_0018358	Ga0495669_0018358_1501_2205	232
2693	3300046684	Ga0495669_0026273	Ga0495669_0026273_178_876	232
2694	3300046684	Ga0495669_0109555	Ga0495669_0109555_236_940	232
2695	3300046689	Ga0495613_0003301	Ga0495613_0003301_11212_11910	232
2696	3300046689	Ga0495613_0038340	Ga0495613_0038340_1454_2158	232
2697	3300046690	Ga0495624_0002339	Ga0495624_0002339_1796_2494	232
2698	3300046690	Ga0495624_0084778	Ga0495624_0084778_501_1199	232
2699	3300046690	Ga0495624_0158801	Ga0495624_0158801_387_1085	232
2700	3300046691	Ga0495670_0006062	Ga0495670_0006062_42_758	232
2701	3300046691	Ga0495670_0013551	Ga0495670_0013551_314_1018	232
2702	3300046692	Ga0495671_0000033	Ga0495671_0000033_104098_104811	232
2703	3300046692	Ga0495671_0013316	Ga0495671_0013316_1876_2574	232
2704	3300046692	Ga0495671_0061244	Ga0495671_0061244_903_1616	232
2705	3300046692	Ga0495671_0061454	Ga0495671_0061454_38_745	232
2706	3300046692	Ga0495671_0066489	Ga0495671_0066489_407_1105	232
2707	3300046694	Ga0495649_0003133	Ga0495649_0003133_3747_4445	232
2708	3300046694	Ga0495649_0008565	Ga0495649_0008565_3978_4676	232
2709	3300046694	Ga0495649_0052106	Ga0495649_0052106_1012_1710	232
2710	3300046694	Ga0495649_0215099	Ga0495649_0215099_174_872	232
2711	3300046794	Ga0495589_0007292	Ga0495589_0007292_2770_3468	232
2712	3300046794	Ga0495589_0015997	Ga0495589_0015997_782_1486	232
2713	3300046794	Ga0495589_0030012	Ga0495589_0030012_491_1189	232
2714	3300046794	Ga0495589_0051167	Ga0495589_0051167_607_1305	232
2715	3300046794	Ga0495589_0154242	Ga0495589_0154242_32_730	232
2716	3300046794	Ga0495589_0220803	Ga0495589_0220803_124_843	232
2717	3300046809	Ga0495600_0003792	Ga0495600_0003792_2231_2929	232
2718	3300046809	Ga0495600_0041073	Ga0495600_0041073_1153_1851	232
2719	3300046809	Ga0495600_0044689	Ga0495600_0044689_189_887	232
2720	3300046809	Ga0495600_0182518	Ga0495600_0182518_217_918	232
2721	3300046810	Ga0495660_0104500	Ga0495660_0104500_224_937	232
2722	3300046810	Ga0495660_0108381	Ga0495660_0108381_605_1372	232
2723	3300046810	Ga0495660_0175418	Ga0495660_0175418_285_983	232
2724	3300047315	Ga0495581_0001681	Ga0495581_0001681_11330_12028	232
2725	3300047317	Ga0495604_0003651	Ga0495604_0003651_10799_11497	232
2726	3300047317	Ga0495604_0004077	Ga0495604_0004077_6136_6834	232
2727	3300047317	Ga0495604_0064528	Ga0495604_0064528_1907_2623	232
2728	3300047317	Ga0495604_0079342	Ga0495604_0079342_408_1106	232
2729	3300047319	Ga0495674_0008133	Ga0495674_0008133_7820_8524	232
2730	3300047319	Ga0495674_0050476	Ga0495674_0050476_2213_2911	232
2731	3300047319	Ga0495674_0058202	Ga0495674_0058202_1655_2353	232
2732	3300047319	Ga0495674_0162093	Ga0495674_0162093_20_718	232
2733	3300047319	Ga0495674_0180842	Ga0495674_0180842_344_1042	232
2734	3300047320	Ga0495672_0000005	Ga0495672_0000005_574726_575493	232
2735	3300047320	Ga0495672_0002512	Ga0495672_0002512_11276_11980	232
2736	3300047320	Ga0495672_0004982	Ga0495672_0004982_27_743	232
2737	3300047320	Ga0495672_0136769	Ga0495672_0136769_80_790	232
2738	3300047321	Ga0495676_0012834	Ga0495676_0012834_2301_2999	232
2739	3300047321	Ga0495676_0040016	Ga0495676_0040016_2676_3374	232
2740	3300047321	Ga0495676_0042815	Ga0495676_0042815_566_1279	232
2741	3300047321	Ga0495676_0086397	Ga0495676_0086397_1416_2114	232
2742	3300047321	Ga0495676_0363615	Ga0495676_0363615_212_910	232
2743	3300047322	Ga0495680_0013518	Ga0495680_0013518_42_740	232
2744	3300047322	Ga0495680_0054836	Ga0495680_0054836_409_1107	232
2745	3300047322	Ga0495680_0106328	Ga0495680_0106328_1252_1950	232
2746	3300047322	Ga0495680_0108373	Ga0495680_0108373_888_1586	232
2747	3300047323	Ga0495683_0003262	Ga0495683_0003262_4726_5424	232
2748	3300047323	Ga0495683_0008621	Ga0495683_0008621_907_1605	232
2749	3300047323	Ga0495683_0013122	Ga0495683_0013122_2897_3595	232
2750	3300047323	Ga0495683_0013822	Ga0495683_0013822_2159_2857	232
2751	3300047323	Ga0495683_0015323	Ga0495683_0015323_3035_3748	232
2752	3300047323	Ga0495683_0083025	Ga0495683_0083025_414_1112	232
2753	3300047443	Ga0495687_000161	Ga0495687_000161_9133_9855	232
2754	3300047443	Ga0495687_017129	Ga0495687_017129_2683_3390	232
2755	3300047443	Ga0495687_022331	Ga0495687_022331_1482_2180	232
2756	3300047443	Ga0495687_023163	Ga0495687_023163_1185_1883	232
2757	3300047444	Ga0495675_0004950	Ga0495675_0004950_6044_6742	232
2758	3300047444	Ga0495675_0008340	Ga0495675_0008340_2532_3230	232
2759	3300047444	Ga0495675_0105070	Ga0495675_0105070_170_868	232
2760	3300047446	Ga0495679_000109	Ga0495679_000109_50292_50990	232
2761	3300047446	Ga0495679_001329	Ga0495679_001329_2387_3085	232
2762	3300047446	Ga0495679_002198	Ga0495679_002198_165_863	232
2763	3300047446	Ga0495679_009000	Ga0495679_009000_2237_2944	232
2764	3300047446	Ga0495679_026951	Ga0495679_026951_10_723	232
2765	3300047446	Ga0495679_061995	Ga0495679_061995_251_949	232
2766	3300047446	Ga0495679_083896	Ga0495679_083896_108_812	232
2767	3300047447	Ga0495685_000337	Ga0495685_000337_2615_3331	232
2768	3300047469	Ga0495673_0000166	Ga0495673_0000166_14177_14890	232
2769	3300047469	Ga0495673_0009082	Ga0495673_0009082_464_1162	232
2770	3300047469	Ga0495673_0027225	Ga0495673_0027225_2014_2712	232
2771	3300047469	Ga0495673_0074581	Ga0495673_0074581_422_1126	232
2772	3300047470	Ga0495681_0002756	Ga0495681_0002756_11130_11837	232
2773	3300047470	Ga0495681_0014372	Ga0495681_0014372_2952_3671	232
2774	3300047470	Ga0495681_0022078	Ga0495681_0022078_1736_2440	232
2775	3300047471	Ga0495684_0213557	Ga0495684_0213557_590_1288	232
2776	3300047471	Ga0495684_0339072	Ga0495684_0339072_257_955	232
2777	3300047472	Ga0495686_0000014	Ga0495686_0000014_309907_310611	232
2778	3300047472	Ga0495686_0000240	Ga0495686_0000240_10410_11123	232
2779	3300047472	Ga0495686_0011137	Ga0495686_0011137_2805_3533	232
2780	3300047472	Ga0495686_0015577	Ga0495686_0015577_684_1391	232
2781	3300047472	Ga0495686_0123456	Ga0495686_0123456_598_1311	232
2782	3300047472	Ga0495686_0153789	Ga0495686_0153789_575_1273	232
2783	3300047472	Ga0495686_0203076	Ga0495686_0203076_213_911	232
2784	3300047673	Ga0495593_0022587	Ga0495593_0022587_2368_3066	232
2785	3300047673	Ga0495593_0036264	Ga0495593_0036264_42_740	232
2786	3300047673	Ga0495593_0054746	Ga0495593_0054746_1128_1841	232
2787	3300048088	Ga0495602_0029648	Ga0495602_0029648_657_1355	232
2788	3300048088	Ga0495602_0031305	Ga0495602_0031305_1742_2440	232
2789	3300048088	Ga0495602_0051795	Ga0495602_0051795_297_995	232
2790	3300048088	Ga0495602_0067827	Ga0495602_0067827_1204_1902	232
2791	3300048088	Ga0495602_0444940	Ga0495602_0444940_162_860	232
2792	3300048088	Ga0495602_0461722	Ga0495602_0461722_120_818	232
2793	3300048089	Ga0495614_0000434	Ga0495614_0000434_10206_10904	232
2794	3300048089	Ga0495614_0045750	Ga0495614_0045750_1131_1829	232
2795	3300048089	Ga0495614_0075273	Ga0495614_0075273_354_1052	232
2796	3300048089	Ga0495614_0116443	Ga0495614_0116443_267_965	232
2797	3300048091	Ga0495626_0009963	Ga0495626_0009963_866_1564	232
2798	3300048091	Ga0495626_0018106	Ga0495626_0018106_1921_2619	232
2799	3300048091	Ga0495626_0028328	Ga0495626_0028328_848_1546	232
2800	3300048903	Ga0496100_0008832	Ga0496100_0008832_2760_3464	232
2801	3300048903	Ga0496100_0110919	Ga0496100_0110919_136_834	232
2802	3300048903	Ga0496100_0186025	Ga0496100_0186025_164_868	232
2803	3300048903	Ga0496100_0275178	Ga0496100_0275178_478_1188	232
2804	3300048904	Ga0496101_0002582	Ga0496101_0002582_198_908	232
2805	3300048904	Ga0496101_0078988	Ga0496101_0078988_659_1357	232
2806	3300048905	Ga0496102_0000661	Ga0496102_0000661_26110_26808	232
2807	3300048905	Ga0496102_0027627	Ga0496102_0027627_3031_3732	232
2808	3300048905	Ga0496102_0223712	Ga0496102_0223712_519_1223	232
2809	3300048906	Ga0496103_0006555	Ga0496103_0006555_4988_5686	232
2810	3300048906	Ga0496103_0380955	Ga0496103_0380955_58_756	232
2811	3300048907	Ga0496104_0301114	Ga0496104_0301114_799_1503	232
2812	3300048907	Ga0496104_0565938	Ga0496104_0565938_250_948	232
2813	3300048908	Ga0496105_0203481	Ga0496105_0203481_743_1447	232
2814	3300048909	Ga0496106_0142296	Ga0496106_0142296_416_1114	232
2815	3300048909	Ga0496106_0239341	Ga0496106_0239341_714_1418	232
2816	3300048910	Ga0496107_0236263	Ga0496107_0236263_323_1027	232
2817	3300048911	Ga0496108_0519211	Ga0496108_0519211_145_843	232
2818	3300048915	Ga0496112_0136175	Ga0496112_0136175_357_1055	232
2819	3300048917	Ga0496114_0005374	Ga0496114_0005374_4376_5080	232
2820	3300048917	Ga0496114_0128222	Ga0496114_0128222_1179_1883	232
2821	3300048920	Ga0496117_0007212	Ga0496117_0007212_950_1651	232
2822	3300048920	Ga0496117_0010091	Ga0496117_0010091_7586_8284	232
2823	3300048920	Ga0496117_0018857	Ga0496117_0018857_4296_4994	232
2824	3300048920	Ga0496117_0043327	Ga0496117_0043327_1804_2502	232
2825	3300048920	Ga0496117_0055388	Ga0496117_0055388_1443_2141	232
2826	3300048920	Ga0496117_0068144	Ga0496117_0068144_1160_1858	232
2827	3300048921	Ga0496118_0005972	Ga0496118_0005972_3329_4027	232
2828	3300048921	Ga0496118_0008809	Ga0496118_0008809_7854_8552	232
2829	3300048921	Ga0496118_0014297	Ga0496118_0014297_3314_4012	232
2830	3300048921	Ga0496118_0022751	Ga0496118_0022751_3474_4172	232
2831	3300048921	Ga0496118_0075099	Ga0496118_0075099_822_1523	232
2832	3300048921	Ga0496118_0226917	Ga0496118_0226917_147_845	232
2833	3300048923	Ga0496120_0123083	Ga0496120_0123083_208_927	232
2834	3300048924	Ga0496121_0017999	Ga0496121_0017999_4234_4932	232
2835	3300048924	Ga0496121_0031409	Ga0496121_0031409_4019_4717	232
2836	3300048924	Ga0496121_0081049	Ga0496121_0081049_1127_1825	232
2837	3300048924	Ga0496121_0118423	Ga0496121_0118423_650_1348	232
2838	3300048924	Ga0496121_0208086	Ga0496121_0208086_473_1177	232
2839	3300048926	Ga0496123_0003718	Ga0496123_0003718_2184_2897	232
2840	3300048926	Ga0496123_0195566	Ga0496123_0195566_61_759	232
2841	3300048927	Ga0496124_0174442	Ga0496124_0174442_840_1538	232
2842	3300048929	Ga0496126_0000088	Ga0496126_0000088_203064_203765	232
2843	3300048929	Ga0496126_0003165	Ga0496126_0003165_13371_14081	232
2844	3300048929	Ga0496126_0004283	Ga0496126_0004283_7140_7838	232
2845	3300048929	Ga0496126_0007888	Ga0496126_0007888_5897_6595	232
2846	3300048929	Ga0496126_0425384	Ga0496126_0425384_208_921	232
2847	3300049459	Ga0495678_001844	Ga0495678_001844_5847_6563	232
2848	3300049459	Ga0495678_012028	Ga0495678_012028_2999_3697	232
2849	3300049459	Ga0495678_014546	Ga0495678_014546_231_938	232
2850	3300049459	Ga0495678_026548	Ga0495678_026548_219_917	232
2851	3300049459	Ga0495678_043358	Ga0495678_043358_727_1494	232
2852	3300049460	Ga0495682_0004684	Ga0495682_0004684_4294_4992	232
2853	3300049460	Ga0495682_0008343	Ga0495682_0008343_2754_3470	232
2854	3300049460	Ga0495682_0019518	Ga0495682_0019518_471_1169	232
2855	3300049460	Ga0495682_0055475	Ga0495682_0055475_280_978	232
2856	3300049775	Ga0501279_011262	Ga0501279_011262_297_1070	232
2857	3300050493	nmdc:mga0k408_6588_c1	nmdc:mga0k408_6588_c1_1892_2602	232
2858	3300050494	nmdc:mga06z11_66264_c1	nmdc:mga06z11_66264_c1_477_1187	232
2859	3300050496	nmdc:mga07m45_58834_c1	nmdc:mga07m45_58834_c1_879_1592	232
2860	3300050507	nmdc:mga05p37_51960_c1	nmdc:mga05p37_51960_c1_1591_2310	232
2861	3300050508	nmdc:mga09592_1720_c1	nmdc:mga09592_1720_c1_15153_15872	232
2862	3300050516	nmdc:mga0sz30_15569_c1	nmdc:mga0sz30_15569_c1_1636_2346	232
2863	3300053125	Ga0500618_002180	Ga0500618_002180_2870_3583	232
2864	3300053139	Ga0500568_0019333	Ga0500568_0019333_448_1149	232
2865	3300053142	Ga0500577_0119400	Ga0500577_0119400_146_847	232
2866	3300053145	Ga0500586_001375	Ga0500586_001375_3821_4534	232
2867	3300053161	Ga0500634_0020707	Ga0500634_0020707_2328_3032	232
2868	3300059423	Ga0590074_020651	Ga0590074_020651_56_775	232
2869	3300061719	Ga0466962_0015206	Ga0466962_0015206_1936_2634	232
2870	3300061719	Ga0466962_0023534	Ga0466962_0023534_399_1097	232
2871	3300061719	Ga0466962_0061622	Ga0466962_0061622_643_1347	232
2872	iso_pu_bacteria	2510065045	2510249955	232
2873	iso_pu_bacteria	2515154122	2515679438	232
2874	iso_pu_bacteria	2515154189	2516016959	232
2875	iso_pu_bacteria	2599185239	2599737008	232
2876	iso_pu_bacteria	2599185240	2599742882	232
2877	iso_pu_bacteria	2599185355	2600205000	232
2878	iso_pu_bacteria	2675903129	2676741989	232
2879	iso_pu_bacteria	2718217991	2719639113	232
2880	iso_pu_bacteria	2791355137	2792832995	232
2881	iso_pu_bacteria	2808606384	2808971597	232
2882	iso_pu_bacteria	2808606390	2809006426	232
2883	iso_pu_bacteria	2808606391	2809013656	232
2884	iso_pu_bacteria	2818991452	2819632510	232
2885	iso_pu_bacteria	2885270888	2885277319	232
2886	iso_pu_bacteria	2902682994	2902683456	232
2887	iso_pu_bacteria	8018845410	8018852796	232
2888	iso_pu_bacteria	8020945358	8020952316	232
2889	iso_pu_bacteria	8021120328	8021126746	232

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01168

Ala_racemase_N

Alanine racemase, N-terminal domain

55

277

0.88 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
7uau-assembly1.cif.gz_A	the crystal structure of the k137a mutant of e. coli yggs in complex with plp	0.9739	3	227
7uat-assembly1.cif.gz_A	the crystal structure of the k36a mutant of e. coli yggs in complex with plp	0.9734	3	227
7ubp-assembly1.cif.gz_A	the crystal structure of the k36a/k137a double mutant of e. coli yggs in complex with plp	0.9733	3	227
1w8g-assembly1.cif.gz_A	crystal structure of e. coli k-12 yggs	0.9728	3	227
7uax-assembly1.cif.gz_A	the crystal structure of the k36a/k38a double mutant of e. coli yggs in complex with plp	0.9727	3	226

ID	Description	Score	Start	End	Superfamily
1w8gA00	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase	0.9728	3	227	3.20.20.10
1w8gA00	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase	0.9644	3	227	3.20.20.10
af_Q9Z2Y8_11_258_3.20.20.10	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase	0.9288	3	232	3.20.20.10
af_Q2FZ87_1_222_3.20.20.10	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase	0.9175	5	229	3.20.20.10
af_Q9Z2Y8_11_258_3.20.20.10	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase	0.9173	3	232	3.20.20.10

ID	Description	Score	Start	End	GO Terms
AF-A0A5Q4YSJ0-F1-model_v4	Pyridoxal phosphate homeostasis protein (PLP homeostasis protein)	1	1	232	GO:0030170
AF-A0A370N4T9-F1-model_v4	Pyridoxal phosphate homeostasis protein (PLP homeostasis protein)	1	1	232	GO:0030170
AF-A0A160FGW6-F1-model_v4	Pyridoxal phosphate homeostasis protein (PLP homeostasis protein)	0.9997	1	232	GO:0030170
AF-A0A103QMS7-F1-model_v4	YggS family pyridoxal phosphate enzyme	0.9993	40	225	GO:0030170
AF-A0A7Y6NJI0-F1-model_v4	Pyridoxal phosphate homeostasis protein (PLP homeostasis protein)	0.9974	4	228	GO:0030170

Feature Viewer

pLDDT	pTM	Quality
95.58	0.92	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F497127

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF01168

Ala_racemase_N

Alanine racemase, N-terminal domain

55

277

0.88

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map