metagRoot

F497082

General Info

Members	Datasets	Scaffolds	Average Seq Length
2820	944	2527	184

Family's Representative Sequence

Representative Sequence	3300034818\|Ga0373950_0040451\|Ga0373950_0040451_133_765
Length	210
Sequence	MVAGALMEVLMETQVDKSDLGKNGAHKRWYVVHAYSGFEKSVAQALRDRIVRDGMEDRFGDVLVPTEEVVEMRSGQKRRSERKFFPGYVLVQIVTHEEGGIPRIDSESWHLIKETPKVMGFIGGTADKPLPIKDSEADAILQRVQEGVEKPRPKVLFEPGEMVRVTDGPFNDFNGVVEEVNYEKSRLRVAVLIFGRSTPVELEFGQVEKA

Samples

	Sample ID	Description	Type	Environment
1	2162886007	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1	Metagenome	Rhizosphere
2	2506520007	Serratia plymuthica AS9	Isolate	Rhizosphere
3	2506520008	Serratia plymuthica AS12	Isolate	Unclassified
4	2508501071	Serratia proteamaculans S4	Isolate	Rhizosphere
5	2510065053	Pseudomonas sp. MOIL14HWK12:I1	Isolate	Rhizosphere
6	2510065055	Pseudomonas sp. MOIL14HWK12:I2	Isolate	Rhizosphere
7	2510065058	Pseudomonas oleovorans MOIL14HWK12	Isolate	Rhizosphere
8	2524614729	Arenimonas oryziterrae YC6267, DSM 21050	Isolate	Rhizosphere
9	2537561728	Pectobacterium wasabiae CFBP 3304	Isolate	Rhizoplane
10	2537561836	Rhodanobacter spathiphylli B39	Isolate	Unclassified
11	2547132130	Stenotrophomonas maltophilia RR-10	Isolate	Unclassified
12	2547132181	Kosakonia sacchari SP1	Isolate	Stem
13	2547132416	Enterobacter sp. MR1	Isolate	Rhizoplane
14	2554235234	Klebsiella michiganensis SA2	Isolate	Unclassified
15	2554235341	Pseudomonas protegens CHA0	Isolate	Rhizosphere
16	2561511199	Enterobacter sp. R4-368	Isolate	Nodule
17	2565956521	Vibrio rhizosphaerae DSM 18581	Isolate	Rhizosphere
18	2571042365	Lysobacter oryzae DSM 21044	Isolate	Rhizosphere
19	2576861471	Stenotrophomonas rhizophila DSM 14405	Isolate	Rhizosphere
20	2585427591	Rahnella aquatilis OV744	Isolate	Rhizosphere
21	2585427592	Rahnella aquatilis OV588	Isolate	Rhizosphere
22	2593339238	Luteibacter sp. UNCMF366Tsu5.1	Isolate	Unclassified
23	2593339239	Luteibacter sp. UNCMF331Sha3.1	Isolate	Unclassified
24	2599185155	Pseudomonas sp. NFACC10-1	Isolate	Rhizoplane
25	2599185169	Klebsiella quasipneumoniae NFPP35	Isolate	Rhizoplane
26	2599185188	Pseudomonas sp. NFACC45	Isolate	Rhizoplane
27	2599185248	Pseudomonas sp. NFACC08-1	Isolate	Rhizoplane
28	2599185257	Pseudomonas sp. NFACC41-3	Isolate	Rhizoplane
29	2599185289	Pseudomonas sp. NFACC51	Isolate	Rhizoplane
30	2599185291	Pseudomonas sp. NFACC48-1	Isolate	Rhizoplane
31	2599185299	Pantoea ananatis NFR11	Isolate	Rhizoplane
32	2599185302	Pseudomonas sp. NFACC43	Isolate	Rhizoplane
33	2599185304	Pseudomonas sp. NFACC47-1	Isolate	Rhizoplane
34	2599185305	Pseudomonas sp. NFACC07-1	Isolate	Rhizoplane
35	2599185306	Pseudomonas sp. NFACC16-2	Isolate	Rhizoplane
36	2599185307	Pseudomonas sp. NFACC02	Isolate	Rhizoplane
37	2599185308	Pseudomonas sp. NFACC17-2	Isolate	Rhizoplane
38	2599185309	Pseudomonas sp. NFACC49-2	Isolate	Rhizoplane
39	2599185310	Pseudomonas sp. NFACC09-4	Isolate	Rhizoplane
40	2599185313	Pseudomonas sp. NFACC05-1	Isolate	Rhizoplane
41	2599185314	Pseudomonas sp. NFACC23-1	Isolate	Rhizoplane
42	2599185315	Pseudomonas sp. NFACC44-2	Isolate	Rhizoplane
43	2599185320	Pseudomonas sp. NFACC36	Isolate	Rhizoplane
44	2599185321	Pseudomonas sp. NFACC54	Isolate	Rhizoplane
45	2599185324	Pseudomonas sp. NFACC46-3	Isolate	Rhizoplane
46	2599185356	Pseudomonas sp. NFPP14	Isolate	Rhizoplane
47	2600255254	Klebsiella quasipneumoniae NFIX15	Isolate	Rhizoplane
48	2600255255	Klebsiella quasipneumoniae NFIX23	Isolate	Rhizoplane
49	2600255256	Enterobacter sp. NFIX08	Isolate	Rhizoplane
50	2600255257	Enterobacter sp. NFIX03	Isolate	Rhizoplane
51	2600255280	Klebsiella quasipneumoniae NFIX42	Isolate	Rhizoplane
52	2600255281	Klebsiella quasipneumoniae NFIX43	Isolate	Rhizoplane
53	2600255283	Pseudomonas sp. NFR16	Isolate	Rhizoplane
54	2600255287	Klebsiella quasipneumoniae NFIX11	Isolate	Rhizoplane
55	2600255288	Klebsiella quasipneumoniae NFIX14	Isolate	Rhizoplane
56	2600255289	Klebsiella quasipneumoniae NFIX16	Isolate	Rhizoplane
57	2600255290	Klebsiella quasipneumoniae NFIX17	Isolate	Rhizoplane
58	2600255291	Klebsiella quasipneumoniae NFIX19	Isolate	Rhizoplane
59	2600255296	Pseudomonas sp. NFR02	Isolate	Rhizoplane
60	2600255298	Klebsiella quasipneumoniae NFIX21	Isolate	Rhizoplane
61	2600255299	Klebsiella quasipneumoniae NFIX22	Isolate	Rhizoplane
62	2600255300	Klebsiella quasipneumoniae NFIX30	Isolate	Rhizoplane
63	2600255301	Klebsiella quasipneumoniae NFIX33	Isolate	Rhizoplane
64	2600255302	Klebsiella quasipneumoniae NFIX35	Isolate	Rhizoplane
65	2600255303	Klebsiella quasipneumoniae NFIX36	Isolate	Rhizoplane
66	2600255304	Klebsiella quasipneumoniae NFIX37	Isolate	Rhizoplane
67	2600255305	Klebsiella quasipneumoniae NFIX41	Isolate	Rhizoplane
68	2600255306	Klebsiella quasipneumoniae NFIX44	Isolate	Rhizoplane
69	2600255307	Klebsiella quasipneumoniae NFIX56	Isolate	Rhizoplane
70	2600255309	Klebsiella sp. NFIX53	Isolate	Rhizoplane
71	2600255310	Enterobacter sp. NFIX06	Isolate	Rhizoplane
72	2600255311	Enterobacter sp. NFIX04	Isolate	Rhizoplane
73	2600255313	Pseudomonas sp. NFPP16	Isolate	Rhizoplane
74	2600255392	Klebsiella quasipneumoniae NFIX54	Isolate	Rhizoplane
75	2602042046	Enterobacter sp. NFIX09	Isolate	Rhizoplane
76	2602042047	Enterobacter sp. NFIX59	Isolate	Rhizoplane
77	2602042052	Klebsiella quasipneumoniae NFIX18	Isolate	Rhizoplane
78	2602042053	Klebsiella quasipneumoniae NFIX12	Isolate	Rhizoplane
79	2602042066	Enterobacter sp. NFIX45	Isolate	Rhizoplane
80	2602042067	Enterobacter sp. NFIX58	Isolate	Rhizoplane
81	2602042103	Klebsiella quasipneumoniae NFIX29	Isolate	Rhizoplane
82	2602042104	Klebsiella quasipneumoniae NFIX26	Isolate	Rhizoplane
83	2602042105	Klebsiella quasipneumoniae NFIX25	Isolate	Rhizoplane
84	2602042106	Klebsiella quasipneumoniae NFIX13	Isolate	Rhizoplane
85	2602042109	Klebsiella aerogenes NFIX39	Isolate	Rhizoplane
86	2602042110	Klebsiella quasipneumoniae NFIX40	Isolate	Rhizoplane
87	2602042111	Klebsiella quasipneumoniae NFIX20	Isolate	Rhizoplane
88	2603880178	Klebsiella quasipneumoniae NFIX34	Isolate	Rhizoplane
89	2603880184	Klebsiella quasipneumoniae NFIX27	Isolate	Rhizoplane
90	2603880202	Klebsiella quasipneumoniae NFIX38	Isolate	Rhizoplane
91	2603880211	Klebsiella quasipneumoniae NFIX24	Isolate	Rhizoplane
92	2608642108	Pantoea agglomerans NFPP29	Isolate	Rhizoplane
93	2609459761	Enterobacter sp. NFR05	Isolate	Rhizoplane
94	2627854209	Arenimonas oryziterrae YC6267, DSM 21050	Isolate	Rhizosphere
95	2636415599	Klebsiella variicola DX120E	Isolate	Unclassified
96	2643221559	Lysobacter sp. Root559	Isolate	Unclassified
97	2643221562	Rhodanobacter sp. Root561	Isolate	Unclassified
98	2643221573	Lysobacter sp. Root604	Isolate	Unclassified
99	2643221577	Rhodanobacter sp. Root627	Isolate	Unclassified
100	2643221579	Pseudoxanthomonas sp. Root630	Isolate	Unclassified
101	2643221581	Pseudoxanthomonas sp. Root65	Isolate	Unclassified
102	2643221586	Lysobacter sp. Root667	Isolate	Unclassified
103	2643221593	Lysobacter sp. Root690	Isolate	Unclassified
104	2643221612	Lysobacter sp. Root76	Isolate	Unclassified
105	2643221685	Rhodanobacter sp. Root480	Isolate	Unclassified
106	2643221695	Lysobacter sp. Root494	Isolate	Unclassified
107	2643221720	Lysobacter sp. Root916	Isolate	Unclassified
108	2643221727	Lysobacter sp. Root96	Isolate	Unclassified
109	2643221728	Lysobacter sp. Root983	Isolate	Unclassified
110	2648501241	Vibrio splendidus UCD-SED7	Isolate	Rhizosphere
111	2648501693	Pantoea ananatis B1-9	Isolate	Rhizosphere
112	2651869818	Vibrio splendidus UCD-SED10	Isolate	Rhizosphere
113	2654587920	Serratia plymuthica HRO-C48	Isolate	Rhizosphere
114	2667528170	Pseudomonas sp. NFACC50-1	Isolate	Rhizoplane
115	2667528172	Enterobacteriaceae bacterium NFIX31	Isolate	Rhizoplane
116	2667528173	Rahnella sp. NFIX50	Isolate	Rhizoplane
117	2671180115	Cedecea sp. NFIX57	Isolate	Rhizoplane
118	2671180172	Pseudomonas sp. NFIX51	Isolate	Rhizoplane
119	2675903046	Klebsiella quasipneumoniae NFIX52	Isolate	Rhizoplane
120	2681812866	Enterobacter asburiae NFIX55	Isolate	Rhizoplane
121	2681812869	Enterobacter ludwigii NFPP41	Isolate	Rhizoplane
122	2684622997	Pantoea ananatis NFIX48	Isolate	Rhizoplane
123	2687453130	Dyella thiooxydans ATSB10	Isolate	Unclassified
124	2687453601	Serratia plymuthica 3Rp8	Isolate	Unclassified
125	2690315857	Rheinheimera sp. EpRS3	Isolate	Unclassified
126	2706794495	Dickeya zeae ZJU1202	Isolate	Unclassified
127	2711768156	Atlantibacter hermannii DDE1	Isolate	Unclassified
128	2718218334	Luteibacter rhizovicinus LJ96	Isolate	Rhizosphere
129	2734482264	Dyella sp. AD052	Isolate	Unclassified
130	2738541271	Pseudomonas sp. GV021	Isolate	Unclassified
131	2738543009	Luteibacter sp. OK325	Isolate	Unclassified
132	2738543016	Pseudomonas sp. GV012	Isolate	Unclassified
133	2739367700	Dyella sp. YR388	Isolate	Unclassified
134	2747842428	Stenotrophomonas sp. WCS2014-113	Isolate	Unclassified
135	2747842501	Xanthomonas sp. WCS2014-23	Isolate	Unclassified
136	2751185917	Enterobacter sp. HK169	Isolate	Unclassified
137	2765235840	Stenotrophomonas maltophilia AA1	Isolate	Unclassified
138	2765235842	Enterobacter ludwigii AA4	Isolate	Unclassified
139	2772190666	Serratia surfactantfaciens YD25	Isolate	Unclassified
140	2773857672	Pseudomonas sp. 1766	Isolate	Unclassified
141	2773857673	Pseudomonas sp. 443	Isolate	Unclassified
142	2775506706	Enterobacter asburiae 1216	Isolate	Unclassified
143	2775507074	Klebsiella sp. D5A	Isolate	Unclassified
144	2784132063	Pseudomonas sp. 424	Isolate	Unclassified
145	2791354903	Mangrovibacter phragmitis MP23	Isolate	Unclassified
146	2791355010	Kosakonia pseudosacchari NN143	Isolate	Unclassified
147	2791355275	Enterobacter sp. Sa187	Isolate	Unclassified
148	2791355520	Pseudomonas sp. s211(2017)	Isolate	Unclassified
149	2808606414	Pantoea sp. SJZ147	Isolate	Rhizosphere
150	2814123068	Kosakonia radicincitans GXGL-4A	Isolate	Rhizosphere
151	2816332141	Stenotrophomonas muris 1190 (v2) (version 2)	Isolate	Unclassified
152	2818991440	Luteibacter yeojuensis 583	Isolate	Unclassified
153	2818991456	Pseudomonas koreensis 3286	Isolate	Rhizosphere
154	2818991457	Xanthomonas translucens 569	Isolate	Unclassified
155	2818991464	Pseudomonas protegens 3295	Isolate	Rhizosphere
156	2821118458	Enterobacter asburiae 609	Isolate	Unclassified
157	2823373977	Enterobacter ludwigii NCR3	Isolate	Rhizosphere
158	2842391507	Stenotrophomonas maltophilia SEMIA 4027	Isolate	Nodule
159	2842757796	Stenotrophomonas sp. R-72406	Isolate	Unclassified
160	2842780639	Pseudoxanthomonas sp. R-71986	Isolate	Unclassified
161	2842815866	Pseudomonas sp. R-72210	Isolate	Unclassified
162	2842914999	Luteibacter sp. R-72151	Isolate	Unclassified
163	2842918807	Luteibacter sp. R-73110	Isolate	Unclassified
164	2844425489	Enterobacter cloacae SBP-8	Isolate	Rhizosphere
165	2844528606	Pantoea sp. R-72498 v. 2	Isolate	Unclassified
166	2846540461	Photorhabdus luminescens HIM3	Isolate	Rhizosphere
167	2847085930	Erwinia persicina B64	Isolate	Bulb
168	2847797336	Pantoea ananatis NN08200	Isolate	Unclassified
169	2852103415	Edaphovirga cremea DSM 105170	Isolate	Rhizosphere
170	2852649853	Stenotrophomonas sp. JAI102	Isolate	Rhizosphere
171	2852684882	Xanthomonas sp. JAI131	Isolate	Rhizosphere
172	2854601825	Dickeya dianthicola SS70	Isolate	Stem Tuber
173	2855195626	Pectobacterium atrosepticum SS26	Isolate	Stem Tuber
174	2857442823	Stenotrophomonas sp. R-74235	Isolate	Unclassified
175	2858466076	Pectobacterium polaris SS28	Isolate	Stem Tuber
176	2865014394	Pantoea sp. R-71966	Isolate	Unclassified
177	2869551831	Serratia inhibens PRI-2C	Isolate	Rhizosphere
178	2871272651	Pectobacterium carotovorum SS96	Isolate	Stem Tuber
179	2871282230	Pectobacterium parmentieri SS90	Isolate	Stem Tuber
180	2874220319	Stenotrophomonas maltophilia PS5	Isolate	Unclassified
181	2881609920	Pantoea sp. ARC607	Isolate	Rhizosphere
182	2884086401	Kluyvera sp. PO2S7	Isolate	Rhizosphere
183	2884338543	Luteibacter pinisoli MAH-14	Isolate	Rhizosphere
184	2884411467	Dyella sp. AD56	Isolate	Rhizosphere
185	2887630918	Psychrosphaera haliotis UCD-MCMsp1aY	Isolate	Unclassified
186	2888366609	Serratia sp. NGAS9	Isolate	Rhizosphere
187	2888373701	Serratia rhizosphaerae KUDC3025	Isolate	Rhizosphere
188	2891670763	Buttiauxella sp. B2	Isolate	Rhizosphere
189	2894414249	Luteimonas sp. LNNU 24178	Isolate	Rhizosphere
190	2895395659	Rhodanobacter sp. T12-5	Isolate	Unclassified
191	2895498888	Pseudoxanthomonas sp. SGD-10	Isolate	Rhizosphere
192	2895511927	Pseudoxanthomonas sp. SGD-5-1	Isolate	Rhizosphere
193	2895522137	Pseudoxanthomonas sp. SGNA-20	Isolate	Rhizosphere
194	2895525241	Pseudoxanthomonas sp. SGT-18	Isolate	Rhizosphere
195	2904463128	Luteibacter yeojuensis 3191	Isolate	Unclassified
196	2904474040	Rahnella aquatilis 4485	Isolate	Rhizosphere
197	2904504865	Serratia marcescens 1822	Isolate	Unclassified
198	2904513164	Klebsiella variicola 1431	Isolate	Rhizosphere
199	2908446538	Pseudomonas sp. R76	Isolate	Rhizosphere
200	2908669403	Pantoea coffeiphila 1480	Isolate	Rhizosphere
201	2916178963	Pseudoalteromonas rhizosphaerae RA15	Isolate	Rhizosphere
202	2919085039	Luteibacter sp. 1214	Isolate	Unclassified
203	2919089067	Stenotrophomonas sp. 1337	Isolate	Rhizosphere
204	2919108558	Klebsiella sp. 1400	Isolate	Rhizosphere
205	2919130084	Xanthomonas sp. 1678	Isolate	Rhizosphere
206	2919134579	Stenotrophomonas geniculata 1733	Isolate	Rhizosphere
207	2919150387	Rahnella aceris 1817	Isolate	Unclassified
208	2919404418	Luteibacter sp. 3190	Isolate	Unclassified
209	2919493220	Aeromonas salmonicida salmonicida 3466	Isolate	Unclassified
210	2919497567	Shewanella putrefaciens 3469	Isolate	Unclassified
211	2919513703	Luteimonas sp. 3794	Isolate	Unclassified
212	2919534386	Rheinheimera pacifica 3879	Isolate	Unclassified
213	2919543075	Aeromonas salmonicida masoucida 4076	Isolate	Unclassified
214	2919675420	Luteimonas terrae 4099	Isolate	Unclassified
215	2919688452	Pararheinheimera soli 4138	Isolate	Unclassified
216	2923516293	Pseudoxanthomonas mexicana SLBN-89	Isolate	Rhizosphere
217	2923525760	Aeromonas caviae SLBN-129	Isolate	Rhizosphere
218	2923634449	Enterobacter kobei SLBN-76	Isolate	Rhizosphere
219	2927143783	Rahnella sp. 2050	Isolate	Unclassified
220	2927833300	Enterobacter sp. SLBN-59	Isolate	Rhizosphere
221	2928496128	Stenotrophomonas indicatrix 1163	Isolate	Unclassified
222	2928963466	Dyella japonica 1073	Isolate	Unclassified
223	2929195423	Xanthomonas sp. R-73098 Hybrid assembly	Isolate	Unclassified
224	2931380184	Stenotrophomonas sp. DR822	Isolate	Rhizosphere
225	2932406140	Serratia sp. 2723	Isolate	Rhizosphere
226	2935625433	Kosakonia sp. 1610	Isolate	Rhizosphere
227	2937539931	Pantoea sp. LS15	Isolate	Unclassified
228	2937610967	Stenotrophomonas maltophilia EP20	Isolate	Unclassified
229	2937967321	Serratia sp. YC16	Isolate	Unclassified
230	2939568625	Lelliottia sp. 489	Isolate	Rhizosphere
231	2939573065	Citrobacter sp. 506	Isolate	Rhizosphere
232	2939577877	Serratia sp. 509	Isolate	Rhizosphere
233	2939589442	Stenotrophomonas rhizophila 716	Isolate	Rhizosphere
234	2939607340	Leclercia sp. 1548	Isolate	Rhizosphere
235	2939611941	Rhodanobacter soli 1757	Isolate	Rhizosphere
236	2939617950	Kosakonia cowanii 2056	Isolate	Rhizosphere
237	2939622612	Stenotrophomonas sp. 2619	Isolate	Rhizosphere
238	2939626828	Stenotrophomonas sp. 2694	Isolate	Rhizosphere
239	2939642701	Lelliottia nimipressuralis 2756	Isolate	Rhizosphere
240	2941471342	Luteibacter sp. 621	Isolate	Unclassified
241	2941475908	Stenotrophomonas rhizophila 2680	Isolate	Rhizosphere
242	2941489479	Lysobacter enzymogenes 2943	Isolate	Rhizosphere
243	2945874760	Phytobacter diazotrophicus UAEU22	Isolate	Rhizosphere
244	2945951305	Pantoea agglomerans W2I1	Isolate	Rhizosphere
245	2953994433	Luteibacter sp. W1I16	Isolate	Rhizosphere
246	2961047084	Stenotrophomonas maltophilia EP5	Isolate	Unclassified
247	2961064222	Stenotrophomonas maltophilia EP13	Isolate	Unclassified
248	2969079654	Klebsiella variicola E57-7	Isolate	Unclassified
249	2971820967	Klebsiella sp. MPUS7	Isolate	Rhizosphere
250	2974298342	Pseudomonas sp. SORGH_AS 211	Isolate	Unclassified
251	2974307012	Stenotrophomonas sp. SORGH_AS_0282	Isolate	Unclassified
252	2974310843	Enterobacter sp. SORGH_AS 287	Isolate	Unclassified
253	2974435778	Kosakonia cowanii SORGH_AS 304	Isolate	Unclassified
254	2977247770	Stenotrophomonas rhizophila SORGH_AS 457	Isolate	Unclassified
255	2978975091	Pantoea anthophila SORGH_AS 797	Isolate	Unclassified
256	2984494565	Pantoea ananatis SORGH_AS197	Isolate	Aerial Root
257	2984499530	Pseudomonas sp. SORGH_AS199	Isolate	Aerial Root
258	2984504281	Pseudomonas psychrotolerans SORGH_AS201	Isolate	Aerial Root
259	2984514374	Stenotrophomonas sp. SORGH_AS282	Isolate	Aerial Root
260	2984559226	Klebsiella variicola SORGH_AS834	Isolate	Aerial Root
261	2984595703	Klebsiella variicola SORGH_AS1070	Isolate	Aerial Root
262	2987605356	Stenotrophomonas sp. ATCM1_4	Isolate	Unclassified
263	2990261002	Pantoea ananatis SORGH_AS213	Isolate	Aerial Root
264	2995948881	Lysobacter enzymogenes B25	Isolate	Unclassified
265	3000376612	Enterobacteriaceae bacterium 4M9	Isolate	Rhizosphere
266	3007419365	Pseudomonas vanderleydeniana RW8P3	Isolate	Unclassified
267	3007872151	Pseudomonas sp. SWRI51	Isolate	Rhizosphere
268	3300001904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2	Metagenome	Rhizosphere
269	3300001915	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7	Metagenome	Rhizosphere
270	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
271	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
272	3300001990	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3	Metagenome	Rhizosphere
273	3300002067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1	Metagenome	Rhizosphere
274	3300002075	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4	Metagenome	Rhizosphere
275	3300002459	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6	Metagenome	Rhizosphere
276	3300002705	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS	Metagenome	Unclassified
277	3300002737	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA	Metagenome	Endosphere
278	3300002738	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA	Metagenome	Unclassified
279	3300002741	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL	Metagenome	Unclassified
280	3300002771	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB	Metagenome	Endosphere
281	3300002772	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS	Metagenome	Endosphere
282	3300002773	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS	Metagenome	Endosphere
283	3300002774	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA	Metagenome	Endosphere
284	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
285	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
286	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
287	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
288	3300003479	Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_06_lowP_mix1_d1 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
289	3300003558	Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_10_fullP_mix1_d2 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
290	3300003565	Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_16_lowP_mix3_d2 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
291	3300003567	Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
292	3300003578	Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Unclassified
293	3300003751	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2	Metagenome	Endosphere
294	3300003752	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2	Metagenome	Endosphere
295	3300003756	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2	Metagenome	Endosphere
296	3300003759	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2	Metagenome	Endosphere
297	3300003760	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2	Metagenome	Endosphere
298	3300003761	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2	Metagenome	Endosphere
299	3300003762	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2	Metagenome	Endosphere
300	3300003763	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2	Metagenome	Endosphere
301	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
302	3300003773	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2	Metagenome	Endosphere
303	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
304	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
305	3300003784	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2	Metagenome	Endosphere
306	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
307	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
308	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
309	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
310	3300003841	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2	Metagenome	Endosphere
311	3300003856	Agave microbial communities from Guanajuato, Mexico - At.Am.rz	Metagenome	Rhizosphere
312	3300004799	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
313	3300004800	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
314	3300004801	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome)	Metatranscriptome	Unclassified
315	3300004803	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
316	3300005272	Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1	Metagenome	Rhizosphere
317	3300005288	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
318	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
319	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
320	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
321	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
322	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
323	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
324	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
325	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
326	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
327	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
328	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
329	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
330	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
331	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
332	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
333	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
334	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
335	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
336	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
337	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
338	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
339	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
340	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
341	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
342	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
343	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
344	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
345	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
346	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
347	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
348	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
349	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
350	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
351	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
352	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
353	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
354	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
355	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
356	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
357	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
358	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
359	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
360	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
361	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
362	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
363	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
364	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
365	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
366	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
367	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
368	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
369	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
370	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
371	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
372	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
373	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
374	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
375	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
376	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
377	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
378	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
379	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
380	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
381	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
382	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
383	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
384	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
385	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
386	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
387	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
388	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
389	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
390	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
391	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
392	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
393	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
394	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
395	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
396	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
397	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
398	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
399	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
400	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
401	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
402	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
403	3300006948	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15	Metagenome	Nodule
404	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
405	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
406	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
407	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
408	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
409	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
410	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
411	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
412	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
413	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
414	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
415	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
416	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
417	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
418	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
419	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
420	3300009979	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG	Metagenome	Rhizosphere
421	3300009984	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG	Metagenome	Rhizosphere
422	3300009987	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG	Metagenome	Rhizosphere
423	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
424	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
425	3300012475	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610	Metagenome	Rhizosphere
426	3300012478	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610	Metagenome	Rhizosphere
427	3300012485	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610	Metagenome	Rhizosphere
428	3300012487	Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510	Metagenome	Rhizosphere
429	3300012498	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410	Metagenome	Rhizosphere
430	3300012500	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610	Metagenome	Rhizosphere
431	3300012502	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610	Metagenome	Rhizosphere
432	3300012503	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R	Metagenome	Rhizosphere
433	3300012505	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610	Metagenome	Rhizosphere
434	3300012508	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510	Metagenome	Rhizosphere
435	3300012510	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610	Metagenome	Rhizosphere
436	3300012512	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510	Metagenome	Rhizosphere
437	3300012513	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510	Metagenome	Rhizosphere
438	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
439	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
440	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
441	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
442	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
443	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
444	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
445	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
446	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
447	3300013874	Rhizosphere microbial communities from switchgrass harvested rhizosphere in Austin, TX, USA - RS_213	Metagenome	Rhizosphere
448	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
449	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
450	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
451	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
452	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
453	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
454	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
455	3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Metagenome	Rhizosphere
456	3300015679	Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08	Metagenome	Unclassified
457	3300015680	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03	Metagenome	Rhizosphere
458	3300015685	Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12	Metagenome	Unclassified
459	3300015687	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08	Metagenome	Rhizosphere
460	3300015689	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02	Metagenome	Rhizosphere
461	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
462	3300020069	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
463	3300020070	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
464	3300020075	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
465	3300020076	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3)	Metatranscriptome	Rhizosphere
466	3300020077	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
467	3300020078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
468	3300020080	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
469	3300020081	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
470	3300020082	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
471	3300020610	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
472	3300021377	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7	Metagenome	Unclassified
473	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
474	3300022467	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
475	3300025206	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2)	Metagenome	Unclassified
476	3300025207	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
477	3300025224	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
478	3300025225	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
479	3300025226	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
480	3300025228	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
481	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
482	3300025231	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
483	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
484	3300025242	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
485	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
486	3300025246	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2)	Metagenome	Unclassified
487	3300025250	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2)	Metagenome	Unclassified
488	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
489	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
490	3300025256	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2)	Metagenome	Unclassified
491	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
492	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
493	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
494	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
495	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
496	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
497	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
498	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
499	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
500	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
501	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
502	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
503	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
504	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
505	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
506	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
507	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
508	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
509	3300025711	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
510	3300025728	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
511	3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
512	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
513	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
514	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
515	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
516	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
517	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
518	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
519	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
520	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
521	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
522	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
523	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
524	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
525	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
526	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
527	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
528	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
529	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
530	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
531	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
532	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
533	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
534	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
535	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
536	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
537	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
538	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
539	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
540	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
541	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
542	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
543	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
544	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
545	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
546	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
547	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
548	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
549	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
550	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
551	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
552	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
553	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
554	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
555	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
556	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
557	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
558	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
559	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
560	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
561	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
562	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
563	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
564	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
565	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
566	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
567	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
568	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
569	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
570	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
571	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
572	3300027252	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
573	3300027312	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2)	Metagenome	Rhizosphere
574	3300027364	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2)	Metagenome	Rhizosphere
575	3300027395	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2)	Metagenome	Rhizosphere
576	3300027471	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
577	3300027526	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
578	3300027543	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
579	3300027617	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
580	3300027665	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
581	3300027682	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
582	3300027717	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
583	3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
584	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
585	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
586	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
587	3300028577	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG	Metagenome	Rhizosphere
588	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
589	3300030500	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3)	Metagenome	Rhizosphere
590	3300030731	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3	Metagenome	Rhizosphere
591	3300030732	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1	Metagenome	Rhizosphere
592	3300030733	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2	Metagenome	Rhizosphere
593	3300030745	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8	Metagenome	Rhizosphere
594	3300030863	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
595	3300030888	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
596	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
597	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
598	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
599	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
600	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
601	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
602	3300031665	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3	Metagenome	Rhizosphere
603	3300031691	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA	Metagenome	Rhizosphere
604	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
605	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
606	3300031728	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC	Metagenome	Rhizosphere
607	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
608	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
609	3300031733	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1	Metagenome	Rhizosphere
610	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
611	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
612	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
613	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
614	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
615	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
616	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
617	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
618	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
619	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
620	3300032133	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA	Metagenome	Rhizosphere
621	3300032137	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC	Metagenome	Rhizosphere
622	3300032139	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB	Metagenome	Rhizosphere
623	3300032168	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
624	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
625	3300033524	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
626	3300033527	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
627	3300033528	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
628	3300033529	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
629	3300033541	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
630	3300034818	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3	Metagenome	Rhizosphere
631	3300034819	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1	Metagenome	Rhizosphere
632	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
633	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
634	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
635	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
636	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
637	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
638	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
639	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
640	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
641	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
642	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
643	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
644	3300037588	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA	Metagenome	Rhizosphere
645	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
646	3300038705	Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1	Metagenome	Unclassified
647	3300038725	Seagrass microbial communities from Seahorse Key, FL, USA - HV0818	Metagenome	Unclassified
648	3300038726	Seagrass microbial communities from Seahorse Key, FL, USA - TH0319	Metagenome	Unclassified
649	3300038727	Seagrass microbial communities from Seahorse Key, FL, USA - TV0818	Metagenome	Unclassified
650	3300038741	Seagrass microbial communities from Seahorse Key, FL, USA - SV0818	Metagenome	Unclassified
651	3300039062	Seagrass microbial communities from Seahorse Key, FL, USA - HH0818	Metagenome	Unclassified
652	3300039093	Seagrass microbial communities from Seahorse Key, FL, USA - TH0818	Metagenome	Unclassified
653	3300039145	Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1	Metagenome	Unclassified
654	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
655	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
656	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
657	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
658	3300041404	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272	Metagenome	Rhizosphere
659	3300041405	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414	Metagenome	Rhizosphere
660	3300041406	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284	Metagenome	Rhizosphere
661	3300041407	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416	Metagenome	Rhizosphere
662	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
663	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
664	3300041443	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG	Metagenome	Rhizoplane
665	3300041444	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT	Metatranscriptome	Rhizoplane
666	3300041451	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG	Metagenome	Rhizoplane
667	3300041452	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG	Metagenome	Rhizoplane
668	3300041453	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG	Metagenome	Rhizoplane
669	3300041456	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG	Metagenome	Rhizoplane
670	3300041459	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG	Metagenome	Rhizoplane
671	3300041460	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG	Metagenome	Rhizoplane
672	3300041462	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG	Metagenome	Rhizoplane
673	3300041463	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG	Metagenome	Rhizoplane
674	3300041486	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG	Metagenome	Rhizoplane
675	3300041494	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG	Metagenome	Unclassified
676	3300041505	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG	Metagenome	Unclassified
677	3300041507	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG	Metagenome	Unclassified
678	3300041509	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG	Metagenome	Unclassified
679	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
680	3300041997	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607	Metagenome	Rhizosphere
681	3300041999	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297	Metagenome	Rhizosphere
682	3300042000	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539	Metagenome	Rhizosphere
683	3300042004	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619	Metagenome	Rhizosphere
684	3300042005	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216	Metagenome	Rhizosphere
685	3300042006	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437	Metagenome	Rhizosphere
686	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
687	3300042009	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348	Metagenome	Rhizosphere
688	3300042010	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431	Metagenome	Rhizosphere
689	3300042011	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204	Metagenome	Rhizosphere
690	3300042013	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339	Metagenome	Rhizosphere
691	3300042014	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275	Metagenome	Rhizosphere
692	3300042015	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287	Metagenome	Rhizosphere
693	3300042115	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642	Metagenome	Rhizosphere
694	3300042118	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156	Metagenome	Rhizosphere
695	3300042121	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398	Metagenome	Rhizosphere
696	3300042122	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496	Metagenome	Rhizosphere
697	3300042123	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228	Metagenome	Rhizosphere
698	3300042125	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472	Metagenome	Rhizosphere
699	3300042127	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91	Metagenome	Rhizosphere
700	3300042131	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130	Metagenome	Rhizosphere
701	3300042132	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133	Metagenome	Rhizosphere
702	3300042133	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134	Metagenome	Rhizosphere
703	3300042134	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126	Metagenome	Rhizosphere
704	3300042137	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519	Metagenome	Rhizosphere
705	3300042146	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979	Metagenome	Rhizosphere
706	3300042156	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593	Metagenome	Rhizosphere
707	3300042184	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630	Metagenome	Rhizosphere
708	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
709	3300042436	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520	Metagenome	Rhizosphere
710	3300042437	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554	Metagenome	Rhizosphere
711	3300042438	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533	Metagenome	Rhizosphere
712	3300042439	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363	Metagenome	Rhizosphere
713	3300042461	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366	Metagenome	Rhizosphere
714	3300042531	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253	Metagenome	Rhizosphere
715	3300042532	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92	Metagenome	Rhizosphere
716	3300042533	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472	Metagenome	Rhizosphere
717	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
718	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
719	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
720	3300044669	Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E	Metagenome	Unclassified
721	3300044672	Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E	Metagenome	Unclassified
722	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
723	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
724	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
725	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
726	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
727	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
728	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
729	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
730	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
731	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
732	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
733	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
734	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
735	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
736	3300046452	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere	Metagenome	Rhizosphere
737	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
738	3300046458	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere	Metagenome	Rhizosphere
739	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
740	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
741	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
742	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
743	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
744	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
745	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
746	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
747	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
748	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
749	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
750	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
751	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
752	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
753	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
754	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
755	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
756	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
757	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
758	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
759	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
760	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
761	3300046525	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere	Metagenome	Rhizosphere
762	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
763	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
764	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
765	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
766	3300046537	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere	Metagenome	Rhizosphere
767	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
768	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
769	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
770	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
771	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
772	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
773	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
774	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
775	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
776	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
777	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
778	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
779	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
780	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
781	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
782	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
783	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
784	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
785	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
786	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
787	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
788	3300047446	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere	Metagenome	Rhizosphere
789	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
790	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
791	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
792	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
793	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
794	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
795	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
796	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
797	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
798	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
799	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
800	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
801	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
802	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
803	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
804	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
805	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
806	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
807	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
808	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
809	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
810	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
811	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
812	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
813	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
814	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
815	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
816	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
817	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
818	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
819	3300049130	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
820	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
821	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
822	3300049528	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
823	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
824	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
825	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
826	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
827	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
828	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
829	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
830	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
831	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
832	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
833	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
834	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
835	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
836	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
837	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
838	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
839	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
840	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
841	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
842	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
843	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
844	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
845	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
846	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
847	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
848	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
849	3300049661	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control	Metagenome	Rhizosphere
850	3300049663	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought	Metagenome	Rhizosphere
851	3300049672	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought	Metagenome	Rhizosphere
852	3300049680	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought	Metagenome	Rhizosphere
853	3300049686	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control	Metagenome	Rhizosphere
854	3300049705	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought	Metagenome	Rhizosphere
855	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
856	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
857	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
858	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
859	3300049760	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control	Metagenome	Rhizosphere
860	3300049765	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought	Metagenome	Rhizosphere
861	3300049772	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control	Metagenome	Rhizosphere
862	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
863	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
864	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
865	3300049853	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought	Metagenome	Rhizosphere
866	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
867	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
868	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
869	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
870	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
871	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
872	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
873	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
874	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
875	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
876	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
877	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
878	3300053079	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere	Metagenome	Endosphere
879	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
880	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
881	3300053088	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere	Metagenome	Endosphere
882	3300053090	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere	Metagenome	Endosphere
883	3300053092	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere	Metagenome	Endosphere
884	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
885	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
886	3300053098	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere	Metagenome	Endosphere
887	3300053099	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere	Metagenome	Endosphere
888	3300053100	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere	Metagenome	Endosphere
889	3300053103	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere	Metagenome	Endosphere
890	3300053108	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere	Metagenome	Endosphere
891	3300053109	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere	Metagenome	Endosphere
892	3300053120	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere	Metagenome	Endosphere
893	3300053123	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere	Metagenome	Endosphere
894	3300053126	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere	Metagenome	Endosphere
895	3300053131	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere	Metagenome	Endosphere
896	3300053138	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere	Metagenome	Endosphere
897	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
898	3300053140	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere	Metagenome	Endosphere
899	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
900	3300053160	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere	Metagenome	Endosphere
901	3300053161	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere	Metagenome	Endosphere
902	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
903	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
904	3300055283	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere	Metagenome	Endosphere
905	3300059421	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
906	3300059492	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
907	3300059503	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
908	3300059504	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
909	3300059505	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
910	3300059508	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
911	3300059605	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
912	3300059640	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
913	3300059643	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
914	3300059644	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
915	3300059659	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
916	3300060346	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
917	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
918	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
919	637000220	Pseudomonas protegens Pf-5	Isolate	Rhizoplane
920	640427133	Stutzerimonas stutzeri A1501	Isolate	Rhizosphere
921	640753048	Serratia proteamaculans 568	Isolate	Endosphere
922	8002745576	Marinomonas spartinae USM8	Isolate	Rhizosphere
923	8002869464	Pseudoxanthomonas helianthi 110414	Isolate	Unclassified
924	8003014200	Lysobacter changpingensis Cm-3-T8	Isolate	Rhizosphere
925	8004592986	Serratia sp. S119	Isolate	Unclassified
926	8011350971	Pseudomonas sp. 30_B	Isolate	Rhizosphere
927	8015394850	Serratia sp. PGPR-27	Isolate	Rhizosphere
928	8016728285	Pseudomonas psychrotolerans SORGH_AS 227	Isolate	Unclassified
929	8018221730	Enterobacter sp. CM29	Isolate	Unclassified
930	8018405270	Enterobacter sp. 198	Isolate	Rhizosphere
931	8019504834	Atlantibacter hermannii 1903	Isolate	Rhizosphere
932	8021622325	Xanthomonas sp. LMG12462	Isolate	Rhizosphere
933	8021626552	Xanthomonas sp. LMG12460	Isolate	Rhizosphere
934	8021648035	Xanthomonas sp. LMG 12461	Isolate	Rhizosphere
935	8054357960	Idiomarina rhizosphaerae M1R2S28	Isolate	Rhizosphere
936	8054844752	Dryocola boscaweniae H18W14	Isolate	Rhizosphere
937	8054849141	Dryocola clanedunensis H11S18	Isolate	Rhizosphere
938	8055087960	Silvania hatchlandensis H19S6	Isolate	Rhizosphere
939	8055092621	Silvania confinis H4N4	Isolate	Rhizosphere
940	8055097453	Leclercia tamurae H6W5	Isolate	Rhizosphere
941	8055693939	Hafnia alvei A23BA	Isolate	Rhizosphere
942	8056120720	Pseudomonas maumuensis COW77	Isolate	Rhizosphere
943	8056569372	Pseudomonas serboccidentalis IT-P374	Isolate	Rhizosphere
944	8057304971	Scandinavium manionii H17S15	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	85.32
Metatranscriptomes	4.29
Isolates	10.39

Biome Distribution

Category	Percentage (%)
Aerial Root	0.25
Bulb	0.04
Endosphere	9.26
Nodule	0.67
Rhizoplane	5.53
Rhizosphere	72.06
Stem	0.04
Stem Tuber	0.18
Unclassified	11.99

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	SwRhRL2b_contig_388725	2162886007	Bacteria	1795
2	JGI24736J21556_1003356	3300001904	Bacteria	2785
3	JGI24741J21665_1004672	3300001915	Bacteria	2989
4	JGI24741J21665_1013326	3300001915	Bacteria	1397
5	JGI24740J21852_10004454	3300001979	Bacteria	6026
6	JGI24740J21852_10004655	3300001979	Bacteria	5883
7	JGI24740J21852_10008902	3300001979	Bacteria	3968
8	JGI24740J21852_10014944	3300001979	Bacteria	2848
9	JGI24739J22299_10006945	3300001989	Bacteria	4266
10	JGI24737J22298_10003734	3300001990	Bacteria	5360
11	JGI24737J22298_10015387	3300001990	Bacteria	2476
12	JGI24735J21928_10008251	3300002067	Bacteria	3376
13	JGI24735J21928_10016644	3300002067	Bacteria	2278
14	JGI24735J21928_10030712	3300002067	Bacteria	1595
15	JGI24735J21928_10041111	3300002067	Bacteria	1348
16	JGI24738J21930_10000449	3300002075	Bacteria	11665
17	JGI24751J29686_10027821	3300002459	Bacteria	1174
18	JGI25156J39149_1004294	3300002705	Bacteria	4383
19	JGI25156J39149_1005056	3300002705	Bacteria	3892
20	JGI25156J39149_1007872	3300002705	Bacteria	2747
21	JGI25156J39149_1010742	3300002705	Bacteria	2128
22	JGI25162J39368_1000566	3300002737	Bacteria	27108
23	JGI25162J39368_1001382	3300002737	Bacteria	13329
24	JGI25162J39368_1002601	3300002737	Bacteria	6767
25	JGI25162J39368_1004768	3300002737	Bacteria	2976
26	JGI25162J39368_1012130	3300002737	Bacteria	1003
27	JGI25162J39368_1012422	3300002737	Bacteria	978
28	JGI25162J39368_1014701	3300002737	Bacteria	830
29	JGI25162J39368_1014721	3300002737	Bacteria	829
30	JGI25154J39366_1005468	3300002738	Bacteria	2017
31	JGI25157J39369_1001725	3300002741	Bacteria	7298
32	JGI25157J39369_1002210	3300002741	Bacteria	5312
33	JGI25157J39369_1002553	3300002741	Bacteria	4391
34	JGI25157J39369_1002735	3300002741	Bacteria	4061
35	JGI25157J39369_1002856	3300002741	Bacteria	3893
36	JGI25163J39215_1000154	3300002771	Bacteria	27108
37	JGI25163J39215_1000473	3300002771	Bacteria	12125
38	JGI25164J39214_1000364	3300002772	Bacteria	27108
39	JGI25164J39214_1001244	3300002772	Bacteria	6771
40	JGI25164J39214_1003890	3300002772	Bacteria	1802
41	JGI25164J39214_1003977	3300002772	Bacteria	1767
42	JGI25164J39214_1011901	3300002772	Bacteria	829
43	JGI25152J39213_1000334	3300002773	Bacteria	29873
44	JGI25152J39213_1001911	3300002773	Bacteria	8323
45	JGI25150J39212_1001072	3300002774	Bacteria	8314
46	JGI25151J46595_10008142	3300003187	Bacteria	5070
47	JGI25151J46595_10009416	3300003187	Bacteria	4627
48	JGI25151J46595_10025065	3300003187	Bacteria	2432
49	JGI25151J46595_10057280	3300003187	Bacteria	1271
50	JGI25165J46597_1002201	3300003214	Bacteria	6898
51	JGI25165J46597_1002234	3300003214	Bacteria	6771
52	JGI25165J46597_1007590	3300003214	Bacteria	1782
53	JGI25165J46597_1022131	3300003214	Bacteria	829
54	JGI25153J46596_10003805	3300003215	Bacteria	8323
55	JGI25153J46596_10074476	3300003215	Bacteria	867
56	rootH2_10044747	3300003320	Bacteria	1636
57	rootH2_10084819	3300003320	Bacteria	3161
58	Ga0006556J51387_1017050	3300003479	Bacteria	2733
59	Ga0006558J51389_1021279	3300003558	Bacteria	1590
60	Ga0006560J51390_1020844	3300003565	Bacteria	1687
61	Ga0006560J51390_1027413	3300003565	Bacteria	1997
62	Ga0006554J51385_1016964	3300003567	Bacteria	17652
63	Ga0006554J51385_1022274	3300003567	Bacteria	5510
64	Ga0006562J51391_1006869	3300003578	Bacteria	31335
65	Ga0055538_1000270	3300003751	Bacteria	27108
66	Ga0055538_1000620	3300003751	Bacteria	11439
67	Ga0055539_1000298	3300003752	Bacteria	27108
68	Ga0055539_1002274	3300003752	Bacteria	3019
69	Ga0055533_1000280	3300003756	Bacteria	27108
70	Ga0055533_1005870	3300003756	Bacteria	1904
71	Ga0055533_1007101	3300003756	Bacteria	1561
72	Ga0055525_1000111	3300003759	Bacteria	127836
73	Ga0055525_1000404	3300003759	Bacteria	27108
74	Ga0055527_1001226	3300003760	Bacteria	5686
75	Ga0055527_1001685	3300003760	Bacteria	4337
76	Ga0055535_1003479	3300003761	Bacteria	4434
77	Ga0055535_1003543	3300003761	Bacteria	4337
78	Ga0055535_1004845	3300003761	Bacteria	3133
79	Ga0055535_1005054	3300003761	Bacteria	3006
80	Ga0055535_1008702	3300003761	Bacteria	1805
81	Ga0055542_1003332	3300003762	Bacteria	4434
82	Ga0055542_1003393	3300003762	Bacteria	4337
83	Ga0055542_1004884	3300003762	Bacteria	3133
84	Ga0055542_1005157	3300003762	Bacteria	3006
85	Ga0055542_1020229	3300003762	Bacteria	979
86	Ga0055542_1020258	3300003762	Bacteria	978
87	Ga0055529_1001509	3300003763	Bacteria	6771
88	Ga0055529_1001681	3300003763	Bacteria	5748
89	Ga0055529_1002068	3300003763	Bacteria	4337
90	Ga0055529_1002387	3300003763	Bacteria	3683
91	Ga0055529_1005314	3300003763	Bacteria	1873
92	Ga0055526_1006995	3300003771	Bacteria	5983
93	Ga0055526_1008227	3300003771	Bacteria	5243
94	Ga0055526_1010904	3300003771	Bacteria	4167
95	Ga0055537_1002867	3300003773	Bacteria	5525
96	Ga0055537_1003514	3300003773	Bacteria	4800
97	Ga0055524_1006155	3300003775	Bacteria	5243
98	Ga0055524_1022585	3300003775	Bacteria	2050
99	Ga0055524_1024356	3300003775	Bacteria	1921
100	Ga0055524_1026194	3300003775	Bacteria	1809
101	Ga0055536_1017557	3300003781	Bacteria	2337
102	Ga0055536_1020863	3300003781	Bacteria	2008
103	Ga0055536_1046619	3300003781	Bacteria	983
104	Ga0055536_1055359	3300003781	Bacteria	848
105	Ga0055536_1058179	3300003781	Bacteria	812
106	Ga0055534_1003215	3300003784	Bacteria	5246
107	Ga0055534_1003658	3300003784	Bacteria	4765
108	Ga0055534_1003739	3300003784	Bacteria	4688
109	Ga0055528_1006600	3300003790	Bacteria	5246
110	Ga0055528_1007487	3300003790	Bacteria	4820
111	Ga0055528_1029307	3300003790	Bacteria	1493
112	Ga0055530_10017712	3300003791	Bacteria	2220
113	Ga0055530_10048920	3300003791	Bacteria	991
114	Ga0055530_10049009	3300003791	Bacteria	990
115	Ga0055530_10049660	3300003791	Bacteria	981
116	Ga0055540_1052113	3300003792	Bacteria	841
117	Ga0055531_10013410	3300003794	Bacteria	3777
118	Ga0055531_10029643	3300003794	Bacteria	1859
119	Ga0055531_10034025	3300003794	Bacteria	1627
120	Ga0055531_10040495	3300003794	Bacteria	1364
121	Ga0055531_10066811	3300003794	Bacteria	848
122	Ga0055531_10070184	3300003794	Bacteria	812
123	Ga0055541_1000193	3300003841	Bacteria	27108
124	Ga0058692_1003260	3300003856	Bacteria	5078
125	Ga0058692_1003324	3300003856	Bacteria	5001
126	Ga0058692_1011166	3300003856	Bacteria	2186
127	Ga0058692_1016413	3300003856	Bacteria	1646
128	Ga0058692_1016755	3300003856	Bacteria	1621
129	Ga0058692_1025346	3300003856	Bacteria	1180
130	Ga0058692_1028669	3300003856	Bacteria	1072
131	Ga0058692_1030152	3300003856	Bacteria	1032
132	Ga0058692_1040098	3300003856	Bacteria	826
133	Ga0058863_10118331	3300004799	Bacteria	3255
134	Ga0058861_10101296	3300004800	Bacteria	1856
135	Ga0058860_10148632	3300004801	Bacteria	2298
136	Ga0058862_10069052	3300004803	Bacteria	1629
137	Ga0065703_1021565	3300005272	Bacteria	1189
138	Ga0065714_10068333	3300005288	Bacteria	4790
139	Ga0065714_10151095	3300005288	Bacteria	1102
140	Ga0065714_10249790	3300005288	Bacteria	777
141	Ga0065704_10002470	3300005289	Bacteria	10626
142	Ga0065704_10016949	3300005289	Bacteria	1371
143	Ga0065704_10025620	3300005289	Bacteria	1339
144	Ga0065704_10091571	3300005289	Bacteria	2708
145	Ga0065704_10110729	3300005289	Bacteria	1974
146	Ga0065704_10127719	3300005289	Bacteria	1672
147	Ga0065704_10174160	3300005289	Bacteria	1267
148	Ga0065704_10246379	3300005289	Bacteria	1001
149	Ga0065704_10371389	3300005289	Bacteria	785
150	Ga0065712_10147548	3300005290	Bacteria	1386
151	Ga0065715_10017243	3300005293	Bacteria	2113
152	Ga0065715_10023465	3300005293	Bacteria	1311
153	Ga0065715_10027938	3300005293	Bacteria	1903
154	Ga0065715_10043051	3300005293	Bacteria	872
155	Ga0065715_10351885	3300005293	Bacteria	949
156	Ga0065715_10430023	3300005293	Bacteria	848
157	Ga0065715_10502129	3300005293	Bacteria	779
158	Ga0065715_10730347	3300005293	Bacteria	639
159	Ga0065707_10083054	3300005295	Bacteria	10681
160	Ga0065707_10191580	3300005295	Bacteria	1335
161	Ga0065707_10344610	3300005295	Bacteria	928
162	Ga0065707_10350046	3300005295	Bacteria	920
163	Ga0070658_10071967	3300005327	Bacteria	2832
164	Ga0070658_10167997	3300005327	Bacteria	1842
165	Ga0070658_10198435	3300005327	Bacteria	1692
166	Ga0070658_10215702	3300005327	Bacteria	1622
167	Ga0070658_10226964	3300005327	Bacteria	1581
168	Ga0070658_10267292	3300005327	Bacteria	1454
169	Ga0070658_10676279	3300005327	Bacteria	896
170	Ga0070676_10119721	3300005328	Bacteria	1651
171	Ga0070676_10227604	3300005328	Bacteria	1234
172	Ga0070676_10426122	3300005328	Bacteria	928
173	Ga0070683_100373014	3300005329	Bacteria	1359
174	Ga0070683_100734928	3300005329	Bacteria	945
175	Ga0070690_100560007	3300005330	Bacteria	863
176	Ga0070670_100002056	3300005331	Bacteria	16473
177	Ga0070670_100008976	3300005331	Bacteria	8539
178	Ga0070670_100044271	3300005331	Bacteria	3827
179	Ga0070670_100188983	3300005331	Bacteria	1789
180	Ga0070670_100266044	3300005331	Bacteria	1495
181	Ga0070670_100375744	3300005331	Bacteria	1252
182	Ga0070677_10356170	3300005333	Bacteria	760
183	Ga0068869_100097440	3300005334	Bacteria	2221
184	Ga0068869_100301180	3300005334	Bacteria	1294
185	Ga0068869_100402925	3300005334	Bacteria	1125
186	Ga0068869_100489858	3300005334	Bacteria	1025
187	Ga0070666_10001169	3300005335	Bacteria	15928
188	Ga0070666_10051339	3300005335	Bacteria	2776
189	Ga0070666_10067096	3300005335	Bacteria	2435
190	Ga0070666_10214174	3300005335	Bacteria	1357
191	Ga0070666_10244805	3300005335	Bacteria	1268
192	Ga0070666_10455843	3300005335	Bacteria	924
193	Ga0070680_100048463	3300005336	Bacteria	3462
194	Ga0070680_100074056	3300005336	Bacteria	2801
195	Ga0070680_100144953	3300005336	Bacteria	1992
196	Ga0070680_100201551	3300005336	Bacteria	1678
197	Ga0070680_100207524	3300005336	Bacteria	1652
198	Ga0070680_100399371	3300005336	Bacteria	1172
199	Ga0070682_100014445	3300005337	Bacteria	4564
200	Ga0070682_100022694	3300005337	Bacteria	3719
201	Ga0070682_100080685	3300005337	Bacteria	2104
202	Ga0070682_100402549	3300005337	Bacteria	1035
203	Ga0070682_100760773	3300005337	Bacteria	783
204	Ga0068868_100052032	3300005338	Bacteria	3224
205	Ga0068868_100177267	3300005338	Bacteria	1767
206	Ga0068868_101570320	3300005338	Bacteria	617
207	Ga0070660_100188013	3300005339	Bacteria	1672
208	Ga0070660_100188410	3300005339	Bacteria	1670
209	Ga0070660_100206175	3300005339	Bacteria	1595
210	Ga0070660_100221372	3300005339	Bacteria	1538
211	Ga0070660_100226808	3300005339	Bacteria	1519
212	Ga0070660_100317871	3300005339	Bacteria	1278
213	Ga0070660_100519594	3300005339	Bacteria	991
214	Ga0070689_100204752	3300005340	Bacteria	1613
215	Ga0070691_10013145	3300005341	Bacteria	3792
216	Ga0070691_10204507	3300005341	Bacteria	1039
217	Ga0070661_100035650	3300005344	Bacteria	3613
218	Ga0070661_100045394	3300005344	Bacteria	3212
219	Ga0070661_100052083	3300005344	Bacteria	2996
220	Ga0070661_100065491	3300005344	Bacteria	2670
221	Ga0070661_100175338	3300005344	Bacteria	1629
222	Ga0070661_100184088	3300005344	Bacteria	1590
223	Ga0070661_100339555	3300005344	Bacteria	1176
224	Ga0070692_10015429	3300005345	Bacteria	3614
225	Ga0070692_10018374	3300005345	Bacteria	3361
226	Ga0070692_10025320	3300005345	Bacteria	2923
227	Ga0070668_100010246	3300005347	Bacteria	6955
228	Ga0070668_100014264	3300005347	Bacteria	5938
229	Ga0070668_100063319	3300005347	Bacteria	2866
230	Ga0070668_100490866	3300005347	Bacteria	1062
231	Ga0070668_100519519	3300005347	Bacteria	1033
232	Ga0070668_100815339	3300005347	Bacteria	830
233	Ga0070669_100025388	3300005353	Bacteria	4255
234	Ga0070669_100065137	3300005353	Bacteria	2685
235	Ga0070669_100066626	3300005353	Bacteria	2655
236	Ga0070669_100498532	3300005353	Bacteria	1010
237	Ga0070675_100302771	3300005354	Bacteria	1409
238	Ga0070675_100434326	3300005354	Bacteria	1176
239	Ga0070675_100546240	3300005354	Bacteria	1047
240	Ga0070675_100583735	3300005354	Bacteria	1013
241	Ga0070671_100019286	3300005355	Bacteria	5548
242	Ga0070671_100021176	3300005355	Bacteria	5308
243	Ga0070671_100127527	3300005355	Bacteria	2143
244	Ga0070671_100155437	3300005355	Bacteria	1932
245	Ga0070671_100158734	3300005355	Bacteria	1911
246	Ga0070671_100159893	3300005355	Bacteria	1904
247	Ga0070671_100247300	3300005355	Bacteria	1514
248	Ga0070671_100248835	3300005355	Bacteria	1510
249	Ga0070674_100446585	3300005356	Bacteria	1066
250	Ga0070673_100038659	3300005364	Bacteria	3645
251	Ga0070673_100043413	3300005364	Bacteria	3474
252	Ga0070673_100202572	3300005364	Bacteria	1710
253	Ga0070673_100666152	3300005364	Bacteria	953
254	Ga0070673_101320993	3300005364	Bacteria	677
255	Ga0070688_100244767	3300005365	Bacteria	1274
256	Ga0070688_100567264	3300005365	Bacteria	865
257	Ga0070688_100886595	3300005365	Bacteria	703
258	Ga0070659_100020770	3300005366	Bacteria	4993
259	Ga0070659_100121687	3300005366	Bacteria	2114
260	Ga0070659_100200062	3300005366	Bacteria	1644
261	Ga0070659_100219028	3300005366	Bacteria	1570
262	Ga0070659_100266790	3300005366	Bacteria	1421
263	Ga0070659_100273332	3300005366	Bacteria	1404
264	Ga0070659_100286770	3300005366	Bacteria	1370
265	Ga0070659_100362179	3300005366	Bacteria	1218
266	Ga0070659_100485711	3300005366	Bacteria	1051
267	Ga0070667_100002380	3300005367	Bacteria	16473
268	Ga0070667_100011373	3300005367	Bacteria	7358
269	Ga0070667_100072291	3300005367	Bacteria	2939
270	Ga0070667_100081185	3300005367	Bacteria	2774
271	Ga0070667_100178294	3300005367	Bacteria	1878
272	Ga0070667_100321441	3300005367	Bacteria	1396
273	Ga0070667_100383731	3300005367	Bacteria	1276
274	Ga0070709_10055237	3300005434	Bacteria	2507
275	Ga0070714_100038020	3300005435	Bacteria	4047
276	Ga0070714_100159368	3300005435	Bacteria	2040
277	Ga0070714_100213987	3300005435	Bacteria	1768
278	Ga0070714_100472131	3300005435	Bacteria	1194
279	Ga0070714_100704157	3300005435	Bacteria	975
280	Ga0070713_100003744	3300005436	Bacteria	10064
281	Ga0070711_100062834	3300005439	Bacteria	2589
282	Ga0070711_100229383	3300005439	Bacteria	1447
283	Ga0070705_100148441	3300005440	Bacteria	1552
284	Ga0070694_100710971	3300005444	Bacteria	818
285	Ga0070663_100002269	3300005455	Bacteria	10760
286	Ga0070663_100053581	3300005455	Bacteria	2880
287	Ga0070663_100058805	3300005455	Bacteria	2761
288	Ga0070663_100090975	3300005455	Bacteria	2260
289	Ga0070663_100124474	3300005455	Bacteria	1951
290	Ga0070663_100130411	3300005455	Bacteria	1908
291	Ga0070663_100131887	3300005455	Bacteria	1898
292	Ga0070663_100158166	3300005455	Bacteria	1743
293	Ga0070663_100246915	3300005455	Bacteria	1411
294	Ga0070663_100443663	3300005455	Bacteria	1068
295	Ga0070678_100143395	3300005456	Bacteria	1914
296	Ga0070678_100148568	3300005456	Bacteria	1885
297	Ga0070678_100371529	3300005456	Bacteria	1235
298	Ga0070662_100034722	3300005457	Bacteria	3557
299	Ga0070662_100088023	3300005457	Bacteria	2327
300	Ga0070662_100294784	3300005457	Bacteria	1316
301	Ga0070662_100552810	3300005457	Bacteria	965
302	Ga0070662_100616557	3300005457	Bacteria	913
303	Ga0070681_10002821	3300005458	Bacteria	16042
304	Ga0070681_10024210	3300005458	Bacteria	6112
305	Ga0070681_10041156	3300005458	Bacteria	4630
306	Ga0070681_10059680	3300005458	Bacteria	3794
307	Ga0070681_10100999	3300005458	Bacteria	2830
308	Ga0070681_10150090	3300005458	Bacteria	2257
309	Ga0070681_10492461	3300005458	Bacteria	1139
310	Ga0070681_10818532	3300005458	Bacteria	848
311	Ga0068867_100094328	3300005459	Bacteria	2275
312	Ga0068867_100236595	3300005459	Bacteria	1479
313	Ga0070685_10000930	3300005466	Bacteria	15763
314	Ga0070685_10035183	3300005466	Bacteria	2824
315	Ga0070685_10101913	3300005466	Bacteria	1754
316	Ga0070685_10204683	3300005466	Bacteria	1285
317	Ga0070685_10508224	3300005466	Bacteria	854
318	Ga0070685_10652102	3300005466	Bacteria	763
319	Ga0070698_100141211	3300005471	Bacteria	2359
320	Ga0070679_100100994	3300005530	Bacteria	2871
321	Ga0070679_100103701	3300005530	Bacteria	2830
322	Ga0070679_100118312	3300005530	Bacteria	2634
323	Ga0070679_100270521	3300005530	Bacteria	1653
324	Ga0070679_100306546	3300005530	Bacteria	1538
325	Ga0070679_100481755	3300005530	Bacteria	1185
326	Ga0070679_100875761	3300005530	Bacteria	841
327	Ga0070684_100326262	3300005535	Bacteria	1410
328	Ga0070684_100730995	3300005535	Bacteria	923
329	Ga0068853_100023357	3300005539	Bacteria	5175
330	Ga0068853_100032653	3300005539	Bacteria	4411
331	Ga0068853_100044662	3300005539	Bacteria	3793
332	Ga0068853_100046118	3300005539	Bacteria	3736
333	Ga0068853_100095799	3300005539	Bacteria	2617
334	Ga0068853_100100791	3300005539	Bacteria	2553
335	Ga0068853_100122043	3300005539	Bacteria	2325
336	Ga0068853_100139057	3300005539	Bacteria	2179
337	Ga0068853_100254556	3300005539	Bacteria	1612
338	Ga0068853_100286540	3300005539	Bacteria	1519
339	Ga0068853_100392595	3300005539	Bacteria	1297
340	Ga0068853_100441891	3300005539	Bacteria	1222
341	Ga0068853_100451385	3300005539	Bacteria	1209
342	Ga0068853_100495914	3300005539	Bacteria	1152
343	Ga0068853_100496841	3300005539	Bacteria	1151
344	Ga0070672_100063504	3300005543	Bacteria	2916
345	Ga0070672_100096235	3300005543	Bacteria	2395
346	Ga0070672_100264978	3300005543	Bacteria	1450
347	Ga0070672_100349269	3300005543	Bacteria	1261
348	Ga0070672_100859678	3300005543	Bacteria	800
349	Ga0070686_100057394	3300005544	Bacteria	2501
350	Ga0070695_100027553	3300005545	Bacteria	3521
351	Ga0070696_100003490	3300005546	Bacteria	10452
352	Ga0070696_100131478	3300005546	Bacteria	1821
353	Ga0070696_100243863	3300005546	Bacteria	1356
354	Ga0070696_100470661	3300005546	Bacteria	995
355	Ga0070696_100569398	3300005546	Bacteria	910
356	Ga0070693_100007592	3300005547	Bacteria	5308
357	Ga0070693_100126592	3300005547	Bacteria	1591
358	Ga0070693_100243594	3300005547	Bacteria	1189
359	Ga0070693_100399515	3300005547	Bacteria	952
360	Ga0070665_100001064	3300005548	Bacteria	34253
361	Ga0070665_100012202	3300005548	Bacteria	8664
362	Ga0070665_100019895	3300005548	Bacteria	6740
363	Ga0070665_100021740	3300005548	Bacteria	6450
364	Ga0070665_100062280	3300005548	Bacteria	3741
365	Ga0070665_100076166	3300005548	Bacteria	3362
366	Ga0070665_100096622	3300005548	Bacteria	2959
367	Ga0070665_100126553	3300005548	Bacteria	2557
368	Ga0070665_100148185	3300005548	Bacteria	2349
369	Ga0070665_100164706	3300005548	Bacteria	2219
370	Ga0070665_100230863	3300005548	Bacteria	1850
371	Ga0070704_100044058	3300005549	Bacteria	3098
372	Ga0068855_100047024	3300005563	Bacteria	5099
373	Ga0068855_100057294	3300005563	Bacteria	4568
374	Ga0068855_100135470	3300005563	Bacteria	2810
375	Ga0068855_100137338	3300005563	Bacteria	2788
376	Ga0068855_100159594	3300005563	Bacteria	2560
377	Ga0068855_100240501	3300005563	Bacteria	2023
378	Ga0068855_100512338	3300005563	Bacteria	1302
379	Ga0068855_100541084	3300005563	Bacteria	1262
380	Ga0068855_100613080	3300005563	Bacteria	1172
381	Ga0070664_100035912	3300005564	Bacteria	4162
382	Ga0070664_100105397	3300005564	Bacteria	2455
383	Ga0070664_100215508	3300005564	Bacteria	1716
384	Ga0070664_100400902	3300005564	Bacteria	1254
385	Ga0070664_100746207	3300005564	Bacteria	913
386	Ga0068857_100000461	3300005577	Bacteria	28989
387	Ga0068857_100023166	3300005577	Bacteria	5464
388	Ga0068857_100040382	3300005577	Bacteria	4137
389	Ga0068857_100057345	3300005577	Bacteria	3456
390	Ga0068857_100244841	3300005577	Bacteria	1642
391	Ga0068857_100415459	3300005577	Bacteria	1254
392	Ga0068857_100428795	3300005577	Bacteria	1234
393	Ga0068857_100981168	3300005577	Bacteria	813
394	Ga0068857_101153036	3300005577	Bacteria	749
395	Ga0068854_100017607	3300005578	Bacteria	4782
396	Ga0068854_100035599	3300005578	Bacteria	3485
397	Ga0068854_100043676	3300005578	Bacteria	3178
398	Ga0068854_100152285	3300005578	Bacteria	1784
399	Ga0068854_100201090	3300005578	Bacteria	1566
400	Ga0068854_100352222	3300005578	Bacteria	1205
401	Ga0068854_100381568	3300005578	Bacteria	1161
402	Ga0068854_101085072	3300005578	Bacteria	713
403	Ga0068856_100009033	3300005614	Bacteria	9696
404	Ga0068856_100013801	3300005614	Bacteria	7810
405	Ga0068856_100023275	3300005614	Bacteria	6024
406	Ga0068856_100166912	3300005614	Bacteria	2212
407	Ga0068856_100174010	3300005614	Bacteria	2165
408	Ga0068856_100309440	3300005614	Bacteria	1597
409	Ga0068856_100320045	3300005614	Bacteria	1568
410	Ga0068852_100043682	3300005616	Bacteria	3802
411	Ga0068852_100157021	3300005616	Bacteria	2120
412	Ga0068852_100163627	3300005616	Bacteria	2079
413	Ga0068852_100227039	3300005616	Bacteria	1778
414	Ga0068852_100244530	3300005616	Bacteria	1716
415	Ga0068852_100255211	3300005616	Bacteria	1681
416	Ga0068852_100262298	3300005616	Bacteria	1659
417	Ga0068852_100441708	3300005616	Bacteria	1286
418	Ga0068852_100759007	3300005616	Bacteria	982
419	Ga0068852_100890913	3300005616	Bacteria	907
420	Ga0068859_100027489	3300005617	Bacteria	5705
421	Ga0068859_100151848	3300005617	Bacteria	2391
422	Ga0068859_100167169	3300005617	Bacteria	2279
423	Ga0068859_100397714	3300005617	Bacteria	1474
424	Ga0068859_100405272	3300005617	Bacteria	1460
425	Ga0068864_100001987	3300005618	Bacteria	16839
426	Ga0068864_100067043	3300005618	Bacteria	3116
427	Ga0068864_100274569	3300005618	Bacteria	1571
428	Ga0068864_100345610	3300005618	Bacteria	1402
429	Ga0068864_100921399	3300005618	Bacteria	864
430	Ga0068864_101087020	3300005618	Bacteria	796
431	Ga0068861_100021380	3300005719	Bacteria	4650
432	Ga0068861_100570888	3300005719	Bacteria	1034
433	Ga0068851_10001271	3300005834	Bacteria	10998
434	Ga0068851_10002978	3300005834	Bacteria	7479
435	Ga0068851_10025641	3300005834	Bacteria	2893
436	Ga0068851_10054949	3300005834	Bacteria	2028
437	Ga0068851_10384724	3300005834	Bacteria	823
438	Ga0068863_100008984	3300005841	Bacteria	9756
439	Ga0068863_100069436	3300005841	Bacteria	3331
440	Ga0068863_100079648	3300005841	Bacteria	3102
441	Ga0068863_100105745	3300005841	Bacteria	2677
442	Ga0068863_100426980	3300005841	Bacteria	1299
443	Ga0068863_100717368	3300005841	Bacteria	994
444	Ga0068858_100015598	3300005842	Bacteria	7146
445	Ga0068858_100259233	3300005842	Bacteria	1652
446	Ga0068858_100408847	3300005842	Bacteria	1304
447	Ga0068860_100032513	3300005843	Bacteria	5012
448	Ga0068860_100032658	3300005843	Bacteria	5000
449	Ga0068860_100102457	3300005843	Bacteria	2731
450	Ga0068860_100185021	3300005843	Bacteria	2014
451	Ga0068860_100205106	3300005843	Bacteria	1911
452	Ga0068860_100290974	3300005843	Bacteria	1598
453	Ga0068860_100442947	3300005843	Bacteria	1291
454	Ga0068862_100003790	3300005844	Bacteria	12886
455	Ga0068862_100039869	3300005844	Bacteria	3991
456	Ga0068862_100052844	3300005844	Bacteria	3477
457	Ga0081455_10064018	3300005937	Bacteria	3082
458	Ga0081540_1050923	3300005983	Bacteria	2052
459	Ga0075365_10008175	3300006038	Bacteria	5917
460	Ga0075365_10020475	3300006038	Bacteria	4102
461	Ga0075365_10027566	3300006038	Bacteria	3616
462	Ga0075363_100057480	3300006048	Bacteria	2088
463	Ga0075364_10031524	3300006051	Bacteria	3406
464	Ga0075364_10041591	3300006051	Bacteria	2984
465	Ga0075364_10062277	3300006051	Bacteria	2448
466	Ga0075364_10120507	3300006051	Bacteria	1756
467	Ga0075364_10213653	3300006051	Bacteria	1308
468	Ga0075364_10697963	3300006051	Bacteria	692
469	Ga0070715_10144561	3300006163	Bacteria	1159
470	Ga0070712_100061358	3300006175	Bacteria	2656
471	Ga0075369_10028350	3300006186	Bacteria	2346
472	Ga0075369_10071457	3300006186	Bacteria	1527
473	Ga0075369_10237558	3300006186	Bacteria	845
474	Ga0075366_10000617	3300006195	Bacteria	16729
475	Ga0097621_100109872	3300006237	Bacteria	2329
476	Ga0097621_100358482	3300006237	Bacteria	1298
477	Ga0075370_10006883	3300006353	Bacteria	5753
478	Ga0075370_10468440	3300006353	Bacteria	759
479	Ga0068871_100233719	3300006358	Bacteria	1596
480	Ga0068871_100333337	3300006358	Bacteria	1338
481	Ga0068871_100461037	3300006358	Bacteria	1141
482	Ga0068871_100576224	3300006358	Bacteria	1021
483	Ga0075428_100138956	3300006844	Bacteria	2641
484	Ga0075430_100204054	3300006846	Bacteria	1641
485	Ga0075430_100654081	3300006846	Bacteria	867
486	Ga0075433_10115450	3300006852	Bacteria	2382
487	Ga0075433_10146607	3300006852	Bacteria	2098
488	Ga0075433_10998246	3300006852	Bacteria	729
489	Ga0075434_100083384	3300006871	Bacteria	3194
490	Ga0068865_100012803	3300006881	Bacteria	5288
491	Ga0068865_100013813	3300006881	Bacteria	5119
492	Ga0068865_100014953	3300006881	Bacteria	4942
493	Ga0068865_100017096	3300006881	Bacteria	4657
494	Ga0068865_100197571	3300006881	Bacteria	1559
495	Ga0068865_100807327	3300006881	Bacteria	810
496	Ga0097620_100027493	3300006931	Bacteria	5705
497	Ga0097620_100151845	3300006931	Bacteria	2391
498	Ga0097620_100167156	3300006931	Bacteria	2279
499	Ga0097620_100405260	3300006931	Bacteria	1460
500	Ga0079104_1006960	3300006946	Bacteria	4173
501	Ga0079104_1010623	3300006946	Bacteria	3015
502	Ga0079104_1010962	3300006946	Bacteria	2947
503	Ga0079104_1024588	3300006946	Bacteria	1583
504	Ga0079104_1031139	3300006946	Bacteria	1325
505	Ga0099826_10177225	3300006948	Bacteria	1190
506	Ga0075435_100041984	3300007076	Bacteria	3657
507	Ga0105251_10009588	3300009011	Bacteria	5704
508	Ga0105251_10010315	3300009011	Bacteria	5432
509	Ga0105251_10020617	3300009011	Bacteria	3460
510	Ga0105251_10048395	3300009011	Bacteria	2038
511	Ga0105251_10052841	3300009011	Bacteria	1933
512	Ga0105251_10058383	3300009011	Bacteria	1822
513	Ga0105251_10079043	3300009011	Bacteria	1522
514	Ga0105251_10080013	3300009011	Bacteria	1511
515	Ga0105251_10111765	3300009011	Bacteria	1244
516	Ga0105251_10117201	3300009011	Bacteria	1210
517	Ga0105251_10124227	3300009011	Bacteria	1171
518	Ga0105251_10134296	3300009011	Bacteria	1121
519	Ga0105251_10189963	3300009011	Bacteria	925
520	Ga0105251_10199981	3300009011	Bacteria	900
521	Ga0105251_10216946	3300009011	Bacteria	861
522	Ga0105244_10018149	3300009036	Bacteria	3957
523	Ga0105244_10018170	3300009036	Bacteria	3953
524	Ga0105244_10031119	3300009036	Bacteria	2833
525	Ga0105244_10032223	3300009036	Bacteria	2776
526	Ga0105244_10039254	3300009036	Bacteria	2465
527	Ga0105244_10047092	3300009036	Bacteria	2213
528	Ga0105244_10070190	3300009036	Bacteria	1748
529	Ga0105244_10085721	3300009036	Bacteria	1554
530	Ga0105244_10090879	3300009036	Bacteria	1501
531	Ga0105244_10239709	3300009036	Bacteria	847
532	Ga0105244_10330242	3300009036	Bacteria	703
533	Ga0105250_10002892	3300009092	Bacteria	8387
534	Ga0105250_10018596	3300009092	Bacteria	2813
535	Ga0105250_10037277	3300009092	Bacteria	1951
536	Ga0105250_10038870	3300009092	Bacteria	1908
537	Ga0105250_10044405	3300009092	Bacteria	1782
538	Ga0105250_10047063	3300009092	Bacteria	1730
539	Ga0105250_10142962	3300009092	Bacteria	992
540	Ga0105250_10147518	3300009092	Bacteria	977
541	Ga0105250_10191231	3300009092	Bacteria	861
542	Ga0105250_10249229	3300009092	Bacteria	758
543	Ga0105240_10042301	3300009093	Bacteria	5806
544	Ga0105240_10078766	3300009093	Bacteria	4057
545	Ga0105240_10225094	3300009093	Bacteria	2183
546	Ga0105240_10279724	3300009093	Bacteria	1917
547	Ga0105240_10289506	3300009093	Bacteria	1878
548	Ga0105240_10307210	3300009093	Bacteria	1813
549	Ga0105240_10388896	3300009093	Bacteria	1573
550	Ga0105240_10393682	3300009093	Bacteria	1562
551	Ga0105240_10428426	3300009093	Bacteria	1485
552	Ga0105240_10644394	3300009093	Bacteria	1162
553	Ga0105240_10840936	3300009093	Bacteria	991
554	Ga0105240_10851491	3300009093	Bacteria	984
555	Ga0105240_10897983	3300009093	Bacteria	953
556	Ga0111539_10178536	3300009094	Bacteria	2480
557	Ga0111539_10728215	3300009094	Bacteria	1155
558	Ga0105245_10137068	3300009098	Bacteria	2301
559	Ga0105245_10228703	3300009098	Bacteria	1798
560	Ga0105245_10418411	3300009098	Bacteria	1343
561	Ga0105245_11376201	3300009098	Bacteria	755
562	Ga0105247_10003712	3300009101	Bacteria	9908
563	Ga0105247_10011423	3300009101	Bacteria	5354
564	Ga0105247_10035600	3300009101	Bacteria	3035
565	Ga0105247_10084880	3300009101	Bacteria	2001
566	Ga0105247_10271701	3300009101	Bacteria	1166
567	Ga0114129_10084300	3300009147	Bacteria	4413
568	Ga0105243_10019930	3300009148	Bacteria	5086
569	Ga0105243_10058406	3300009148	Bacteria	3074
570	Ga0105243_10228340	3300009148	Bacteria	1650
571	Ga0105243_10340821	3300009148	Bacteria	1373
572	Ga0105243_10666023	3300009148	Bacteria	1010
573	Ga0105241_10000449	3300009174	Bacteria	30964
574	Ga0105241_10003481	3300009174	Bacteria	11713
575	Ga0105241_10031495	3300009174	Bacteria	3972
576	Ga0105241_10144608	3300009174	Bacteria	1939
577	Ga0105241_10435691	3300009174	Bacteria	1157
578	Ga0105241_10452920	3300009174	Bacteria	1135
579	Ga0105241_10663577	3300009174	Bacteria	948
580	Ga0105241_10664504	3300009174	Bacteria	948
581	Ga0105242_10300384	3300009176	Bacteria	1465
582	Ga0105242_10312542	3300009176	Bacteria	1438
583	Ga0105242_10732916	3300009176	Bacteria	971
584	Ga0105248_10040911	3300009177	Bacteria	5196
585	Ga0105248_10111819	3300009177	Bacteria	3081
586	Ga0105248_10113010	3300009177	Bacteria	3063
587	Ga0105248_10287353	3300009177	Bacteria	1852
588	Ga0105248_10313458	3300009177	Bacteria	1767
589	Ga0105248_10402087	3300009177	Bacteria	1542
590	Ga0105248_10681914	3300009177	Bacteria	1159
591	Ga0105248_10860633	3300009177	Bacteria	1023
592	Ga0105248_10961202	3300009177	Bacteria	965
593	Ga0105237_10010986	3300009545	Bacteria	9608
594	Ga0105237_10014180	3300009545	Bacteria	8344
595	Ga0105237_10017002	3300009545	Bacteria	7549
596	Ga0105237_10066242	3300009545	Bacteria	3607
597	Ga0105237_10154710	3300009545	Bacteria	2289
598	Ga0105237_10155852	3300009545	Bacteria	2281
599	Ga0105237_10175129	3300009545	Bacteria	2146
600	Ga0105237_10242989	3300009545	Bacteria	1802
601	Ga0105237_10288930	3300009545	Bacteria	1642
602	Ga0105237_10381926	3300009545	Bacteria	1413
603	Ga0105237_10709310	3300009545	Bacteria	1012
604	Ga0105238_10016109	3300009551	Bacteria	7560
605	Ga0105238_10031768	3300009551	Bacteria	5373
606	Ga0105238_10076297	3300009551	Bacteria	3343
607	Ga0105238_10077069	3300009551	Bacteria	3326
608	Ga0105238_10128695	3300009551	Bacteria	2510
609	Ga0105238_10160989	3300009551	Bacteria	2220
610	Ga0105238_10181683	3300009551	Bacteria	2080
611	Ga0105238_10306250	3300009551	Bacteria	1573
612	Ga0105238_10313486	3300009551	Bacteria	1554
613	Ga0105238_10316103	3300009551	Bacteria	1547
614	Ga0105238_10332840	3300009551	Bacteria	1505
615	Ga0105249_10005629	3300009553	Bacteria	10838
616	Ga0105249_10012173	3300009553	Bacteria	7575
617	Ga0105249_10044182	3300009553	Bacteria	4052
618	Ga0105249_10311248	3300009553	Bacteria	1583
619	Ga0105249_10386061	3300009553	Bacteria	1427
620	Ga0105249_10418817	3300009553	Bacteria	1373
621	Ga0105249_11051662	3300009553	Bacteria	884
622	Ga0105032_100739	3300009979	Bacteria	3117
623	Ga0105029_105252	3300009984	Bacteria	905
624	Ga0105030_100855	3300009987	Bacteria	2724
625	Ga0105239_10012347	3300010375	Bacteria	9513
626	Ga0105239_10026059	3300010375	Bacteria	6437
627	Ga0105239_10048383	3300010375	Bacteria	4663
628	Ga0105239_10059674	3300010375	Bacteria	4187
629	Ga0105239_10087320	3300010375	Bacteria	3438
630	Ga0105239_10169014	3300010375	Bacteria	2445
631	Ga0105239_10247147	3300010375	Bacteria	2003
632	Ga0105239_10250561	3300010375	Bacteria	1989
633	Ga0105239_10262506	3300010375	Bacteria	1941
634	Ga0105239_10428657	3300010375	Bacteria	1499
635	Ga0105239_11797138	3300010375	Bacteria	710
636	Ga0105246_10043410	3300011119	Bacteria	3050
637	Ga0105246_10142610	3300011119	Bacteria	1803
638	Ga0105246_10162691	3300011119	Bacteria	1701
639	Ga0105246_10250317	3300011119	Bacteria	1406
640	Ga0105246_10454721	3300011119	Bacteria	1077
641	Ga0157317_1004393	3300012475	Bacteria	917
642	Ga0157317_1004865	3300012475	Bacteria	889
643	Ga0157328_1001974	3300012478	Bacteria	939
644	Ga0157325_1005526	3300012485	Bacteria	783
645	Ga0157321_1008427	3300012487	Bacteria	748
646	Ga0157345_1014776	3300012498	Bacteria	732
647	Ga0157345_1026457	3300012498	Bacteria	625
648	Ga0157314_1001362	3300012500	Bacteria	1766
649	Ga0157314_1012467	3300012500	Bacteria	765
650	Ga0157347_1004212	3300012502	Bacteria	1324
651	Ga0157313_1002009	3300012503	Bacteria	1171
652	Ga0157339_1005074	3300012505	Bacteria	1025
653	Ga0157315_1009651	3300012508	Bacteria	834
654	Ga0157316_1003832	3300012510	Bacteria	1109
655	Ga0157327_1007986	3300012512	Bacteria	937
656	Ga0157326_1025748	3300012513	Bacteria	753
657	Ga0157326_1040601	3300012513	Bacteria	651
658	Ga0157373_10039043	3300013100	Bacteria	3400
659	Ga0157373_10074160	3300013100	Bacteria	2400
660	Ga0157373_10082010	3300013100	Bacteria	2273
661	Ga0157373_10099071	3300013100	Bacteria	2051
662	Ga0157373_10213590	3300013100	Bacteria	1360
663	Ga0157373_10220520	3300013100	Bacteria	1338
664	Ga0157373_10237607	3300013100	Bacteria	1288
665	Ga0157373_10293836	3300013100	Bacteria	1152
666	Ga0157373_10541027	3300013100	Bacteria	844
667	Ga0157373_10601736	3300013100	Bacteria	800
668	Ga0157371_10001231	3300013102	Bacteria	27154
669	Ga0157371_10002740	3300013102	Bacteria	16581
670	Ga0157371_10036785	3300013102	Bacteria	3506
671	Ga0157371_10050552	3300013102	Bacteria	2954
672	Ga0157371_10061445	3300013102	Bacteria	2664
673	Ga0157371_10081932	3300013102	Bacteria	2284
674	Ga0157371_10090670	3300013102	Bacteria	2165
675	Ga0157371_10124643	3300013102	Bacteria	1832
676	Ga0157371_10159743	3300013102	Bacteria	1609
677	Ga0157371_10177262	3300013102	Bacteria	1524
678	Ga0157371_10198988	3300013102	Bacteria	1436
679	Ga0157371_10460327	3300013102	Bacteria	936
680	Ga0157371_10816397	3300013102	Bacteria	703
681	Ga0157370_10013884	3300013104	Bacteria	8272
682	Ga0157370_10016678	3300013104	Bacteria	7434
683	Ga0157370_10081101	3300013104	Bacteria	3054
684	Ga0157370_10103903	3300013104	Bacteria	2659
685	Ga0157370_10109919	3300013104	Bacteria	2577
686	Ga0157370_10122040	3300013104	Bacteria	2433
687	Ga0157370_10126028	3300013104	Bacteria	2390
688	Ga0157370_10164115	3300013104	Bacteria	2066
689	Ga0157370_10193584	3300013104	Bacteria	1887
690	Ga0157370_10200189	3300013104	Bacteria	1853
691	Ga0157370_10218225	3300013104	Bacteria	1767
692	Ga0157370_10264033	3300013104	Bacteria	1591
693	Ga0157370_10286438	3300013104	Bacteria	1522
694	Ga0157370_10286749	3300013104	Bacteria	1521
695	Ga0157370_10320819	3300013104	Bacteria	1429
696	Ga0157370_10337338	3300013104	Bacteria	1390
697	Ga0157370_10875814	3300013104	Bacteria	815
698	Ga0157369_10000706	3300013105	Bacteria	43083
699	Ga0157369_10003889	3300013105	Bacteria	17724
700	Ga0157369_10020428	3300013105	Bacteria	7402
701	Ga0157369_10047440	3300013105	Bacteria	4664
702	Ga0157369_10068956	3300013105	Bacteria	3799
703	Ga0157369_10137986	3300013105	Bacteria	2581
704	Ga0157369_10175623	3300013105	Bacteria	2255
705	Ga0157369_10221303	3300013105	Bacteria	1982
706	Ga0157369_10336539	3300013105	Bacteria	1568
707	Ga0157369_11431280	3300013105	Bacteria	703
708	Ga0157369_11497667	3300013105	Bacteria	686
709	Ga0157374_10023329	3300013296	Bacteria	5534
710	Ga0157374_10114207	3300013296	Bacteria	2600
711	Ga0157374_10454332	3300013296	Bacteria	1283
712	Ga0157374_10540921	3300013296	Bacteria	1172
713	Ga0157378_10002252	3300013297	Bacteria	17134
714	Ga0157378_10078261	3300013297	Bacteria	2982
715	Ga0157378_10675766	3300013297	Bacteria	1050
716	Ga0157378_10909845	3300013297	Bacteria	911
717	Ga0157378_11022905	3300013297	Bacteria	861
718	Ga0157378_11197745	3300013297	Bacteria	799
719	Ga0163162_10002151	3300013306	Bacteria	18484
720	Ga0163162_10003050	3300013306	Bacteria	16004
721	Ga0163162_10069094	3300013306	Bacteria	3585
722	Ga0163162_10103665	3300013306	Bacteria	2939
723	Ga0163162_10187030	3300013306	Bacteria	2198
724	Ga0163162_10246205	3300013306	Bacteria	1919
725	Ga0163162_10398189	3300013306	Bacteria	1509
726	Ga0163162_10943108	3300013306	Bacteria	974
727	Ga0163162_11757281	3300013306	Bacteria	709
728	Ga0157372_10014121	3300013307	Bacteria	8531
729	Ga0157372_10016993	3300013307	Bacteria	7811
730	Ga0157372_10101589	3300013307	Bacteria	3283
731	Ga0157372_10109152	3300013307	Bacteria	3168
732	Ga0157372_10149460	3300013307	Bacteria	2695
733	Ga0157372_10175731	3300013307	Bacteria	2478
734	Ga0157372_10184632	3300013307	Bacteria	2415
735	Ga0157372_10201867	3300013307	Bacteria	2303
736	Ga0157372_10271545	3300013307	Bacteria	1971
737	Ga0157372_10293263	3300013307	Bacteria	1892
738	Ga0157372_10358449	3300013307	Bacteria	1699
739	Ga0157372_10453768	3300013307	Bacteria	1494
740	Ga0157372_10607637	3300013307	Bacteria	1274
741	Ga0157372_10909382	3300013307	Bacteria	1021
742	Ga0157372_10995356	3300013307	Bacteria	971
743	Ga0157372_11804675	3300013307	Bacteria	703
744	Ga0157372_11804676	3300013307	Bacteria	703
745	Ga0157375_10018696	3300013308	Bacteria	6290
746	Ga0157375_10045772	3300013308	Bacteria	4260
747	Ga0157375_10079377	3300013308	Bacteria	3317
748	Ga0157375_10168391	3300013308	Bacteria	2337
749	Ga0157375_10191124	3300013308	Bacteria	2202
750	Ga0157375_10643157	3300013308	Bacteria	1217
751	Ga0157375_10735097	3300013308	Bacteria	1139
752	Ga0157514_123279	3300013874	Bacteria	877
753	Ga0163163_10000304	3300014325	Bacteria	48244
754	Ga0163163_10002238	3300014325	Bacteria	16294
755	Ga0163163_10029107	3300014325	Bacteria	5311
756	Ga0157380_10014433	3300014326	Bacteria	5779
757	Ga0157380_10148782	3300014326	Bacteria	2022
758	Ga0157380_10415103	3300014326	Bacteria	1282
759	Ga0157380_10523508	3300014326	Bacteria	1157
760	Ga0182008_10003699	3300014497	Bacteria	9124
761	Ga0182008_10014045	3300014497	Bacteria	4200
762	Ga0182008_10024262	3300014497	Bacteria	3089
763	Ga0182008_10031766	3300014497	Bacteria	2656
764	Ga0182008_10051843	3300014497	Bacteria	2034
765	Ga0182008_10068140	3300014497	Bacteria	1751
766	Ga0182008_10069189	3300014497	Bacteria	1737
767	Ga0182008_10071291	3300014497	Bacteria	1709
768	Ga0182008_10079792	3300014497	Bacteria	1610
769	Ga0182008_10099314	3300014497	Bacteria	1438
770	Ga0182008_10142436	3300014497	Bacteria	1200
771	Ga0182008_10156847	3300014497	Bacteria	1144
772	Ga0182008_10324563	3300014497	Bacteria	811
773	Ga0157379_10027876	3300014968	Bacteria	5027
774	Ga0157379_10064773	3300014968	Bacteria	3266
775	Ga0157379_10654827	3300014968	Bacteria	983
776	Ga0157376_10009528	3300014969	Bacteria	7059
777	Ga0157376_10286837	3300014969	Bacteria	1553
778	Ga0157376_10465754	3300014969	Bacteria	1236
779	Ga0182006_1000574	3300015261	Bacteria	27080
780	Ga0182006_1009176	3300015261	Bacteria	4445
781	Ga0182006_1010130	3300015261	Bacteria	4200
782	Ga0182006_1010843	3300015261	Bacteria	4035
783	Ga0182006_1026763	3300015261	Bacteria	2359
784	Ga0182006_1041127	3300015261	Bacteria	1816
785	Ga0182006_1055987	3300015261	Bacteria	1503
786	Ga0182006_1060508	3300015261	Bacteria	1431
787	Ga0182006_1065484	3300015261	Bacteria	1360
788	Ga0182006_1072679	3300015261	Bacteria	1271
789	Ga0182006_1176099	3300015261	Bacteria	715
790	Ga0182007_10004689	3300015262	Bacteria	6163
791	Ga0182007_10005059	3300015262	Bacteria	5855
792	Ga0182007_10010950	3300015262	Bacteria	3554
793	Ga0182007_10027874	3300015262	Bacteria	1944
794	Ga0182007_10078941	3300015262	Bacteria	1079
795	Ga0182007_10105530	3300015262	Bacteria	935
796	Ga0182005_1002982	3300015265	Bacteria	5861
797	Ga0182005_1007115	3300015265	Bacteria	3377
798	Ga0182005_1018834	3300015265	Bacteria	1907
799	Ga0182005_1034959	3300015265	Bacteria	1367
800	Ga0183366_1010	3300015679	Bacteria	29263
801	Ga0183370_1010	3300015680	Bacteria	29263
802	Ga0183369_1007	3300015685	Bacteria	414878
803	Ga0183369_1025	3300015685	Bacteria	29263
804	Ga0183368_1002	3300015687	Bacteria	1865598
805	Ga0183368_1013	3300015687	Bacteria	29263
806	Ga0183360_10001	3300015689	Bacteria	3943671
807	Ga0163161_10004249	3300017792	Bacteria	9991
808	Ga0163161_10021406	3300017792	Bacteria	4545
809	Ga0163161_10032926	3300017792	Bacteria	3703
810	Ga0163161_10054417	3300017792	Bacteria	2904
811	Ga0163161_10083297	3300017792	Bacteria	2357
812	Ga0163161_10233639	3300017792	Bacteria	1428
813	Ga0197907_11461921	3300020069	Bacteria	865
814	Ga0206356_10099316	3300020070	Bacteria	3870
815	Ga0206356_11309913	3300020070	Bacteria	2359
816	Ga0206356_11773737	3300020070	Bacteria	1789
817	Ga0206349_1813039	3300020075	Bacteria	11017
818	Ga0206355_1650366	3300020076	Bacteria	2659
819	Ga0206351_10145385	3300020077	Bacteria	7588
820	Ga0206351_10151579	3300020077	Bacteria	1670
821	Ga0206351_10423965	3300020077	Bacteria	1412
822	Ga0206352_10426777	3300020078	Bacteria	5161
823	Ga0206352_11312937	3300020078	Bacteria	1747
824	Ga0206350_10902162	3300020080	Bacteria	998
825	Ga0206350_11195945	3300020080	Bacteria	895
826	Ga0206354_10542630	3300020081	Bacteria	1953
827	Ga0206353_10625963	3300020082	Bacteria	1660
828	Ga0206353_10742767	3300020082	Bacteria	1125
829	Ga0206353_10834072	3300020082	Bacteria	1538
830	Ga0154015_1042565	3300020610	Bacteria	2591
831	Ga0154015_1536303	3300020610	Bacteria	3725
832	Ga0213874_10196679	3300021377	Bacteria	724
833	Ga0213876_10000387	3300021384	Bacteria	36975
834	Ga0224712_10001762	3300022467	Bacteria	5158
835	Ga0224712_10088180	3300022467	Bacteria	1295
836	Ga0209435_106010	3300025206	Bacteria	1358
837	Ga0209435_107860	3300025206	Bacteria	1177
838	Ga0209760_100180	3300025207	Bacteria	33283
839	Ga0209760_100324	3300025207	Bacteria	14554
840	Ga0209760_101217	3300025207	Bacteria	2883
841	Ga0209784_100291	3300025224	Bacteria	27389
842	Ga0209784_100478	3300025224	Bacteria	16181
843	Ga0209566_100498	3300025225	Bacteria	27389
844	Ga0209566_102590	3300025225	Bacteria	3233
845	Ga0209566_111034	3300025225	Bacteria	896
846	Ga0209674_100342	3300025226	Bacteria	27389
847	Ga0209674_100501	3300025226	Bacteria	16151
848	Ga0209674_101111	3300025226	Bacteria	7916
849	Ga0209674_102097	3300025226	Bacteria	4525
850	Ga0209672_100004	3300025228	Bacteria	1467504
851	Ga0209672_101424	3300025228	Bacteria	8631
852	Ga0209672_101755	3300025228	Bacteria	6816
853	Ga0209672_102547	3300025228	Bacteria	4388
854	Ga0209672_103266	3300025228	Bacteria	3431
855	Ga0209672_113603	3300025228	Bacteria	970
856	Ga0209563_100103	3300025230	Bacteria	151835
857	Ga0209563_100230	3300025230	Bacteria	27389
858	Ga0207427_100370	3300025231	Bacteria	27389
859	Ga0207427_100687	3300025231	Bacteria	16035
860	Ga0207427_100946	3300025231	Bacteria	12365
861	Ga0207427_105874	3300025231	Bacteria	1650
862	Ga0207427_105979	3300025231	Bacteria	1611
863	Ga0209437_100193	3300025233	Bacteria	122027
864	Ga0209437_100515	3300025233	Bacteria	27389
865	Ga0209437_100541	3300025233	Bacteria	25950
866	Ga0209437_100721	3300025233	Bacteria	16841
867	Ga0209437_100741	3300025233	Bacteria	16221
868	Ga0209437_100750	3300025233	Bacteria	15948
869	Ga0209437_101275	3300025233	Bacteria	6823
870	Ga0209437_108123	3300025233	Bacteria	1686
871	Ga0209258_100003	3300025242	Bacteria	1467504
872	Ga0209258_100859	3300025242	Bacteria	16158
873	Ga0209258_100861	3300025242	Bacteria	16136
874	Ga0209258_101207	3300025242	Bacteria	10178
875	Ga0209258_101718	3300025242	Bacteria	6817
876	Ga0209258_102994	3300025242	Bacteria	3907
877	Ga0209258_114654	3300025242	Bacteria	908
878	Ga0207425_1000117	3300025245	Bacteria	74911
879	Ga0207425_1006106	3300025245	Bacteria	3335
880	Ga0207425_1017175	3300025245	Bacteria	1595
881	Ga0209646_1001352	3300025246	Bacteria	6762
882	Ga0209646_1010670	3300025246	Bacteria	1435
883	Ga0209646_1019219	3300025246	Bacteria	994
884	Ga0209026_1000274	3300025250	Bacteria	61312
885	Ga0209026_1000838	3300025250	Bacteria	16221
886	Ga0209026_1000845	3300025250	Bacteria	16140
887	Ga0209026_1001800	3300025250	Bacteria	8838
888	Ga0209026_1002336	3300025250	Bacteria	7196
889	Ga0209677_100373	3300025253	Bacteria	27389
890	Ga0209677_101146	3300025253	Bacteria	12333
891	Ga0209148_1000002	3300025254	Bacteria	2399500
892	Ga0209148_1000025	3300025254	Bacteria	663262
893	Ga0209148_1000083	3300025254	Bacteria	270142
894	Ga0209148_1001102	3300025254	Bacteria	16221
895	Ga0209148_1001106	3300025254	Bacteria	16158
896	Ga0209148_1001110	3300025254	Bacteria	16136
897	Ga0209148_1002173	3300025254	Bacteria	7265
898	Ga0209759_1002083	3300025256	Bacteria	9342
899	Ga0209759_1002399	3300025256	Bacteria	8257
900	Ga0209759_1010555	3300025256	Bacteria	2700
901	Ga0209759_1013965	3300025256	Bacteria	2147
902	Ga0209759_1021741	3300025256	Bacteria	1451
903	Ga0209129_1000011	3300025258	Bacteria	568657
904	Ga0209129_1000464	3300025258	Bacteria	29923
905	Ga0209129_1001097	3300025258	Bacteria	15809
906	Ga0209129_1004985	3300025258	Bacteria	4903
907	Ga0209233_1000679	3300025261	Bacteria	16221
908	Ga0209233_1000687	3300025261	Bacteria	16035
909	Ga0209233_1000946	3300025261	Bacteria	12600
910	Ga0209233_1005629	3300025261	Bacteria	4142
911	Ga0209233_1017142	3300025261	Bacteria	1979
912	Ga0209233_1036758	3300025261	Bacteria	1094
913	Ga0209565_1000001	3300025263	Bacteria	2950419
914	Ga0209565_1000870	3300025263	Bacteria	16660
915	Ga0209455_1000004	3300025272	Bacteria	1467504
916	Ga0209455_1000095	3300025272	Bacteria	217487
917	Ga0209455_1000860	3300025272	Bacteria	16221
918	Ga0209455_1000863	3300025272	Bacteria	16136
919	Ga0209455_1000868	3300025272	Bacteria	16035
920	Ga0209455_1005012	3300025272	Bacteria	4195
921	Ga0209455_1006713	3300025272	Bacteria	3361
922	Ga0209673_1000001	3300025273	Bacteria	3176258
923	Ga0209673_1000204	3300025273	Bacteria	119618
924	Ga0209673_1011655	3300025273	Bacteria	3607
925	Ga0209130_1011762	3300025284	Bacteria	2327
926	Ga0209675_1000001	3300025291	Bacteria	2950293
927	Ga0209675_1000015	3300025291	Bacteria	403517
928	Ga0209676_1001936	3300025292	Bacteria	16690
929	Ga0209676_1004715	3300025292	Bacteria	7469
930	Ga0209676_1004908	3300025292	Bacteria	7207
931	Ga0209676_1014712	3300025292	Bacteria	2926
932	Ga0209025_1000002	3300025294	Bacteria	1393142
933	Ga0209025_1000006	3300025294	Bacteria	1153444
934	Ga0209025_1014466	3300025294	Bacteria	4848
935	Ga0209025_1062676	3300025294	Bacteria	1377
936	Ga0209564_1000001	3300025295	Bacteria	3176258
937	Ga0209564_1000037	3300025295	Bacteria	414794
938	Ga0209564_1004754	3300025295	Bacteria	8120
939	Ga0209758_1000003	3300025297	Bacteria	1398533
940	Ga0209758_1014771	3300025297	Bacteria	4118
941	Ga0209758_1030041	3300025297	Bacteria	2258
942	Ga0209758_1043308	3300025297	Bacteria	1659
943	Ga0209050_1003984	3300025298	Bacteria	10415
944	Ga0209050_1007102	3300025298	Bacteria	6400
945	Ga0209050_1008716	3300025298	Bacteria	5347
946	Ga0209256_1002493	3300025299	Bacteria	14890
947	Ga0209256_1005997	3300025299	Bacteria	6663
948	Ga0209256_1007679	3300025299	Bacteria	5240
949	Ga0209256_1014458	3300025299	Bacteria	2839
950	Ga0209256_1018819	3300025299	Bacteria	2225
951	Ga0209256_1027904	3300025299	Bacteria	1601
952	Ga0209256_1067797	3300025299	Bacteria	811
953	Ga0207426_1027180	3300025302	Bacteria	1909
954	Ga0207426_1060758	3300025302	Bacteria	1088
955	Ga0209051_1002511	3300025303	Bacteria	13033
956	Ga0209051_1002516	3300025303	Bacteria	13004
957	Ga0209051_1004652	3300025303	Bacteria	8359
958	Ga0209051_1009299	3300025303	Bacteria	5078
959	Ga0209257_1002723	3300025304	Bacteria	16800
960	Ga0209257_1002823	3300025304	Bacteria	16317
961	Ga0209257_1003063	3300025304	Bacteria	15070
962	Ga0209257_1008039	3300025304	Bacteria	6142
963	Ga0209257_1026957	3300025304	Bacteria	1923
964	Ga0207697_10052334	3300025315	Bacteria	1689
965	Ga0207656_10000850	3300025321	Bacteria	9970
966	Ga0207656_10003933	3300025321	Bacteria	5143
967	Ga0207656_10004184	3300025321	Bacteria	5021
968	Ga0207656_10034750	3300025321	Bacteria	2106
969	Ga0207656_10099697	3300025321	Bacteria	1330
970	Ga0207656_10102111	3300025321	Bacteria	1316
971	Ga0207656_10109546	3300025321	Bacteria	1274
972	Ga0207696_1000512	3300025711	Bacteria	32191
973	Ga0207696_1000531	3300025711	Bacteria	31313
974	Ga0207696_1000593	3300025711	Bacteria	27627
975	Ga0207696_1000597	3300025711	Bacteria	27278
976	Ga0207696_1000599	3300025711	Bacteria	27115
977	Ga0207696_1001158	3300025711	Bacteria	15140
978	Ga0207696_1001209	3300025711	Bacteria	14674
979	Ga0207696_1002273	3300025711	Bacteria	9546
980	Ga0207696_1023203	3300025711	Bacteria	1960
981	Ga0207696_1045573	3300025711	Bacteria	1268
982	Ga0207655_1000805	3300025728	Bacteria	34156
983	Ga0207655_1005044	3300025728	Bacteria	9128
984	Ga0207655_1008349	3300025728	Bacteria	6590
985	Ga0207655_1010779	3300025728	Bacteria	5514
986	Ga0207655_1014338	3300025728	Bacteria	4485
987	Ga0207655_1017007	3300025728	Bacteria	3944
988	Ga0207655_1027767	3300025728	Bacteria	2687
989	Ga0207655_1031010	3300025728	Bacteria	2473
990	Ga0207655_1032332	3300025728	Bacteria	2392
991	Ga0207655_1034914	3300025728	Bacteria	2254
992	Ga0207655_1049189	3300025728	Bacteria	1724
993	Ga0207655_1052126	3300025728	Bacteria	1649
994	Ga0207713_1000294	3300025735	Bacteria	57476
995	Ga0207713_1000712	3300025735	Bacteria	31062
996	Ga0207713_1000931	3300025735	Bacteria	26234
997	Ga0207713_1008383	3300025735	Bacteria	5965
998	Ga0207713_1017633	3300025735	Bacteria	3569
999	Ga0207713_1018372	3300025735	Bacteria	3464
1000	Ga0207713_1018417	3300025735	Bacteria	3460
1001	Ga0207713_1021327	3300025735	Bacteria	3109
1002	Ga0207713_1022394	3300025735	Bacteria	3001
1003	Ga0207713_1046396	3300025735	Bacteria	1767
1004	Ga0207713_1062375	3300025735	Bacteria	1413
1005	Ga0207682_10050644	3300025893	Bacteria	1717
1006	Ga0207682_10054904	3300025893	Bacteria	1656
1007	Ga0207692_10232465	3300025898	Bacteria	1098
1008	Ga0207710_10000424	3300025900	Bacteria	27708
1009	Ga0207710_10023689	3300025900	Bacteria	2640
1010	Ga0207710_10123418	3300025900	Bacteria	1239
1011	Ga0207710_10280426	3300025900	Bacteria	839
1012	Ga0207688_10223531	3300025901	Bacteria	1135
1013	Ga0207680_10000001	3300025903	Bacteria	1091453
1014	Ga0207680_10008634	3300025903	Bacteria	5014
1015	Ga0207680_10016121	3300025903	Bacteria	3915
1016	Ga0207680_10030396	3300025903	Bacteria	3046
1017	Ga0207680_10203600	3300025903	Bacteria	1350
1018	Ga0207647_10000415	3300025904	Bacteria	35115
1019	Ga0207647_10005116	3300025904	Bacteria	9655
1020	Ga0207647_10017860	3300025904	Bacteria	4812
1021	Ga0207647_10031232	3300025904	Bacteria	3428
1022	Ga0207647_10037027	3300025904	Bacteria	3096
1023	Ga0207647_10042642	3300025904	Bacteria	2845
1024	Ga0207647_10060669	3300025904	Bacteria	2311
1025	Ga0207647_10062187	3300025904	Bacteria	2275
1026	Ga0207647_10063091	3300025904	Bacteria	2255
1027	Ga0207699_10061887	3300025906	Bacteria	2254
1028	Ga0207699_10084216	3300025906	Bacteria	1980
1029	Ga0207699_10487626	3300025906	Bacteria	888
1030	Ga0207645_10014702	3300025907	Bacteria	5226
1031	Ga0207645_10174948	3300025907	Bacteria	1408
1032	Ga0207645_10429664	3300025907	Bacteria	890
1033	Ga0207645_10690449	3300025907	Bacteria	694
1034	Ga0207645_10727060	3300025907	Bacteria	675
1035	Ga0207705_10001937	3300025909	Bacteria	16164
1036	Ga0207705_10003115	3300025909	Bacteria	12650
1037	Ga0207705_10008038	3300025909	Bacteria	7732
1038	Ga0207705_10009186	3300025909	Bacteria	7201
1039	Ga0207705_10015934	3300025909	Bacteria	5396
1040	Ga0207705_10052989	3300025909	Bacteria	2922
1041	Ga0207705_10147273	3300025909	Bacteria	1762
1042	Ga0207705_10180112	3300025909	Bacteria	1594
1043	Ga0207705_10197873	3300025909	Bacteria	1522
1044	Ga0207705_10240746	3300025909	Bacteria	1378
1045	Ga0207705_11118487	3300025909	Bacteria	606
1046	Ga0207654_10000282	3300025911	Bacteria	30973
1047	Ga0207654_10000464	3300025911	Bacteria	23191
1048	Ga0207654_10048044	3300025911	Bacteria	2441
1049	Ga0207654_10107322	3300025911	Bacteria	1731
1050	Ga0207654_10136508	3300025911	Bacteria	1559
1051	Ga0207654_10285983	3300025911	Bacteria	1117
1052	Ga0207707_10002633	3300025912	Bacteria	16050
1053	Ga0207707_10002946	3300025912	Bacteria	15155
1054	Ga0207707_10010749	3300025912	Bacteria	7953
1055	Ga0207707_10100737	3300025912	Bacteria	2524
1056	Ga0207707_10182579	3300025912	Bacteria	1831
1057	Ga0207707_10204024	3300025912	Bacteria	1723
1058	Ga0207707_10232332	3300025912	Bacteria	1604
1059	Ga0207707_10303001	3300025912	Bacteria	1382
1060	Ga0207707_10402109	3300025912	Bacteria	1176
1061	Ga0207695_10000014	3300025913	Bacteria	812599
1062	Ga0207695_10000818	3300025913	Bacteria	57675
1063	Ga0207695_10004669	3300025913	Bacteria	18565
1064	Ga0207695_10005720	3300025913	Bacteria	16384
1065	Ga0207695_10021914	3300025913	Bacteria	7272
1066	Ga0207695_10074159	3300025913	Bacteria	3465
1067	Ga0207695_10100938	3300025913	Bacteria	2881
1068	Ga0207695_10111930	3300025913	Bacteria	2709
1069	Ga0207695_10151054	3300025913	Bacteria	2262
1070	Ga0207695_10211637	3300025913	Bacteria	1849
1071	Ga0207695_10250901	3300025913	Bacteria	1669
1072	Ga0207695_10267239	3300025913	Bacteria	1607
1073	Ga0207671_10003150	3300025914	Bacteria	16713
1074	Ga0207671_10003375	3300025914	Bacteria	15989
1075	Ga0207671_10006347	3300025914	Bacteria	10548
1076	Ga0207671_10007292	3300025914	Bacteria	9619
1077	Ga0207671_10068036	3300025914	Bacteria	2653
1078	Ga0207671_10205759	3300025914	Bacteria	1538
1079	Ga0207671_10348767	3300025914	Bacteria	1174
1080	Ga0207693_10093121	3300025915	Bacteria	2362
1081	Ga0207693_10157160	3300025915	Bacteria	1788
1082	Ga0207663_10319571	3300025916	Bacteria	1166
1083	Ga0207660_10001404	3300025917	Bacteria	16163
1084	Ga0207660_10004504	3300025917	Bacteria	9087
1085	Ga0207660_10037893	3300025917	Bacteria	3362
1086	Ga0207660_10060127	3300025917	Bacteria	2730
1087	Ga0207660_10185064	3300025917	Bacteria	1620
1088	Ga0207660_10249419	3300025917	Bacteria	1401
1089	Ga0207660_10329338	3300025917	Bacteria	1221
1090	Ga0207657_10085968	3300025919	Bacteria	2633
1091	Ga0207657_10115495	3300025919	Bacteria	2212
1092	Ga0207657_10186483	3300025919	Bacteria	1675
1093	Ga0207657_10295411	3300025919	Bacteria	1284
1094	Ga0207649_10002410	3300025920	Bacteria	10474
1095	Ga0207649_10004519	3300025920	Bacteria	7550
1096	Ga0207649_10009101	3300025920	Bacteria	5430
1097	Ga0207649_10023099	3300025920	Bacteria	3598
1098	Ga0207649_10063343	3300025920	Bacteria	2334
1099	Ga0207649_10148607	3300025920	Bacteria	1611
1100	Ga0207649_10161015	3300025920	Bacteria	1555
1101	Ga0207649_10230853	3300025920	Bacteria	1323
1102	Ga0207649_10393574	3300025920	Bacteria	1035
1103	Ga0207652_10002564	3300025921	Bacteria	15246
1104	Ga0207652_10002764	3300025921	Bacteria	14740
1105	Ga0207652_10080824	3300025921	Bacteria	2842
1106	Ga0207652_10143161	3300025921	Bacteria	2138
1107	Ga0207652_10146436	3300025921	Bacteria	2114
1108	Ga0207652_10177174	3300025921	Bacteria	1915
1109	Ga0207652_10181760	3300025921	Bacteria	1890
1110	Ga0207652_10231376	3300025921	Bacteria	1666
1111	Ga0207652_10242459	3300025921	Bacteria	1625
1112	Ga0207652_10271989	3300025921	Bacteria	1528
1113	Ga0207652_10442145	3300025921	Bacteria	1172
1114	Ga0207652_10834386	3300025921	Bacteria	817
1115	Ga0207681_10009533	3300025923	Bacteria	5933
1116	Ga0207681_10083330	3300025923	Bacteria	2263
1117	Ga0207681_10120090	3300025923	Bacteria	1926
1118	Ga0207681_10122553	3300025923	Bacteria	1909
1119	Ga0207681_10148900	3300025923	Bacteria	1752
1120	Ga0207681_10194832	3300025923	Bacteria	1553
1121	Ga0207681_10313903	3300025923	Bacteria	1244
1122	Ga0207681_10925649	3300025923	Bacteria	730
1123	Ga0207694_10006898	3300025924	Bacteria	8625
1124	Ga0207694_10047855	3300025924	Bacteria	3307
1125	Ga0207694_10067393	3300025924	Bacteria	2794
1126	Ga0207694_10087203	3300025924	Bacteria	2458
1127	Ga0207694_10091030	3300025924	Bacteria	2407
1128	Ga0207694_10113914	3300025924	Bacteria	2153
1129	Ga0207694_10136809	3300025924	Bacteria	1968
1130	Ga0207694_10207293	3300025924	Bacteria	1596
1131	Ga0207694_10259854	3300025924	Bacteria	1422
1132	Ga0207694_10454690	3300025924	Bacteria	1069
1133	Ga0207694_10556184	3300025924	Bacteria	963
1134	Ga0207650_10000013	3300025925	Bacteria	409471
1135	Ga0207650_10057733	3300025925	Bacteria	2888
1136	Ga0207650_10095156	3300025925	Bacteria	2283
1137	Ga0207650_10104591	3300025925	Bacteria	2184
1138	Ga0207650_10470590	3300025925	Bacteria	1048
1139	Ga0207650_10559308	3300025925	Bacteria	959
1140	Ga0207650_10615038	3300025925	Bacteria	914
1141	Ga0207650_10823134	3300025925	Bacteria	787
1142	Ga0207659_10238265	3300025926	Bacteria	1471
1143	Ga0207659_10512739	3300025926	Bacteria	1016
1144	Ga0207659_10896486	3300025926	Bacteria	762
1145	Ga0207687_10178399	3300025927	Bacteria	1644
1146	Ga0207687_10338108	3300025927	Bacteria	1223
1147	Ga0207700_10000259	3300025928	Bacteria	31587
1148	Ga0207700_10032177	3300025928	Bacteria	3737
1149	Ga0207664_10008018	3300025929	Bacteria	7343
1150	Ga0207664_10050903	3300025929	Bacteria	3268
1151	Ga0207664_10284500	3300025929	Bacteria	1451
1152	Ga0207644_10009151	3300025931	Bacteria	6495
1153	Ga0207644_10019953	3300025931	Bacteria	4552
1154	Ga0207644_10068702	3300025931	Bacteria	2585
1155	Ga0207644_10147703	3300025931	Bacteria	1816
1156	Ga0207644_10214907	3300025931	Bacteria	1522
1157	Ga0207690_10000291	3300025932	Bacteria	35587
1158	Ga0207690_10001189	3300025932	Bacteria	16436
1159	Ga0207690_10001233	3300025932	Bacteria	16163
1160	Ga0207690_10005182	3300025932	Bacteria	7689
1161	Ga0207690_10008624	3300025932	Bacteria	6046
1162	Ga0207690_10093352	3300025932	Bacteria	2132
1163	Ga0207690_10108190	3300025932	Bacteria	1997
1164	Ga0207690_10302977	3300025932	Bacteria	1251
1165	Ga0207706_10033044	3300025933	Bacteria	4605
1166	Ga0207706_10077559	3300025933	Bacteria	2922
1167	Ga0207706_10135385	3300025933	Bacteria	2167
1168	Ga0207706_10193027	3300025933	Bacteria	1787
1169	Ga0207706_10261829	3300025933	Bacteria	1510
1170	Ga0207706_10534636	3300025933	Bacteria	1010
1171	Ga0207706_10746635	3300025933	Bacteria	834
1172	Ga0207686_10011529	3300025934	Bacteria	4843
1173	Ga0207686_10047572	3300025934	Bacteria	2653
1174	Ga0207686_10105080	3300025934	Bacteria	1893
1175	Ga0207686_10648445	3300025934	Bacteria	835
1176	Ga0207709_10000421	3300025935	Bacteria	41092
1177	Ga0207709_10006449	3300025935	Bacteria	6588
1178	Ga0207709_10034933	3300025935	Bacteria	2968
1179	Ga0207709_10041233	3300025935	Bacteria	2769
1180	Ga0207709_10575032	3300025935	Bacteria	889
1181	Ga0207709_10621165	3300025935	Bacteria	858
1182	Ga0207670_10008314	3300025936	Bacteria	5850
1183	Ga0207670_10412894	3300025936	Bacteria	1081
1184	Ga0207669_10252075	3300025937	Bacteria	1315
1185	Ga0207704_10006000	3300025938	Bacteria	5632
1186	Ga0207704_10055985	3300025938	Bacteria	2413
1187	Ga0207704_10066561	3300025938	Bacteria	2262
1188	Ga0207704_10078803	3300025938	Bacteria	2120
1189	Ga0207704_10143254	3300025938	Bacteria	1675
1190	Ga0207704_10154768	3300025938	Bacteria	1623
1191	Ga0207704_10273377	3300025938	Bacteria	1280
1192	Ga0207665_10762751	3300025939	Bacteria	763
1193	Ga0207691_10022595	3300025940	Bacteria	5931
1194	Ga0207691_10026545	3300025940	Bacteria	5434
1195	Ga0207691_10036543	3300025940	Bacteria	4552
1196	Ga0207691_10107510	3300025940	Bacteria	2483
1197	Ga0207691_10248347	3300025940	Bacteria	1536
1198	Ga0207691_10375275	3300025940	Bacteria	1214
1199	Ga0207691_10400008	3300025940	Bacteria	1171
1200	Ga0207711_10000194	3300025941	Bacteria	65127
1201	Ga0207711_10000272	3300025941	Bacteria	55799
1202	Ga0207711_10126488	3300025941	Bacteria	2287
1203	Ga0207711_10155015	3300025941	Bacteria	2070
1204	Ga0207711_10162589	3300025941	Bacteria	2022
1205	Ga0207711_10329225	3300025941	Bacteria	1412
1206	Ga0207711_10726105	3300025941	Bacteria	926
1207	Ga0207711_10753926	3300025941	Bacteria	907
1208	Ga0207689_10051266	3300025942	Bacteria	3402
1209	Ga0207689_10077986	3300025942	Bacteria	2722
1210	Ga0207689_10118464	3300025942	Bacteria	2178
1211	Ga0207689_10280620	3300025942	Bacteria	1379
1212	Ga0207661_10284860	3300025944	Bacteria	1477
1213	Ga0207661_10314448	3300025944	Bacteria	1406
1214	Ga0207661_10381189	3300025944	Bacteria	1276
1215	Ga0207679_10028435	3300025945	Bacteria	3879
1216	Ga0207679_10091426	3300025945	Bacteria	2355
1217	Ga0207679_10438411	3300025945	Bacteria	1156
1218	Ga0207679_10483657	3300025945	Bacteria	1102
1219	Ga0207667_10006669	3300025949	Bacteria	13958
1220	Ga0207667_10010404	3300025949	Bacteria	10876
1221	Ga0207667_10015014	3300025949	Bacteria	8810
1222	Ga0207667_10017063	3300025949	Bacteria	8189
1223	Ga0207667_10018825	3300025949	Bacteria	7732
1224	Ga0207667_10028559	3300025949	Bacteria	6057
1225	Ga0207667_10030766	3300025949	Bacteria	5801
1226	Ga0207667_10044633	3300025949	Bacteria	4696
1227	Ga0207667_10045732	3300025949	Bacteria	4635
1228	Ga0207667_10059771	3300025949	Bacteria	3990
1229	Ga0207667_10091753	3300025949	Bacteria	3137
1230	Ga0207667_10138024	3300025949	Bacteria	2511
1231	Ga0207667_10282425	3300025949	Bacteria	1696
1232	Ga0207667_10573031	3300025949	Bacteria	1140
1233	Ga0207651_10132077	3300025960	Bacteria	1913
1234	Ga0207651_10252986	3300025960	Bacteria	1442
1235	Ga0207712_10002516	3300025961	Bacteria	11796
1236	Ga0207712_10003174	3300025961	Bacteria	10467
1237	Ga0207712_10073754	3300025961	Bacteria	2462
1238	Ga0207712_10216860	3300025961	Bacteria	1528
1239	Ga0207712_10657876	3300025961	Bacteria	911
1240	Ga0207712_10947519	3300025961	Bacteria	762
1241	Ga0207668_10008501	3300025972	Bacteria	6123
1242	Ga0207668_10019129	3300025972	Bacteria	4324
1243	Ga0207668_10057549	3300025972	Bacteria	2712
1244	Ga0207668_10071362	3300025972	Bacteria	2480
1245	Ga0207668_10276699	3300025972	Bacteria	1374
1246	Ga0207668_10494095	3300025972	Bacteria	1051
1247	Ga0207668_10667715	3300025972	Bacteria	911
1248	Ga0207668_10688811	3300025972	Bacteria	897
1249	Ga0207640_10017365	3300025981	Bacteria	4209
1250	Ga0207640_10021791	3300025981	Bacteria	3824
1251	Ga0207640_10039154	3300025981	Bacteria	2998
1252	Ga0207640_10053170	3300025981	Bacteria	2642
1253	Ga0207640_10069188	3300025981	Bacteria	2369
1254	Ga0207640_10070027	3300025981	Bacteria	2357
1255	Ga0207640_10181283	3300025981	Bacteria	1579
1256	Ga0207640_10409205	3300025981	Bacteria	1107
1257	Ga0207640_10592375	3300025981	Bacteria	937
1258	Ga0207658_10000005	3300025986	Bacteria	408341
1259	Ga0207658_10001619	3300025986	Bacteria	17277
1260	Ga0207658_10016088	3300025986	Bacteria	5138
1261	Ga0207658_10103406	3300025986	Bacteria	2236
1262	Ga0207658_10553842	3300025986	Bacteria	1029
1263	Ga0207658_10877296	3300025986	Bacteria	816
1264	Ga0207677_10031095	3300026023	Bacteria	3416
1265	Ga0207703_10011233	3300026035	Bacteria	6968
1266	Ga0207703_10029076	3300026035	Bacteria	4360
1267	Ga0207703_10108866	3300026035	Bacteria	2361
1268	Ga0207703_10751263	3300026035	Bacteria	929
1269	Ga0207639_10002455	3300026041	Bacteria	12436
1270	Ga0207639_10002641	3300026041	Bacteria	12036
1271	Ga0207639_10003444	3300026041	Bacteria	10648
1272	Ga0207639_10012233	3300026041	Bacteria	5973
1273	Ga0207639_10015866	3300026041	Bacteria	5320
1274	Ga0207639_10020753	3300026041	Bacteria	4708
1275	Ga0207639_10053621	3300026041	Bacteria	3077
1276	Ga0207639_10055668	3300026041	Bacteria	3028
1277	Ga0207639_10071930	3300026041	Bacteria	2707
1278	Ga0207639_10093184	3300026041	Bacteria	2415
1279	Ga0207639_10121637	3300026041	Bacteria	2146
1280	Ga0207639_10282081	3300026041	Bacteria	1461
1281	Ga0207639_10310668	3300026041	Bacteria	1396
1282	Ga0207639_10319907	3300026041	Bacteria	1377
1283	Ga0207639_10381313	3300026041	Bacteria	1266
1284	Ga0207639_10572602	3300026041	Unclassified	1039
1285	Ga0207639_10600512	3300026041	Bacteria	1015
1286	Ga0207639_10778386	3300026041	Bacteria	891
1287	Ga0207678_10006857	3300026067	Bacteria	10099
1288	Ga0207678_10010932	3300026067	Bacteria	7976
1289	Ga0207678_10025159	3300026067	Bacteria	5196
1290	Ga0207678_10222407	3300026067	Bacteria	1616
1291	Ga0207678_10251266	3300026067	Bacteria	1514
1292	Ga0207678_10277633	3300026067	Bacteria	1437
1293	Ga0207678_10297804	3300026067	Bacteria	1386
1294	Ga0207708_10180198	3300026075	Bacteria	1677
1295	Ga0207708_10644121	3300026075	Bacteria	901
1296	Ga0207708_11093915	3300026075	Bacteria	695
1297	Ga0207702_10000517	3300026078	Bacteria	43478
1298	Ga0207702_10002956	3300026078	Bacteria	15854
1299	Ga0207702_10030270	3300026078	Bacteria	4510
1300	Ga0207702_10045752	3300026078	Bacteria	3682
1301	Ga0207702_10047233	3300026078	Bacteria	3627
1302	Ga0207702_10060035	3300026078	Bacteria	3241
1303	Ga0207702_10093601	3300026078	Bacteria	2636
1304	Ga0207702_10103762	3300026078	Bacteria	2515
1305	Ga0207702_10278374	3300026078	Bacteria	1581
1306	Ga0207702_10315977	3300026078	Bacteria	1486
1307	Ga0207702_10348563	3300026078	Bacteria	1416
1308	Ga0207702_10566484	3300026078	Bacteria	1112
1309	Ga0207702_10607742	3300026078	Bacteria	1073
1310	Ga0207641_10006475	3300026088	Bacteria	9861
1311	Ga0207641_10013273	3300026088	Bacteria	6757
1312	Ga0207641_10017580	3300026088	Bacteria	5853
1313	Ga0207641_10059337	3300026088	Bacteria	3257
1314	Ga0207641_10123527	3300026088	Bacteria	2314
1315	Ga0207641_10222332	3300026088	Bacteria	1751
1316	Ga0207641_10224348	3300026088	Bacteria	1744
1317	Ga0207641_10444224	3300026088	Bacteria	1252
1318	Ga0207641_10787210	3300026088	Bacteria	940
1319	Ga0207641_11056005	3300026088	Bacteria	810
1320	Ga0207648_10012933	3300026089	Bacteria	7794
1321	Ga0207648_10023985	3300026089	Bacteria	5453
1322	Ga0207648_10208756	3300026089	Bacteria	1733
1323	Ga0207648_10290104	3300026089	Bacteria	1465
1324	Ga0207676_10000010	3300026095	Bacteria	519402
1325	Ga0207676_10029716	3300026095	Bacteria	4094
1326	Ga0207676_10422611	3300026095	Bacteria	1250
1327	Ga0207676_10455717	3300026095	Bacteria	1206
1328	Ga0207676_10727059	3300026095	Bacteria	964
1329	Ga0207674_10001609	3300026116	Bacteria	29068
1330	Ga0207674_10004758	3300026116	Bacteria	16278
1331	Ga0207674_10054588	3300026116	Bacteria	4067
1332	Ga0207674_10081900	3300026116	Bacteria	3229
1333	Ga0207674_10097950	3300026116	Bacteria	2916
1334	Ga0207674_10102165	3300026116	Bacteria	2847
1335	Ga0207674_10129551	3300026116	Bacteria	2487
1336	Ga0207674_10206059	3300026116	Bacteria	1916
1337	Ga0207674_10330653	3300026116	Bacteria	1474
1338	Ga0207674_10401363	3300026116	Bacteria	1325
1339	Ga0207675_100155615	3300026118	Bacteria	2178
1340	Ga0207675_100203449	3300026118	Bacteria	1902
1341	Ga0207683_10090472	3300026121	Bacteria	2725
1342	Ga0207683_10178131	3300026121	Bacteria	1927
1343	Ga0207683_10563683	3300026121	Bacteria	1053
1344	Ga0207698_10031854	3300026142	Bacteria	3812
1345	Ga0207698_10044265	3300026142	Bacteria	3343
1346	Ga0207698_10137872	3300026142	Bacteria	2096
1347	Ga0207698_10190970	3300026142	Bacteria	1824
1348	Ga0207698_10217152	3300026142	Bacteria	1725
1349	Ga0207698_10321538	3300026142	Bacteria	1449
1350	Ga0207698_10340257	3300026142	Bacteria	1413
1351	Ga0207698_10345475	3300026142	Bacteria	1403
1352	Ga0207698_10398463	3300026142	Bacteria	1315
1353	Ga0209281_1000581	3300027111	Bacteria	43027
1354	Ga0209281_1000756	3300027111	Bacteria	31155
1355	Ga0209281_1000803	3300027111	Bacteria	28991
1356	Ga0209281_1000810	3300027111	Bacteria	28512
1357	Ga0209281_1001632	3300027111	Bacteria	12017
1358	Ga0209281_1006505	3300027111	Bacteria	3041
1359	Ga0209281_1007130	3300027111	Bacteria	2828
1360	Ga0209281_1013013	3300027111	Bacteria	1808
1361	Ga0209281_1015375	3300027111	Bacteria	1597
1362	Ga0209281_1022024	3300027111	Bacteria	1225
1363	Ga0209281_1033283	3300027111	Bacteria	907
1364	Ga0209973_1000651	3300027252	Bacteria	2724
1365	Ga0209371_1000656	3300027312	Bacteria	30128
1366	Ga0209371_1000680	3300027312	Bacteria	29361
1367	Ga0209371_1001128	3300027312	Bacteria	19631
1368	Ga0209371_1001398	3300027312	Bacteria	16566
1369	Ga0209371_1001408	3300027312	Bacteria	16504
1370	Ga0209371_1002769	3300027312	Bacteria	9387
1371	Ga0209371_1002801	3300027312	Bacteria	9282
1372	Ga0209371_1007177	3300027312	Bacteria	3939
1373	Ga0209371_1008096	3300027312	Bacteria	3546
1374	Ga0209371_1010069	3300027312	Bacteria	2946
1375	Ga0209371_1010622	3300027312	Bacteria	2810
1376	Ga0209371_1015739	3300027312	Bacteria	2020
1377	Ga0209371_1019313	3300027312	Bacteria	1703
1378	Ga0209371_1033105	3300027312	Bacteria	1106
1379	Ga0209967_1003102	3300027364	Bacteria	2180
1380	Ga0209996_1004121	3300027395	Bacteria	1843
1381	Ga0209995_1008136	3300027471	Bacteria	1690
1382	Ga0209968_1013591	3300027526	Bacteria	1278
1383	Ga0209999_1007190	3300027543	Bacteria	2001
1384	Ga0209999_1031359	3300027543	Bacteria	987
1385	Ga0210002_1002230	3300027617	Bacteria	2800
1386	Ga0209983_1001182	3300027665	Bacteria	5765
1387	Ga0209971_1001747	3300027682	Bacteria	5335
1388	Ga0209998_10010467	3300027717	Bacteria	1921
1389	Ga0209974_10028237	3300027876	Bacteria	1858
1390	Ga0209974_10043155	3300027876	Bacteria	1502
1391	Ga0209974_10052961	3300027876	Bacteria	1366
1392	Ga0268266_10000001	3300028379	Bacteria	4040580
1393	Ga0268266_10000013	3300028379	Bacteria	649715
1394	Ga0268266_10000059	3300028379	Bacteria	269485
1395	Ga0268266_10000079	3300028379	Bacteria	213545
1396	Ga0268266_10006932	3300028379	Bacteria	10308
1397	Ga0268266_10024424	3300028379	Bacteria	5140
1398	Ga0268266_10037806	3300028379	Bacteria	4109
1399	Ga0268266_10294770	3300028379	Bacteria	1511
1400	Ga0268266_10376912	3300028379	Bacteria	1337
1401	Ga0268266_10440217	3300028379	Bacteria	1238
1402	Ga0268266_10640827	3300028379	Bacteria	1022
1403	Ga0268265_10000756	3300028380	Bacteria	31420
1404	Ga0268265_10006263	3300028380	Bacteria	8058
1405	Ga0268265_10228059	3300028380	Bacteria	1635
1406	Ga0268265_10229747	3300028380	Bacteria	1630
1407	Ga0268265_10411812	3300028380	Bacteria	1253
1408	Ga0268265_10857344	3300028380	Bacteria	889
1409	Ga0268264_10000036	3300028381	Bacteria	392994
1410	Ga0268264_10011814	3300028381	Bacteria	7196
1411	Ga0268264_10022866	3300028381	Bacteria	5100
1412	Ga0268264_10076078	3300028381	Bacteria	2855
1413	Ga0268264_10141753	3300028381	Bacteria	2144
1414	Ga0268264_10153795	3300028381	Bacteria	2065
1415	Ga0268264_10248343	3300028381	Bacteria	1652
1416	Ga0268264_10575193	3300028381	Bacteria	1108
1417	Ga0265318_10194762	3300028577	Bacteria	741
1418	Ga0307515_10049206	3300028794	Bacteria	6351
1419	Ga0268256_1000584	3300030500	Bacteria	29264
1420	Ga0268256_1000623	3300030500	Bacteria	27502
1421	Ga0268256_1001199	3300030500	Bacteria	16566
1422	Ga0268256_1001205	3300030500	Bacteria	16504
1423	Ga0268256_1004154	3300030500	Bacteria	6140
1424	Ga0268256_1004426	3300030500	Bacteria	5830
1425	Ga0268256_1006331	3300030500	Bacteria	4422
1426	Ga0268256_1008378	3300030500	Bacteria	3546
1427	Ga0268256_1010748	3300030500	Bacteria	2946
1428	Ga0268256_1011253	3300030500	Bacteria	2844
1429	Ga0268256_1014204	3300030500	Bacteria	2376
1430	Ga0268256_1020526	3300030500	Bacteria	1779
1431	Ga0268256_1036385	3300030500	Bacteria	1135
1432	Ga0268256_1036901	3300030500	Bacteria	1123
1433	Ga0316177_1088114	3300030731	Bacteria	6350
1434	Ga0316176_1058550	3300030732	Bacteria	1290
1435	Ga0316176_1126945	3300030732	Bacteria	3197
1436	Ga0314311_1025656	3300030733	Bacteria	2134
1437	Ga0314311_1168466	3300030733	Bacteria	1925
1438	Ga0316182_1037902	3300030745	Bacteria	2125
1439	Ga0265766_1000150	3300030863	Bacteria	2521
1440	Ga0265766_1001148	3300030863	Bacteria	1292
1441	Ga0265769_103674	3300030888	Bacteria	866
1442	Ga0265339_10201645	3300031249	Bacteria	981
1443	Ga0265331_10090087	3300031250	Bacteria	1418
1444	Ga0265327_10000005	3300031251	Bacteria	790146
1445	Ga0265327_10002455	3300031251	Bacteria	19557
1446	Ga0307509_10006255	3300031507	Bacteria	16094
1447	Ga0307509_10036013	3300031507	Bacteria	5424
1448	Ga0307408_100020277	3300031548	Bacteria	4485
1449	Ga0307408_100222383	3300031548	Bacteria	1541
1450	Ga0307408_100497609	3300031548	Bacteria	1066
1451	Ga0307408_100554162	3300031548	Bacteria	1015
1452	Ga0307408_100610180	3300031548	Bacteria	971
1453	Ga0307408_101300448	3300031548	Bacteria	681
1454	Ga0307508_10179392	3300031616	Bacteria	1720
1455	Ga0307508_10263409	3300031616	Bacteria	1318
1456	Ga0316575_10014580	3300031665	Bacteria	2953
1457	Ga0316575_10015707	3300031665	Bacteria	2856
1458	Ga0316575_10076299	3300031665	Bacteria	1349
1459	Ga0316575_10077669	3300031665	Bacteria	1337
1460	Ga0316575_10169998	3300031665	Bacteria	903
1461	Ga0316579_10001300	3300031691	Bacteria	9013
1462	Ga0316579_10007898	3300031691	Bacteria	4412
1463	Ga0316579_10022392	3300031691	Bacteria	2825
1464	Ga0316579_10079644	3300031691	Bacteria	1558
1465	Ga0316579_10129777	3300031691	Bacteria	1214
1466	Ga0316579_10161778	3300031691	Bacteria	1081
1467	Ga0316579_10166683	3300031691	Bacteria	1065
1468	Ga0265314_10032324	3300031711	Bacteria	3850
1469	Ga0316576_10017216	3300031727	Bacteria	4904
1470	Ga0316576_10019068	3300031727	Bacteria	4695
1471	Ga0316576_10059820	3300031727	Bacteria	2790
1472	Ga0316576_10101422	3300031727	Bacteria	2151
1473	Ga0316576_10152177	3300031727	Bacteria	1743
1474	Ga0316576_10168771	3300031727	Bacteria	1651
1475	Ga0316576_10226863	3300031727	Bacteria	1404
1476	Ga0316576_10271689	3300031727	Bacteria	1270
1477	Ga0316576_10708938	3300031727	Bacteria	729
1478	Ga0316578_10001601	3300031728	Bacteria	9345
1479	Ga0316578_10007292	3300031728	Bacteria	5534
1480	Ga0316578_10011810	3300031728	Bacteria	4585
1481	Ga0316578_10029645	3300031728	Bacteria	3106
1482	Ga0316578_10054383	3300031728	Bacteria	2348
1483	Ga0316578_10271848	3300031728	Bacteria	1015
1484	Ga0307516_10054191	3300031730	Bacteria	3920
1485	Ga0307516_10181396	3300031730	Bacteria	1838
1486	Ga0307405_10232552	3300031731	Bacteria	1360
1487	Ga0307405_10247554	3300031731	Bacteria	1324
1488	Ga0307405_11115196	3300031731	Bacteria	679
1489	Ga0316577_10035968	3300031733	Bacteria	2768
1490	Ga0316577_10065811	3300031733	Bacteria	2023
1491	Ga0316577_10076751	3300031733	Bacteria	1866
1492	Ga0316577_10083989	3300031733	Bacteria	1781
1493	Ga0316577_10114436	3300031733	Bacteria	1514
1494	Ga0316577_10173397	3300031733	Bacteria	1217
1495	Ga0316577_10453647	3300031733	Bacteria	728
1496	Ga0307413_10010652	3300031824	Bacteria	4475
1497	Ga0307413_10096570	3300031824	Bacteria	1940
1498	Ga0307413_10106312	3300031824	Bacteria	1867
1499	Ga0307413_10108314	3300031824	Bacteria	1854
1500	Ga0307413_10170907	3300031824	Bacteria	1538
1501	Ga0307413_10380753	3300031824	Bacteria	1099
1502	Ga0307410_10148477	3300031852	Bacteria	1742
1503	Ga0307410_10312165	3300031852	Bacteria	1244
1504	Ga0307410_10694432	3300031852	Bacteria	857
1505	Ga0307406_10008581	3300031901	Bacteria	5705
1506	Ga0307406_10014028	3300031901	Bacteria	4603
1507	Ga0307406_10113294	3300031901	Bacteria	1871
1508	Ga0307406_10157570	3300031901	Bacteria	1628
1509	Ga0307406_10393883	3300031901	Bacteria	1096
1510	Ga0307407_10072864	3300031903	Bacteria	2050
1511	Ga0307407_10102919	3300031903	Bacteria	1776
1512	Ga0307407_10243144	3300031903	Bacteria	1229
1513	Ga0307407_10322180	3300031903	Bacteria	1085
1514	Ga0307407_11129268	3300031903	Bacteria	610
1515	Ga0307412_10001988	3300031911	Bacteria	11318
1516	Ga0307412_10090449	3300031911	Bacteria	2139
1517	Ga0307412_10157891	3300031911	Bacteria	1681
1518	Ga0307412_10243401	3300031911	Bacteria	1392
1519	Ga0307412_10331069	3300031911	Bacteria	1215
1520	Ga0307412_10867705	3300031911	Bacteria	788
1521	Ga0307409_100153225	3300031995	Bacteria	2004
1522	Ga0307409_100304833	3300031995	Bacteria	1483
1523	Ga0307409_100416125	3300031995	Bacteria	1288
1524	Ga0307416_100064961	3300032002	Bacteria	2996
1525	Ga0307414_10014078	3300032004	Bacteria	4780
1526	Ga0307414_10037252	3300032004	Bacteria	3254
1527	Ga0307414_10063148	3300032004	Bacteria	2631
1528	Ga0307414_10088179	3300032004	Bacteria	2295
1529	Ga0307414_10110053	3300032004	Bacteria	2094
1530	Ga0307414_10133292	3300032004	Bacteria	1932
1531	Ga0307414_10141938	3300032004	Bacteria	1882
1532	Ga0307414_10177997	3300032004	Bacteria	1707
1533	Ga0307414_10189781	3300032004	Bacteria	1661
1534	Ga0307414_10215179	3300032004	Bacteria	1573
1535	Ga0307414_10380040	3300032004	Bacteria	1221
1536	Ga0307414_10763837	3300032004	Bacteria	879
1537	Ga0307414_11001223	3300032004	Bacteria	769
1538	Ga0307414_11028391	3300032004	Bacteria	759
1539	Ga0307414_11058993	3300032004	Bacteria	748
1540	Ga0307411_10146296	3300032005	Bacteria	1749
1541	Ga0307411_10981484	3300032005	Bacteria	755
1542	Ga0307411_11460413	3300032005	Bacteria	627
1543	Ga0307415_100120125	3300032126	Bacteria	1968
1544	Ga0307415_100363981	3300032126	Bacteria	1222
1545	Ga0307415_100593731	3300032126	Bacteria	984
1546	Ga0316583_10048311	3300032133	Bacteria	1498
1547	Ga0316583_10074424	3300032133	Bacteria	1188
1548	Ga0316583_10207571	3300032133	Bacteria	679
1549	Ga0316585_10013640	3300032137	Bacteria	2420
1550	Ga0316585_10046137	3300032137	Bacteria	1394
1551	Ga0316585_10058413	3300032137	Bacteria	1243
1552	Ga0316585_10126227	3300032137	Bacteria	843
1553	Ga0316585_10175548	3300032137	Bacteria	708
1554	Ga0316580_10015109	3300032139	Bacteria	2359
1555	Ga0316580_10024842	3300032139	Bacteria	1851
1556	Ga0316580_10027299	3300032139	Bacteria	1765
1557	Ga0316580_10042857	3300032139	Bacteria	1396
1558	Ga0316593_10000024	3300032168	Bacteria	15590
1559	Ga0316593_10001034	3300032168	Bacteria	5780
1560	Ga0316593_10001157	3300032168	Bacteria	5608
1561	Ga0316593_10002297	3300032168	Bacteria	4487
1562	Ga0316593_10002966	3300032168	Bacteria	4129
1563	Ga0316593_10002990	3300032168	Bacteria	4116
1564	Ga0316593_10003485	3300032168	Bacteria	3912
1565	Ga0316593_10003720	3300032168	Bacteria	3827
1566	Ga0316593_10004334	3300032168	Bacteria	3634
1567	Ga0316593_10005148	3300032168	Bacteria	3423
1568	Ga0316593_10007068	3300032168	Bacteria	3065
1569	Ga0316593_10012084	3300032168	Bacteria	2527
1570	Ga0316593_10014956	3300032168	Bacteria	2325
1571	Ga0316593_10015158	3300032168	Bacteria	2314
1572	Ga0316593_10038631	3300032168	Bacteria	1581
1573	Ga0316593_10041792	3300032168	Bacteria	1527
1574	Ga0316593_10043784	3300032168	Bacteria	1496
1575	Ga0316593_10047649	3300032168	Bacteria	1441
1576	Ga0316593_10060570	3300032168	Bacteria	1293
1577	Ga0316593_10061898	3300032168	Bacteria	1281
1578	Ga0316593_10068500	3300032168	Bacteria	1224
1579	Ga0316593_10086577	3300032168	Bacteria	1099
1580	Ga0316593_10087355	3300032168	Bacteria	1095
1581	Ga0316593_10149916	3300032168	Bacteria	848
1582	Ga0316593_10160930	3300032168	Bacteria	820
1583	Ga0316593_10231884	3300032168	Bacteria	688
1584	Ga0316593_10253377	3300032168	Bacteria	659
1585	Ga0307510_10005401	3300033180	Bacteria	15214
1586	Ga0307510_10389091	3300033180	Bacteria	838
1587	Ga0316592_1000481	3300033524	Bacteria	5553
1588	Ga0316592_1000515	3300033524	Bacteria	5426
1589	Ga0316592_1011726	3300033524	Bacteria	1787
1590	Ga0316592_1019510	3300033524	Bacteria	1434
1591	Ga0316592_1022784	3300033524	Bacteria	1341
1592	Ga0316592_1035755	3300033524	Bacteria	1090
1593	Ga0316592_1048809	3300033524	Bacteria	944
1594	Ga0316592_1058814	3300033524	Bacteria	862
1595	Ga0316592_1074632	3300033524	Bacteria	769
1596	Ga0316586_1002986	3300033527	Bacteria	2174
1597	Ga0316586_1003851	3300033527	Bacteria	2004
1598	Ga0316586_1010016	3300033527	Bacteria	1430
1599	Ga0316586_1019570	3300033527	Bacteria	1107
1600	Ga0316586_1021762	3300033527	Bacteria	1062
1601	Ga0316588_1002220	3300033528	Bacteria	3360
1602	Ga0316588_1006114	3300033528	Bacteria	2389
1603	Ga0316588_1006441	3300033528	Bacteria	2346
1604	Ga0316588_1015191	3300033528	Bacteria	1693
1605	Ga0316588_1023025	3300033528	Bacteria	1427
1606	Ga0316588_1033838	3300033528	Bacteria	1206
1607	Ga0316588_1041809	3300033528	Bacteria	1097
1608	Ga0316588_1080690	3300033528	Bacteria	805
1609	Ga0316587_1000564	3300033529	Bacteria	3880
1610	Ga0316587_1000671	3300033529	Bacteria	3661
1611	Ga0316587_1001854	3300033529	Bacteria	2714
1612	Ga0316587_1002052	3300033529	Bacteria	2624
1613	Ga0316587_1002654	3300033529	Bacteria	2416
1614	Ga0316587_1007718	3300033529	Bacteria	1677
1615	Ga0316587_1016326	3300033529	Bacteria	1238
1616	Ga0316587_1021285	3300033529	Bacteria	1105
1617	Ga0316587_1030548	3300033529	Bacteria	951
1618	Ga0316587_1043492	3300033529	Bacteria	814
1619	Ga0316596_1000175	3300033541	Bacteria	9183
1620	Ga0316596_1001146	3300033541	Bacteria	5185
1621	Ga0316596_1001653	3300033541	Bacteria	4590
1622	Ga0316596_1010619	3300033541	Bacteria	2234
1623	Ga0316596_1011976	3300033541	Bacteria	2127
1624	Ga0316596_1012435	3300033541	Bacteria	2092
1625	Ga0316596_1015130	3300033541	Bacteria	1920
1626	Ga0316596_1015238	3300033541	Bacteria	1915
1627	Ga0316596_1027787	3300033541	Bacteria	1461
1628	Ga0316596_1041323	3300033541	Bacteria	1212
1629	Ga0316596_1042726	3300033541	Bacteria	1193
1630	Ga0316596_1043473	3300033541	Bacteria	1183
1631	Ga0316596_1070647	3300033541	Bacteria	935
1632	Ga0373950_0040451	3300034818	Bacteria	891
1633	Ga0373958_0067890	3300034819	Bacteria	786
1634	Ga0373934_0192346	3300035086	Bacteria	840
1635	Ga0373953_0096210	3300035117	Bacteria	1243
1636	Ga0373960_0286195	3300035121	Bacteria	609
1637	Ga0316574_0006051	3300035398	Bacteria	6504
1638	Ga0316574_0027798	3300035398	Bacteria	3408
1639	Ga0316574_0068312	3300035398	Bacteria	2241
1640	Ga0316574_0071266	3300035398	Bacteria	2195
1641	Ga0316574_0075434	3300035398	Bacteria	2135
1642	Ga0316574_0082950	3300035398	Bacteria	2037
1643	Ga0316574_0135792	3300035398	Bacteria	1584
1644	Ga0316574_0177185	3300035398	Bacteria	1372
1645	Ga0316574_0179454	3300035398	Bacteria	1362
1646	Ga0316574_0243813	3300035398	Bacteria	1148
1647	Ga0316574_0369821	3300035398	Bacteria	905
1648	Ga0316574_0446545	3300035398	Bacteria	810
1649	Ga0373937_0265209	3300036401	Bacteria	1620
1650	Ga0373937_0298350	3300036401	Bacteria	1523
1651	Ga0373937_0335030	3300036401	Bacteria	1432
1652	Ga0373937_0423109	3300036401	Bacteria	1264
1653	Ga0316582_0009358	3300036647	Bacteria	5315
1654	Ga0316582_0009719	3300036647	Bacteria	5230
1655	Ga0316582_0013406	3300036647	Bacteria	4612
1656	Ga0316582_0023843	3300036647	Bacteria	3650
1657	Ga0316582_0025158	3300036647	Bacteria	3571
1658	Ga0316582_0028628	3300036647	Bacteria	3377
1659	Ga0316582_0054642	3300036647	Bacteria	2543
1660	Ga0316584_0046567	3300036712	Bacteria	3239
1661	Ga0316584_0070615	3300036712	Bacteria	2617
1662	Ga0316584_0176698	3300036712	Bacteria	1581
1663	Ga0316584_0261957	3300036712	Bacteria	1260
1664	Ga0316584_0338298	3300036712	Bacteria	1082
1665	Ga0316584_0420842	3300036712	Bacteria	949
1666	Ga0316584_0436407	3300036712	Bacteria	928
1667	Ga0316584_0980142	3300036712	Bacteria	566
1668	Ga0373925_0601174	3300037068	Bacteria	906
1669	Ga0395899_0007387	3300037312	Bacteria	8494
1670	Ga0395899_0013146	3300037312	Bacteria	6329
1671	Ga0395899_0094791	3300037312	Bacteria	2159
1672	Ga0395899_0110837	3300037312	Bacteria	1973
1673	Ga0395899_0137592	3300037312	Bacteria	1740
1674	Ga0395899_0181528	3300037312	Bacteria	1477
1675	Ga0395899_0215956	3300037312	Bacteria	1330
1676	Ga0395899_0266863	3300037312	Bacteria	1168
1677	Ga0395900_0003355	3300037418	Bacteria	17305
1678	Ga0395900_0007701	3300037418	Bacteria	11106
1679	Ga0395900_0018419	3300037418	Bacteria	7122
1680	Ga0395900_0059651	3300037418	Bacteria	3928
1681	Ga0395900_0101953	3300037418	Bacteria	2948
1682	Ga0395900_0114806	3300037418	Bacteria	2763
1683	Ga0395900_0158596	3300037418	Bacteria	2309
1684	Ga0395900_0241323	3300037418	Bacteria	1812
1685	Ga0395900_0262668	3300037418	Bacteria	1723
1686	Ga0395900_0288259	3300037418	Bacteria	1631
1687	Ga0395898_0014952	3300037466	Bacteria	7969
1688	Ga0395898_0019569	3300037466	Bacteria	6887
1689	Ga0395898_0033007	3300037466	Bacteria	5167
1690	Ga0395898_0101437	3300037466	Bacteria	2763
1691	Ga0395898_0380341	3300037466	Bacteria	1346
1692	Ga0395898_0394424	3300037466	Bacteria	1320
1693	Ga0395905_0069743	3300037471	Bacteria	3292
1694	Ga0395905_0074732	3300037471	Bacteria	3176
1695	Ga0395905_0131638	3300037471	Bacteria	2352
1696	Ga0316581_0000596	3300037588	Bacteria	7146
1697	Ga0316581_0000862	3300037588	Bacteria	6376
1698	Ga0395901_0003416	3300038443	Bacteria	16002
1699	Ga0395901_0004750	3300038443	Bacteria	13711
1700	Ga0395901_0081806	3300038443	Bacteria	3373
1701	Ga0395901_0939099	3300038443	Bacteria	844
1702	Ga0395901_1125972	3300038443	Bacteria	754
1703	Ga0237819_00830	3300038705	Bacteria	9758
1704	Ga0237819_11907	3300038705	Bacteria	1088
1705	Ga0400484_08595	3300038725	Bacteria	2627
1706	Ga0400490_14561	3300038726	Bacteria	6337
1707	Ga0400491_13676	3300038727	Bacteria	1266
1708	Ga0400488_08236	3300038741	Bacteria	2839
1709	Ga0400488_49540	3300038741	Bacteria	3367
1710	Ga0400483_011564	3300039062	Bacteria	3489
1711	Ga0400483_059643	3300039062	Bacteria	25197
1712	Ga0400483_137795	3300039062	Bacteria	2018
1713	Ga0400483_161420	3300039062	Bacteria	1778
1714	Ga0400483_164417	3300039062	Bacteria	7493
1715	Ga0400483_209600	3300039062	Bacteria	2109
1716	Ga0400483_242937	3300039062	Bacteria	1505
1717	Ga0400483_251466	3300039062	Bacteria	1537
1718	Ga0400489_45645	3300039093	Bacteria	1311
1719	Ga0400489_50915	3300039093	Bacteria	1729
1720	Ga0237816_00118	3300039145	Bacteria	5930
1721	Ga0436365_0628801	3300039437	Bacteria	37043
1722	Ga0436365_0857921	3300039437	Bacteria	76443
1723	Ga0436365_1829866	3300039437	Bacteria	763
1724	Ga0436360_0872355	3300039438	Bacteria	2704
1725	Ga0436363_0574461	3300039450	Bacteria	2054
1726	Ga0436362_1128374	3300039453	Bacteria	1415
1727	Ga0439436_0000176	3300041404	Bacteria	15135
1728	Ga0439436_0007411	3300041404	Bacteria	3376
1729	Ga0439436_0031260	3300041404	Bacteria	1545
1730	Ga0439438_000065	3300041405	Bacteria	49586
1731	Ga0439438_002016	3300041405	Bacteria	8852
1732	Ga0439438_002194	3300041405	Bacteria	8396
1733	Ga0439438_005052	3300041405	Bacteria	4919
1734	Ga0439438_015549	3300041405	Bacteria	2235
1735	Ga0439438_077001	3300041405	Bacteria	821
1736	Ga0439439_0014995	3300041406	Bacteria	1890
1737	Ga0439439_0089716	3300041406	Bacteria	839
1738	Ga0439439_0091442	3300041406	Bacteria	831
1739	Ga0439447_001007	3300041407	Bacteria	10287
1740	Ga0439447_002531	3300041407	Bacteria	6645
1741	Ga0439447_007199	3300041407	Bacteria	3549
1742	Ga0439466_0000114	3300041411	Bacteria	31085
1743	Ga0439465_0001430	3300041413	Bacteria	7724
1744	Ga0439465_0003075	3300041413	Bacteria	5458
1745	Ga0439465_0013442	3300041413	Bacteria	2552
1746	Ga0439465_0035903	3300041413	Bacteria	1590
1747	Ga0451789_0445104	3300041443	Bacteria	1044
1748	Ga0451790_19849	3300041444	Bacteria	922
1749	Ga0451791_0198640	3300041451	Bacteria	1241
1750	Ga0451793_0657735	3300041452	Bacteria	1330
1751	Ga0451793_0845108	3300041452	Bacteria	2355
1752	Ga0451797_0405083	3300041453	Bacteria	3443
1753	Ga0451797_1130154	3300041453	Bacteria	1137
1754	Ga0451795_0071692	3300041456	Bacteria	800
1755	Ga0451800_0124581	3300041459	Bacteria	6009
1756	Ga0451802_0888371	3300041460	Bacteria	1786
1757	Ga0451802_1002675	3300041460	Bacteria	1335
1758	Ga0451806_385064	3300041462	Bacteria	9086
1759	Ga0451804_0247020	3300041463	Bacteria	1033
1760	Ga0451804_1083353	3300041463	Bacteria	4670
1761	Ga0451807_0857467	3300041486	Bacteria	4217
1762	Ga0451807_1061879	3300041486	Bacteria	1349
1763	Ga0451807_1079531	3300041486	Bacteria	1045
1764	Ga0451807_1348637	3300041486	Bacteria	1432
1765	Ga0451807_1583600	3300041486	Bacteria	935
1766	Ga0451807_2605462	3300041486	Bacteria	1280
1767	Ga0451837_0327342	3300041494	Bacteria	1124
1768	Ga0451837_1033783	3300041494	Bacteria	932
1769	Ga0451837_1433720	3300041494	Bacteria	1012
1770	Ga0451837_1621251	3300041494	Bacteria	1621
1771	Ga0451849_0670867	3300041505	Bacteria	650
1772	Ga0451849_0785659	3300041505	Bacteria	868
1773	Ga0451849_1419098	3300041505	Bacteria	916
1774	Ga0451851_1022700	3300041507	Bacteria	674
1775	Ga0451843_1712711	3300041509	Bacteria	1118
1776	Ga0451853_0923083	3300041512	Bacteria	1270
1777	Ga0451853_1403623	3300041512	Bacteria	1391
1778	Ga0451853_3185635	3300041512	Bacteria	1292
1779	Ga0439431_0008078	3300041997	Bacteria	2359
1780	Ga0439433_0017439	3300041999	Bacteria	1594
1781	Ga0439437_008627	3300042000	Bacteria	1147
1782	Ga0439445_0001711	3300042004	Bacteria	4821
1783	Ga0439445_0084473	3300042004	Bacteria	889
1784	Ga0439448_0009993	3300042005	Bacteria	2804
1785	Ga0439432_014481	3300042006	Bacteria	2669
1786	Ga0439432_034951	3300042006	Bacteria	1611
1787	Ga0439432_045642	3300042006	Bacteria	1377
1788	Ga0439432_059295	3300042006	Bacteria	1182
1789	Ga0439432_074221	3300042006	Bacteria	1035
1790	Ga0439432_107650	3300042006	Bacteria	831
1791	Ga0439449_0002305	3300042007	Bacteria	7473
1792	Ga0439449_0010785	3300042007	Bacteria	3449
1793	Ga0439449_0018556	3300042007	Bacteria	2611
1794	Ga0439449_0023626	3300042007	Bacteria	2298
1795	Ga0439449_0027723	3300042007	Bacteria	2113
1796	Ga0439449_0080821	3300042007	Bacteria	1198
1797	Ga0439449_0108662	3300042007	Bacteria	1027
1798	Ga0439449_0200023	3300042007	Bacteria	748
1799	Ga0439451_029646	3300042009	Bacteria	1101
1800	Ga0439452_000335	3300042010	Bacteria	29254
1801	Ga0439452_000392	3300042010	Bacteria	26118
1802	Ga0439452_002113	3300042010	Bacteria	7525
1803	Ga0439452_011107	3300042010	Bacteria	2596
1804	Ga0439452_033283	3300042010	Bacteria	1252
1805	Ga0439452_047881	3300042010	Bacteria	987
1806	Ga0439454_030238	3300042011	Bacteria	845
1807	Ga0439456_051564	3300042013	Bacteria	899
1808	Ga0439457_017979	3300042014	Bacteria	1569
1809	Ga0439462_0030040	3300042015	Bacteria	1437
1810	Ga0450911_020046	3300042115	Bacteria	874
1811	Ga0450914_012182	3300042118	Bacteria	858
1812	Ga0450919_017688	3300042121	Bacteria	804
1813	Ga0450920_000570	3300042122	Bacteria	5865
1814	Ga0450921_002251	3300042123	Bacteria	1266
1815	Ga0450923_004529	3300042125	Bacteria	2185
1816	Ga0450923_005010	3300042125	Bacteria	2116
1817	Ga0450890_009840	3300042127	Bacteria	1229
1818	Ga0450890_017206	3300042127	Bacteria	961
1819	Ga0450894_024168	3300042131	Bacteria	828
1820	Ga0450895_001279	3300042132	Bacteria	1720
1821	Ga0450896_015197	3300042133	Bacteria	1101
1822	Ga0450898_015126	3300042134	Bacteria	1305
1823	Ga0450898_054358	3300042134	Bacteria	779
1824	Ga0450902_000769	3300042137	Bacteria	4120
1825	Ga0450907_001482	3300042146	Bacteria	5056
1826	Ga0450907_069010	3300042146	Bacteria	612
1827	Ga0439446_0008668	3300042156	Bacteria	2708
1828	Ga0439446_0181850	3300042156	Bacteria	703
1829	Ga0450908_003971	3300042184	Bacteria	2858
1830	Ga0450908_016922	3300042184	Bacteria	1297
1831	Ga0439434_0004071	3300042435	Bacteria	4269
1832	Ga0439435_0000395	3300042436	Bacteria	6763
1833	Ga0439444_0000762	3300042437	Bacteria	3835
1834	Ga0439459_0000645	3300042438	Bacteria	4735
1835	Ga0439464_0000183	3300042439	Bacteria	10831
1836	Ga0439464_0000850	3300042439	Bacteria	6773
1837	Ga0439464_0006735	3300042439	Bacteria	2995
1838	Ga0439460_0129347	3300042461	Bacteria	831
1839	Ga0450918_019297	3300042531	Bacteria	1189
1840	Ga0450918_035894	3300042531	Bacteria	882
1841	Ga0450893_0030976	3300042532	Bacteria	954
1842	Ga0450901_009798	3300042533	Bacteria	990
1843	Ga0451577_0022632	3300042876	Bacteria	5739
1844	Ga0451577_0469321	3300042876	Bacteria	1143
1845	Ga0466969_0008630	3300044656	Bacteria	5406
1846	Ga0466969_0011450	3300044656	Bacteria	4696
1847	Ga0466972_0002322	3300044658	Bacteria	9363
1848	Ga0466981_0000054	3300044669	Bacteria	29349
1849	Ga0466982_0000005	3300044672	Bacteria	364340
1850	Ga0453683_0398435	3300044673	Bacteria	887
1851	Ga0466965_0075701	3300044683	Bacteria	1697
1852	Ga0466965_0131221	3300044683	Bacteria	1299
1853	Ga0466966_0012146	3300044684	Bacteria	5705
1854	Ga0466966_0094367	3300044684	Bacteria	1854
1855	Ga0466961_0024868	3300044693	Bacteria	3852
1856	Ga0466961_0061896	3300044693	Bacteria	2378
1857	Ga0466961_0129964	3300044693	Bacteria	1578
1858	Ga0466961_0169876	3300044693	Bacteria	1356
1859	Ga0466961_0179808	3300044693	Bacteria	1313
1860	Ga0453684_0009802	3300044712	Bacteria	16610
1861	Ga0453684_0010223	3300044712	Bacteria	16079
1862	Ga0453684_0604364	3300044712	Bacteria	1202
1863	Ga0466971_0013305	3300044719	Bacteria	3612
1864	Ga0466971_0172223	3300044719	Bacteria	1016
1865	Ga0466968_0002557	3300044735	Bacteria	6685
1866	Ga0466968_0014516	3300044735	Bacteria	3113
1867	Ga0466970_0002634	3300044765	Bacteria	8654
1868	Ga0466970_0004707	3300044765	Bacteria	6736
1869	Ga0466970_0028368	3300044765	Bacteria	2939
1870	Ga0466970_0099207	3300044765	Bacteria	1585
1871	Ga0466970_0162930	3300044765	Bacteria	1234
1872	Ga0466957_0004429	3300044842	Bacteria	7820
1873	Ga0466957_0043782	3300044842	Bacteria	2711
1874	Ga0466960_0000695	3300044901	Bacteria	11738
1875	Ga0466959_0016440	3300045049	Bacteria	5407
1876	Ga0466959_0140574	3300045049	Bacteria	1706
1877	Ga0466959_0939283	3300045049	Bacteria	576
1878	Ga0451576_0000025	3300045051	Bacteria	427980
1879	Ga0451576_0000741	3300045051	Bacteria	65303
1880	Ga0466958_0047782	3300045836	Bacteria	2584
1881	Ga0466958_0131980	3300045836	Bacteria	1569
1882	Ga0466958_0187866	3300045836	Bacteria	1312
1883	Ga0466967_0295990	3300045976	Bacteria	1556
1884	Ga0495617_001043	3300046452	Bacteria	12675
1885	Ga0495627_000477	3300046453	Bacteria	33956
1886	Ga0495627_041872	3300046453	Bacteria	1405
1887	Ga0495591_000543	3300046458	Bacteria	28965
1888	Ga0495591_002788	3300046458	Bacteria	9419
1889	Ga0495629_0386033	3300046459	Bacteria	953
1890	Ga0495629_0664997	3300046459	Bacteria	693
1891	Ga0495638_0005342	3300046460	Bacteria	9576
1892	Ga0495638_0008369	3300046460	Bacteria	7335
1893	Ga0495638_0032034	3300046460	Bacteria	3373
1894	Ga0495638_0036071	3300046460	Bacteria	3151
1895	Ga0495638_0060929	3300046460	Bacteria	2332
1896	Ga0495638_0074544	3300046460	Bacteria	2069
1897	Ga0495638_0076004	3300046460	Bacteria	2046
1898	Ga0495638_0115329	3300046460	Bacteria	1592
1899	Ga0495638_0234740	3300046460	Bacteria	1018
1900	Ga0495641_0095051	3300046461	Bacteria	1331
1901	Ga0495650_0000892	3300046471	Bacteria	35189
1902	Ga0495650_0001118	3300046471	Bacteria	29311
1903	Ga0495650_0001197	3300046471	Bacteria	27412
1904	Ga0495650_0002281	3300046471	Bacteria	15944
1905	Ga0495650_0004579	3300046471	Bacteria	9400
1906	Ga0495650_0010900	3300046471	Bacteria	5032
1907	Ga0495650_0104958	3300046471	Bacteria	1056
1908	Ga0495605_0096853	3300046474	Bacteria	1360
1909	Ga0495605_0204688	3300046474	Bacteria	859
1910	Ga0495639_0070630	3300046475	Bacteria	1613
1911	Ga0495584_0004077	3300046491	Bacteria	7887
1912	Ga0495584_0007053	3300046491	Bacteria	5872
1913	Ga0495585_0012000	3300046492	Bacteria	5113
1914	Ga0495596_0005528	3300046500	Bacteria	5950
1915	Ga0495607_0005682	3300046501	Bacteria	8884
1916	Ga0495607_0005957	3300046501	Bacteria	8644
1917	Ga0495607_0029812	3300046501	Bacteria	3356
1918	Ga0495607_0042497	3300046501	Bacteria	2693
1919	Ga0495607_0135087	3300046501	Bacteria	1278
1920	Ga0495583_0024511	3300046506	Bacteria	3030
1921	Ga0495606_0007685	3300046507	Bacteria	9557
1922	Ga0495606_0016276	3300046507	Bacteria	5678
1923	Ga0495606_0034447	3300046507	Bacteria	3476
1924	Ga0495606_0059204	3300046507	Bacteria	2458
1925	Ga0495606_0068032	3300046507	Bacteria	2254
1926	Ga0495606_0076683	3300046507	Bacteria	2088
1927	Ga0495610_0006443	3300046512	Bacteria	8074
1928	Ga0495610_0011002	3300046512	Bacteria	5568
1929	Ga0495610_0141185	3300046512	Bacteria	1036
1930	Ga0495616_0009332	3300046513	Bacteria	5748
1931	Ga0495616_0022270	3300046513	Bacteria	3422
1932	Ga0495620_0051692	3300046515	Bacteria	1747
1933	Ga0495620_0092182	3300046515	Bacteria	1215
1934	Ga0495630_0949807	3300046517	Bacteria	654
1935	Ga0495631_0017419	3300046518	Bacteria	3401
1936	Ga0495631_0168164	3300046518	Bacteria	940
1937	Ga0495631_0217188	3300046518	Bacteria	816
1938	Ga0495632_0010665	3300046519	Bacteria	5421
1939	Ga0495632_0043557	3300046519	Bacteria	2242
1940	Ga0495632_0135003	3300046519	Bacteria	1147
1941	Ga0495637_0027016	3300046520	Bacteria	2571
1942	Ga0495643_0048987	3300046522	Bacteria	2280
1943	Ga0495643_0049333	3300046522	Bacteria	2270
1944	Ga0495644_0009544	3300046523	Bacteria	3740
1945	Ga0495648_0010675	3300046524	Bacteria	6979
1946	Ga0495648_0022154	3300046524	Bacteria	4382
1947	Ga0495648_0062293	3300046524	Bacteria	2209
1948	Ga0495663_0002005	3300046525	Bacteria	6261
1949	Ga0495663_0034220	3300046525	Bacteria	1520
1950	Ga0495663_0035776	3300046525	Bacteria	1492
1951	Ga0495654_0000419	3300046530	Bacteria	36153
1952	Ga0495654_0030855	3300046530	Bacteria	2723
1953	Ga0495665_0092743	3300046531	Bacteria	1587
1954	Ga0495640_0480888	3300046533	Bacteria	757
1955	Ga0495586_0297959	3300046535	Bacteria	924
1956	Ga0495598_0001815	3300046537	Bacteria	4295
1957	Ga0495621_0004295	3300046539	Bacteria	3993
1958	Ga0495621_0062012	3300046539	Bacteria	1360
1959	Ga0495621_0084696	3300046539	Bacteria	1187
1960	Ga0495621_0137537	3300046539	Bacteria	954
1961	Ga0495597_0000561	3300046542	Bacteria	30821
1962	Ga0495645_0052869	3300046543	Bacteria	2954
1963	Ga0495633_0061117	3300046558	Bacteria	1764
1964	Ga0495656_0011224	3300046615	Bacteria	3285
1965	Ga0495668_0019984	3300046616	Bacteria	3852
1966	Ga0495668_0064175	3300046616	Bacteria	2022
1967	Ga0495668_0269180	3300046616	Bacteria	933
1968	Ga0495611_0000029	3300046648	Bacteria	115887
1969	Ga0495611_0100535	3300046648	Bacteria	1342
1970	Ga0495625_0008764	3300046660	Bacteria	8572
1971	Ga0495625_0033113	3300046660	Bacteria	3824
1972	Ga0495625_0058812	3300046660	Bacteria	2729
1973	Ga0495625_0152548	3300046660	Bacteria	1552
1974	Ga0495625_0214750	3300046660	Bacteria	1263
1975	Ga0495635_0277230	3300046663	Bacteria	1127
1976	Ga0495661_0140949	3300046665	Bacteria	1311
1977	Ga0495588_0075821	3300046674	Bacteria	1752
1978	Ga0495658_0084439	3300046683	Bacteria	1869
1979	Ga0495670_0010181	3300046691	Bacteria	4625
1980	Ga0495670_0041870	3300046691	Bacteria	2285
1981	Ga0495671_0000881	3300046692	Bacteria	21419
1982	Ga0495671_0001092	3300046692	Bacteria	18775
1983	Ga0495649_0018400	3300046694	Bacteria	3931
1984	Ga0495649_0064648	3300046694	Bacteria	1964
1985	Ga0495589_0000144	3300046794	Bacteria	65654
1986	Ga0495589_0000511	3300046794	Bacteria	27340
1987	Ga0495589_0016531	3300046794	Bacteria	3792
1988	Ga0495660_0000413	3300046810	Bacteria	36358
1989	Ga0495660_0000474	3300046810	Bacteria	33386
1990	Ga0495660_0019303	3300046810	Bacteria	3913
1991	Ga0495660_0022601	3300046810	Bacteria	3589
1992	Ga0495660_0024423	3300046810	Bacteria	3442
1993	Ga0495604_0446871	3300047317	Bacteria	845
1994	Ga0495636_0010004	3300047318	Bacteria	3738
1995	Ga0495636_0047006	3300047318	Bacteria	1801
1996	Ga0495636_0423079	3300047318	Bacteria	637
1997	Ga0495672_0000679	3300047320	Bacteria	37907
1998	Ga0495672_0000719	3300047320	Bacteria	36413
1999	Ga0495672_0000881	3300047320	Bacteria	31554
2000	Ga0495672_0006232	3300047320	Bacteria	9300
2001	Ga0495672_0035703	3300047320	Bacteria	3060
2002	Ga0495672_0047413	3300047320	Bacteria	2556
2003	Ga0495683_0003053	3300047323	Bacteria	9840
2004	Ga0495683_0028991	3300047323	Bacteria	2828
2005	Ga0495679_000077	3300047446	Bacteria	91410
2006	Ga0495679_001139	3300047446	Bacteria	15912
2007	Ga0495679_007017	3300047446	Bacteria	4759
2008	Ga0495679_035293	3300047446	Bacteria	1586
2009	Ga0495673_0000581	3300047469	Bacteria	36788
2010	Ga0495673_0000827	3300047469	Bacteria	28983
2011	Ga0495673_0001835	3300047469	Bacteria	15993
2012	Ga0495673_0001841	3300047469	Bacteria	15926
2013	Ga0495684_0277772	3300047471	Bacteria	1210
2014	Ga0495686_0003188	3300047472	Bacteria	14447
2015	Ga0495686_0008278	3300047472	Bacteria	7654
2016	Ga0495686_0026449	3300047472	Bacteria	3795
2017	Ga0495686_0059194	3300047472	Bacteria	2385
2018	Ga0495686_0072058	3300047472	Bacteria	2125
2019	Ga0495686_0100918	3300047472	Bacteria	1740
2020	Ga0495686_0220185	3300047472	Bacteria	1080
2021	Ga0495686_0442544	3300047472	Bacteria	691
2022	Ga0495602_0377014	3300048088	Bacteria	1017
2023	Ga0495626_0241492	3300048091	Bacteria	727
2024	Ga0496100_0046183	3300048903	Bacteria	2799
2025	Ga0496100_0055454	3300048903	Bacteria	2589
2026	Ga0496100_0077605	3300048903	Bacteria	2233
2027	Ga0496101_0023056	3300048904	Bacteria	4295
2028	Ga0496101_0024485	3300048904	Bacteria	4178
2029	Ga0496101_0055696	3300048904	Bacteria	2857
2030	Ga0496101_0114156	3300048904	Bacteria	2036
2031	Ga0496101_0117232	3300048904	Bacteria	2010
2032	Ga0496102_0020726	3300048905	Bacteria	5809
2033	Ga0496102_0134141	3300048905	Bacteria	2319
2034	Ga0496102_0314765	3300048905	Bacteria	1475
2035	Ga0496102_0377646	3300048905	Bacteria	1334
2036	Ga0496102_0509062	3300048905	Bacteria	1126
2037	Ga0496104_0000670	3300048907	Bacteria	29396
2038	Ga0496104_0002228	3300048907	Bacteria	16739
2039	Ga0496104_0038337	3300048907	Bacteria	4484
2040	Ga0496104_0049579	3300048907	Bacteria	3959
2041	Ga0496104_0153250	3300048907	Bacteria	2212
2042	Ga0496104_0170927	3300048907	Bacteria	2084
2043	Ga0496105_0000021	3300048908	Bacteria	164255
2044	Ga0496105_0085886	3300048908	Bacteria	2600
2045	Ga0496105_0114093	3300048908	Bacteria	2228
2046	Ga0496105_0194074	3300048908	Bacteria	1659
2047	Ga0496106_0021873	3300048909	Bacteria	4750
2048	Ga0496106_0043526	3300048909	Bacteria	3369
2049	Ga0496107_0075751	3300048910	Bacteria	2449
2050	Ga0496108_0062034	3300048911	Bacteria	3147
2051	Ga0496108_0272794	3300048911	Bacteria	1472
2052	Ga0496108_0350668	3300048911	Bacteria	1288
2053	Ga0496109_0029720	3300048912	Bacteria	4896
2054	Ga0496109_0067177	3300048912	Bacteria	3284
2055	Ga0496109_0310390	3300048912	Bacteria	1488
2056	Ga0496109_0785572	3300048912	Bacteria	890
2057	Ga0496110_0023385	3300048913	Bacteria	5254
2058	Ga0496110_0060639	3300048913	Bacteria	3337
2059	Ga0496110_0182060	3300048913	Bacteria	1908
2060	Ga0496112_0234173	3300048915	Bacteria	1790
2061	Ga0496113_0034039	3300048916	Bacteria	3714
2062	Ga0496113_0059816	3300048916	Bacteria	2871
2063	Ga0496113_0157977	3300048916	Bacteria	1791
2064	Ga0496114_0006354	3300048917	Bacteria	9297
2065	Ga0496114_0041875	3300048917	Bacteria	3795
2066	Ga0496114_0136753	3300048917	Bacteria	2119
2067	Ga0496114_0153608	3300048917	Bacteria	1998
2068	Ga0496114_0162862	3300048917	Bacteria	1940
2069	Ga0496114_0227811	3300048917	Bacteria	1637
2070	Ga0496115_0000256	3300048918	Bacteria	47176
2071	Ga0496115_0009677	3300048918	Bacteria	7172
2072	Ga0496115_0075855	3300048918	Bacteria	2732
2073	Ga0496115_0081105	3300048918	Bacteria	2642
2074	Ga0496115_0096753	3300048918	Bacteria	2417
2075	Ga0496115_0108705	3300048918	Bacteria	2276
2076	Ga0496115_0118389	3300048918	Bacteria	2178
2077	Ga0496115_0740336	3300048918	Bacteria	769
2078	Ga0496116_0001114	3300048919	Bacteria	32173
2079	Ga0496116_0001347	3300048919	Bacteria	27949
2080	Ga0496116_0006433	3300048919	Bacteria	10649
2081	Ga0496116_0007604	3300048919	Bacteria	9574
2082	Ga0496116_0023527	3300048919	Bacteria	4585
2083	Ga0496116_0031269	3300048919	Bacteria	3814
2084	Ga0496116_0050388	3300048919	Bacteria	2774
2085	Ga0496116_0054507	3300048919	Bacteria	2633
2086	Ga0496116_0093398	3300048919	Bacteria	1821
2087	Ga0496116_0107632	3300048919	Bacteria	1648
2088	Ga0496116_0117890	3300048919	Bacteria	1543
2089	Ga0496116_0187021	3300048919	Bacteria	1101
2090	Ga0496117_0001935	3300048920	Bacteria	27638
2091	Ga0496117_0002080	3300048920	Bacteria	26433
2092	Ga0496117_0009196	3300048920	Bacteria	9250
2093	Ga0496117_0017925	3300048920	Bacteria	5894
2094	Ga0496117_0022053	3300048920	Bacteria	5120
2095	Ga0496117_0037690	3300048920	Bacteria	3597
2096	Ga0496117_0040227	3300048920	Bacteria	3440
2097	Ga0496117_0043445	3300048920	Bacteria	3267
2098	Ga0496117_0071854	3300048920	Bacteria	2316
2099	Ga0496117_0093781	3300048920	Bacteria	1924
2100	Ga0496117_0112703	3300048920	Bacteria	1690
2101	Ga0496117_0127689	3300048920	Bacteria	1548
2102	Ga0496117_0131170	3300048920	Bacteria	1518
2103	Ga0496117_0136350	3300048920	Bacteria	1477
2104	Ga0496117_0155152	3300048920	Bacteria	1349
2105	Ga0496117_0166084	3300048920	Bacteria	1287
2106	Ga0496117_0395167	3300048920	Bacteria	699
2107	Ga0496118_0006752	3300048921	Bacteria	12484
2108	Ga0496118_0007268	3300048921	Bacteria	11799
2109	Ga0496118_0009630	3300048921	Bacteria	9719
2110	Ga0496118_0009809	3300048921	Bacteria	9598
2111	Ga0496118_0012111	3300048921	Bacteria	8324
2112	Ga0496118_0017106	3300048921	Bacteria	6618
2113	Ga0496118_0018317	3300048921	Bacteria	6322
2114	Ga0496118_0025840	3300048921	Bacteria	5022
2115	Ga0496118_0034937	3300048921	Bacteria	4092
2116	Ga0496118_0044470	3300048921	Bacteria	3477
2117	Ga0496118_0046667	3300048921	Bacteria	3366
2118	Ga0496118_0065967	3300048921	Bacteria	2645
2119	Ga0496118_0077156	3300048921	Bacteria	2364
2120	Ga0496118_0088219	3300048921	Bacteria	2146
2121	Ga0496118_0092545	3300048921	Bacteria	2074
2122	Ga0496118_0098907	3300048921	Bacteria	1979
2123	Ga0496118_0102017	3300048921	Bacteria	1935
2124	Ga0496118_0203765	3300048921	Bacteria	1168
2125	Ga0496118_0430482	3300048921	Bacteria	676
2126	Ga0496119_0001676	3300048922	Bacteria	25905
2127	Ga0496119_0007226	3300048922	Bacteria	10054
2128	Ga0496119_0009096	3300048922	Bacteria	8602
2129	Ga0496119_0012809	3300048922	Bacteria	6765
2130	Ga0496119_0013010	3300048922	Bacteria	6682
2131	Ga0496119_0025070	3300048922	Bacteria	4173
2132	Ga0496119_0027480	3300048922	Bacteria	3908
2133	Ga0496119_0033761	3300048922	Bacteria	3385
2134	Ga0496119_0035104	3300048922	Bacteria	3290
2135	Ga0496119_0035242	3300048922	Bacteria	3281
2136	Ga0496119_0036271	3300048922	Bacteria	3221
2137	Ga0496119_0080908	3300048922	Bacteria	1872
2138	Ga0496119_0095460	3300048922	Bacteria	1679
2139	Ga0496119_0148831	3300048922	Bacteria	1256
2140	Ga0496119_0275997	3300048922	Bacteria	838
2141	Ga0496120_0000480	3300048923	Bacteria	62598
2142	Ga0496120_0001292	3300048923	Bacteria	31189
2143	Ga0496120_0001793	3300048923	Bacteria	24110
2144	Ga0496120_0003484	3300048923	Bacteria	14310
2145	Ga0496120_0005871	3300048923	Bacteria	9586
2146	Ga0496120_0009583	3300048923	Bacteria	6849
2147	Ga0496120_0012742	3300048923	Bacteria	5701
2148	Ga0496120_0017087	3300048923	Bacteria	4715
2149	Ga0496120_0021238	3300048923	Bacteria	4105
2150	Ga0496120_0040816	3300048923	Bacteria	2723
2151	Ga0496120_0042458	3300048923	Bacteria	2655
2152	Ga0496120_0132067	3300048923	Bacteria	1277
2153	Ga0496120_0132069	3300048923	Bacteria	1277
2154	Ga0496121_0000290	3300048924	Bacteria	104280
2155	Ga0496121_0005739	3300048924	Bacteria	15766
2156	Ga0496121_0006044	3300048924	Bacteria	15242
2157	Ga0496121_0012288	3300048924	Bacteria	9369
2158	Ga0496121_0018787	3300048924	Bacteria	6945
2159	Ga0496121_0027687	3300048924	Bacteria	5297
2160	Ga0496121_0052565	3300048924	Bacteria	3420
2161	Ga0496121_0053481	3300048924	Bacteria	3382
2162	Ga0496121_0117252	3300048924	Bacteria	2017
2163	Ga0496121_0133799	3300048924	Bacteria	1850
2164	Ga0496121_0144158	3300048924	Bacteria	1762
2165	Ga0496121_0147981	3300048924	Bacteria	1732
2166	Ga0496121_0245597	3300048924	Bacteria	1244
2167	Ga0496121_0259232	3300048924	Bacteria	1201
2168	Ga0496122_0002332	3300048925	Bacteria	27370
2169	Ga0496122_0004402	3300048925	Bacteria	17528
2170	Ga0496122_0023046	3300048925	Bacteria	5509
2171	Ga0496122_0024773	3300048925	Bacteria	5240
2172	Ga0496122_0038209	3300048925	Bacteria	3850
2173	Ga0496122_0039727	3300048925	Bacteria	3748
2174	Ga0496122_0052996	3300048925	Bacteria	3062
2175	Ga0496122_0054166	3300048925	Bacteria	3015
2176	Ga0496122_0056653	3300048925	Bacteria	2919
2177	Ga0496122_0077113	3300048925	Bacteria	2342
2178	Ga0496122_0084569	3300048925	Bacteria	2193
2179	Ga0496122_0105579	3300048925	Bacteria	1867
2180	Ga0496122_0110465	3300048925	Bacteria	1806
2181	Ga0496122_0131324	3300048925	Bacteria	1590
2182	Ga0496122_0131870	3300048925	Bacteria	1585
2183	Ga0496122_0337989	3300048925	Bacteria	792
2184	Ga0496123_0007406	3300048926	Bacteria	10354
2185	Ga0496123_0008275	3300048926	Bacteria	9582
2186	Ga0496123_0013804	3300048926	Bacteria	6740
2187	Ga0496123_0017937	3300048926	Bacteria	5666
2188	Ga0496123_0019197	3300048926	Bacteria	5396
2189	Ga0496123_0027787	3300048926	Bacteria	4205
2190	Ga0496123_0033088	3300048926	Bacteria	3727
2191	Ga0496123_0039166	3300048926	Bacteria	3318
2192	Ga0496123_0047037	3300048926	Bacteria	2919
2193	Ga0496123_0048725	3300048926	Bacteria	2847
2194	Ga0496123_0055210	3300048926	Bacteria	2607
2195	Ga0496123_0063598	3300048926	Bacteria	2356
2196	Ga0496123_0087239	3300048926	Bacteria	1867
2197	Ga0496123_0223487	3300048926	Bacteria	948
2198	Ga0496124_0000632	3300048927	Bacteria	58404
2199	Ga0496124_0001727	3300048927	Bacteria	30748
2200	Ga0496124_0002542	3300048927	Bacteria	23661
2201	Ga0496124_0004447	3300048927	Bacteria	16343
2202	Ga0496124_0006827	3300048927	Bacteria	12312
2203	Ga0496124_0008243	3300048927	Bacteria	10929
2204	Ga0496124_0010014	3300048927	Bacteria	9676
2205	Ga0496124_0023156	3300048927	Bacteria	5677
2206	Ga0496124_0075629	3300048927	Bacteria	2781
2207	Ga0496124_0076505	3300048927	Bacteria	2762
2208	Ga0496124_0098142	3300048927	Bacteria	2377
2209	Ga0496124_0101661	3300048927	Bacteria	2328
2210	Ga0496124_0235176	3300048927	Bacteria	1366
2211	Ga0496124_0246814	3300048927	Bacteria	1323
2212	Ga0496125_0001897	3300048928	Bacteria	28648
2213	Ga0496125_0002049	3300048928	Bacteria	27227
2214	Ga0496125_0004963	3300048928	Bacteria	15047
2215	Ga0496125_0010624	3300048928	Bacteria	9295
2216	Ga0496125_0014774	3300048928	Bacteria	7584
2217	Ga0496125_0034308	3300048928	Bacteria	4475
2218	Ga0496125_0040899	3300048928	Bacteria	3969
2219	Ga0496125_0067059	3300048928	Bacteria	2830
2220	Ga0496125_0089642	3300048928	Bacteria	2312
2221	Ga0496125_0267827	3300048928	Bacteria	1066
2222	Ga0496126_0002533	3300048929	Bacteria	24459
2223	Ga0496126_0002654	3300048929	Bacteria	23701
2224	Ga0496126_0023902	3300048929	Bacteria	5909
2225	Ga0496126_0046419	3300048929	Bacteria	3984
2226	Ga0496126_0061738	3300048929	Bacteria	3365
2227	Ga0496126_0077472	3300048929	Bacteria	2947
2228	Ga0496126_0083282	3300048929	Bacteria	2823
2229	Ga0496126_0113174	3300048929	Bacteria	2362
2230	Ga0496126_0125836	3300048929	Bacteria	2218
2231	Ga0496126_0127892	3300048929	Bacteria	2197
2232	Ga0496126_0165330	3300048929	Bacteria	1888
2233	Ga0496126_0175900	3300048929	Bacteria	1820
2234	Ga0496126_0181532	3300048929	Bacteria	1787
2235	Ga0496126_0250380	3300048929	Bacteria	1476
2236	Ga0496126_0258022	3300048929	Bacteria	1450
2237	Ga0496126_0291819	3300048929	Bacteria	1348
2238	Ga0496126_0350476	3300048929	Bacteria	1207
2239	Ga0501310_000893	3300049130	Bacteria	2657
2240	Ga0495678_001677	3300049459	Bacteria	16820
2241	Ga0495678_003387	3300049459	Bacteria	9918
2242	Ga0495678_006854	3300049459	Bacteria	5987
2243	Ga0495678_040746	3300049459	Bacteria	1864
2244	Ga0495682_0000831	3300049460	Bacteria	19326
2245	Ga0501312_070777	3300049528	Bacteria	618
2246	Ga0501031_0001839	3300049568	Bacteria	13347
2247	Ga0501031_0065381	3300049568	Bacteria	2369
2248	Ga0501031_0106569	3300049568	Bacteria	1829
2249	Ga0501031_0198823	3300049568	Bacteria	1308
2250	Ga0501032_0004867	3300049569	Bacteria	10049
2251	Ga0501032_0093708	3300049569	Bacteria	1991
2252	Ga0501032_0102491	3300049569	Bacteria	1896
2253	Ga0501032_0159259	3300049569	Bacteria	1482
2254	Ga0501032_0189079	3300049569	Bacteria	1346
2255	Ga0501033_0002014	3300049570	Bacteria	17674
2256	Ga0501033_0011254	3300049570	Bacteria	6848
2257	Ga0501033_0012407	3300049570	Bacteria	6503
2258	Ga0501033_0078614	3300049570	Bacteria	2420
2259	Ga0501033_0089208	3300049570	Bacteria	2255
2260	Ga0501033_0091619	3300049570	Bacteria	2223
2261	Ga0501033_0163250	3300049570	Bacteria	1603
2262	Ga0501034_0010746	3300049571	Bacteria	9507
2263	Ga0501034_0014583	3300049571	Bacteria	8091
2264	Ga0501034_0020760	3300049571	Bacteria	6704
2265	Ga0501034_0040480	3300049571	Bacteria	4717
2266	Ga0501034_0047606	3300049571	Bacteria	4329
2267	Ga0501034_0059579	3300049571	Bacteria	3834
2268	Ga0501034_0109493	3300049571	Bacteria	2753
2269	Ga0501034_0123408	3300049571	Bacteria	2576
2270	Ga0501034_0145069	3300049571	Bacteria	2351
2271	Ga0501034_0148511	3300049571	Bacteria	2320
2272	Ga0501034_0196113	3300049571	Bacteria	1979
2273	Ga0501034_0237553	3300049571	Bacteria	1769
2274	Ga0501034_0277854	3300049571	Bacteria	1614
2275	Ga0501036_0020291	3300049572	Bacteria	5582
2276	Ga0501036_0051248	3300049572	Bacteria	3494
2277	Ga0501036_0128310	3300049572	Bacteria	2141
2278	Ga0501036_0133833	3300049572	Bacteria	2092
2279	Ga0501036_0196372	3300049572	Bacteria	1697
2280	Ga0501036_0224345	3300049572	Bacteria	1577
2281	Ga0501036_0230528	3300049572	Bacteria	1554
2282	Ga0501036_0385208	3300049572	Bacteria	1170
2283	Ga0501037_0006356	3300049573	Bacteria	8638
2284	Ga0501037_0013116	3300049573	Bacteria	6110
2285	Ga0501037_0081962	3300049573	Bacteria	2338
2286	Ga0501037_0179841	3300049573	Bacteria	1501
2287	Ga0501037_0334898	3300049573	Bacteria	1046
2288	Ga0501037_0645845	3300049573	Bacteria	707
2289	Ga0501038_0014977	3300049574	Bacteria	7061
2290	Ga0501038_0039430	3300049574	Bacteria	4131
2291	Ga0501038_0057648	3300049574	Bacteria	3334
2292	Ga0501038_0092857	3300049574	Bacteria	2526
2293	Ga0501038_0127188	3300049574	Bacteria	2096
2294	Ga0501038_0140451	3300049574	Bacteria	1976
2295	Ga0501038_0141336	3300049574	Bacteria	1969
2296	Ga0501038_0143517	3300049574	Bacteria	1951
2297	Ga0501039_0014983	3300049575	Bacteria	5930
2298	Ga0501039_0028478	3300049575	Bacteria	4300
2299	Ga0501039_0120905	3300049575	Bacteria	2052
2300	Ga0501039_0122038	3300049575	Bacteria	2042
2301	Ga0501039_0207000	3300049575	Bacteria	1542
2302	Ga0501039_0412417	3300049575	Bacteria	1061
2303	Ga0501040_0035724	3300049576	Bacteria	3371
2304	Ga0501040_0228818	3300049576	Bacteria	1324
2305	Ga0501040_0341704	3300049576	Bacteria	1072
2306	Ga0501040_0922499	3300049576	Bacteria	633
2307	Ga0501041_0018425	3300049577	Bacteria	4160
2308	Ga0501041_0278152	3300049577	Bacteria	1053
2309	Ga0501042_0076869	3300049578	Bacteria	2390
2310	Ga0501042_0134519	3300049578	Bacteria	1782
2311	Ga0501042_0144765	3300049578	Bacteria	1713
2312	Ga0501042_0374558	3300049578	Bacteria	1030
2313	Ga0501043_0008887	3300049579	Bacteria	7907
2314	Ga0501043_0045254	3300049579	Bacteria	3461
2315	Ga0501043_0104923	3300049579	Bacteria	2221
2316	Ga0501043_0111464	3300049579	Bacteria	2148
2317	Ga0501043_0121474	3300049579	Bacteria	2049
2318	Ga0501043_0125801	3300049579	Bacteria	2010
2319	Ga0501043_0184256	3300049579	Bacteria	1626
2320	Ga0501046_0010105	3300049580	Bacteria	8123
2321	Ga0501046_0036014	3300049580	Bacteria	3984
2322	Ga0501046_0038068	3300049580	Bacteria	3862
2323	Ga0501046_0072771	3300049580	Bacteria	2668
2324	Ga0501046_0119975	3300049580	Bacteria	2001
2325	Ga0501046_0521438	3300049580	Bacteria	849
2326	Ga0501047_0039200	3300049581	Bacteria	4583
2327	Ga0501047_0044153	3300049581	Bacteria	4305
2328	Ga0501047_0080066	3300049581	Bacteria	3140
2329	Ga0501047_0143932	3300049581	Bacteria	2261
2330	Ga0501047_0149699	3300049581	Bacteria	2210
2331	Ga0501047_0163219	3300049581	Bacteria	2099
2332	Ga0501047_0165177	3300049581	Bacteria	2084
2333	Ga0501047_0299264	3300049581	Bacteria	1451
2334	Ga0501047_0303853	3300049581	Bacteria	1437
2335	Ga0501047_0335261	3300049581	Bacteria	1351
2336	Ga0501047_0339648	3300049581	Bacteria	1339
2337	Ga0501048_0063859	3300049582	Bacteria	2603
2338	Ga0501048_0139322	3300049582	Bacteria	1715
2339	Ga0501048_0428698	3300049582	Bacteria	946
2340	Ga0501048_0546356	3300049582	Bacteria	831
2341	Ga0501067_0528318	3300049583	Bacteria	660
2342	Ga0501068_0030728	3300049584	Bacteria	3188
2343	Ga0501068_0049231	3300049584	Bacteria	2544
2344	Ga0501068_0099865	3300049584	Bacteria	1798
2345	Ga0501069_0027832	3300049585	Bacteria	3098
2346	Ga0501069_0116466	3300049585	Bacteria	1524
2347	Ga0501069_0152109	3300049585	Bacteria	1330
2348	Ga0501070_0017521	3300049586	Bacteria	6013
2349	Ga0501070_0048294	3300049586	Bacteria	3536
2350	Ga0501070_0051635	3300049586	Bacteria	3413
2351	Ga0501070_0054465	3300049586	Bacteria	3317
2352	Ga0501070_0064217	3300049586	Bacteria	3040
2353	Ga0501070_0095941	3300049586	Bacteria	2453
2354	Ga0501070_0103503	3300049586	Bacteria	2354
2355	Ga0501070_0112448	3300049586	Bacteria	2250
2356	Ga0501070_0129103	3300049586	Bacteria	2088
2357	Ga0501070_0212755	3300049586	Bacteria	1586
2358	Ga0501070_0271828	3300049586	Bacteria	1384
2359	Ga0501070_0353415	3300049586	Bacteria	1192
2360	Ga0501071_0030849	3300049587	Bacteria	3794
2361	Ga0501071_0042884	3300049587	Bacteria	3242
2362	Ga0501071_0178158	3300049587	Bacteria	1592
2363	Ga0501071_0388740	3300049587	Bacteria	1064
2364	Ga0501072_0007608	3300049588	Bacteria	8221
2365	Ga0501072_0042355	3300049588	Bacteria	3576
2366	Ga0501072_0120481	3300049588	Bacteria	2090
2367	Ga0501072_0567224	3300049588	Bacteria	896
2368	Ga0501073_0010722	3300049589	Bacteria	6711
2369	Ga0501073_0020538	3300049589	Bacteria	4762
2370	Ga0501073_0021358	3300049589	Bacteria	4666
2371	Ga0501073_0049711	3300049589	Bacteria	2939
2372	Ga0501073_0084863	3300049589	Bacteria	2203
2373	Ga0501073_0150764	3300049589	Bacteria	1611
2374	Ga0501073_0188527	3300049589	Bacteria	1427
2375	Ga0501073_0190431	3300049589	Bacteria	1419
2376	Ga0501073_0199365	3300049589	Bacteria	1384
2377	Ga0501074_0013772	3300049590	Bacteria	5881
2378	Ga0501074_0074605	3300049590	Bacteria	2435
2379	Ga0501074_0080568	3300049590	Bacteria	2335
2380	Ga0501074_0089893	3300049590	Bacteria	2199
2381	Ga0501074_0114744	3300049590	Bacteria	1927
2382	Ga0501074_0150893	3300049590	Bacteria	1661
2383	Ga0501074_0279814	3300049590	Bacteria	1186
2384	Ga0501075_0305426	3300049591	Bacteria	1212
2385	Ga0501075_0326095	3300049591	Bacteria	1170
2386	Ga0501076_0011906	3300049592	Bacteria	6495
2387	Ga0501076_0065058	3300049592	Bacteria	2907
2388	Ga0501077_0144063	3300049593	Bacteria	1511
2389	Ga0501077_0257097	3300049593	Bacteria	1111
2390	Ga0501077_0320265	3300049593	Bacteria	989
2391	Ga0501217_033887	3300049661	Bacteria	1271
2392	Ga0501223_010780	3300049663	Bacteria	1836
2393	Ga0501239_003389	3300049672	Bacteria	1513
2394	Ga0501250_036292	3300049680	Bacteria	706
2395	Ga0501257_024610	3300049686	Bacteria	1430
2396	Ga0501225_0018260	3300049705	Bacteria	1945
2397	Ga0501225_0021180	3300049705	Bacteria	1796
2398	Ga0501225_0074914	3300049705	Bacteria	966
2399	Ga0501079_0005576	3300049741	Bacteria	9392
2400	Ga0501079_0258328	3300049741	Bacteria	1361
2401	Ga0501079_0460270	3300049741	Bacteria	999
2402	Ga0501080_0016783	3300049742	Bacteria	6762
2403	Ga0501080_0016830	3300049742	Bacteria	6753
2404	Ga0501080_0022374	3300049742	Bacteria	5856
2405	Ga0501080_0030593	3300049742	Bacteria	5017
2406	Ga0501080_0069868	3300049742	Bacteria	3266
2407	Ga0501080_0076026	3300049742	Bacteria	3123
2408	Ga0501080_0106738	3300049742	Bacteria	2595
2409	Ga0501080_0132487	3300049742	Bacteria	2307
2410	Ga0501080_0147329	3300049742	Bacteria	2176
2411	Ga0501080_0288173	3300049742	Bacteria	1491
2412	Ga0501080_0298124	3300049742	Bacteria	1462
2413	Ga0501080_0941689	3300049742	Bacteria	751
2414	Ga0501080_1187078	3300049742	Bacteria	656
2415	Ga0501081_0002211	3300049743	Bacteria	12235
2416	Ga0501081_0550941	3300049743	Bacteria	861
2417	Ga0501083_0001675	3300049744	Bacteria	15126
2418	Ga0501083_0062153	3300049744	Bacteria	2492
2419	Ga0501083_0202569	3300049744	Bacteria	1294
2420	Ga0501263_007535	3300049760	Bacteria	1283
2421	Ga0501268_006952	3300049765	Bacteria	1677
2422	Ga0501275_001031	3300049772	Bacteria	2878
2423	Ga0501035_0000666	3300049822	Bacteria	37861
2424	Ga0501035_0035341	3300049822	Bacteria	4535
2425	Ga0501035_0064465	3300049822	Bacteria	3256
2426	Ga0501035_0075770	3300049822	Bacteria	2975
2427	Ga0501035_0089303	3300049822	Bacteria	2714
2428	Ga0501035_0111035	3300049822	Bacteria	2403
2429	Ga0501035_0186602	3300049822	Bacteria	1784
2430	Ga0501035_0240954	3300049822	Bacteria	1538
2431	Ga0501035_0257419	3300049822	Bacteria	1480
2432	Ga0501035_0387697	3300049822	Bacteria	1164
2433	Ga0501035_0629865	3300049822	Bacteria	871
2434	Ga0501044_0013439	3300049823	Bacteria	8853
2435	Ga0501044_0016454	3300049823	Bacteria	7938
2436	Ga0501044_0051741	3300049823	Bacteria	4234
2437	Ga0501044_0058107	3300049823	Bacteria	3967
2438	Ga0501044_0064287	3300049823	Bacteria	3746
2439	Ga0501044_0088792	3300049823	Bacteria	3120
2440	Ga0501044_0150968	3300049823	Bacteria	2305
2441	Ga0501044_0153637	3300049823	Bacteria	2282
2442	Ga0501044_0163965	3300049823	Bacteria	2197
2443	Ga0501044_0183619	3300049823	Bacteria	2057
2444	Ga0501044_0198994	3300049823	Bacteria	1962
2445	Ga0501044_0211865	3300049823	Bacteria	1891
2446	Ga0501044_0419504	3300049823	Bacteria	1248
2447	Ga0501044_0443840	3300049823	Bacteria	1205
2448	Ga0501045_0055116	3300049824	Bacteria	2907
2449	Ga0501045_0970521	3300049824	Bacteria	623
2450	Ga0501226_018093	3300049853	Bacteria	776
2451	nmdc:mga00v17_105616_c1	3300050491	Bacteria	1782
2452	nmdc:mga00v17_35978_c1	3300050491	Bacteria	2950
2453	nmdc:mga00v17_62772_c1	3300050491	Bacteria	2287
2454	nmdc:mga00v17_7659_c1	3300050491	Bacteria	5777
2455	nmdc:mga00v17_99787_c1	3300050491	Bacteria	1832
2456	nmdc:mga0yw44_2510_c1	3300050492	Bacteria	7858
2457	nmdc:mga0k408_1334_c1	3300050493	Bacteria	9186
2458	nmdc:mga06z11_36378_c1	3300050494	Bacteria	2430
2459	nmdc:mga07m45_9450_c2	3300050496	Bacteria	4712
2460	nmdc:mga05p37_59516_c1	3300050507	Bacteria	4704
2461	nmdc:mga09592_141858_c1	3300050508	Bacteria	2071
2462	nmdc:mga08y16_21884_c1	3300050511	Bacteria	6749
2463	nmdc:mga08y16_28546_c1	3300050511	Bacteria	5882
2464	nmdc:mga0n895_266646_c1	3300050512	Bacteria	1737
2465	nmdc:mga0n895_8228_c1	3300050512	Bacteria	9018
2466	nmdc:mga0rr50_13871_c1	3300050513	Bacteria	5265
2467	nmdc:mga0a205_40273_c1	3300050515	Bacteria	4498
2468	nmdc:mga0a205_43446_c1	3300050515	Bacteria	4333
2469	nmdc:mga0sz30_349177_c1	3300050516	Bacteria	661
2470	nmdc:mga0sz30_51591_c1	3300050516	Bacteria	1745
2471	nmdc:mga0sz30_76529_c1	3300050516	Bacteria	1445
2472	Ga0500610_0002648	3300053079	Bacteria	6663
2473	Ga0495619_0701957	3300053085	Bacteria	688
2474	Ga0500643_000120	3300053087	Bacteria	81701
2475	Ga0500643_002146	3300053087	Bacteria	10444
2476	Ga0500644_0047346	3300053088	Bacteria	1458
2477	Ga0500646_0054425	3300053090	Bacteria	1162
2478	Ga0500583_0199033	3300053092	Bacteria	996
2479	Ga0500651_0012159	3300053093	Bacteria	5210
2480	Ga0500651_0033599	3300053093	Bacteria	3233
2481	Ga0500651_0053199	3300053093	Bacteria	2539
2482	Ga0500651_0521493	3300053093	Bacteria	653
2483	Ga0500641_0004514	3300053096	Bacteria	4919
2484	Ga0500650_0000177	3300053098	Bacteria	15840
2485	Ga0500654_117462	3300053099	Bacteria	1062
2486	Ga0500660_049143	3300053100	Bacteria	2098
2487	Ga0500555_000588	3300053103	Bacteria	14269
2488	Ga0500562_017519	3300053108	Bacteria	1848
2489	Ga0500569_048636	3300053109	Bacteria	1271
2490	Ga0500597_212750	3300053120	Bacteria	807
2491	Ga0500614_076561	3300053123	Bacteria	929
2492	Ga0500621_000030	3300053126	Bacteria	36497
2493	Ga0500652_043219	3300053131	Bacteria	1821
2494	Ga0500652_143974	3300053131	Bacteria	991
2495	Ga0500564_155134	3300053138	Bacteria	973
2496	Ga0500568_0004215	3300053139	Bacteria	7741
2497	Ga0500568_0129740	3300053139	Bacteria	938
2498	Ga0500573_0283456	3300053140	Bacteria	837
2499	Ga0500622_0161160	3300053156	Bacteria	1051
2500	Ga0500633_0082098	3300053160	Bacteria	1168
2501	Ga0500634_0005374	3300053161	Bacteria	6070
2502	Ga0500645_023864	3300053730	Bacteria	1873
2503	Ga0501084_0073082	3300054114	Bacteria	2872
2504	Ga0501084_0096520	3300054114	Bacteria	2482
2505	Ga0501084_0672808	3300054114	Bacteria	873
2506	Ga0500661_002897	3300055283	Bacteria	3232
2507	Ga0500661_002959	3300055283	Bacteria	3198
2508	Ga0590071_053210	3300059421	Bacteria	983
2509	Ga0587073_0015864	3300059492	Bacteria	1365
2510	Ga0587080_009044	3300059503	Bacteria	1440
2511	Ga0587082_000039	3300059504	Bacteria	6254
2512	Ga0587083_0008920	3300059505	Bacteria	1584
2513	Ga0587088_009978	3300059508	Bacteria	1380
2514	Ga0587106_001841	3300059605	Bacteria	1973
2515	Ga0587067_007681	3300059640	Bacteria	1550
2516	Ga0587072_010478	3300059643	Bacteria	1499
2517	Ga0587075_003266	3300059644	Bacteria	1792
2518	Ga0587120_002042	3300059659	Bacteria	1335
2519	Ga0587111_0109862	3300060346	Bacteria	697
2520	Ga0501082_0003821	3300060353	Bacteria	13165
2521	Ga0501082_0049831	3300060353	Bacteria	3611
2522	Ga0501082_0212553	3300060353	Bacteria	1682
2523	Ga0501082_0264134	3300060353	Bacteria	1497
2524	Ga0501082_0359399	3300060353	Bacteria	1270
2525	Ga0466962_0001755	3300061719	Bacteria	10201
2526	Ga0466962_0068664	3300061719	Bacteria	1692
2527	Ga0466962_0081616	3300061719	Bacteria	1546

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300028577	Ga0265318_10194762	Ga0265318_101947622	150
2	3300031548	Ga0307408_100554162	Ga0307408_1005541622	154
3	3300031903	Ga0307407_11129268	Ga0307407_111292681	154
4	3300003771	Ga0055526_1010904	Ga0055526_10109044	158
5	3300003773	Ga0055537_1003514	Ga0055537_10035146	158
6	3300003775	Ga0055524_1024356	Ga0055524_10243563	158
7	3300003784	Ga0055534_1003658	Ga0055534_10036583	158
8	3300003790	Ga0055528_1007487	Ga0055528_10074874	158
9	3300005347	Ga0070668_100490866	Ga0070668_1004908661	158
10	3300005548	Ga0070665_100076166	Ga0070665_1000761663	158
11	3300013102	Ga0157371_10177262	Ga0157371_101772622	158
12	3300015261	Ga0182006_1009176	Ga0182006_10091766	158
13	3300025263	Ga0209565_1000870	Ga0209565_100087011	158
14	3300025273	Ga0209673_1000204	Ga0209673_10002044	158
15	3300025291	Ga0209675_1000015	Ga0209675_100001545	158
16	3300025295	Ga0209564_1000037	Ga0209564_1000037323	158
17	3300025299	Ga0209256_1007679	Ga0209256_10076792	158
18	3300028379	Ga0268266_10037806	Ga0268266_100378064	158
19	3300042006	Ga0439432_107650	Ga0439432_107650_75_635	158
20	3300048920	Ga0496117_0127689	Ga0496117_0127689_22_582	158
21	3300048921	Ga0496118_0102017	Ga0496118_0102017_610_1170	158
22	3300003794	Ga0055531_10013410	Ga0055531_100134105	160
23	3300006038	Ga0075365_10020475	Ga0075365_100204754	160
24	3300013100	Ga0157373_10082010	Ga0157373_100820103	160
25	3300014497	Ga0182008_10051843	Ga0182008_100518433	160
26	3300017792	Ga0163161_10083297	Ga0163161_100832973	160
27	3300046460	Ga0495638_0115329	Ga0495638_0115329_538_1098	160
28	3300046522	Ga0495643_0049333	Ga0495643_0049333_763_1323	160
29	3300046660	Ga0495625_0033113	Ga0495625_0033113_2513_3073	160
30	3300047320	Ga0495672_0006232	Ga0495672_0006232_1074_1634	160
31	3300047472	Ga0495686_0072058	Ga0495686_0072058_957_1517	160
32	3300048925	Ga0496122_0131324	Ga0496122_0131324_778_1338	160
33	3300048926	Ga0496123_0063598	Ga0496123_0063598_1170_1730	160
34	3300048928	Ga0496125_0089642	Ga0496125_0089642_746_1306	160
35	3300049853	Ga0501226_018093	Ga0501226_018093_264_758	164
36	3300009551	Ga0105238_10306250	Ga0105238_103062504	171
37	3300009553	Ga0105249_10005629	Ga0105249_100056294	171
38	3300037312	Ga0395899_0266863	Ga0395899_0266863_609_1151	171
39	3300037466	Ga0395898_0394424	Ga0395898_0394424_753_1295	171
40	3300041444	Ga0451790_19849	Ga0451790_19849_17_559	171
41	3300045049	Ga0466959_0939283	Ga0466959_0939283_15_557	171
42	3300046471	Ga0495650_0104958	Ga0495650_0104958_498_1040	171
43	3300046507	Ga0495606_0059204	Ga0495606_0059204_893_1435	171
44	3300048905	Ga0496102_0509062	Ga0496102_0509062_19_561	171
45	3300048921	Ga0496118_0065967	Ga0496118_0065967_1491_2033	171
46	iso_pu_bacteria	2547132130	2547502366	172
47	iso_pu_bacteria	2576861471	2578459536	172
48	iso_pu_bacteria	2643221579	2643906485	172
49	iso_pu_bacteria	2643221581	2643916678	172
50	iso_pu_bacteria	2747842428	2747951346	172
51	iso_pu_bacteria	2747842501	2748019961	172
52	iso_pu_bacteria	2765235840	2765577770	172
53	iso_pu_bacteria	2816332141	2816519976	172
54	iso_pu_bacteria	2818991457	2819659592	172
55	iso_pu_bacteria	2842391507	2842395677	172
56	iso_pu_bacteria	2842757796	2842759726	172
57	iso_pu_bacteria	2842780639	2842781662	172
58	iso_pu_bacteria	2852649853	2852653087	172
59	iso_pu_bacteria	2852684882	2852689575	172
60	iso_pu_bacteria	2857442823	2857445071	172
61	iso_pu_bacteria	2874220319	2874220375	172
62	iso_pu_bacteria	2895498888	2895501312	172
63	iso_pu_bacteria	2895511927	2895514455	172
64	iso_pu_bacteria	2895522137	2895524063	172
65	iso_pu_bacteria	2895525241	2895527551	172
66	iso_pu_bacteria	2919089067	2919091645	172
67	iso_pu_bacteria	2919130084	2919134552	172
68	iso_pu_bacteria	2919134579	2919134948	172
69	iso_pu_bacteria	2923516293	2923519241	172
70	iso_pu_bacteria	2928496128	2928498465	172
71	iso_pu_bacteria	2929195423	2929198931	172
72	iso_pu_bacteria	2931380184	2931381968	172
73	iso_pu_bacteria	2937610967	2937611266	172
74	iso_pu_bacteria	2939589442	2939591846	172
75	iso_pu_bacteria	2939622612	2939626777	172
76	iso_pu_bacteria	2939626828	2939631143	172
77	iso_pu_bacteria	2941475908	2941477291	172
78	iso_pu_bacteria	2961047084	2961047140	172
79	iso_pu_bacteria	2961064222	2961068510	172
80	iso_pu_bacteria	2974307012	2974309989	172
81	iso_pu_bacteria	2977247770	2977250724	172
82	iso_pu_bacteria	2984514374	2984514791	172
83	iso_pu_bacteria	2987605356	2987605634	172
84	iso_pu_bacteria	8002869464	8002871432	172
85	iso_pu_bacteria	8021622325	8021626538	172
86	iso_pu_bacteria	8021626552	8021627110	172
87	iso_pu_bacteria	8021648035	8021650793	172
88	iso_pu_bacteria	2510065053	2510285501	173
89	iso_pu_bacteria	2510065055	2510296083	173
90	iso_pu_bacteria	2510065058	2510313650	173
91	iso_pu_bacteria	2524614729	2525558538	173
92	iso_pu_bacteria	2537561836	2538835205	173
93	iso_pu_bacteria	2554235341	2555672491	173
94	iso_pu_bacteria	2593339238	2595449326	173
95	iso_pu_bacteria	2593339239	2595453040	173
96	iso_pu_bacteria	2599185155	2599329219	173
97	iso_pu_bacteria	2599185188	2599505428	173
98	iso_pu_bacteria	2599185248	2599773777	173
99	iso_pu_bacteria	2599185257	2599807282	173
100	iso_pu_bacteria	2599185289	2599890119	173
101	iso_pu_bacteria	2599185291	2599902013	173
102	iso_pu_bacteria	2599185302	2599946432	173
103	iso_pu_bacteria	2599185304	2599957743	173
104	iso_pu_bacteria	2599185305	2599963834	173
105	iso_pu_bacteria	2599185306	2599969885	173
106	iso_pu_bacteria	2599185307	2599973981	173
107	iso_pu_bacteria	2599185308	2599981442	173
108	iso_pu_bacteria	2599185309	2599986964	173
109	iso_pu_bacteria	2599185310	2599992325	173
110	iso_pu_bacteria	2599185313	2600009344	173
111	iso_pu_bacteria	2599185314	2600015262	173
112	iso_pu_bacteria	2599185315	2600021546	173
113	iso_pu_bacteria	2599185320	2600050675	173
114	iso_pu_bacteria	2599185321	2600056706	173
115	iso_pu_bacteria	2599185324	2600074773	173
116	iso_pu_bacteria	2599185356	2600211698	173
117	iso_pu_bacteria	2600255283	2601628578	173
118	iso_pu_bacteria	2600255296	2601693756	173
119	iso_pu_bacteria	2600255313	2601771876	173
120	iso_pu_bacteria	2627854209	2630650598	173
121	iso_pu_bacteria	2643221562	2643829752	173
122	iso_pu_bacteria	2643221577	2643897033	173
123	iso_pu_bacteria	2643221685	2644477393	173
124	iso_pu_bacteria	2667528170	2671094258	173
125	iso_pu_bacteria	2671180172	2671773156	173
126	iso_pu_bacteria	2687453130	2687584053	173
127	iso_pu_bacteria	2718218334	2721028636	173
128	iso_pu_bacteria	2734482264	2735835772	173
129	iso_pu_bacteria	2738541271	2738690931	173
130	iso_pu_bacteria	2738543009	2739227022	173
131	iso_pu_bacteria	2738543016	2739266932	173
132	iso_pu_bacteria	2739367700	2739732136	173
133	iso_pu_bacteria	2773857672	2774129638	173
134	iso_pu_bacteria	2773857673	2774138576	173
135	iso_pu_bacteria	2784132063	2784262151	173
136	iso_pu_bacteria	2791355520	2794598514	173
137	iso_pu_bacteria	2818991440	2819566661	173
138	iso_pu_bacteria	2818991456	2819659377	173
139	iso_pu_bacteria	2818991464	2819706256	173
140	iso_pu_bacteria	2842815866	2842819768	173
141	iso_pu_bacteria	2842914999	2842918788	173
142	iso_pu_bacteria	2842918807	2842922219	173
143	iso_pu_bacteria	2884338543	2884339551	173
144	iso_pu_bacteria	2884411467	2884415071	173
145	iso_pu_bacteria	2895395659	2895396643	173
146	iso_pu_bacteria	2904463128	2904467340	173
147	iso_pu_bacteria	2908446538	2908452242	173
148	iso_pu_bacteria	2919085039	2919086812	173
149	iso_pu_bacteria	2919404418	2919408218	173
150	iso_pu_bacteria	2928963466	2928968091	173
151	iso_pu_bacteria	2939611941	2939612745	173
152	iso_pu_bacteria	2941471342	2941473863	173
153	iso_pu_bacteria	2953994433	2953997337	173
154	iso_pu_bacteria	2974298342	2974301961	173
155	iso_pu_bacteria	2984499530	2984500471	173
156	iso_pu_bacteria	2984504281	2984506985	173
157	iso_pu_bacteria	3007419365	3007425385	173
158	iso_pu_bacteria	3007872151	3007873883	173
159	iso_pu_bacteria	637000220	637322929	173
160	iso_pu_bacteria	640427133	640486729	173
161	iso_pu_bacteria	8002745576	8002747950	173
162	iso_pu_bacteria	8011350971	8011355285	173
163	iso_pu_bacteria	8056120720	8056121215	173
164	iso_pu_bacteria	8056569372	8056572118	173
165	3300031249	Ga0265339_10201645	Ga0265339_102016451	175
166	3300031691	Ga0316579_10007898	Ga0316579_100078983	175
167	3300031691	Ga0316579_10022392	Ga0316579_100223925	175
168	3300031727	Ga0316576_10059820	Ga0316576_100598203	175
169	3300031728	Ga0316578_10007292	Ga0316578_100072925	175
170	3300031728	Ga0316578_10011810	Ga0316578_100118104	175
171	3300031733	Ga0316577_10035968	Ga0316577_100359684	175
172	3300032133	Ga0316583_10048311	Ga0316583_100483112	175
173	3300032137	Ga0316585_10175548	Ga0316585_101755481	175
174	3300032168	Ga0316593_10014956	Ga0316593_100149563	175
175	3300033524	Ga0316592_1058814	Ga0316592_10588142	175
176	3300033528	Ga0316588_1080690	Ga0316588_10806902	175
177	3300033541	Ga0316596_1001653	Ga0316596_10016534	175
178	3300033541	Ga0316596_1042726	Ga0316596_10427262	175
179	3300038741	Ga0400488_08236	Ga0400488_08236_1832_2359	175
180	3300038741	Ga0400488_49540	Ga0400488_49540_63_590	175
181	3300039062	Ga0400483_137795	Ga0400483_137795_483_1010	175
182	3300039062	Ga0400483_164417	Ga0400483_164417_361_888	175
183	iso_pu_bacteria	2690315857	2691330517	175
184	iso_pu_bacteria	2894414249	2894416031	175
185	iso_pu_bacteria	2919534386	2919538585	175
186	iso_pu_bacteria	2919688452	2919691896	175
187	iso_pu_bacteria	8054357960	8054358777	175
188	3300002459	JGI24751J29686_10027821	JGI24751J29686_100278211	176
189	3300002773	JGI25152J39213_1001911	JGI25152J39213_10019116	176
190	3300002774	JGI25150J39212_1001072	JGI25150J39212_10010726	176
191	3300003187	JGI25151J46595_10009416	JGI25151J46595_100094166	176
192	3300003215	JGI25153J46596_10003805	JGI25153J46596_100038056	176
193	3300003320	rootH2_10044747	rootH2_100447471	176
194	3300003775	Ga0055524_1022585	Ga0055524_10225852	176
195	3300003781	Ga0055536_1017557	Ga0055536_10175574	176
196	3300003781	Ga0055536_1046619	Ga0055536_10466191	176
197	3300003781	Ga0055536_1055359	Ga0055536_10553591	176
198	3300003781	Ga0055536_1058179	Ga0055536_10581791	176
199	3300003791	Ga0055530_10048920	Ga0055530_100489201	176
200	3300003791	Ga0055530_10049009	Ga0055530_100490092	176
201	3300003792	Ga0055540_1052113	Ga0055540_10521132	176
202	3300003794	Ga0055531_10029643	Ga0055531_100296433	176
203	3300003794	Ga0055531_10066811	Ga0055531_100668111	176
204	3300003794	Ga0055531_10070184	Ga0055531_100701841	176
205	3300003856	Ga0058692_1003260	Ga0058692_10032607	176
206	3300003856	Ga0058692_1003324	Ga0058692_10033248	176
207	3300005289	Ga0065704_10025620	Ga0065704_100256201	176
208	3300005289	Ga0065704_10110729	Ga0065704_101107294	176
209	3300005289	Ga0065704_10127719	Ga0065704_101277192	176
210	3300005289	Ga0065704_10246379	Ga0065704_102463791	176
211	3300005331	Ga0070670_100002056	Ga0070670_1000020564	176
212	3300005331	Ga0070670_100008976	Ga0070670_1000089763	176
213	3300005335	Ga0070666_10067096	Ga0070666_100670964	176
214	3300005353	Ga0070669_100066626	Ga0070669_1000666263	176
215	3300005355	Ga0070671_100158734	Ga0070671_1001587342	176
216	3300005365	Ga0070688_100244767	Ga0070688_1002447671	176
217	3300005367	Ga0070667_100002380	Ga0070667_1000023804	176
218	3300005435	Ga0070714_100213987	Ga0070714_1002139872	176
219	3300005444	Ga0070694_100710971	Ga0070694_1007109711	176
220	3300005466	Ga0070685_10000930	Ga0070685_1000093011	176
221	3300005466	Ga0070685_10652102	Ga0070685_106521021	176
222	3300005539	Ga0068853_100451385	Ga0068853_1004513852	176
223	3300005548	Ga0070665_100021740	Ga0070665_1000217406	176
224	3300005548	Ga0070665_100230863	Ga0070665_1002308634	176
225	3300005617	Ga0068859_100167169	Ga0068859_1001671694	176
226	3300005618	Ga0068864_100001987	Ga0068864_10000198711	176
227	3300005842	Ga0068858_100408847	Ga0068858_1004088471	176
228	3300005843	Ga0068860_100032658	Ga0068860_1000326586	176
229	3300005844	Ga0068862_100003790	Ga0068862_1000037908	176
230	3300006048	Ga0075363_100057480	Ga0075363_1000574804	176
231	3300006186	Ga0075369_10237558	Ga0075369_102375581	176
232	3300006931	Ga0097620_100167156	Ga0097620_1001671564	176
233	3300006946	Ga0079104_1006960	Ga0079104_10069604	176
234	3300009011	Ga0105251_10009588	Ga0105251_100095884	176
235	3300009011	Ga0105251_10010315	Ga0105251_100103156	176
236	3300009011	Ga0105251_10117201	Ga0105251_101172011	176
237	3300009036	Ga0105244_10090879	Ga0105244_100908793	176
238	3300009148	Ga0105243_10019930	Ga0105243_100199303	176
239	3300009148	Ga0105243_10340821	Ga0105243_103408211	176
240	3300009177	Ga0105248_10287353	Ga0105248_102873534	176
241	3300009553	Ga0105249_10044182	Ga0105249_100441825	176
242	3300013100	Ga0157373_10293836	Ga0157373_102938362	176
243	3300013104	Ga0157370_10109919	Ga0157370_101099194	176
244	3300013105	Ga0157369_10336539	Ga0157369_103365393	176
245	3300014325	Ga0163163_10029107	Ga0163163_100291074	176
246	3300014497	Ga0182008_10024262	Ga0182008_100242624	176
247	3300015261	Ga0182006_1065484	Ga0182006_10654841	176
248	3300015262	Ga0182007_10004689	Ga0182007_100046894	176
249	3300015265	Ga0182005_1002982	Ga0182005_10029824	176
250	3300015265	Ga0182005_1007115	Ga0182005_10071154	176
251	3300020075	Ga0206349_1813039	Ga0206349_18130398	176
252	3300025245	Ga0207425_1000117	Ga0207425_100011754	176
253	3300025258	Ga0209129_1000011	Ga0209129_1000011327	176
254	3300025284	Ga0209130_1011762	Ga0209130_10117622	176
255	3300025292	Ga0209676_1001936	Ga0209676_10019364	176
256	3300025292	Ga0209676_1004715	Ga0209676_10047154	176
257	3300025292	Ga0209676_1004908	Ga0209676_10049086	176
258	3300025294	Ga0209025_1000002	Ga0209025_1000002471	176
259	3300025297	Ga0209758_1000003	Ga0209758_1000003478	176
260	3300025298	Ga0209050_1007102	Ga0209050_10071024	176
261	3300025298	Ga0209050_1008716	Ga0209050_10087166	176
262	3300025299	Ga0209256_1014458	Ga0209256_10144584	176
263	3300025303	Ga0209051_1004652	Ga0209051_10046524	176
264	3300025304	Ga0209257_1002823	Ga0209257_100282311	176
265	3300025304	Ga0209257_1003063	Ga0209257_10030638	176
266	3300025304	Ga0209257_1008039	Ga0209257_10080396	176
267	3300025304	Ga0209257_1026957	Ga0209257_10269573	176
268	3300025728	Ga0207655_1034914	Ga0207655_10349144	176
269	3300025735	Ga0207713_1000294	Ga0207713_100029424	176
270	3300025900	Ga0207710_10280426	Ga0207710_102804261	176
271	3300025903	Ga0207680_10016121	Ga0207680_100161214	176
272	3300025923	Ga0207681_10009533	Ga0207681_100095334	176
273	3300025925	Ga0207650_10000013	Ga0207650_10000013161	176
274	3300025925	Ga0207650_10057733	Ga0207650_100577332	176
275	3300025931	Ga0207644_10009151	Ga0207644_100091513	176
276	3300025935	Ga0207709_10000421	Ga0207709_1000042110	176
277	3300025935	Ga0207709_10041233	Ga0207709_100412334	176
278	3300025941	Ga0207711_10000194	Ga0207711_1000019446	176
279	3300025961	Ga0207712_10657876	Ga0207712_106578762	176
280	3300025972	Ga0207668_10071362	Ga0207668_100713624	176
281	3300025986	Ga0207658_10000005	Ga0207658_10000005162	176
282	3300026035	Ga0207703_10108866	Ga0207703_101088664	176
283	3300026041	Ga0207639_10600512	Ga0207639_106005122	176
284	3300026088	Ga0207641_10013273	Ga0207641_100132734	176
285	3300026095	Ga0207676_10000010	Ga0207676_10000010259	176
286	3300027312	Ga0209371_1001398	Ga0209371_100139811	176
287	3300027312	Ga0209371_1001408	Ga0209371_100140811	176
288	3300028379	Ga0268266_10024424	Ga0268266_100244244	176
289	3300028379	Ga0268266_10640827	Ga0268266_106408272	176
290	3300028380	Ga0268265_10006263	Ga0268265_100062634	176
291	3300028381	Ga0268264_10000036	Ga0268264_10000036359	176
292	3300030500	Ga0268256_1001199	Ga0268256_10011994	176
293	3300030500	Ga0268256_1001205	Ga0268256_10012054	176
294	3300030732	Ga0316176_1126945	Ga0316176_11269454	176
295	3300030733	Ga0314311_1168466	Ga0314311_11684662	176
296	3300031250	Ga0265331_10090087	Ga0265331_100900874	176
297	3300031251	Ga0265327_10002455	Ga0265327_1000245511	176
298	3300032004	Ga0307414_10014078	Ga0307414_100140784	176
299	3300032004	Ga0307414_10110053	Ga0307414_101100532	176
300	3300032004	Ga0307414_10215179	Ga0307414_102151792	176
301	3300032005	Ga0307411_11460413	Ga0307411_114604131	176
302	3300036401	Ga0373937_0265209	Ga0373937_0265209_272_802	176
303	3300038705	Ga0237819_00830	Ga0237819_00830_8211_8768	176
304	3300038705	Ga0237819_11907	Ga0237819_11907_14_574	176
305	3300039145	Ga0237816_00118	Ga0237816_00118_1838_2395	176
306	3300041452	Ga0451793_0845108	Ga0451793_0845108_516_1073	176
307	3300041453	Ga0451797_0405083	Ga0451797_0405083_291_848	176
308	3300041459	Ga0451800_0124581	Ga0451800_0124581_4656_5213	176
309	3300041462	Ga0451806_385064	Ga0451806_385064_7733_8290	176
310	3300041463	Ga0451804_1083353	Ga0451804_1083353_3317_3874	176
311	3300041486	Ga0451807_1348637	Ga0451807_1348637_519_1076	176
312	3300041509	Ga0451843_1712711	Ga0451843_1712711_42_599	176
313	3300041997	Ga0439431_0008078	Ga0439431_0008078_64_621	176
314	3300042014	Ga0439457_017979	Ga0439457_017979_809_1366	176
315	3300042533	Ga0450901_009798	Ga0450901_009798_47_610	176
316	3300046453	Ga0495627_041872	Ga0495627_041872_570_1130	176
317	3300046460	Ga0495638_0032034	Ga0495638_0032034_1975_2535	176
318	3300046460	Ga0495638_0036071	Ga0495638_0036071_742_1299	176
319	3300046501	Ga0495607_0029812	Ga0495607_0029812_760_1317	176
320	3300046512	Ga0495610_0006443	Ga0495610_0006443_4760_5320	176
321	3300046525	Ga0495663_0002005	Ga0495663_0002005_4657_5214	176
322	3300046558	Ga0495633_0061117	Ga0495633_0061117_849_1412	176
323	3300047472	Ga0495686_0026449	Ga0495686_0026449_3013_3570	176
324	3300048907	Ga0496104_0170927	Ga0496104_0170927_449_1009	176
325	3300048908	Ga0496105_0085886	Ga0496105_0085886_284_844	176
326	3300048919	Ga0496116_0023527	Ga0496116_0023527_316_876	176
327	3300048920	Ga0496117_0017925	Ga0496117_0017925_832_1389	176
328	3300048920	Ga0496117_0022053	Ga0496117_0022053_992_1552	176
329	3300048920	Ga0496117_0112703	Ga0496117_0112703_824_1384	176
330	3300048921	Ga0496118_0046667	Ga0496118_0046667_2054_2611	176
331	3300048921	Ga0496118_0077156	Ga0496118_0077156_730_1290	176
332	3300048921	Ga0496118_0088219	Ga0496118_0088219_763_1323	176
333	3300048922	Ga0496119_0007226	Ga0496119_0007226_7798_8358	176
334	3300048922	Ga0496119_0009096	Ga0496119_0009096_3828_4385	176
335	3300048923	Ga0496120_0000480	Ga0496120_0000480_7074_7634	176
336	3300048923	Ga0496120_0012742	Ga0496120_0012742_4313_4870	176
337	3300048924	Ga0496121_0133799	Ga0496121_0133799_1041_1601	176
338	3300048924	Ga0496121_0144158	Ga0496121_0144158_247_807	176
339	3300048925	Ga0496122_0023046	Ga0496122_0023046_4111_4668	176
340	3300048925	Ga0496122_0077113	Ga0496122_0077113_984_1544	176
341	3300048925	Ga0496122_0110465	Ga0496122_0110465_291_848	176
342	3300048925	Ga0496122_0131870	Ga0496122_0131870_60_620	176
343	3300048926	Ga0496123_0019197	Ga0496123_0019197_842_1399	176
344	3300048926	Ga0496123_0039166	Ga0496123_0039166_1747_2307	176
345	3300048926	Ga0496123_0055210	Ga0496123_0055210_759_1319	176
346	3300048927	Ga0496124_0004447	Ga0496124_0004447_15004_15561	176
347	3300048927	Ga0496124_0023156	Ga0496124_0023156_4279_4836	176
348	3300048927	Ga0496124_0075629	Ga0496124_0075629_1163_1723	176
349	3300048928	Ga0496125_0034308	Ga0496125_0034308_1846_2376	176
350	3300048928	Ga0496125_0267827	Ga0496125_0267827_78_638	176
351	3300048929	Ga0496126_0113174	Ga0496126_0113174_770_1330	176
352	3300049571	Ga0501034_0040480	Ga0501034_0040480_3366_3929	176
353	3300049571	Ga0501034_0237553	Ga0501034_0237553_861_1418	176
354	3300049573	Ga0501037_0013116	Ga0501037_0013116_3267_3830	176
355	3300049574	Ga0501038_0092857	Ga0501038_0092857_1150_1713	176
356	3300049584	Ga0501068_0099865	Ga0501068_0099865_947_1510	176
357	3300049823	Ga0501044_0016454	Ga0501044_0016454_5388_5951	176
358	3300050491	nmdc:mga00v17_7659_c1	nmdc:mga00v17_7659_c1_798_1355	176
359	3300053098	Ga0500650_0000177	Ga0500650_0000177_14607_15137	176
360	3300053099	Ga0500654_117462	Ga0500654_117462_339_872	176
361	3300053138	Ga0500564_155134	Ga0500564_155134_395_925	176
362	3300053161	Ga0500634_0005374	Ga0500634_0005374_793_1350	176
363	3300055283	Ga0500661_002959	Ga0500661_002959_2562_3092	176
364	iso_pu_bacteria	2643221559	2643816190	176
365	iso_pu_bacteria	2643221573	2643882152	176
366	iso_pu_bacteria	2643221586	2643938253	176
367	iso_pu_bacteria	2643221612	2644077790	176
368	iso_pu_bacteria	2643221720	2644660760	176
369	iso_pu_bacteria	2643221727	2644697184	176
370	iso_pu_bacteria	2643221728	2644698651	176
371	iso_pu_bacteria	8003014200	8003015015	176
372	3300001979	JGI24740J21852_10004655	JGI24740J21852_100046554	177
373	3300001979	JGI24740J21852_10008902	JGI24740J21852_100089024	177
374	3300001989	JGI24739J22299_10006945	JGI24739J22299_100069456	177
375	3300001990	JGI24737J22298_10003734	JGI24737J22298_100037343	177
376	3300001990	JGI24737J22298_10015387	JGI24737J22298_100153871	177
377	3300002067	JGI24735J21928_10008251	JGI24735J21928_100082513	177
378	3300002067	JGI24735J21928_10016644	JGI24735J21928_100166443	177
379	3300002067	JGI24735J21928_10030712	JGI24735J21928_100307121	177
380	3300002067	JGI24735J21928_10041111	JGI24735J21928_100411114	177
381	3300002075	JGI24738J21930_10000449	JGI24738J21930_100004497	177
382	3300002705	JGI25156J39149_1004294	JGI25156J39149_10042944	177
383	3300002705	JGI25156J39149_1005056	JGI25156J39149_10050564	177
384	3300002705	JGI25156J39149_1007872	JGI25156J39149_10078723	177
385	3300002705	JGI25156J39149_1010742	JGI25156J39149_10107423	177
386	3300002737	JGI25162J39368_1002601	JGI25162J39368_10026017	177
387	3300002737	JGI25162J39368_1004768	JGI25162J39368_10047684	177
388	3300002737	JGI25162J39368_1012130	JGI25162J39368_10121301	177
389	3300002737	JGI25162J39368_1012422	JGI25162J39368_10124221	177
390	3300002737	JGI25162J39368_1014701	JGI25162J39368_10147011	177
391	3300002737	JGI25162J39368_1014721	JGI25162J39368_10147211	177
392	3300002738	JGI25154J39366_1005468	JGI25154J39366_10054682	177
393	3300002741	JGI25157J39369_1001725	JGI25157J39369_10017257	177
394	3300002741	JGI25157J39369_1002210	JGI25157J39369_10022104	177
395	3300002741	JGI25157J39369_1002553	JGI25157J39369_10025536	177
396	3300002741	JGI25157J39369_1002735	JGI25157J39369_10027355	177
397	3300002741	JGI25157J39369_1002856	JGI25157J39369_10028564	177
398	3300002771	JGI25163J39215_1000473	JGI25163J39215_10004734	177
399	3300002772	JGI25164J39214_1001244	JGI25164J39214_10012443	177
400	3300002772	JGI25164J39214_1003890	JGI25164J39214_10038904	177
401	3300002772	JGI25164J39214_1003977	JGI25164J39214_10039773	177
402	3300002772	JGI25164J39214_1011901	JGI25164J39214_10119011	177
403	3300003187	JGI25151J46595_10025065	JGI25151J46595_100250654	177
404	3300003187	JGI25151J46595_10057280	JGI25151J46595_100572801	177
405	3300003214	JGI25165J46597_1002201	JGI25165J46597_10022014	177
406	3300003214	JGI25165J46597_1002234	JGI25165J46597_10022343	177
407	3300003214	JGI25165J46597_1007590	JGI25165J46597_10075903	177
408	3300003214	JGI25165J46597_1022131	JGI25165J46597_10221311	177
409	3300003320	rootH2_10084819	rootH2_100848193	177
410	3300003479	Ga0006556J51387_1017050	Ga0006556J51387_10170504	177
411	3300003558	Ga0006558J51389_1021279	Ga0006558J51389_10212792	177
412	3300003565	Ga0006560J51390_1020844	Ga0006560J51390_10208442	177
413	3300003565	Ga0006560J51390_1027413	Ga0006560J51390_10274133	177
414	3300003567	Ga0006554J51385_1016964	Ga0006554J51385_10169649	177
415	3300003567	Ga0006554J51385_1022274	Ga0006554J51385_10222745	177
416	3300003578	Ga0006562J51391_1006869	Ga0006562J51391_10068693	177
417	3300003751	Ga0055538_1000620	Ga0055538_10006204	177
418	3300003752	Ga0055539_1002274	Ga0055539_10022743	177
419	3300003756	Ga0055533_1005870	Ga0055533_10058702	177
420	3300003756	Ga0055533_1007101	Ga0055533_10071013	177
421	3300003759	Ga0055525_1000111	Ga0055525_100011150	177
422	3300003760	Ga0055527_1001226	Ga0055527_10012266	177
423	3300003760	Ga0055527_1001685	Ga0055527_10016853	177
424	3300003761	Ga0055535_1003479	Ga0055535_10034794	177
425	3300003761	Ga0055535_1003543	Ga0055535_10035433	177
426	3300003761	Ga0055535_1004845	Ga0055535_10048454	177
427	3300003761	Ga0055535_1005054	Ga0055535_10050543	177
428	3300003761	Ga0055535_1008702	Ga0055535_10087022	177
429	3300003762	Ga0055542_1003332	Ga0055542_10033324	177
430	3300003762	Ga0055542_1003393	Ga0055542_10033933	177
431	3300003762	Ga0055542_1004884	Ga0055542_10048844	177
432	3300003762	Ga0055542_1005157	Ga0055542_10051573	177
433	3300003762	Ga0055542_1020229	Ga0055542_10202291	177
434	3300003762	Ga0055542_1020258	Ga0055542_10202581	177
435	3300003763	Ga0055529_1001509	Ga0055529_10015093	177
436	3300003763	Ga0055529_1001681	Ga0055529_10016816	177
437	3300003763	Ga0055529_1002068	Ga0055529_10020683	177
438	3300003763	Ga0055529_1002387	Ga0055529_10023874	177
439	3300003763	Ga0055529_1005314	Ga0055529_10053143	177
440	3300003771	Ga0055526_1006995	Ga0055526_10069955	177
441	3300003775	Ga0055524_1026194	Ga0055524_10261944	177
442	3300003781	Ga0055536_1020863	Ga0055536_10208632	177
443	3300003784	Ga0055534_1003739	Ga0055534_10037394	177
444	3300003790	Ga0055528_1029307	Ga0055528_10293073	177
445	3300003791	Ga0055530_10017712	Ga0055530_100177123	177
446	3300003791	Ga0055530_10049660	Ga0055530_100496601	177
447	3300003794	Ga0055531_10034025	Ga0055531_100340254	177
448	3300003794	Ga0055531_10040495	Ga0055531_100404951	177
449	3300004801	Ga0058860_10148632	Ga0058860_101486323	177
450	3300005288	Ga0065714_10249790	Ga0065714_102497902	177
451	3300005290	Ga0065712_10147548	Ga0065712_101475483	177
452	3300005293	Ga0065715_10017243	Ga0065715_100172434	177
453	3300005293	Ga0065715_10351885	Ga0065715_103518851	177
454	3300005293	Ga0065715_10430023	Ga0065715_104300231	177
455	3300005293	Ga0065715_10730347	Ga0065715_107303471	177
456	3300005295	Ga0065707_10083054	Ga0065707_100830548	177
457	3300005295	Ga0065707_10191580	Ga0065707_101915803	177
458	3300005295	Ga0065707_10344610	Ga0065707_103446102	177
459	3300005295	Ga0065707_10350046	Ga0065707_103500462	177
460	3300005327	Ga0070658_10167997	Ga0070658_101679974	177
461	3300005327	Ga0070658_10198435	Ga0070658_101984353	177
462	3300005327	Ga0070658_10226964	Ga0070658_102269644	177
463	3300005327	Ga0070658_10676279	Ga0070658_106762792	177
464	3300005328	Ga0070676_10227604	Ga0070676_102276042	177
465	3300005329	Ga0070683_100734928	Ga0070683_1007349282	177
466	3300005331	Ga0070670_100188983	Ga0070670_1001889831	177
467	3300005331	Ga0070670_100266044	Ga0070670_1002660442	177
468	3300005331	Ga0070670_100375744	Ga0070670_1003757442	177
469	3300005334	Ga0068869_100097440	Ga0068869_1000974403	177
470	3300005334	Ga0068869_100301180	Ga0068869_1003011802	177
471	3300005334	Ga0068869_100402925	Ga0068869_1004029251	177
472	3300005334	Ga0068869_100489858	Ga0068869_1004898582	177
473	3300005335	Ga0070666_10001169	Ga0070666_1000116910	177
474	3300005335	Ga0070666_10051339	Ga0070666_100513394	177
475	3300005335	Ga0070666_10455843	Ga0070666_104558432	177
476	3300005336	Ga0070680_100048463	Ga0070680_1000484636	177
477	3300005337	Ga0070682_100014445	Ga0070682_1000144454	177
478	3300005337	Ga0070682_100080685	Ga0070682_1000806852	177
479	3300005337	Ga0070682_100402549	Ga0070682_1004025492	177
480	3300005338	Ga0068868_100052032	Ga0068868_1000520324	177
481	3300005338	Ga0068868_100177267	Ga0068868_1001772672	177
482	3300005338	Ga0068868_101570320	Ga0068868_1015703201	177
483	3300005339	Ga0070660_100188013	Ga0070660_1001880132	177
484	3300005339	Ga0070660_100188410	Ga0070660_1001884101	177
485	3300005339	Ga0070660_100317871	Ga0070660_1003178712	177
486	3300005340	Ga0070689_100204752	Ga0070689_1002047523	177
487	3300005341	Ga0070691_10204507	Ga0070691_102045072	177
488	3300005344	Ga0070661_100045394	Ga0070661_1000453944	177
489	3300005344	Ga0070661_100052083	Ga0070661_1000520834	177
490	3300005344	Ga0070661_100175338	Ga0070661_1001753382	177
491	3300005344	Ga0070661_100184088	Ga0070661_1001840881	177
492	3300005345	Ga0070692_10018374	Ga0070692_100183745	177
493	3300005347	Ga0070668_100063319	Ga0070668_1000633194	177
494	3300005347	Ga0070668_100519519	Ga0070668_1005195192	177
495	3300005347	Ga0070668_100815339	Ga0070668_1008153391	177
496	3300005353	Ga0070669_100498532	Ga0070669_1004985321	177
497	3300005354	Ga0070675_100302771	Ga0070675_1003027712	177
498	3300005354	Ga0070675_100546240	Ga0070675_1005462401	177
499	3300005354	Ga0070675_100583735	Ga0070675_1005837352	177
500	3300005355	Ga0070671_100021176	Ga0070671_1000211763	177
501	3300005355	Ga0070671_100127527	Ga0070671_1001275273	177
502	3300005355	Ga0070671_100248835	Ga0070671_1002488353	177
503	3300005356	Ga0070674_100446585	Ga0070674_1004465852	177
504	3300005364	Ga0070673_100043413	Ga0070673_1000434134	177
505	3300005364	Ga0070673_100202572	Ga0070673_1002025723	177
506	3300005365	Ga0070688_100567264	Ga0070688_1005672641	177
507	3300005365	Ga0070688_100886595	Ga0070688_1008865951	177
508	3300005366	Ga0070659_100200062	Ga0070659_1002000622	177
509	3300005366	Ga0070659_100219028	Ga0070659_1002190282	177
510	3300005366	Ga0070659_100266790	Ga0070659_1002667902	177
511	3300005366	Ga0070659_100286770	Ga0070659_1002867701	177
512	3300005366	Ga0070659_100362179	Ga0070659_1003621792	177
513	3300005367	Ga0070667_100011373	Ga0070667_1000113736	177
514	3300005367	Ga0070667_100072291	Ga0070667_1000722913	177
515	3300005367	Ga0070667_100081185	Ga0070667_1000811854	177
516	3300005367	Ga0070667_100178294	Ga0070667_1001782944	177
517	3300005367	Ga0070667_100321441	Ga0070667_1003214412	177
518	3300005367	Ga0070667_100383731	Ga0070667_1003837312	177
519	3300005434	Ga0070709_10055237	Ga0070709_100552374	177
520	3300005435	Ga0070714_100038020	Ga0070714_1000380206	177
521	3300005435	Ga0070714_100159368	Ga0070714_1001593683	177
522	3300005435	Ga0070714_100472131	Ga0070714_1004721313	177
523	3300005435	Ga0070714_100704157	Ga0070714_1007041572	177
524	3300005436	Ga0070713_100003744	Ga0070713_10000374414	177
525	3300005439	Ga0070711_100062834	Ga0070711_1000628344	177
526	3300005455	Ga0070663_100002269	Ga0070663_1000022697	177
527	3300005455	Ga0070663_100053581	Ga0070663_1000535811	177
528	3300005455	Ga0070663_100090975	Ga0070663_1000909754	177
529	3300005455	Ga0070663_100130411	Ga0070663_1001304111	177
530	3300005455	Ga0070663_100131887	Ga0070663_1001318874	177
531	3300005455	Ga0070663_100158166	Ga0070663_1001581662	177
532	3300005455	Ga0070663_100443663	Ga0070663_1004436631	177
533	3300005456	Ga0070678_100143395	Ga0070678_1001433953	177
534	3300005456	Ga0070678_100148568	Ga0070678_1001485682	177
535	3300005456	Ga0070678_100371529	Ga0070678_1003715292	177
536	3300005457	Ga0070662_100034722	Ga0070662_1000347226	177
537	3300005457	Ga0070662_100294784	Ga0070662_1002947842	177
538	3300005457	Ga0070662_100552810	Ga0070662_1005528101	177
539	3300005457	Ga0070662_100616557	Ga0070662_1006165572	177
540	3300005458	Ga0070681_10041156	Ga0070681_100411566	177
541	3300005458	Ga0070681_10059680	Ga0070681_100596805	177
542	3300005458	Ga0070681_10150090	Ga0070681_101500904	177
543	3300005458	Ga0070681_10492461	Ga0070681_104924612	177
544	3300005459	Ga0068867_100094328	Ga0068867_1000943284	177
545	3300005459	Ga0068867_100236595	Ga0068867_1002365953	177
546	3300005466	Ga0070685_10035183	Ga0070685_100351833	177
547	3300005466	Ga0070685_10101913	Ga0070685_101019132	177
548	3300005466	Ga0070685_10204683	Ga0070685_102046832	177
549	3300005530	Ga0070679_100100994	Ga0070679_1001009943	177
550	3300005530	Ga0070679_100118312	Ga0070679_1001183122	177
551	3300005530	Ga0070679_100481755	Ga0070679_1004817551	177
552	3300005539	Ga0068853_100023357	Ga0068853_1000233576	177
553	3300005539	Ga0068853_100032653	Ga0068853_1000326536	177
554	3300005539	Ga0068853_100046118	Ga0068853_1000461184	177
555	3300005539	Ga0068853_100095799	Ga0068853_1000957993	177
556	3300005539	Ga0068853_100100791	Ga0068853_1001007914	177
557	3300005539	Ga0068853_100122043	Ga0068853_1001220433	177
558	3300005539	Ga0068853_100139057	Ga0068853_1001390573	177
559	3300005539	Ga0068853_100254556	Ga0068853_1002545562	177
560	3300005539	Ga0068853_100392595	Ga0068853_1003925952	177
561	3300005539	Ga0068853_100441891	Ga0068853_1004418912	177
562	3300005543	Ga0070672_100063504	Ga0070672_1000635044	177
563	3300005543	Ga0070672_100264978	Ga0070672_1002649783	177
564	3300005543	Ga0070672_100349269	Ga0070672_1003492691	177
565	3300005544	Ga0070686_100057394	Ga0070686_1000573943	177
566	3300005545	Ga0070695_100027553	Ga0070695_1000275535	177
567	3300005546	Ga0070696_100003490	Ga0070696_1000034904	177
568	3300005546	Ga0070696_100131478	Ga0070696_1001314781	177
569	3300005546	Ga0070696_100470661	Ga0070696_1004706612	177
570	3300005546	Ga0070696_100569398	Ga0070696_1005693981	177
571	3300005547	Ga0070693_100126592	Ga0070693_1001265921	177
572	3300005547	Ga0070693_100243594	Ga0070693_1002435941	177
573	3300005547	Ga0070693_100399515	Ga0070693_1003995151	177
574	3300005548	Ga0070665_100001064	Ga0070665_1000010644	177
575	3300005548	Ga0070665_100012202	Ga0070665_1000122024	177
576	3300005548	Ga0070665_100096622	Ga0070665_1000966224	177
577	3300005548	Ga0070665_100126553	Ga0070665_1001265534	177
578	3300005548	Ga0070665_100148185	Ga0070665_1001481853	177
579	3300005548	Ga0070665_100164706	Ga0070665_1001647063	177
580	3300005549	Ga0070704_100044058	Ga0070704_1000440583	177
581	3300005563	Ga0068855_100047024	Ga0068855_1000470244	177
582	3300005563	Ga0068855_100057294	Ga0068855_1000572944	177
583	3300005563	Ga0068855_100159594	Ga0068855_1001595943	177
584	3300005563	Ga0068855_100240501	Ga0068855_1002405014	177
585	3300005563	Ga0068855_100512338	Ga0068855_1005123382	177
586	3300005563	Ga0068855_100541084	Ga0068855_1005410841	177
587	3300005564	Ga0070664_100746207	Ga0070664_1007462072	177
588	3300005577	Ga0068857_100023166	Ga0068857_1000231667	177
589	3300005577	Ga0068857_100040382	Ga0068857_1000403822	177
590	3300005577	Ga0068857_100057345	Ga0068857_1000573453	177
591	3300005577	Ga0068857_100244841	Ga0068857_1002448412	177
592	3300005577	Ga0068857_100415459	Ga0068857_1004154591	177
593	3300005577	Ga0068857_100428795	Ga0068857_1004287952	177
594	3300005577	Ga0068857_100981168	Ga0068857_1009811681	177
595	3300005578	Ga0068854_100017607	Ga0068854_1000176074	177
596	3300005578	Ga0068854_100035599	Ga0068854_1000355992	177
597	3300005578	Ga0068854_100152285	Ga0068854_1001522852	177
598	3300005578	Ga0068854_101085072	Ga0068854_1010850721	177
599	3300005614	Ga0068856_100009033	Ga0068856_1000090338	177
600	3300005614	Ga0068856_100013801	Ga0068856_1000138014	177
601	3300005614	Ga0068856_100023275	Ga0068856_1000232755	177
602	3300005614	Ga0068856_100166912	Ga0068856_1001669123	177
603	3300005614	Ga0068856_100174010	Ga0068856_1001740103	177
604	3300005616	Ga0068852_100157021	Ga0068852_1001570214	177
605	3300005616	Ga0068852_100255211	Ga0068852_1002552112	177
606	3300005616	Ga0068852_100890913	Ga0068852_1008909132	177
607	3300005617	Ga0068859_100027489	Ga0068859_1000274897	177
608	3300005617	Ga0068859_100151848	Ga0068859_1001518483	177
609	3300005617	Ga0068859_100397714	Ga0068859_1003977142	177
610	3300005618	Ga0068864_100274569	Ga0068864_1002745694	177
611	3300005618	Ga0068864_100921399	Ga0068864_1009213992	177
612	3300005618	Ga0068864_101087020	Ga0068864_1010870202	177
613	3300005719	Ga0068861_100021380	Ga0068861_1000213806	177
614	3300005719	Ga0068861_100570888	Ga0068861_1005708882	177
615	3300005834	Ga0068851_10001271	Ga0068851_100012713	177
616	3300005834	Ga0068851_10384724	Ga0068851_103847241	177
617	3300005841	Ga0068863_100069436	Ga0068863_1000694365	177
618	3300005841	Ga0068863_100079648	Ga0068863_1000796484	177
619	3300005841	Ga0068863_100105745	Ga0068863_1001057452	177
620	3300005841	Ga0068863_100426980	Ga0068863_1004269802	177
621	3300005841	Ga0068863_100717368	Ga0068863_1007173682	177
622	3300005842	Ga0068858_100015598	Ga0068858_1000155984	177
623	3300005842	Ga0068858_100259233	Ga0068858_1002592334	177
624	3300005843	Ga0068860_100032513	Ga0068860_1000325137	177
625	3300005843	Ga0068860_100185021	Ga0068860_1001850214	177
626	3300005843	Ga0068860_100205106	Ga0068860_1002051063	177
627	3300005843	Ga0068860_100442947	Ga0068860_1004429472	177
628	3300005844	Ga0068862_100039869	Ga0068862_10003986910	177
629	3300005844	Ga0068862_100052844	Ga0068862_1000528446	177
630	3300005937	Ga0081455_10064018	Ga0081455_100640182	177
631	3300005983	Ga0081540_1050923	Ga0081540_10509234	177
632	3300006163	Ga0070715_10144561	Ga0070715_101445612	177
633	3300006175	Ga0070712_100061358	Ga0070712_1000613585	177
634	3300006186	Ga0075369_10028350	Ga0075369_100283501	177
635	3300006186	Ga0075369_10071457	Ga0075369_100714572	177
636	3300006237	Ga0097621_100358482	Ga0097621_1003584822	177
637	3300006353	Ga0075370_10468440	Ga0075370_104684402	177
638	3300006358	Ga0068871_100333337	Ga0068871_1003333372	177
639	3300006358	Ga0068871_100576224	Ga0068871_1005762242	177
640	3300006844	Ga0075428_100138956	Ga0075428_1001389564	177
641	3300006846	Ga0075430_100204054	Ga0075430_1002040543	177
642	3300006846	Ga0075430_100654081	Ga0075430_1006540812	177
643	3300006852	Ga0075433_10115450	Ga0075433_101154503	177
644	3300006852	Ga0075433_10146607	Ga0075433_101466073	177
645	3300006852	Ga0075433_10998246	Ga0075433_109982461	177
646	3300006871	Ga0075434_100083384	Ga0075434_1000833845	177
647	3300006881	Ga0068865_100012803	Ga0068865_1000128036	177
648	3300006881	Ga0068865_100013813	Ga0068865_1000138133	177
649	3300006881	Ga0068865_100014953	Ga0068865_1000149539	177
650	3300006881	Ga0068865_100017096	Ga0068865_1000170966	177
651	3300006881	Ga0068865_100197571	Ga0068865_1001975712	177
652	3300006881	Ga0068865_100807327	Ga0068865_1008073271	177
653	3300006931	Ga0097620_100027493	Ga0097620_1000274934	177
654	3300006931	Ga0097620_100151845	Ga0097620_1001518453	177
655	3300006948	Ga0099826_10177225	Ga0099826_101772251	177
656	3300007076	Ga0075435_100041984	Ga0075435_1000419842	177
657	3300009092	Ga0105250_10147518	Ga0105250_101475181	177
658	3300009093	Ga0105240_10042301	Ga0105240_100423016	177
659	3300009093	Ga0105240_10078766	Ga0105240_100787662	177
660	3300009093	Ga0105240_10279724	Ga0105240_102797241	177
661	3300009093	Ga0105240_10289506	Ga0105240_102895062	177
662	3300009093	Ga0105240_10307210	Ga0105240_103072104	177
663	3300009093	Ga0105240_10393682	Ga0105240_103936822	177
664	3300009093	Ga0105240_10428426	Ga0105240_104284261	177
665	3300009094	Ga0111539_10178536	Ga0111539_101785364	177
666	3300009094	Ga0111539_10728215	Ga0111539_107282152	177
667	3300009098	Ga0105245_10137068	Ga0105245_101370684	177
668	3300009098	Ga0105245_10228703	Ga0105245_102287032	177
669	3300009098	Ga0105245_10418411	Ga0105245_104184112	177
670	3300009098	Ga0105245_11376201	Ga0105245_113762011	177
671	3300009101	Ga0105247_10011423	Ga0105247_100114236	177
672	3300009101	Ga0105247_10035600	Ga0105247_100356004	177
673	3300009101	Ga0105247_10084880	Ga0105247_100848804	177
674	3300009147	Ga0114129_10084300	Ga0114129_100843006	177
675	3300009174	Ga0105241_10031495	Ga0105241_100314954	177
676	3300009174	Ga0105241_10144608	Ga0105241_101446084	177
677	3300009174	Ga0105241_10664504	Ga0105241_106645041	177
678	3300009176	Ga0105242_10300384	Ga0105242_103003842	177
679	3300009176	Ga0105242_10312542	Ga0105242_103125421	177
680	3300009177	Ga0105248_10040911	Ga0105248_100409113	177
681	3300009177	Ga0105248_10113010	Ga0105248_101130103	177
682	3300009177	Ga0105248_10313458	Ga0105248_103134583	177
683	3300009177	Ga0105248_10860633	Ga0105248_108606332	177
684	3300009177	Ga0105248_10961202	Ga0105248_109612022	177
685	3300009545	Ga0105237_10010986	Ga0105237_100109866	177
686	3300009545	Ga0105237_10017002	Ga0105237_100170024	177
687	3300009545	Ga0105237_10154710	Ga0105237_101547104	177
688	3300009545	Ga0105237_10242989	Ga0105237_102429892	177
689	3300009545	Ga0105237_10288930	Ga0105237_102889303	177
690	3300009545	Ga0105237_10381926	Ga0105237_103819264	177
691	3300009545	Ga0105237_10709310	Ga0105237_107093101	177
692	3300009551	Ga0105238_10016109	Ga0105238_100161094	177
693	3300009551	Ga0105238_10076297	Ga0105238_100762974	177
694	3300009551	Ga0105238_10077069	Ga0105238_100770694	177
695	3300009551	Ga0105238_10128695	Ga0105238_101286954	177
696	3300009551	Ga0105238_10160989	Ga0105238_101609893	177
697	3300009551	Ga0105238_10181683	Ga0105238_101816833	177
698	3300009551	Ga0105238_10316103	Ga0105238_103161034	177
699	3300009551	Ga0105238_10332840	Ga0105238_103328403	177
700	3300009553	Ga0105249_10012173	Ga0105249_100121734	177
701	3300009553	Ga0105249_10311248	Ga0105249_103112482	177
702	3300009553	Ga0105249_10386061	Ga0105249_103860613	177
703	3300009553	Ga0105249_10418817	Ga0105249_104188174	177
704	3300009553	Ga0105249_11051662	Ga0105249_110516621	177
705	3300009984	Ga0105029_105252	Ga0105029_1052521	177
706	3300009987	Ga0105030_100855	Ga0105030_1008554	177
707	3300010375	Ga0105239_10012347	Ga0105239_100123474	177
708	3300010375	Ga0105239_10026059	Ga0105239_100260594	177
709	3300010375	Ga0105239_10048383	Ga0105239_100483837	177
710	3300010375	Ga0105239_10059674	Ga0105239_100596745	177
711	3300010375	Ga0105239_10087320	Ga0105239_100873204	177
712	3300010375	Ga0105239_10169014	Ga0105239_101690143	177
713	3300010375	Ga0105239_10247147	Ga0105239_102471472	177
714	3300010375	Ga0105239_10250561	Ga0105239_102505613	177
715	3300010375	Ga0105239_10262506	Ga0105239_102625063	177
716	3300011119	Ga0105246_10250317	Ga0105246_102503173	177
717	3300011119	Ga0105246_10454721	Ga0105246_104547212	177
718	3300012475	Ga0157317_1004393	Ga0157317_10043932	177
719	3300012478	Ga0157328_1001974	Ga0157328_10019741	177
720	3300012485	Ga0157325_1005526	Ga0157325_10055261	177
721	3300012487	Ga0157321_1008427	Ga0157321_10084272	177
722	3300012498	Ga0157345_1014776	Ga0157345_10147761	177
723	3300012500	Ga0157314_1001362	Ga0157314_10013624	177
724	3300012502	Ga0157347_1004212	Ga0157347_10042121	177
725	3300012503	Ga0157313_1002009	Ga0157313_10020092	177
726	3300012505	Ga0157339_1005074	Ga0157339_10050741	177
727	3300012508	Ga0157315_1009651	Ga0157315_10096511	177
728	3300012510	Ga0157316_1003832	Ga0157316_10038323	177
729	3300012512	Ga0157327_1007986	Ga0157327_10079861	177
730	3300013100	Ga0157373_10099071	Ga0157373_100990714	177
731	3300013100	Ga0157373_10213590	Ga0157373_102135902	177
732	3300013100	Ga0157373_10601736	Ga0157373_106017361	177
733	3300013102	Ga0157371_10124643	Ga0157371_101246432	177
734	3300013104	Ga0157370_10016678	Ga0157370_100166784	177
735	3300013104	Ga0157370_10122040	Ga0157370_101220402	177
736	3300013104	Ga0157370_10126028	Ga0157370_101260283	177
737	3300013104	Ga0157370_10164115	Ga0157370_101641152	177
738	3300013104	Ga0157370_10193584	Ga0157370_101935842	177
739	3300013104	Ga0157370_10200189	Ga0157370_102001892	177
740	3300013104	Ga0157370_10218225	Ga0157370_102182254	177
741	3300013104	Ga0157370_10286438	Ga0157370_102864382	177
742	3300013104	Ga0157370_10286749	Ga0157370_102867491	177
743	3300013104	Ga0157370_10337338	Ga0157370_103373382	177
744	3300013105	Ga0157369_10000706	Ga0157369_1000070612	177
745	3300013105	Ga0157369_10003889	Ga0157369_1000388912	177
746	3300013105	Ga0157369_10175623	Ga0157369_101756233	177
747	3300013105	Ga0157369_10221303	Ga0157369_102213033	177
748	3300013296	Ga0157374_10023329	Ga0157374_100233294	177
749	3300013296	Ga0157374_10114207	Ga0157374_101142073	177
750	3300013297	Ga0157378_10909845	Ga0157378_109098452	177
751	3300013297	Ga0157378_11022905	Ga0157378_110229051	177
752	3300013297	Ga0157378_11197745	Ga0157378_111977452	177
753	3300013306	Ga0163162_10003050	Ga0163162_1000305011	177
754	3300013306	Ga0163162_10187030	Ga0163162_101870304	177
755	3300013306	Ga0163162_10246205	Ga0163162_102462052	177
756	3300013306	Ga0163162_10943108	Ga0163162_109431082	177
757	3300013307	Ga0157372_10101589	Ga0157372_101015894	177
758	3300013307	Ga0157372_10149460	Ga0157372_101494603	177
759	3300013307	Ga0157372_10175731	Ga0157372_101757313	177
760	3300013307	Ga0157372_10201867	Ga0157372_102018673	177
761	3300013307	Ga0157372_10271545	Ga0157372_102715454	177
762	3300013307	Ga0157372_10293263	Ga0157372_102932632	177
763	3300013307	Ga0157372_10453768	Ga0157372_104537682	177
764	3300013307	Ga0157372_10607637	Ga0157372_106076371	177
765	3300013308	Ga0157375_10018696	Ga0157375_100186966	177
766	3300013308	Ga0157375_10045772	Ga0157375_100457725	177
767	3300013308	Ga0157375_10079377	Ga0157375_100793773	177
768	3300013308	Ga0157375_10168391	Ga0157375_101683914	177
769	3300013308	Ga0157375_10191124	Ga0157375_101911243	177
770	3300013308	Ga0157375_10643157	Ga0157375_106431572	177
771	3300013308	Ga0157375_10735097	Ga0157375_107350971	177
772	3300013874	Ga0157514_123279	Ga0157514_1232792	177
773	3300014326	Ga0157380_10014433	Ga0157380_100144336	177
774	3300014326	Ga0157380_10148782	Ga0157380_101487823	177
775	3300014326	Ga0157380_10523508	Ga0157380_105235084	177
776	3300014497	Ga0182008_10014045	Ga0182008_100140454	177
777	3300014497	Ga0182008_10069189	Ga0182008_100691892	177
778	3300014497	Ga0182008_10071291	Ga0182008_100712914	177
779	3300014497	Ga0182008_10079792	Ga0182008_100797923	177
780	3300014497	Ga0182008_10099314	Ga0182008_100993142	177
781	3300014497	Ga0182008_10142436	Ga0182008_101424362	177
782	3300014497	Ga0182008_10324563	Ga0182008_103245632	177
783	3300014968	Ga0157379_10064773	Ga0157379_100647732	177
784	3300014968	Ga0157379_10654827	Ga0157379_106548271	177
785	3300014969	Ga0157376_10009528	Ga0157376_100095286	177
786	3300015261	Ga0182006_1010130	Ga0182006_10101304	177
787	3300015261	Ga0182006_1010843	Ga0182006_10108433	177
788	3300015261	Ga0182006_1041127	Ga0182006_10411273	177
789	3300015261	Ga0182006_1055987	Ga0182006_10559872	177
790	3300015261	Ga0182006_1060508	Ga0182006_10605083	177
791	3300015261	Ga0182006_1072679	Ga0182006_10726792	177
792	3300015262	Ga0182007_10005059	Ga0182007_100050596	177
793	3300015262	Ga0182007_10027874	Ga0182007_100278744	177
794	3300015262	Ga0182007_10078941	Ga0182007_100789411	177
795	3300015262	Ga0182007_10105530	Ga0182007_101055302	177
796	3300015265	Ga0182005_1018834	Ga0182005_10188344	177
797	3300015265	Ga0182005_1034959	Ga0182005_10349592	177
798	3300015685	Ga0183369_1007	Ga0183369_1007139	177
799	3300015687	Ga0183368_1002	Ga0183368_1002408	177
800	3300017792	Ga0163161_10032926	Ga0163161_100329263	177
801	3300017792	Ga0163161_10233639	Ga0163161_102336392	177
802	3300020070	Ga0206356_10099316	Ga0206356_100993165	177
803	3300020076	Ga0206355_1650366	Ga0206355_16503664	177
804	3300020078	Ga0206352_11312937	Ga0206352_113129372	177
805	3300020082	Ga0206353_10742767	Ga0206353_107427671	177
806	3300022467	Ga0224712_10001762	Ga0224712_100017624	177
807	3300025206	Ga0209435_106010	Ga0209435_1060103	177
808	3300025206	Ga0209435_107860	Ga0209435_1078603	177
809	3300025207	Ga0209760_100324	Ga0209760_10032410	177
810	3300025224	Ga0209784_100478	Ga0209784_1004784	177
811	3300025225	Ga0209566_102590	Ga0209566_1025903	177
812	3300025225	Ga0209566_111034	Ga0209566_1110342	177
813	3300025226	Ga0209674_100501	Ga0209674_10050112	177
814	3300025226	Ga0209674_101111	Ga0209674_10111111	177
815	3300025226	Ga0209674_102097	Ga0209674_1020974	177
816	3300025228	Ga0209672_100004	Ga0209672_1000041283	177
817	3300025228	Ga0209672_101424	Ga0209672_1014246	177
818	3300025228	Ga0209672_101755	Ga0209672_1017556	177
819	3300025228	Ga0209672_102547	Ga0209672_1025474	177
820	3300025228	Ga0209672_103266	Ga0209672_1032665	177
821	3300025228	Ga0209672_113603	Ga0209672_1136032	177
822	3300025230	Ga0209563_100103	Ga0209563_10010350	177
823	3300025231	Ga0207427_100687	Ga0207427_1006874	177
824	3300025231	Ga0207427_100946	Ga0207427_1009467	177
825	3300025231	Ga0207427_105874	Ga0207427_1058742	177
826	3300025231	Ga0207427_105979	Ga0207427_1059792	177
827	3300025233	Ga0209437_100193	Ga0209437_100193121	177
828	3300025233	Ga0209437_100721	Ga0209437_10072110	177
829	3300025233	Ga0209437_100741	Ga0209437_10074111	177
830	3300025233	Ga0209437_100750	Ga0209437_1007503	177
831	3300025233	Ga0209437_101275	Ga0209437_1012754	177
832	3300025233	Ga0209437_108123	Ga0209437_1081233	177
833	3300025242	Ga0209258_100003	Ga0209258_1000031283	177
834	3300025242	Ga0209258_100859	Ga0209258_10085911	177
835	3300025242	Ga0209258_100861	Ga0209258_10086111	177
836	3300025242	Ga0209258_101207	Ga0209258_1012074	177
837	3300025242	Ga0209258_101718	Ga0209258_1017184	177
838	3300025242	Ga0209258_102994	Ga0209258_1029944	177
839	3300025242	Ga0209258_114654	Ga0209258_1146541	177
840	3300025245	Ga0207425_1017175	Ga0207425_10171753	177
841	3300025246	Ga0209646_1001352	Ga0209646_10013524	177
842	3300025246	Ga0209646_1010670	Ga0209646_10106701	177
843	3300025246	Ga0209646_1019219	Ga0209646_10192192	177
844	3300025250	Ga0209026_1000274	Ga0209026_100027462	177
845	3300025250	Ga0209026_1000838	Ga0209026_10008384	177
846	3300025250	Ga0209026_1000845	Ga0209026_10008454	177
847	3300025250	Ga0209026_1001800	Ga0209026_10018004	177
848	3300025250	Ga0209026_1002336	Ga0209026_10023366	177
849	3300025253	Ga0209677_101146	Ga0209677_10114613	177
850	3300025254	Ga0209148_1000002	Ga0209148_10000021268	177
851	3300025254	Ga0209148_1000025	Ga0209148_1000025587	177
852	3300025254	Ga0209148_1000083	Ga0209148_1000083258	177
853	3300025254	Ga0209148_1001102	Ga0209148_100110211	177
854	3300025254	Ga0209148_1001106	Ga0209148_100110611	177
855	3300025254	Ga0209148_1001110	Ga0209148_100111011	177
856	3300025254	Ga0209148_1002173	Ga0209148_10021736	177
857	3300025256	Ga0209759_1002083	Ga0209759_10020834	177
858	3300025256	Ga0209759_1002399	Ga0209759_10023994	177
859	3300025256	Ga0209759_1010555	Ga0209759_10105553	177
860	3300025256	Ga0209759_1013965	Ga0209759_10139651	177
861	3300025256	Ga0209759_1021741	Ga0209759_10217413	177
862	3300025258	Ga0209129_1001097	Ga0209129_10010973	177
863	3300025258	Ga0209129_1004985	Ga0209129_10049856	177
864	3300025261	Ga0209233_1000679	Ga0209233_10006794	177
865	3300025261	Ga0209233_1000687	Ga0209233_10006874	177
866	3300025261	Ga0209233_1005629	Ga0209233_10056296	177
867	3300025261	Ga0209233_1017142	Ga0209233_10171422	177
868	3300025261	Ga0209233_1036758	Ga0209233_10367582	177
869	3300025272	Ga0209455_1000004	Ga0209455_10000041283	177
870	3300025272	Ga0209455_1000095	Ga0209455_100009557	177
871	3300025272	Ga0209455_1000860	Ga0209455_10008604	177
872	3300025272	Ga0209455_1000863	Ga0209455_100086311	177
873	3300025272	Ga0209455_1000868	Ga0209455_10008684	177
874	3300025272	Ga0209455_1005012	Ga0209455_10050122	177
875	3300025272	Ga0209455_1006713	Ga0209455_10067134	177
876	3300025273	Ga0209673_1011655	Ga0209673_10116554	177
877	3300025292	Ga0209676_1014712	Ga0209676_10147124	177
878	3300025294	Ga0209025_1014466	Ga0209025_10144664	177
879	3300025294	Ga0209025_1062676	Ga0209025_10626762	177
880	3300025295	Ga0209564_1004754	Ga0209564_10047546	177
881	3300025297	Ga0209758_1030041	Ga0209758_10300414	177
882	3300025297	Ga0209758_1043308	Ga0209758_10433082	177
883	3300025298	Ga0209050_1003984	Ga0209050_10039844	177
884	3300025299	Ga0209256_1005997	Ga0209256_10059976	177
885	3300025299	Ga0209256_1018819	Ga0209256_10188193	177
886	3300025299	Ga0209256_1027904	Ga0209256_10279044	177
887	3300025299	Ga0209256_1067797	Ga0209256_10677971	177
888	3300025302	Ga0207426_1027180	Ga0207426_10271801	177
889	3300025302	Ga0207426_1060758	Ga0207426_10607581	177
890	3300025303	Ga0209051_1002511	Ga0209051_100251120	177
891	3300025303	Ga0209051_1002516	Ga0209051_100251618	177
892	3300025303	Ga0209051_1009299	Ga0209051_100929910	177
893	3300025304	Ga0209257_1002723	Ga0209257_10027234	177
894	3300025315	Ga0207697_10052334	Ga0207697_100523342	177
895	3300025321	Ga0207656_10000850	Ga0207656_100008505	177
896	3300025321	Ga0207656_10004184	Ga0207656_100041847	177
897	3300025321	Ga0207656_10099697	Ga0207656_100996973	177
898	3300025321	Ga0207656_10109546	Ga0207656_101095463	177
899	3300025893	Ga0207682_10050644	Ga0207682_100506443	177
900	3300025893	Ga0207682_10054904	Ga0207682_100549042	177
901	3300025898	Ga0207692_10232465	Ga0207692_102324652	177
902	3300025900	Ga0207710_10023689	Ga0207710_100236893	177
903	3300025900	Ga0207710_10123418	Ga0207710_101234183	177
904	3300025901	Ga0207688_10223531	Ga0207688_102235312	177
905	3300025903	Ga0207680_10000001	Ga0207680_1000000111	177
906	3300025903	Ga0207680_10030396	Ga0207680_100303964	177
907	3300025903	Ga0207680_10203600	Ga0207680_102036002	177
908	3300025904	Ga0207647_10000415	Ga0207647_100004157	177
909	3300025904	Ga0207647_10005116	Ga0207647_100051167	177
910	3300025904	Ga0207647_10031232	Ga0207647_100312323	177
911	3300025904	Ga0207647_10037027	Ga0207647_100370274	177
912	3300025904	Ga0207647_10062187	Ga0207647_100621873	177
913	3300025904	Ga0207647_10063091	Ga0207647_100630913	177
914	3300025906	Ga0207699_10061887	Ga0207699_100618871	177
915	3300025906	Ga0207699_10084216	Ga0207699_100842164	177
916	3300025906	Ga0207699_10487626	Ga0207699_104876262	177
917	3300025907	Ga0207645_10014702	Ga0207645_100147027	177
918	3300025907	Ga0207645_10174948	Ga0207645_101749482	177
919	3300025907	Ga0207645_10429664	Ga0207645_104296641	177
920	3300025907	Ga0207645_10690449	Ga0207645_106904491	177
921	3300025907	Ga0207645_10727060	Ga0207645_107270601	177
922	3300025909	Ga0207705_10003115	Ga0207705_100031157	177
923	3300025909	Ga0207705_10015934	Ga0207705_100159346	177
924	3300025909	Ga0207705_10180112	Ga0207705_101801122	177
925	3300025909	Ga0207705_10197873	Ga0207705_101978733	177
926	3300025909	Ga0207705_11118487	Ga0207705_111184871	177
927	3300025911	Ga0207654_10048044	Ga0207654_100480444	177
928	3300025911	Ga0207654_10107322	Ga0207654_101073222	177
929	3300025911	Ga0207654_10136508	Ga0207654_101365083	177
930	3300025912	Ga0207707_10010749	Ga0207707_100107496	177
931	3300025912	Ga0207707_10204024	Ga0207707_102040242	177
932	3300025912	Ga0207707_10232332	Ga0207707_102323321	177
933	3300025912	Ga0207707_10402109	Ga0207707_104021091	177
934	3300025913	Ga0207695_10000014	Ga0207695_10000014388	177
935	3300025913	Ga0207695_10004669	Ga0207695_100046691	177
936	3300025913	Ga0207695_10021914	Ga0207695_100219144	177
937	3300025913	Ga0207695_10100938	Ga0207695_101009384	177
938	3300025913	Ga0207695_10151054	Ga0207695_101510544	177
939	3300025913	Ga0207695_10211637	Ga0207695_102116373	177
940	3300025913	Ga0207695_10250901	Ga0207695_102509013	177
941	3300025914	Ga0207671_10003150	Ga0207671_1000315012	177
942	3300025914	Ga0207671_10003375	Ga0207671_1000337511	177
943	3300025914	Ga0207671_10006347	Ga0207671_100063477	177
944	3300025914	Ga0207671_10007292	Ga0207671_100072924	177
945	3300025914	Ga0207671_10205759	Ga0207671_102057593	177
946	3300025915	Ga0207693_10093121	Ga0207693_100931214	177
947	3300025915	Ga0207693_10157160	Ga0207693_101571602	177
948	3300025916	Ga0207663_10319571	Ga0207663_103195712	177
949	3300025917	Ga0207660_10185064	Ga0207660_101850641	177
950	3300025917	Ga0207660_10329338	Ga0207660_103293381	177
951	3300025919	Ga0207657_10115495	Ga0207657_101154953	177
952	3300025919	Ga0207657_10186483	Ga0207657_101864832	177
953	3300025919	Ga0207657_10295411	Ga0207657_102954112	177
954	3300025920	Ga0207649_10009101	Ga0207649_100091015	177
955	3300025920	Ga0207649_10023099	Ga0207649_100230991	177
956	3300025920	Ga0207649_10063343	Ga0207649_100633433	177
957	3300025920	Ga0207649_10161015	Ga0207649_101610153	177
958	3300025921	Ga0207652_10143161	Ga0207652_101431611	177
959	3300025921	Ga0207652_10146436	Ga0207652_101464364	177
960	3300025921	Ga0207652_10242459	Ga0207652_102424592	177
961	3300025921	Ga0207652_10834386	Ga0207652_108343862	177
962	3300025923	Ga0207681_10148900	Ga0207681_101489003	177
963	3300025923	Ga0207681_10194832	Ga0207681_101948323	177
964	3300025923	Ga0207681_10313903	Ga0207681_103139031	177
965	3300025923	Ga0207681_10925649	Ga0207681_109256492	177
966	3300025924	Ga0207694_10006898	Ga0207694_100068986	177
967	3300025924	Ga0207694_10047855	Ga0207694_100478554	177
968	3300025924	Ga0207694_10067393	Ga0207694_100673934	177
969	3300025924	Ga0207694_10087203	Ga0207694_100872032	177
970	3300025924	Ga0207694_10091030	Ga0207694_100910302	177
971	3300025924	Ga0207694_10113914	Ga0207694_101139143	177
972	3300025924	Ga0207694_10136809	Ga0207694_101368093	177
973	3300025924	Ga0207694_10207293	Ga0207694_102072934	177
974	3300025924	Ga0207694_10259854	Ga0207694_102598543	177
975	3300025925	Ga0207650_10095156	Ga0207650_100951562	177
976	3300025925	Ga0207650_10104591	Ga0207650_101045911	177
977	3300025925	Ga0207650_10470590	Ga0207650_104705902	177
978	3300025925	Ga0207650_10559308	Ga0207650_105593082	177
979	3300025926	Ga0207659_10238265	Ga0207659_102382652	177
980	3300025926	Ga0207659_10512739	Ga0207659_105127392	177
981	3300025926	Ga0207659_10896486	Ga0207659_108964861	177
982	3300025927	Ga0207687_10178399	Ga0207687_101783991	177
983	3300025927	Ga0207687_10338108	Ga0207687_103381083	177
984	3300025928	Ga0207700_10000259	Ga0207700_1000025921	177
985	3300025928	Ga0207700_10032177	Ga0207700_100321775	177
986	3300025929	Ga0207664_10008018	Ga0207664_100080185	177
987	3300025929	Ga0207664_10050903	Ga0207664_100509034	177
988	3300025929	Ga0207664_10284500	Ga0207664_102845002	177
989	3300025931	Ga0207644_10147703	Ga0207644_101477034	177
990	3300025931	Ga0207644_10214907	Ga0207644_102149073	177
991	3300025932	Ga0207690_10000291	Ga0207690_1000029141	177
992	3300025932	Ga0207690_10005182	Ga0207690_100051824	177
993	3300025932	Ga0207690_10093352	Ga0207690_100933522	177
994	3300025932	Ga0207690_10108190	Ga0207690_101081902	177
995	3300025932	Ga0207690_10302977	Ga0207690_103029773	177
996	3300025933	Ga0207706_10077559	Ga0207706_100775593	177
997	3300025933	Ga0207706_10193027	Ga0207706_101930273	177
998	3300025933	Ga0207706_10534636	Ga0207706_105346362	177
999	3300025933	Ga0207706_10746635	Ga0207706_107466352	177
1000	3300025934	Ga0207686_10011529	Ga0207686_100115292	177
1001	3300025934	Ga0207686_10105080	Ga0207686_101050802	177
1002	3300025934	Ga0207686_10648445	Ga0207686_106484451	177
1003	3300025935	Ga0207709_10575032	Ga0207709_105750322	177
1004	3300025936	Ga0207670_10008314	Ga0207670_100083143	177
1005	3300025936	Ga0207670_10412894	Ga0207670_104128943	177
1006	3300025938	Ga0207704_10006000	Ga0207704_100060003	177
1007	3300025938	Ga0207704_10055985	Ga0207704_100559853	177
1008	3300025938	Ga0207704_10066561	Ga0207704_100665613	177
1009	3300025938	Ga0207704_10078803	Ga0207704_100788034	177
1010	3300025938	Ga0207704_10143254	Ga0207704_101432542	177
1011	3300025938	Ga0207704_10154768	Ga0207704_101547684	177
1012	3300025938	Ga0207704_10273377	Ga0207704_102733772	177
1013	3300025939	Ga0207665_10762751	Ga0207665_107627512	177
1014	3300025940	Ga0207691_10026545	Ga0207691_100265454	177
1015	3300025940	Ga0207691_10036543	Ga0207691_100365434	177
1016	3300025940	Ga0207691_10107510	Ga0207691_101075103	177
1017	3300025940	Ga0207691_10248347	Ga0207691_102483474	177
1018	3300025940	Ga0207691_10400008	Ga0207691_104000082	177
1019	3300025941	Ga0207711_10000272	Ga0207711_100002723	177
1020	3300025941	Ga0207711_10126488	Ga0207711_101264883	177
1021	3300025941	Ga0207711_10155015	Ga0207711_101550152	177
1022	3300025941	Ga0207711_10726105	Ga0207711_107261051	177
1023	3300025942	Ga0207689_10051266	Ga0207689_100512664	177
1024	3300025942	Ga0207689_10118464	Ga0207689_101184643	177
1025	3300025942	Ga0207689_10280620	Ga0207689_102806202	177
1026	3300025944	Ga0207661_10381189	Ga0207661_103811892	177
1027	3300025945	Ga0207679_10438411	Ga0207679_104384112	177
1028	3300025949	Ga0207667_10015014	Ga0207667_100150148	177
1029	3300025949	Ga0207667_10017063	Ga0207667_100170634	177
1030	3300025949	Ga0207667_10028559	Ga0207667_100285596	177
1031	3300025949	Ga0207667_10030766	Ga0207667_100307664	177
1032	3300025949	Ga0207667_10044633	Ga0207667_100446334	177
1033	3300025949	Ga0207667_10045732	Ga0207667_100457323	177
1034	3300025949	Ga0207667_10091753	Ga0207667_100917534	177
1035	3300025960	Ga0207651_10132077	Ga0207651_101320774	177
1036	3300025960	Ga0207651_10252986	Ga0207651_102529863	177
1037	3300025961	Ga0207712_10002516	Ga0207712_100025164	177
1038	3300025961	Ga0207712_10003174	Ga0207712_100031748	177
1039	3300025961	Ga0207712_10073754	Ga0207712_100737543	177
1040	3300025961	Ga0207712_10216860	Ga0207712_102168604	177
1041	3300025961	Ga0207712_10947519	Ga0207712_109475191	177
1042	3300025972	Ga0207668_10276699	Ga0207668_102766994	177
1043	3300025972	Ga0207668_10494095	Ga0207668_104940952	177
1044	3300025972	Ga0207668_10667715	Ga0207668_106677152	177
1045	3300025972	Ga0207668_10688811	Ga0207668_106888112	177
1046	3300025981	Ga0207640_10053170	Ga0207640_100531704	177
1047	3300025981	Ga0207640_10069188	Ga0207640_100691883	177
1048	3300025981	Ga0207640_10070027	Ga0207640_100700273	177
1049	3300025981	Ga0207640_10592375	Ga0207640_105923752	177
1050	3300025986	Ga0207658_10001619	Ga0207658_1000161911	177
1051	3300025986	Ga0207658_10016088	Ga0207658_100160884	177
1052	3300025986	Ga0207658_10103406	Ga0207658_101034063	177
1053	3300025986	Ga0207658_10553842	Ga0207658_105538422	177
1054	3300025986	Ga0207658_10877296	Ga0207658_108772961	177
1055	3300026023	Ga0207677_10031095	Ga0207677_100310954	177
1056	3300026035	Ga0207703_10011233	Ga0207703_100112334	177
1057	3300026035	Ga0207703_10029076	Ga0207703_100290763	177
1058	3300026035	Ga0207703_10751263	Ga0207703_107512631	177
1059	3300026041	Ga0207639_10002641	Ga0207639_100026412	177
1060	3300026041	Ga0207639_10012233	Ga0207639_100122334	177
1061	3300026041	Ga0207639_10015866	Ga0207639_100158666	177
1062	3300026041	Ga0207639_10020753	Ga0207639_100207533	177
1063	3300026041	Ga0207639_10053621	Ga0207639_100536214	177
1064	3300026041	Ga0207639_10055668	Ga0207639_100556683	177
1065	3300026041	Ga0207639_10121637	Ga0207639_101216371	177
1066	3300026041	Ga0207639_10310668	Ga0207639_103106683	177
1067	3300026041	Ga0207639_10319907	Ga0207639_103199071	177
1068	3300026041	Ga0207639_10381313	Ga0207639_103813133	177
1069	3300026041	Ga0207639_10778386	Ga0207639_107783862	177
1070	3300026067	Ga0207678_10006857	Ga0207678_100068577	177
1071	3300026067	Ga0207678_10010932	Ga0207678_100109324	177
1072	3300026067	Ga0207678_10025159	Ga0207678_100251593	177
1073	3300026067	Ga0207678_10222407	Ga0207678_102224073	177
1074	3300026067	Ga0207678_10251266	Ga0207678_102512664	177
1075	3300026067	Ga0207678_10277633	Ga0207678_102776332	177
1076	3300026067	Ga0207678_10297804	Ga0207678_102978044	177
1077	3300026075	Ga0207708_10180198	Ga0207708_101801983	177
1078	3300026075	Ga0207708_10644121	Ga0207708_106441212	177
1079	3300026078	Ga0207702_10000517	Ga0207702_1000051743	177
1080	3300026078	Ga0207702_10002956	Ga0207702_1000295611	177
1081	3300026078	Ga0207702_10045752	Ga0207702_100457528	177
1082	3300026078	Ga0207702_10103762	Ga0207702_101037624	177
1083	3300026078	Ga0207702_10278374	Ga0207702_102783743	177
1084	3300026078	Ga0207702_10315977	Ga0207702_103159773	177
1085	3300026088	Ga0207641_10017580	Ga0207641_100175806	177
1086	3300026088	Ga0207641_10059337	Ga0207641_100593374	177
1087	3300026088	Ga0207641_10222332	Ga0207641_102223322	177
1088	3300026088	Ga0207641_10224348	Ga0207641_102243482	177
1089	3300026088	Ga0207641_10444224	Ga0207641_104442242	177
1090	3300026088	Ga0207641_10787210	Ga0207641_107872102	177
1091	3300026088	Ga0207641_11056005	Ga0207641_110560052	177
1092	3300026089	Ga0207648_10012933	Ga0207648_1001293310	177
1093	3300026089	Ga0207648_10023985	Ga0207648_100239854	177
1094	3300026089	Ga0207648_10208756	Ga0207648_102087563	177
1095	3300026089	Ga0207648_10290104	Ga0207648_102901044	177
1096	3300026095	Ga0207676_10422611	Ga0207676_104226111	177
1097	3300026095	Ga0207676_10727059	Ga0207676_107270592	177
1098	3300026116	Ga0207674_10054588	Ga0207674_100545882	177
1099	3300026116	Ga0207674_10081900	Ga0207674_100819004	177
1100	3300026116	Ga0207674_10097950	Ga0207674_100979503	177
1101	3300026116	Ga0207674_10129551	Ga0207674_101295514	177
1102	3300026116	Ga0207674_10206059	Ga0207674_102060592	177
1103	3300026116	Ga0207674_10330653	Ga0207674_103306532	177
1104	3300026116	Ga0207674_10401363	Ga0207674_104013631	177
1105	3300026118	Ga0207675_100155615	Ga0207675_1001556153	177
1106	3300026121	Ga0207683_10090472	Ga0207683_100904723	177
1107	3300026121	Ga0207683_10178131	Ga0207683_101781313	177
1108	3300026121	Ga0207683_10563683	Ga0207683_105636832	177
1109	3300026142	Ga0207698_10137872	Ga0207698_101378723	177
1110	3300026142	Ga0207698_10398463	Ga0207698_103984632	177
1111	3300027395	Ga0209996_1004121	Ga0209996_10041214	177
1112	3300027471	Ga0209995_1008136	Ga0209995_10081364	177
1113	3300027526	Ga0209968_1013591	Ga0209968_10135912	177
1114	3300027543	Ga0209999_1031359	Ga0209999_10313592	177
1115	3300027717	Ga0209998_10010467	Ga0209998_100104671	177
1116	3300027876	Ga0209974_10043155	Ga0209974_100431552	177
1117	3300027876	Ga0209974_10052961	Ga0209974_100529613	177
1118	3300028379	Ga0268266_10000001	Ga0268266_100000013297	177
1119	3300028379	Ga0268266_10000013	Ga0268266_10000013140	177
1120	3300028379	Ga0268266_10000059	Ga0268266_10000059252	177
1121	3300028379	Ga0268266_10294770	Ga0268266_102947701	177
1122	3300028379	Ga0268266_10376912	Ga0268266_103769123	177
1123	3300028379	Ga0268266_10440217	Ga0268266_104402173	177
1124	3300028380	Ga0268265_10000756	Ga0268265_100007568	177
1125	3300028380	Ga0268265_10228059	Ga0268265_102280592	177
1126	3300028380	Ga0268265_10229747	Ga0268265_102297473	177
1127	3300028380	Ga0268265_10857344	Ga0268265_108573442	177
1128	3300028381	Ga0268264_10011814	Ga0268264_100118149	177
1129	3300028381	Ga0268264_10076078	Ga0268264_100760783	177
1130	3300028381	Ga0268264_10141753	Ga0268264_101417534	177
1131	3300028381	Ga0268264_10153795	Ga0268264_101537953	177
1132	3300028381	Ga0268264_10575193	Ga0268264_105751932	177
1133	3300028794	Ga0307515_10049206	Ga0307515_100492066	177
1134	3300030863	Ga0265766_1000150	Ga0265766_10001504	177
1135	3300030863	Ga0265766_1001148	Ga0265766_10011481	177
1136	3300030888	Ga0265769_103674	Ga0265769_1036742	177
1137	3300031251	Ga0265327_10000005	Ga0265327_100000054	177
1138	3300031507	Ga0307509_10006255	Ga0307509_100062554	177
1139	3300031507	Ga0307509_10036013	Ga0307509_100360134	177
1140	3300031548	Ga0307408_100222383	Ga0307408_1002223832	177
1141	3300031548	Ga0307408_100497609	Ga0307408_1004976092	177
1142	3300031548	Ga0307408_100610180	Ga0307408_1006101801	177
1143	3300031548	Ga0307408_101300448	Ga0307408_1013004481	177
1144	3300031616	Ga0307508_10179392	Ga0307508_101793923	177
1145	3300031616	Ga0307508_10263409	Ga0307508_102634093	177
1146	3300031665	Ga0316575_10014580	Ga0316575_100145808	177
1147	3300031665	Ga0316575_10015707	Ga0316575_100157075	177
1148	3300031665	Ga0316575_10076299	Ga0316575_100762992	177
1149	3300031665	Ga0316575_10077669	Ga0316575_100776692	177
1150	3300031665	Ga0316575_10169998	Ga0316575_101699981	177
1151	3300031691	Ga0316579_10001300	Ga0316579_100013003	177
1152	3300031691	Ga0316579_10079644	Ga0316579_100796444	177
1153	3300031691	Ga0316579_10129777	Ga0316579_101297771	177
1154	3300031691	Ga0316579_10161778	Ga0316579_101617783	177
1155	3300031691	Ga0316579_10166683	Ga0316579_101666831	177
1156	3300031711	Ga0265314_10032324	Ga0265314_100323246	177
1157	3300031727	Ga0316576_10017216	Ga0316576_100172162	177
1158	3300031727	Ga0316576_10019068	Ga0316576_100190683	177
1159	3300031727	Ga0316576_10101422	Ga0316576_101014224	177
1160	3300031727	Ga0316576_10152177	Ga0316576_101521771	177
1161	3300031727	Ga0316576_10168771	Ga0316576_101687714	177
1162	3300031727	Ga0316576_10226863	Ga0316576_102268633	177
1163	3300031727	Ga0316576_10271689	Ga0316576_102716893	177
1164	3300031727	Ga0316576_10708938	Ga0316576_107089381	177
1165	3300031728	Ga0316578_10001601	Ga0316578_100016014	177
1166	3300031728	Ga0316578_10029645	Ga0316578_100296452	177
1167	3300031728	Ga0316578_10054383	Ga0316578_100543833	177
1168	3300031728	Ga0316578_10271848	Ga0316578_102718482	177
1169	3300031730	Ga0307516_10054191	Ga0307516_100541914	177
1170	3300031731	Ga0307405_10247554	Ga0307405_102475542	177
1171	3300031731	Ga0307405_11115196	Ga0307405_111151962	177
1172	3300031733	Ga0316577_10065811	Ga0316577_100658113	177
1173	3300031733	Ga0316577_10076751	Ga0316577_100767513	177
1174	3300031733	Ga0316577_10083989	Ga0316577_100839894	177
1175	3300031733	Ga0316577_10114436	Ga0316577_101144363	177
1176	3300031733	Ga0316577_10173397	Ga0316577_101733971	177
1177	3300031733	Ga0316577_10453647	Ga0316577_104536471	177
1178	3300031824	Ga0307413_10106312	Ga0307413_101063122	177
1179	3300031824	Ga0307413_10108314	Ga0307413_101083142	177
1180	3300031824	Ga0307413_10380753	Ga0307413_103807531	177
1181	3300031852	Ga0307410_10148477	Ga0307410_101484773	177
1182	3300031852	Ga0307410_10312165	Ga0307410_103121654	177
1183	3300031852	Ga0307410_10694432	Ga0307410_106944321	177
1184	3300031901	Ga0307406_10008581	Ga0307406_100085816	177
1185	3300031901	Ga0307406_10113294	Ga0307406_101132944	177
1186	3300031901	Ga0307406_10393883	Ga0307406_103938832	177
1187	3300031903	Ga0307407_10072864	Ga0307407_100728644	177
1188	3300031903	Ga0307407_10102919	Ga0307407_101029192	177
1189	3300031903	Ga0307407_10243144	Ga0307407_102431443	177
1190	3300031903	Ga0307407_10322180	Ga0307407_103221802	177
1191	3300031911	Ga0307412_10001988	Ga0307412_100019887	177
1192	3300031911	Ga0307412_10090449	Ga0307412_100904493	177
1193	3300031911	Ga0307412_10157891	Ga0307412_101578912	177
1194	3300031911	Ga0307412_10243401	Ga0307412_102434012	177
1195	3300031995	Ga0307409_100153225	Ga0307409_1001532253	177
1196	3300031995	Ga0307409_100304833	Ga0307409_1003048331	177
1197	3300031995	Ga0307409_100416125	Ga0307409_1004161253	177
1198	3300032002	Ga0307416_100064961	Ga0307416_1000649615	177
1199	3300032004	Ga0307414_10141938	Ga0307414_101419384	177
1200	3300032004	Ga0307414_11028391	Ga0307414_110283911	177
1201	3300032005	Ga0307411_10146296	Ga0307411_101462964	177
1202	3300032005	Ga0307411_10981484	Ga0307411_109814841	177
1203	3300032126	Ga0307415_100120125	Ga0307415_1001201254	177
1204	3300032126	Ga0307415_100363981	Ga0307415_1003639811	177
1205	3300032133	Ga0316583_10074424	Ga0316583_100744242	177
1206	3300032133	Ga0316583_10207571	Ga0316583_102075711	177
1207	3300032137	Ga0316585_10013640	Ga0316585_100136403	177
1208	3300032137	Ga0316585_10046137	Ga0316585_100461372	177
1209	3300032137	Ga0316585_10058413	Ga0316585_100584131	177
1210	3300032137	Ga0316585_10126227	Ga0316585_101262272	177
1211	3300032139	Ga0316580_10015109	Ga0316580_100151094	177
1212	3300032139	Ga0316580_10024842	Ga0316580_100248424	177
1213	3300032139	Ga0316580_10027299	Ga0316580_100272992	177
1214	3300032139	Ga0316580_10042857	Ga0316580_100428572	177
1215	3300032168	Ga0316593_10000024	Ga0316593_100000244	177
1216	3300032168	Ga0316593_10001034	Ga0316593_100010344	177
1217	3300032168	Ga0316593_10001157	Ga0316593_100011575	177
1218	3300032168	Ga0316593_10002297	Ga0316593_100022974	177
1219	3300032168	Ga0316593_10002966	Ga0316593_100029665	177
1220	3300032168	Ga0316593_10002990	Ga0316593_100029905	177
1221	3300032168	Ga0316593_10003720	Ga0316593_100037205	177
1222	3300032168	Ga0316593_10004334	Ga0316593_100043345	177
1223	3300032168	Ga0316593_10005148	Ga0316593_100051485	177
1224	3300032168	Ga0316593_10012084	Ga0316593_100120844	177
1225	3300032168	Ga0316593_10038631	Ga0316593_100386312	177
1226	3300032168	Ga0316593_10041792	Ga0316593_100417922	177
1227	3300032168	Ga0316593_10043784	Ga0316593_100437841	177
1228	3300032168	Ga0316593_10061898	Ga0316593_100618982	177
1229	3300032168	Ga0316593_10068500	Ga0316593_100685002	177
1230	3300032168	Ga0316593_10086577	Ga0316593_100865772	177
1231	3300032168	Ga0316593_10087355	Ga0316593_100873551	177
1232	3300032168	Ga0316593_10149916	Ga0316593_101499161	177
1233	3300032168	Ga0316593_10160930	Ga0316593_101609301	177
1234	3300032168	Ga0316593_10253377	Ga0316593_102533771	177
1235	3300033180	Ga0307510_10005401	Ga0307510_100054011	177
1236	3300033180	Ga0307510_10389091	Ga0307510_103890911	177
1237	3300033524	Ga0316592_1000481	Ga0316592_10004817	177
1238	3300033524	Ga0316592_1000515	Ga0316592_10005155	177
1239	3300033524	Ga0316592_1011726	Ga0316592_10117261	177
1240	3300033524	Ga0316592_1019510	Ga0316592_10195101	177
1241	3300033524	Ga0316592_1022784	Ga0316592_10227841	177
1242	3300033524	Ga0316592_1035755	Ga0316592_10357551	177
1243	3300033524	Ga0316592_1048809	Ga0316592_10488091	177
1244	3300033524	Ga0316592_1074632	Ga0316592_10746321	177
1245	3300033527	Ga0316586_1002986	Ga0316586_10029863	177
1246	3300033527	Ga0316586_1003851	Ga0316586_10038511	177
1247	3300033527	Ga0316586_1010016	Ga0316586_10100163	177
1248	3300033527	Ga0316586_1019570	Ga0316586_10195701	177
1249	3300033527	Ga0316586_1021762	Ga0316586_10217622	177
1250	3300033528	Ga0316588_1002220	Ga0316588_10022202	177
1251	3300033528	Ga0316588_1006114	Ga0316588_10061143	177
1252	3300033528	Ga0316588_1006441	Ga0316588_10064411	177
1253	3300033528	Ga0316588_1015191	Ga0316588_10151913	177
1254	3300033528	Ga0316588_1023025	Ga0316588_10230252	177
1255	3300033528	Ga0316588_1033838	Ga0316588_10338381	177
1256	3300033528	Ga0316588_1041809	Ga0316588_10418092	177
1257	3300033529	Ga0316587_1000564	Ga0316587_10005643	177
1258	3300033529	Ga0316587_1000671	Ga0316587_10006715	177
1259	3300033529	Ga0316587_1001854	Ga0316587_10018546	177
1260	3300033529	Ga0316587_1002052	Ga0316587_10020523	177
1261	3300033529	Ga0316587_1002654	Ga0316587_10026544	177
1262	3300033529	Ga0316587_1007718	Ga0316587_10077184	177
1263	3300033529	Ga0316587_1016326	Ga0316587_10163261	177
1264	3300033529	Ga0316587_1021285	Ga0316587_10212852	177
1265	3300033529	Ga0316587_1030548	Ga0316587_10305482	177
1266	3300033529	Ga0316587_1043492	Ga0316587_10434921	177
1267	3300033541	Ga0316596_1000175	Ga0316596_10001757	177
1268	3300033541	Ga0316596_1001146	Ga0316596_10011466	177
1269	3300033541	Ga0316596_1010619	Ga0316596_10106193	177
1270	3300033541	Ga0316596_1012435	Ga0316596_10124353	177
1271	3300033541	Ga0316596_1015130	Ga0316596_10151303	177
1272	3300033541	Ga0316596_1015238	Ga0316596_10152383	177
1273	3300033541	Ga0316596_1027787	Ga0316596_10277872	177
1274	3300033541	Ga0316596_1041323	Ga0316596_10413234	177
1275	3300033541	Ga0316596_1043473	Ga0316596_10434733	177
1276	3300033541	Ga0316596_1070647	Ga0316596_10706472	177
1277	3300034819	Ga0373958_0067890	Ga0373958_0067890_153_719	177
1278	3300035117	Ga0373953_0096210	Ga0373953_0096210_572_1132	177
1279	3300035121	Ga0373960_0286195	Ga0373960_0286195_22_582	177
1280	3300035398	Ga0316574_0006051	Ga0316574_0006051_4219_4764	177
1281	3300035398	Ga0316574_0027798	Ga0316574_0027798_604_1137	177
1282	3300035398	Ga0316574_0068312	Ga0316574_0068312_451_984	177
1283	3300035398	Ga0316574_0071266	Ga0316574_0071266_313_849	177
1284	3300035398	Ga0316574_0075434	Ga0316574_0075434_21_554	177
1285	3300035398	Ga0316574_0082950	Ga0316574_0082950_663_1202	177
1286	3300035398	Ga0316574_0135792	Ga0316574_0135792_912_1445	177
1287	3300035398	Ga0316574_0177185	Ga0316574_0177185_614_1147	177
1288	3300035398	Ga0316574_0179454	Ga0316574_0179454_672_1205	177
1289	3300035398	Ga0316574_0243813	Ga0316574_0243813_595_1128	177
1290	3300035398	Ga0316574_0369821	Ga0316574_0369821_225_758	177
1291	3300035398	Ga0316574_0446545	Ga0316574_0446545_51_584	177
1292	3300036401	Ga0373937_0298350	Ga0373937_0298350_445_1005	177
1293	3300036401	Ga0373937_0335030	Ga0373937_0335030_286_846	177
1294	3300036401	Ga0373937_0423109	Ga0373937_0423109_357_917	177
1295	3300036647	Ga0316582_0009358	Ga0316582_0009358_1698_2231	177
1296	3300036647	Ga0316582_0009719	Ga0316582_0009719_490_1029	177
1297	3300036647	Ga0316582_0013406	Ga0316582_0013406_214_747	177
1298	3300036647	Ga0316582_0023843	Ga0316582_0023843_1646_2179	177
1299	3300036647	Ga0316582_0025158	Ga0316582_0025158_54_587	177
1300	3300036647	Ga0316582_0028628	Ga0316582_0028628_2516_3049	177
1301	3300036647	Ga0316582_0054642	Ga0316582_0054642_362_895	177
1302	3300036712	Ga0316584_0046567	Ga0316584_0046567_681_1214	177
1303	3300036712	Ga0316584_0070615	Ga0316584_0070615_1229_1762	177
1304	3300036712	Ga0316584_0176698	Ga0316584_0176698_355_888	177
1305	3300036712	Ga0316584_0261957	Ga0316584_0261957_663_1202	177
1306	3300036712	Ga0316584_0338298	Ga0316584_0338298_417_950	177
1307	3300036712	Ga0316584_0420842	Ga0316584_0420842_398_931	177
1308	3300036712	Ga0316584_0436407	Ga0316584_0436407_86_625	177
1309	3300036712	Ga0316584_0980142	Ga0316584_0980142_13_546	177
1310	3300037068	Ga0373925_0601174	Ga0373925_0601174_213_773	177
1311	3300037312	Ga0395899_0007387	Ga0395899_0007387_1021_1581	177
1312	3300037312	Ga0395899_0110837	Ga0395899_0110837_837_1397	177
1313	3300037312	Ga0395899_0215956	Ga0395899_0215956_50_610	177
1314	3300037418	Ga0395900_0003355	Ga0395900_0003355_15289_15849	177
1315	3300037418	Ga0395900_0114806	Ga0395900_0114806_1358_1918	177
1316	3300037418	Ga0395900_0241323	Ga0395900_0241323_672_1232	177
1317	3300037418	Ga0395900_0262668	Ga0395900_0262668_1104_1664	177
1318	3300037466	Ga0395898_0014952	Ga0395898_0014952_1857_2417	177
1319	3300037466	Ga0395898_0019569	Ga0395898_0019569_5524_6084	177
1320	3300037466	Ga0395898_0033007	Ga0395898_0033007_559_1119	177
1321	3300037466	Ga0395898_0101437	Ga0395898_0101437_846_1406	177
1322	3300037588	Ga0316581_0000596	Ga0316581_0000596_3902_4435	177
1323	3300037588	Ga0316581_0000862	Ga0316581_0000862_4884_5417	177
1324	3300038443	Ga0395901_0003416	Ga0395901_0003416_14606_15166	177
1325	3300038443	Ga0395901_0004750	Ga0395901_0004750_7486_8046	177
1326	3300038443	Ga0395901_1125972	Ga0395901_1125972_40_600	177
1327	3300038725	Ga0400484_08595	Ga0400484_08595_1526_2059	177
1328	3300038726	Ga0400490_14561	Ga0400490_14561_5193_5726	177
1329	3300038727	Ga0400491_13676	Ga0400491_13676_79_612	177
1330	3300039062	Ga0400483_011564	Ga0400483_011564_2385_2918	177
1331	3300039062	Ga0400483_161420	Ga0400483_161420_661_1194	177
1332	3300039062	Ga0400483_209600	Ga0400483_209600_966_1502	177
1333	3300039062	Ga0400483_251466	Ga0400483_251466_620_1153	177
1334	3300039093	Ga0400489_50915	Ga0400489_50915_961_1494	177
1335	3300039437	Ga0436365_1829866	Ga0436365_1829866_94_654	177
1336	3300039438	Ga0436360_0872355	Ga0436360_0872355_1693_2226	177
1337	3300041404	Ga0439436_0000176	Ga0439436_0000176_13863_14423	177
1338	3300041405	Ga0439438_077001	Ga0439438_077001_181_714	177
1339	3300041406	Ga0439439_0014995	Ga0439439_0014995_1166_1699	177
1340	3300041406	Ga0439439_0089716	Ga0439439_0089716_291_824	177
1341	3300041413	Ga0439465_0001430	Ga0439465_0001430_1520_2080	177
1342	3300041443	Ga0451789_0445104	Ga0451789_0445104_311_871	177
1343	3300041451	Ga0451791_0198640	Ga0451791_0198640_408_968	177
1344	3300041452	Ga0451793_0657735	Ga0451793_0657735_746_1306	177
1345	3300041453	Ga0451797_1130154	Ga0451797_1130154_238_798	177
1346	3300041456	Ga0451795_0071692	Ga0451795_0071692_163_723	177
1347	3300041460	Ga0451802_1002675	Ga0451802_1002675_260_820	177
1348	3300041463	Ga0451804_0247020	Ga0451804_0247020_43_603	177
1349	3300041486	Ga0451807_0857467	Ga0451807_0857467_62_622	177
1350	3300041486	Ga0451807_1061879	Ga0451807_1061879_536_1096	177
1351	3300041486	Ga0451807_1583600	Ga0451807_1583600_33_593	177
1352	3300041486	Ga0451807_2605462	Ga0451807_2605462_168_728	177
1353	3300041494	Ga0451837_1433720	Ga0451837_1433720_266_826	177
1354	3300041505	Ga0451849_0670867	Ga0451849_0670867_56_616	177
1355	3300041505	Ga0451849_1419098	Ga0451849_1419098_211_771	177
1356	3300041507	Ga0451851_1022700	Ga0451851_1022700_62_622	177
1357	3300041512	Ga0451853_0923083	Ga0451853_0923083_547_1107	177
1358	3300041512	Ga0451853_1403623	Ga0451853_1403623_629_1189	177
1359	3300041512	Ga0451853_3185635	Ga0451853_3185635_610_1170	177
1360	3300041999	Ga0439433_0017439	Ga0439433_0017439_939_1472	177
1361	3300042000	Ga0439437_008627	Ga0439437_008627_548_1108	177
1362	3300042004	Ga0439445_0084473	Ga0439445_0084473_255_815	177
1363	3300042005	Ga0439448_0009993	Ga0439448_0009993_2138_2698	177
1364	3300042006	Ga0439432_074221	Ga0439432_074221_169_729	177
1365	3300042007	Ga0439449_0023626	Ga0439449_0023626_1035_1604	177
1366	3300042009	Ga0439451_029646	Ga0439451_029646_256_789	177
1367	3300042011	Ga0439454_030238	Ga0439454_030238_198_758	177
1368	3300042115	Ga0450911_020046	Ga0450911_020046_322_855	177
1369	3300042118	Ga0450914_012182	Ga0450914_012182_203_736	177
1370	3300042121	Ga0450919_017688	Ga0450919_017688_249_782	177
1371	3300042122	Ga0450920_000570	Ga0450920_000570_4745_5278	177
1372	3300042123	Ga0450921_002251	Ga0450921_002251_227_760	177
1373	3300042125	Ga0450923_004529	Ga0450923_004529_414_947	177
1374	3300042125	Ga0450923_005010	Ga0450923_005010_323_856	177
1375	3300042127	Ga0450890_009840	Ga0450890_009840_637_1170	177
1376	3300042131	Ga0450894_024168	Ga0450894_024168_97_630	177
1377	3300042132	Ga0450895_001279	Ga0450895_001279_517_1050	177
1378	3300042133	Ga0450896_015197	Ga0450896_015197_146_679	177
1379	3300042134	Ga0450898_015126	Ga0450898_015126_326_859	177
1380	3300042146	Ga0450907_069010	Ga0450907_069010_41_574	177
1381	3300042156	Ga0439446_0008668	Ga0439446_0008668_494_1027	177
1382	3300042156	Ga0439446_0181850	Ga0439446_0181850_96_656	177
1383	3300042184	Ga0450908_003971	Ga0450908_003971_1044_1604	177
1384	3300042184	Ga0450908_016922	Ga0450908_016922_137_670	177
1385	3300042435	Ga0439434_0004071	Ga0439434_0004071_1103_1636	177
1386	3300042436	Ga0439435_0000395	Ga0439435_0000395_623_1156	177
1387	3300042437	Ga0439444_0000762	Ga0439444_0000762_523_1056	177
1388	3300042438	Ga0439459_0000645	Ga0439459_0000645_982_1542	177
1389	3300042461	Ga0439460_0129347	Ga0439460_0129347_235_768	177
1390	3300042531	Ga0450918_019297	Ga0450918_019297_47_580	177
1391	3300042531	Ga0450918_035894	Ga0450918_035894_26_559	177
1392	3300042532	Ga0450893_0030976	Ga0450893_0030976_392_925	177
1393	3300042876	Ga0451577_0022632	Ga0451577_0022632_974_1534	177
1394	3300042876	Ga0451577_0469321	Ga0451577_0469321_564_1097	177
1395	3300044656	Ga0466969_0008630	Ga0466969_0008630_4183_4743	177
1396	3300044656	Ga0466969_0011450	Ga0466969_0011450_3536_4096	177
1397	3300044658	Ga0466972_0002322	Ga0466972_0002322_816_1376	177
1398	3300044672	Ga0466982_0000005	Ga0466982_0000005_117276_117836	177
1399	3300044683	Ga0466965_0075701	Ga0466965_0075701_113_673	177
1400	3300044683	Ga0466965_0131221	Ga0466965_0131221_610_1170	177
1401	3300044684	Ga0466966_0012146	Ga0466966_0012146_4009_4569	177
1402	3300044684	Ga0466966_0094367	Ga0466966_0094367_179_739	177
1403	3300044693	Ga0466961_0024868	Ga0466961_0024868_822_1382	177
1404	3300044693	Ga0466961_0061896	Ga0466961_0061896_985_1545	177
1405	3300044693	Ga0466961_0129964	Ga0466961_0129964_230_790	177
1406	3300044693	Ga0466961_0169876	Ga0466961_0169876_566_1126	177
1407	3300044693	Ga0466961_0179808	Ga0466961_0179808_527_1087	177
1408	3300044712	Ga0453684_0009802	Ga0453684_0009802_6099_6632	177
1409	3300044712	Ga0453684_0010223	Ga0453684_0010223_14739_15299	177
1410	3300044712	Ga0453684_0604364	Ga0453684_0604364_78_638	177
1411	3300044719	Ga0466971_0013305	Ga0466971_0013305_2040_2600	177
1412	3300044719	Ga0466971_0172223	Ga0466971_0172223_233_793	177
1413	3300044735	Ga0466968_0002557	Ga0466968_0002557_5301_5861	177
1414	3300044735	Ga0466968_0014516	Ga0466968_0014516_2011_2571	177
1415	3300044765	Ga0466970_0002634	Ga0466970_0002634_4470_5030	177
1416	3300044765	Ga0466970_0004707	Ga0466970_0004707_813_1373	177
1417	3300044765	Ga0466970_0028368	Ga0466970_0028368_1672_2232	177
1418	3300044765	Ga0466970_0099207	Ga0466970_0099207_137_697	177
1419	3300044765	Ga0466970_0162930	Ga0466970_0162930_298_858	177
1420	3300044842	Ga0466957_0004429	Ga0466957_0004429_836_1396	177
1421	3300044842	Ga0466957_0043782	Ga0466957_0043782_1372_1932	177
1422	3300044901	Ga0466960_0000695	Ga0466960_0000695_8435_8995	177
1423	3300045049	Ga0466959_0016440	Ga0466959_0016440_4006_4566	177
1424	3300045049	Ga0466959_0140574	Ga0466959_0140574_856_1416	177
1425	3300045051	Ga0451576_0000025	Ga0451576_0000025_88253_88813	177
1426	3300045051	Ga0451576_0000741	Ga0451576_0000741_59611_60144	177
1427	3300045836	Ga0466958_0047782	Ga0466958_0047782_1393_1953	177
1428	3300045836	Ga0466958_0131980	Ga0466958_0131980_52_612	177
1429	3300045836	Ga0466958_0187866	Ga0466958_0187866_646_1206	177
1430	3300046452	Ga0495617_001043	Ga0495617_001043_574_1134	177
1431	3300046459	Ga0495629_0386033	Ga0495629_0386033_213_773	177
1432	3300046459	Ga0495629_0664997	Ga0495629_0664997_47_580	177
1433	3300046460	Ga0495638_0005342	Ga0495638_0005342_957_1517	177
1434	3300046460	Ga0495638_0008369	Ga0495638_0008369_6074_6634	177
1435	3300046460	Ga0495638_0060929	Ga0495638_0060929_605_1165	177
1436	3300046460	Ga0495638_0074544	Ga0495638_0074544_829_1389	177
1437	3300046460	Ga0495638_0234740	Ga0495638_0234740_475_1008	177
1438	3300046461	Ga0495641_0095051	Ga0495641_0095051_49_609	177
1439	3300046471	Ga0495650_0002281	Ga0495650_0002281_760_1320	177
1440	3300046471	Ga0495650_0004579	Ga0495650_0004579_8029_8589	177
1441	3300046471	Ga0495650_0010900	Ga0495650_0010900_659_1219	177
1442	3300046474	Ga0495605_0204688	Ga0495605_0204688_78_638	177
1443	3300046475	Ga0495639_0070630	Ga0495639_0070630_784_1344	177
1444	3300046491	Ga0495584_0004077	Ga0495584_0004077_4039_4599	177
1445	3300046492	Ga0495585_0012000	Ga0495585_0012000_3883_4443	177
1446	3300046501	Ga0495607_0005682	Ga0495607_0005682_7007_7567	177
1447	3300046501	Ga0495607_0005957	Ga0495607_0005957_7142_7702	177
1448	3300046501	Ga0495607_0135087	Ga0495607_0135087_308_868	177
1449	3300046506	Ga0495583_0024511	Ga0495583_0024511_542_1102	177
1450	3300046507	Ga0495606_0007685	Ga0495606_0007685_829_1389	177
1451	3300046507	Ga0495606_0034447	Ga0495606_0034447_1112_1672	177
1452	3300046507	Ga0495606_0068032	Ga0495606_0068032_594_1154	177
1453	3300046507	Ga0495606_0076683	Ga0495606_0076683_1259_1819	177
1454	3300046512	Ga0495610_0011002	Ga0495610_0011002_2312_2872	177
1455	3300046512	Ga0495610_0141185	Ga0495610_0141185_51_611	177
1456	3300046513	Ga0495616_0009332	Ga0495616_0009332_671_1231	177
1457	3300046515	Ga0495620_0051692	Ga0495620_0051692_374_934	177
1458	3300046515	Ga0495620_0092182	Ga0495620_0092182_375_935	177
1459	3300046517	Ga0495630_0949807	Ga0495630_0949807_103_636	177
1460	3300046518	Ga0495631_0168164	Ga0495631_0168164_35_595	177
1461	3300046518	Ga0495631_0217188	Ga0495631_0217188_143_703	177
1462	3300046519	Ga0495632_0010665	Ga0495632_0010665_4041_4601	177
1463	3300046519	Ga0495632_0043557	Ga0495632_0043557_1418_1978	177
1464	3300046519	Ga0495632_0135003	Ga0495632_0135003_364_897	177
1465	3300046520	Ga0495637_0027016	Ga0495637_0027016_1485_2045	177
1466	3300046522	Ga0495643_0048987	Ga0495643_0048987_1365_1925	177
1467	3300046524	Ga0495648_0022154	Ga0495648_0022154_1545_2105	177
1468	3300046524	Ga0495648_0062293	Ga0495648_0062293_1587_2147	177
1469	3300046531	Ga0495665_0092743	Ga0495665_0092743_759_1319	177
1470	3300046533	Ga0495640_0480888	Ga0495640_0480888_115_675	177
1471	3300046535	Ga0495586_0297959	Ga0495586_0297959_307_867	177
1472	3300046539	Ga0495621_0137537	Ga0495621_0137537_204_764	177
1473	3300046543	Ga0495645_0052869	Ga0495645_0052869_716_1276	177
1474	3300046616	Ga0495668_0269180	Ga0495668_0269180_352_885	177
1475	3300046648	Ga0495611_0000029	Ga0495611_0000029_82922_83482	177
1476	3300046648	Ga0495611_0100535	Ga0495611_0100535_475_1035	177
1477	3300046660	Ga0495625_0008764	Ga0495625_0008764_671_1231	177
1478	3300046660	Ga0495625_0058812	Ga0495625_0058812_1164_1724	177
1479	3300046660	Ga0495625_0152548	Ga0495625_0152548_371_931	177
1480	3300046660	Ga0495625_0214750	Ga0495625_0214750_162_722	177
1481	3300046663	Ga0495635_0277230	Ga0495635_0277230_441_1001	177
1482	3300046665	Ga0495661_0140949	Ga0495661_0140949_671_1231	177
1483	3300046683	Ga0495658_0084439	Ga0495658_0084439_1053_1613	177
1484	3300046691	Ga0495670_0010181	Ga0495670_0010181_2954_3514	177
1485	3300046691	Ga0495670_0041870	Ga0495670_0041870_361_921	177
1486	3300046692	Ga0495671_0000881	Ga0495671_0000881_18506_19066	177
1487	3300046694	Ga0495649_0018400	Ga0495649_0018400_1546_2106	177
1488	3300046694	Ga0495649_0064648	Ga0495649_0064648_303_863	177
1489	3300046794	Ga0495589_0000144	Ga0495589_0000144_40056_40616	177
1490	3300046810	Ga0495660_0019303	Ga0495660_0019303_2869_3429	177
1491	3300046810	Ga0495660_0022601	Ga0495660_0022601_2545_3105	177
1492	3300047317	Ga0495604_0446871	Ga0495604_0446871_149_709	177
1493	3300047318	Ga0495636_0010004	Ga0495636_0010004_2593_3162	177
1494	3300047320	Ga0495672_0035703	Ga0495672_0035703_337_870	177
1495	3300047320	Ga0495672_0047413	Ga0495672_0047413_1064_1624	177
1496	3300047323	Ga0495683_0003053	Ga0495683_0003053_2097_2657	177
1497	3300047446	Ga0495679_001139	Ga0495679_001139_14651_15211	177
1498	3300047469	Ga0495673_0001835	Ga0495673_0001835_14762_15322	177
1499	3300047469	Ga0495673_0001841	Ga0495673_0001841_14870_15430	177
1500	3300047471	Ga0495684_0277772	Ga0495684_0277772_378_938	177
1501	3300047472	Ga0495686_0003188	Ga0495686_0003188_1221_1781	177
1502	3300047472	Ga0495686_0008278	Ga0495686_0008278_633_1193	177
1503	3300047472	Ga0495686_0059194	Ga0495686_0059194_169_729	177
1504	3300047472	Ga0495686_0100918	Ga0495686_0100918_302_862	177
1505	3300047472	Ga0495686_0220185	Ga0495686_0220185_209_769	177
1506	3300047472	Ga0495686_0442544	Ga0495686_0442544_71_631	177
1507	3300048088	Ga0495602_0377014	Ga0495602_0377014_312_872	177
1508	3300048091	Ga0495626_0241492	Ga0495626_0241492_165_698	177
1509	3300048903	Ga0496100_0046183	Ga0496100_0046183_1298_1858	177
1510	3300048904	Ga0496101_0023056	Ga0496101_0023056_2184_2744	177
1511	3300048904	Ga0496101_0055696	Ga0496101_0055696_1476_2036	177
1512	3300048905	Ga0496102_0314765	Ga0496102_0314765_597_1157	177
1513	3300048905	Ga0496102_0377646	Ga0496102_0377646_67_627	177
1514	3300048907	Ga0496104_0002228	Ga0496104_0002228_15303_15863	177
1515	3300048907	Ga0496104_0038337	Ga0496104_0038337_3120_3680	177
1516	3300048907	Ga0496104_0153250	Ga0496104_0153250_1483_2043	177
1517	3300048908	Ga0496105_0000021	Ga0496105_0000021_63332_63892	177
1518	3300048909	Ga0496106_0043526	Ga0496106_0043526_2282_2842	177
1519	3300048912	Ga0496109_0785572	Ga0496109_0785572_132_692	177
1520	3300048913	Ga0496110_0182060	Ga0496110_0182060_756_1289	177
1521	3300048917	Ga0496114_0041875	Ga0496114_0041875_2525_3085	177
1522	3300048917	Ga0496114_0153608	Ga0496114_0153608_160_693	177
1523	3300048917	Ga0496114_0227811	Ga0496114_0227811_123_683	177
1524	3300048918	Ga0496115_0009677	Ga0496115_0009677_1100_1660	177
1525	3300048918	Ga0496115_0075855	Ga0496115_0075855_1395_1955	177
1526	3300048918	Ga0496115_0081105	Ga0496115_0081105_643_1203	177
1527	3300048918	Ga0496115_0108705	Ga0496115_0108705_942_1502	177
1528	3300048918	Ga0496115_0118389	Ga0496115_0118389_822_1382	177
1529	3300048918	Ga0496115_0740336	Ga0496115_0740336_173_733	177
1530	3300048919	Ga0496116_0107632	Ga0496116_0107632_527_1087	177
1531	3300048919	Ga0496116_0187021	Ga0496116_0187021_443_1003	177
1532	3300048920	Ga0496117_0037690	Ga0496117_0037690_1503_2063	177
1533	3300048920	Ga0496117_0043445	Ga0496117_0043445_829_1389	177
1534	3300048920	Ga0496117_0093781	Ga0496117_0093781_514_1074	177
1535	3300048920	Ga0496117_0136350	Ga0496117_0136350_107_667	177
1536	3300048921	Ga0496118_0007268	Ga0496118_0007268_820_1380	177
1537	3300048921	Ga0496118_0012111	Ga0496118_0012111_6288_6848	177
1538	3300048921	Ga0496118_0025840	Ga0496118_0025840_1052_1612	177
1539	3300048921	Ga0496118_0034937	Ga0496118_0034937_493_1053	177
1540	3300048921	Ga0496118_0430482	Ga0496118_0430482_19_579	177
1541	3300048922	Ga0496119_0033761	Ga0496119_0033761_1522_2082	177
1542	3300048922	Ga0496119_0035242	Ga0496119_0035242_1227_1787	177
1543	3300048923	Ga0496120_0017087	Ga0496120_0017087_3145_3705	177
1544	3300048923	Ga0496120_0040816	Ga0496120_0040816_860_1420	177
1545	3300048924	Ga0496121_0000290	Ga0496121_0000290_27732_28292	177
1546	3300048924	Ga0496121_0027687	Ga0496121_0027687_4313_4873	177
1547	3300048924	Ga0496121_0052565	Ga0496121_0052565_711_1271	177
1548	3300048924	Ga0496121_0053481	Ga0496121_0053481_737_1297	177
1549	3300048924	Ga0496121_0117252	Ga0496121_0117252_996_1556	177
1550	3300048924	Ga0496121_0259232	Ga0496121_0259232_44_604	177
1551	3300048925	Ga0496122_0004402	Ga0496122_0004402_8709_9269	177
1552	3300048925	Ga0496122_0024773	Ga0496122_0024773_3832_4392	177
1553	3300048925	Ga0496122_0084569	Ga0496122_0084569_1367_1927	177
1554	3300048925	Ga0496122_0337989	Ga0496122_0337989_191_751	177
1555	3300048926	Ga0496123_0007406	Ga0496123_0007406_9734_10294	177
1556	3300048926	Ga0496123_0027787	Ga0496123_0027787_1323_1883	177
1557	3300048926	Ga0496123_0048725	Ga0496123_0048725_1466_2026	177
1558	3300048926	Ga0496123_0223487	Ga0496123_0223487_224_784	177
1559	3300048927	Ga0496124_0006827	Ga0496124_0006827_11514_12074	177
1560	3300048927	Ga0496124_0101661	Ga0496124_0101661_1530_2090	177
1561	3300048928	Ga0496125_0004963	Ga0496125_0004963_830_1390	177
1562	3300048928	Ga0496125_0010624	Ga0496125_0010624_7495_8055	177
1563	3300048929	Ga0496126_0046419	Ga0496126_0046419_2476_3036	177
1564	3300048929	Ga0496126_0077472	Ga0496126_0077472_1389_1949	177
1565	3300048929	Ga0496126_0127892	Ga0496126_0127892_696_1256	177
1566	3300048929	Ga0496126_0175900	Ga0496126_0175900_1039_1599	177
1567	3300048929	Ga0496126_0258022	Ga0496126_0258022_329_889	177
1568	3300048929	Ga0496126_0291819	Ga0496126_0291819_751_1311	177
1569	3300049459	Ga0495678_001677	Ga0495678_001677_1542_2102	177
1570	3300049459	Ga0495678_003387	Ga0495678_003387_7032_7592	177
1571	3300049528	Ga0501312_070777	Ga0501312_070777_14_574	177
1572	3300049568	Ga0501031_0001839	Ga0501031_0001839_8281_8841	177
1573	3300049568	Ga0501031_0106569	Ga0501031_0106569_806_1366	177
1574	3300049568	Ga0501031_0198823	Ga0501031_0198823_581_1141	177
1575	3300049569	Ga0501032_0004867	Ga0501032_0004867_7625_8185	177
1576	3300049569	Ga0501032_0093708	Ga0501032_0093708_673_1233	177
1577	3300049569	Ga0501032_0189079	Ga0501032_0189079_761_1321	177
1578	3300049570	Ga0501033_0002014	Ga0501033_0002014_14286_14846	177
1579	3300049570	Ga0501033_0011254	Ga0501033_0011254_740_1300	177
1580	3300049570	Ga0501033_0012407	Ga0501033_0012407_810_1370	177
1581	3300049570	Ga0501033_0078614	Ga0501033_0078614_1042_1602	177
1582	3300049570	Ga0501033_0089208	Ga0501033_0089208_895_1455	177
1583	3300049570	Ga0501033_0091619	Ga0501033_0091619_771_1331	177
1584	3300049570	Ga0501033_0163250	Ga0501033_0163250_655_1215	177
1585	3300049571	Ga0501034_0014583	Ga0501034_0014583_786_1346	177
1586	3300049571	Ga0501034_0020760	Ga0501034_0020760_5425_5985	177
1587	3300049571	Ga0501034_0059579	Ga0501034_0059579_633_1193	177
1588	3300049571	Ga0501034_0123408	Ga0501034_0123408_1498_2064	177
1589	3300049571	Ga0501034_0145069	Ga0501034_0145069_899_1459	177
1590	3300049571	Ga0501034_0196113	Ga0501034_0196113_500_1060	177
1591	3300049572	Ga0501036_0051248	Ga0501036_0051248_370_930	177
1592	3300049572	Ga0501036_0128310	Ga0501036_0128310_602_1135	177
1593	3300049572	Ga0501036_0133833	Ga0501036_0133833_559_1119	177
1594	3300049572	Ga0501036_0196372	Ga0501036_0196372_821_1381	177
1595	3300049572	Ga0501036_0224345	Ga0501036_0224345_933_1493	177
1596	3300049572	Ga0501036_0385208	Ga0501036_0385208_346_879	177
1597	3300049573	Ga0501037_0006356	Ga0501037_0006356_800_1360	177
1598	3300049573	Ga0501037_0081962	Ga0501037_0081962_899_1459	177
1599	3300049573	Ga0501037_0334898	Ga0501037_0334898_38_598	177
1600	3300049573	Ga0501037_0645845	Ga0501037_0645845_27_587	177
1601	3300049574	Ga0501038_0014977	Ga0501038_0014977_5707_6267	177
1602	3300049574	Ga0501038_0057648	Ga0501038_0057648_2294_2827	177
1603	3300049574	Ga0501038_0127188	Ga0501038_0127188_1109_1669	177
1604	3300049574	Ga0501038_0140451	Ga0501038_0140451_646_1206	177
1605	3300049574	Ga0501038_0141336	Ga0501038_0141336_499_1032	177
1606	3300049574	Ga0501038_0143517	Ga0501038_0143517_761_1321	177
1607	3300049575	Ga0501039_0014983	Ga0501039_0014983_4592_5152	177
1608	3300049575	Ga0501039_0028478	Ga0501039_0028478_2867_3427	177
1609	3300049575	Ga0501039_0122038	Ga0501039_0122038_588_1148	177
1610	3300049575	Ga0501039_0207000	Ga0501039_0207000_586_1146	177
1611	3300049576	Ga0501040_0035724	Ga0501040_0035724_627_1187	177
1612	3300049576	Ga0501040_0228818	Ga0501040_0228818_557_1117	177
1613	3300049576	Ga0501040_0922499	Ga0501040_0922499_59_595	177
1614	3300049577	Ga0501041_0018425	Ga0501041_0018425_582_1115	177
1615	3300049577	Ga0501041_0278152	Ga0501041_0278152_22_555	177
1616	3300049578	Ga0501042_0076869	Ga0501042_0076869_673_1233	177
1617	3300049578	Ga0501042_0134519	Ga0501042_0134519_514_1047	177
1618	3300049578	Ga0501042_0144765	Ga0501042_0144765_507_1040	177
1619	3300049578	Ga0501042_0374558	Ga0501042_0374558_472_1005	177
1620	3300049579	Ga0501043_0008887	Ga0501043_0008887_5556_6116	177
1621	3300049579	Ga0501043_0045254	Ga0501043_0045254_1086_1655	177
1622	3300049579	Ga0501043_0121474	Ga0501043_0121474_452_1012	177
1623	3300049579	Ga0501043_0125801	Ga0501043_0125801_441_1001	177
1624	3300049580	Ga0501046_0010105	Ga0501046_0010105_1792_2352	177
1625	3300049580	Ga0501046_0036014	Ga0501046_0036014_2831_3391	177
1626	3300049580	Ga0501046_0038068	Ga0501046_0038068_1798_2358	177
1627	3300049580	Ga0501046_0119975	Ga0501046_0119975_997_1557	177
1628	3300049580	Ga0501046_0521438	Ga0501046_0521438_214_774	177
1629	3300049581	Ga0501047_0044153	Ga0501047_0044153_1876_2436	177
1630	3300049581	Ga0501047_0143932	Ga0501047_0143932_895_1455	177
1631	3300049581	Ga0501047_0149699	Ga0501047_0149699_630_1190	177
1632	3300049581	Ga0501047_0165177	Ga0501047_0165177_1243_1803	177
1633	3300049581	Ga0501047_0299264	Ga0501047_0299264_806_1366	177
1634	3300049581	Ga0501047_0335261	Ga0501047_0335261_222_782	177
1635	3300049581	Ga0501047_0339648	Ga0501047_0339648_752_1312	177
1636	3300049582	Ga0501048_0063859	Ga0501048_0063859_869_1429	177
1637	3300049582	Ga0501048_0139322	Ga0501048_0139322_723_1256	177
1638	3300049582	Ga0501048_0428698	Ga0501048_0428698_107_640	177
1639	3300049583	Ga0501067_0528318	Ga0501067_0528318_44_577	177
1640	3300049584	Ga0501068_0049231	Ga0501068_0049231_1090_1650	177
1641	3300049585	Ga0501069_0027832	Ga0501069_0027832_715_1275	177
1642	3300049586	Ga0501070_0051635	Ga0501070_0051635_1208_1768	177
1643	3300049586	Ga0501070_0103503	Ga0501070_0103503_895_1455	177
1644	3300049586	Ga0501070_0271828	Ga0501070_0271828_807_1340	177
1645	3300049587	Ga0501071_0030849	Ga0501071_0030849_2824_3357	177
1646	3300049587	Ga0501071_0042884	Ga0501071_0042884_1859_2419	177
1647	3300049587	Ga0501071_0388740	Ga0501071_0388740_425_958	177
1648	3300049588	Ga0501072_0007608	Ga0501072_0007608_759_1319	177
1649	3300049588	Ga0501072_0042355	Ga0501072_0042355_561_1094	177
1650	3300049588	Ga0501072_0120481	Ga0501072_0120481_777_1310	177
1651	3300049588	Ga0501072_0567224	Ga0501072_0567224_63_596	177
1652	3300049589	Ga0501073_0010722	Ga0501073_0010722_1086_1619	177
1653	3300049589	Ga0501073_0084863	Ga0501073_0084863_873_1433	177
1654	3300049589	Ga0501073_0150764	Ga0501073_0150764_588_1148	177
1655	3300049589	Ga0501073_0188527	Ga0501073_0188527_528_1088	177
1656	3300049589	Ga0501073_0190431	Ga0501073_0190431_297_857	177
1657	3300049589	Ga0501073_0199365	Ga0501073_0199365_347_880	177
1658	3300049590	Ga0501074_0080568	Ga0501074_0080568_895_1455	177
1659	3300049590	Ga0501074_0089893	Ga0501074_0089893_869_1429	177
1660	3300049590	Ga0501074_0114744	Ga0501074_0114744_1156_1689	177
1661	3300049590	Ga0501074_0279814	Ga0501074_0279814_79_612	177
1662	3300049591	Ga0501075_0305426	Ga0501075_0305426_403_936	177
1663	3300049591	Ga0501075_0326095	Ga0501075_0326095_450_983	177
1664	3300049592	Ga0501076_0011906	Ga0501076_0011906_5341_5874	177
1665	3300049592	Ga0501076_0065058	Ga0501076_0065058_911_1471	177
1666	3300049593	Ga0501077_0257097	Ga0501077_0257097_43_609	177
1667	3300049593	Ga0501077_0320265	Ga0501077_0320265_19_579	177
1668	3300049686	Ga0501257_024610	Ga0501257_024610_669_1229	177
1669	3300049741	Ga0501079_0005576	Ga0501079_0005576_4416_4949	177
1670	3300049741	Ga0501079_0258328	Ga0501079_0258328_519_1052	177
1671	3300049742	Ga0501080_0022374	Ga0501080_0022374_3380_3940	177
1672	3300049742	Ga0501080_0030593	Ga0501080_0030593_3878_4438	177
1673	3300049742	Ga0501080_0069868	Ga0501080_0069868_757_1317	177
1674	3300049742	Ga0501080_0147329	Ga0501080_0147329_1100_1633	177
1675	3300049742	Ga0501080_0288173	Ga0501080_0288173_644_1204	177
1676	3300049742	Ga0501080_0941689	Ga0501080_0941689_30_563	177
1677	3300049743	Ga0501081_0002211	Ga0501081_0002211_667_1200	177
1678	3300049743	Ga0501081_0550941	Ga0501081_0550941_118_651	177
1679	3300049744	Ga0501083_0062153	Ga0501083_0062153_779_1339	177
1680	3300049744	Ga0501083_0202569	Ga0501083_0202569_543_1103	177
1681	3300049822	Ga0501035_0000666	Ga0501035_0000666_1197_1757	177
1682	3300049822	Ga0501035_0075770	Ga0501035_0075770_1523_2083	177
1683	3300049822	Ga0501035_0089303	Ga0501035_0089303_1206_1766	177
1684	3300049822	Ga0501035_0111035	Ga0501035_0111035_785_1345	177
1685	3300049822	Ga0501035_0186602	Ga0501035_0186602_592_1152	177
1686	3300049822	Ga0501035_0257419	Ga0501035_0257419_714_1274	177
1687	3300049822	Ga0501035_0387697	Ga0501035_0387697_617_1150	177
1688	3300049822	Ga0501035_0629865	Ga0501035_0629865_220_780	177
1689	3300049823	Ga0501044_0013439	Ga0501044_0013439_7363_7923	177
1690	3300049823	Ga0501044_0051741	Ga0501044_0051741_909_1475	177
1691	3300049823	Ga0501044_0058107	Ga0501044_0058107_588_1148	177
1692	3300049823	Ga0501044_0088792	Ga0501044_0088792_62_622	177
1693	3300049823	Ga0501044_0153637	Ga0501044_0153637_1352_1912	177
1694	3300049823	Ga0501044_0163965	Ga0501044_0163965_886_1446	177
1695	3300049823	Ga0501044_0183619	Ga0501044_0183619_541_1101	177
1696	3300049823	Ga0501044_0198994	Ga0501044_0198994_1292_1852	177
1697	3300049823	Ga0501044_0211865	Ga0501044_0211865_768_1328	177
1698	3300049824	Ga0501045_0055116	Ga0501045_0055116_381_941	177
1699	3300049824	Ga0501045_0970521	Ga0501045_0970521_21_554	177
1700	3300050507	nmdc:mga05p37_59516_c1	nmdc:mga05p37_59516_c1_3290_3823	177
1701	3300050508	nmdc:mga09592_141858_c1	nmdc:mga09592_141858_c1_96_629	177
1702	3300050511	nmdc:mga08y16_21884_c1	nmdc:mga08y16_21884_c1_1498_2031	177
1703	3300050511	nmdc:mga08y16_28546_c1	nmdc:mga08y16_28546_c1_357_890	177
1704	3300050512	nmdc:mga0n895_266646_c1	nmdc:mga0n895_266646_c1_757_1323	177
1705	3300050512	nmdc:mga0n895_8228_c1	nmdc:mga0n895_8228_c1_618_1151	177
1706	3300050513	nmdc:mga0rr50_13871_c1	nmdc:mga0rr50_13871_c1_3019_3552	177
1707	3300050515	nmdc:mga0a205_40273_c1	nmdc:mga0a205_40273_c1_3353_3886	177
1708	3300050515	nmdc:mga0a205_43446_c1	nmdc:mga0a205_43446_c1_112_645	177
1709	3300050516	nmdc:mga0sz30_349177_c1	nmdc:mga0sz30_349177_c1_54_614	177
1710	3300050516	nmdc:mga0sz30_51591_c1	nmdc:mga0sz30_51591_c1_35_595	177
1711	3300050516	nmdc:mga0sz30_76529_c1	nmdc:mga0sz30_76529_c1_509_1069	177
1712	3300053079	Ga0500610_0002648	Ga0500610_0002648_1577_2137	177
1713	3300053085	Ga0495619_0701957	Ga0495619_0701957_64_597	177
1714	3300053087	Ga0500643_000120	Ga0500643_000120_59235_59795	177
1715	3300053087	Ga0500643_002146	Ga0500643_002146_7979_8539	177
1716	3300053088	Ga0500644_0047346	Ga0500644_0047346_668_1201	177
1717	3300053090	Ga0500646_0054425	Ga0500646_0054425_363_923	177
1718	3300053092	Ga0500583_0199033	Ga0500583_0199033_169_729	177
1719	3300053093	Ga0500651_0012159	Ga0500651_0012159_3829_4389	177
1720	3300053093	Ga0500651_0033599	Ga0500651_0033599_712_1272	177
1721	3300053093	Ga0500651_0053199	Ga0500651_0053199_370_930	177
1722	3300053093	Ga0500651_0521493	Ga0500651_0521493_10_543	177
1723	3300053096	Ga0500641_0004514	Ga0500641_0004514_2010_2543	177
1724	3300053100	Ga0500660_049143	Ga0500660_049143_658_1191	177
1725	3300053103	Ga0500555_000588	Ga0500555_000588_1349_1909	177
1726	3300053108	Ga0500562_017519	Ga0500562_017519_517_1050	177
1727	3300053109	Ga0500569_048636	Ga0500569_048636_19_552	177
1728	3300053120	Ga0500597_212750	Ga0500597_212750_216_776	177
1729	3300053123	Ga0500614_076561	Ga0500614_076561_340_900	177
1730	3300053131	Ga0500652_043219	Ga0500652_043219_77_610	177
1731	3300053131	Ga0500652_143974	Ga0500652_143974_113_673	177
1732	3300053139	Ga0500568_0004215	Ga0500568_0004215_7095_7655	177
1733	3300053139	Ga0500568_0129740	Ga0500568_0129740_195_728	177
1734	3300053140	Ga0500573_0283456	Ga0500573_0283456_203_763	177
1735	3300053156	Ga0500622_0161160	Ga0500622_0161160_388_921	177
1736	3300053160	Ga0500633_0082098	Ga0500633_0082098_348_908	177
1737	3300053730	Ga0500645_023864	Ga0500645_023864_795_1355	177
1738	3300054114	Ga0501084_0073082	Ga0501084_0073082_1428_1988	177
1739	3300054114	Ga0501084_0096520	Ga0501084_0096520_274_807	177
1740	3300054114	Ga0501084_0672808	Ga0501084_0672808_279_812	177
1741	3300055283	Ga0500661_002897	Ga0500661_002897_823_1383	177
1742	3300059421	Ga0590071_053210	Ga0590071_053210_349_882	177
1743	3300059492	Ga0587073_0015864	Ga0587073_0015864_182_742	177
1744	3300059503	Ga0587080_009044	Ga0587080_009044_354_914	177
1745	3300059504	Ga0587082_000039	Ga0587082_000039_5332_5892	177
1746	3300059505	Ga0587083_0008920	Ga0587083_0008920_564_1124	177
1747	3300059508	Ga0587088_009978	Ga0587088_009978_280_840	177
1748	3300059605	Ga0587106_001841	Ga0587106_001841_803_1363	177
1749	3300059640	Ga0587067_007681	Ga0587067_007681_294_854	177
1750	3300059643	Ga0587072_010478	Ga0587072_010478_718_1278	177
1751	3300059644	Ga0587075_003266	Ga0587075_003266_973_1533	177
1752	3300059659	Ga0587120_002042	Ga0587120_002042_189_749	177
1753	3300060346	Ga0587111_0109862	Ga0587111_0109862_51_611	177
1754	3300060353	Ga0501082_0003821	Ga0501082_0003821_1266_1799	177
1755	3300060353	Ga0501082_0049831	Ga0501082_0049831_2190_2750	177
1756	3300060353	Ga0501082_0212553	Ga0501082_0212553_782_1342	177
1757	3300060353	Ga0501082_0264134	Ga0501082_0264134_620_1153	177
1758	3300060353	Ga0501082_0359399	Ga0501082_0359399_299_832	177
1759	3300061719	Ga0466962_0001755	Ga0466962_0001755_3742_4302	177
1760	3300061719	Ga0466962_0068664	Ga0466962_0068664_605_1165	177
1761	3300061719	Ga0466962_0081616	Ga0466962_0081616_760_1320	177
1762	iso_pu_bacteria	2506520007	2506576248	177
1763	iso_pu_bacteria	2506520008	2506581386	177
1764	iso_pu_bacteria	2508501071	2508850223	177
1765	iso_pu_bacteria	2537561728	2538425733	177
1766	iso_pu_bacteria	2547132181	2547698822	177
1767	iso_pu_bacteria	2547132416	2548652995	177
1768	iso_pu_bacteria	2554235234	2555262606	177
1769	iso_pu_bacteria	2561511199	2562465423	177
1770	iso_pu_bacteria	2565956521	2566038624	177
1771	iso_pu_bacteria	2571042365	2572253349	177
1772	iso_pu_bacteria	2585427591	2585830262	177
1773	iso_pu_bacteria	2585427592	2585835274	177
1774	iso_pu_bacteria	2599185169	2599413658	177
1775	iso_pu_bacteria	2599185299	2599925272	177
1776	iso_pu_bacteria	2600255254	2601526323	177
1777	iso_pu_bacteria	2600255255	2601531347	177
1778	iso_pu_bacteria	2600255256	2601536738	177
1779	iso_pu_bacteria	2600255257	2601542035	177
1780	iso_pu_bacteria	2600255280	2601618209	177
1781	iso_pu_bacteria	2600255281	2601623214	177
1782	iso_pu_bacteria	2600255287	2601646611	177
1783	iso_pu_bacteria	2600255288	2601651624	177
1784	iso_pu_bacteria	2600255289	2601656628	177
1785	iso_pu_bacteria	2600255290	2601661634	177
1786	iso_pu_bacteria	2600255291	2601666570	177
1787	iso_pu_bacteria	2600255298	2601699502	177
1788	iso_pu_bacteria	2600255299	2601704441	177
1789	iso_pu_bacteria	2600255300	2601709436	177
1790	iso_pu_bacteria	2600255301	2601714452	177
1791	iso_pu_bacteria	2600255302	2601719484	177
1792	iso_pu_bacteria	2600255303	2601724385	177
1793	iso_pu_bacteria	2600255304	2601729406	177
1794	iso_pu_bacteria	2600255305	2601734429	177
1795	iso_pu_bacteria	2600255306	2601739447	177
1796	iso_pu_bacteria	2600255307	2601744540	177
1797	iso_pu_bacteria	2600255309	2601755071	177
1798	iso_pu_bacteria	2600255310	2601760419	177
1799	iso_pu_bacteria	2600255311	2601765796	177
1800	iso_pu_bacteria	2600255392	2602022366	177
1801	iso_pu_bacteria	2602042046	2603636457	177
1802	iso_pu_bacteria	2602042047	2603641939	177
1803	iso_pu_bacteria	2602042052	2603659230	177
1804	iso_pu_bacteria	2602042053	2603664123	177
1805	iso_pu_bacteria	2602042066	2603697982	177
1806	iso_pu_bacteria	2602042067	2603702301	177
1807	iso_pu_bacteria	2602042103	2603836779	177
1808	iso_pu_bacteria	2602042104	2603841886	177
1809	iso_pu_bacteria	2602042105	2603846959	177
1810	iso_pu_bacteria	2602042106	2603852002	177
1811	iso_pu_bacteria	2602042109	2603864975	177
1812	iso_pu_bacteria	2602042110	2603869601	177
1813	iso_pu_bacteria	2602042111	2603874749	177
1814	iso_pu_bacteria	2603880178	2606046787	177
1815	iso_pu_bacteria	2603880184	2606068553	177
1816	iso_pu_bacteria	2603880202	2606144459	177
1817	iso_pu_bacteria	2603880211	2606174676	177
1818	iso_pu_bacteria	2608642108	2608672284	177
1819	iso_pu_bacteria	2609459761	2609914455	177
1820	iso_pu_bacteria	2636415599	2637227671	177
1821	iso_pu_bacteria	2643221593	2643973937	177
1822	iso_pu_bacteria	2643221695	2644530922	177
1823	iso_pu_bacteria	2648501241	2649122820	177
1824	iso_pu_bacteria	2648501693	2650896958	177
1825	iso_pu_bacteria	2651869818	2652976486	177
1826	iso_pu_bacteria	2654587920	2656276593	177
1827	iso_pu_bacteria	2654587920	2656277580	177
1828	iso_pu_bacteria	2667528172	2671105875	177
1829	iso_pu_bacteria	2667528173	2671111064	177
1830	iso_pu_bacteria	2671180115	2671588977	177
1831	iso_pu_bacteria	2675903046	2676410330	177
1832	iso_pu_bacteria	2681812866	2681995250	177
1833	iso_pu_bacteria	2681812869	2682010053	177
1834	iso_pu_bacteria	2684622997	2686356875	177
1835	iso_pu_bacteria	2687453601	2689442680	177
1836	iso_pu_bacteria	2706794495	2707102015	177
1837	iso_pu_bacteria	2711768156	2712471546	177
1838	iso_pu_bacteria	2751185917	2753854102	177
1839	iso_pu_bacteria	2765235842	2765586997	177
1840	iso_pu_bacteria	2772190666	2772436822	177
1841	iso_pu_bacteria	2775506706	2775542469	177
1842	iso_pu_bacteria	2775507074	2777024496	177
1843	iso_pu_bacteria	2791354903	2791923304	177
1844	iso_pu_bacteria	2791355010	2792314849	177
1845	iso_pu_bacteria	2791355275	2793407305	177
1846	iso_pu_bacteria	2808606414	2809128030	177
1847	iso_pu_bacteria	2814123068	2814698828	177
1848	iso_pu_bacteria	2821118458	2821122109	177
1849	iso_pu_bacteria	2823373977	2823378589	177
1850	iso_pu_bacteria	2844425489	2844425715	177
1851	iso_pu_bacteria	2844528606	2844533116	177
1852	iso_pu_bacteria	2846540461	2846543284	177
1853	iso_pu_bacteria	2847085930	2847089559	177
1854	iso_pu_bacteria	2847797336	2847801852	177
1855	iso_pu_bacteria	2852103415	2852106426	177
1856	iso_pu_bacteria	2854601825	2854603902	177
1857	iso_pu_bacteria	2855195626	2855196394	177
1858	iso_pu_bacteria	2858466076	2858467389	177
1859	iso_pu_bacteria	2865014394	2865018861	177
1860	iso_pu_bacteria	2869551831	2869552100	177
1861	iso_pu_bacteria	2871272651	2871275589	177
1862	iso_pu_bacteria	2871282230	2871285597	177
1863	iso_pu_bacteria	2881609920	2881610766	177
1864	iso_pu_bacteria	2884086401	2884090979	177
1865	iso_pu_bacteria	2888366609	2888366873	177
1866	iso_pu_bacteria	2888373701	2888375474	177
1867	iso_pu_bacteria	2891670763	2891673992	177
1868	iso_pu_bacteria	2904474040	2904479196	177
1869	iso_pu_bacteria	2904504865	2904509604	177
1870	iso_pu_bacteria	2904513164	2904518487	177
1871	iso_pu_bacteria	2908669403	2908674614	177
1872	iso_pu_bacteria	2919108558	2919114013	177
1873	iso_pu_bacteria	2919150387	2919155571	177
1874	iso_pu_bacteria	2919513703	2919515150	177
1875	iso_pu_bacteria	2919675420	2919679047	177
1876	iso_pu_bacteria	2923634449	2923637483	177
1877	iso_pu_bacteria	2927143783	2927148963	177
1878	iso_pu_bacteria	2927833300	2927836063	177
1879	iso_pu_bacteria	2932406140	2932410852	177
1880	iso_pu_bacteria	2935625433	2935630294	177
1881	iso_pu_bacteria	2937539931	2937542009	177
1882	iso_pu_bacteria	2937967321	2937969511	177
1883	iso_pu_bacteria	2939568625	2939572998	177
1884	iso_pu_bacteria	2939573065	2939577804	177
1885	iso_pu_bacteria	2939577877	2939582464	177
1886	iso_pu_bacteria	2939607340	2939611878	177
1887	iso_pu_bacteria	2939617950	2939622471	177
1888	iso_pu_bacteria	2939642701	2939646952	177
1889	iso_pu_bacteria	2945874760	2945874944	177
1890	iso_pu_bacteria	2945951305	2945954732	177
1891	iso_pu_bacteria	2969079654	2969084711	177
1892	iso_pu_bacteria	2971820967	2971826236	177
1893	iso_pu_bacteria	2974310843	2974314128	177
1894	iso_pu_bacteria	2974435778	2974436467	177
1895	iso_pu_bacteria	2978975091	2978977221	177
1896	iso_pu_bacteria	2984494565	2984498614	177
1897	iso_pu_bacteria	2984559226	2984561832	177
1898	iso_pu_bacteria	2984595703	2984599898	177
1899	iso_pu_bacteria	2990261002	2990265633	177
1900	iso_pu_bacteria	3000376612	3000380975	177
1901	iso_pu_bacteria	640753048	640935771	177
1902	iso_pu_bacteria	8004592986	8004595851	177
1903	iso_pu_bacteria	8015394850	8015398590	177
1904	iso_pu_bacteria	8016728285	8016730948	177
1905	iso_pu_bacteria	8018221730	8018222259	177
1906	iso_pu_bacteria	8018405270	8018406493	177
1907	iso_pu_bacteria	8019504834	8019509361	177
1908	iso_pu_bacteria	8054844752	8054846332	177
1909	iso_pu_bacteria	8054849141	8054852269	177
1910	iso_pu_bacteria	8055087960	8055091780	177
1911	iso_pu_bacteria	8055092621	8055097422	177
1912	iso_pu_bacteria	8055097453	8055097632	177
1913	iso_pu_bacteria	8055693939	8055694214	177
1914	iso_pu_bacteria	8057304971	8057305552	177
1915	3300005355	Ga0070671_100159893	Ga0070671_1001598934	178
1916	3300005364	Ga0070673_100038659	Ga0070673_1000386591	178
1917	3300005440	Ga0070705_100148441	Ga0070705_1001484411	178
1918	3300009177	Ga0105248_10402087	Ga0105248_104020872	178
1919	3300012513	Ga0157326_1025748	Ga0157326_10257481	178
1920	3300013306	Ga0163162_10002151	Ga0163162_1000215113	178
1921	3300025931	Ga0207644_10019953	Ga0207644_100199536	178
1922	3300025941	Ga0207711_10329225	Ga0207711_103292252	178
1923	3300032126	Ga0307415_100593731	Ga0307415_1005937312	178
1924	3300037312	Ga0395899_0137592	Ga0395899_0137592_876_1448	178
1925	3300037418	Ga0395900_0158596	Ga0395900_0158596_586_1158	178
1926	3300037418	Ga0395900_0288259	Ga0395900_0288259_344_916	178
1927	3300037471	Ga0395905_0069743	Ga0395905_0069743_1342_1914	178
1928	3300037471	Ga0395905_0074732	Ga0395905_0074732_2192_2764	178
1929	3300037471	Ga0395905_0131638	Ga0395905_0131638_1361_1933	178
1930	3300038443	Ga0395901_0081806	Ga0395901_0081806_1557_2129	178
1931	3300042134	Ga0450898_054358	Ga0450898_054358_43_615	178
1932	3300045976	Ga0466967_0295990	Ga0466967_0295990_152_724	178
1933	3300046616	Ga0495668_0064175	Ga0495668_0064175_700_1272	178
1934	3300048903	Ga0496100_0077605	Ga0496100_0077605_82_654	178
1935	3300048904	Ga0496101_0114156	Ga0496101_0114156_773_1345	178
1936	3300048904	Ga0496101_0117232	Ga0496101_0117232_516_1088	178
1937	3300048911	Ga0496108_0062034	Ga0496108_0062034_295_867	178
1938	3300048911	Ga0496108_0350668	Ga0496108_0350668_481_1053	178
1939	3300048912	Ga0496109_0067177	Ga0496109_0067177_2314_2886	178
1940	3300048915	Ga0496112_0234173	Ga0496112_0234173_502_1074	178
1941	3300048916	Ga0496113_0034039	Ga0496113_0034039_2442_3014	178
1942	3300048918	Ga0496115_0096753	Ga0496115_0096753_681_1262	178
1943	3300005293	Ga0065715_10027938	Ga0065715_100279383	179
1944	3300005333	Ga0070677_10356170	Ga0070677_103561701	179
1945	3300005355	Ga0070671_100019286	Ga0070671_1000192866	179
1946	3300005439	Ga0070711_100229383	Ga0070711_1002293831	179
1947	3300005618	Ga0068864_100345610	Ga0068864_1003456103	179
1948	3300012475	Ga0157317_1004865	Ga0157317_10048652	179
1949	3300012498	Ga0157345_1026457	Ga0157345_10264571	179
1950	3300012500	Ga0157314_1012467	Ga0157314_10124671	179
1951	3300012513	Ga0157326_1040601	Ga0157326_10406011	179
1952	3300025923	Ga0207681_10120090	Ga0207681_101200903	179
1953	3300025925	Ga0207650_10615038	Ga0207650_106150381	179
1954	3300025931	Ga0207644_10068702	Ga0207644_100687024	179
1955	3300025940	Ga0207691_10375275	Ga0207691_103752752	179
1956	3300026095	Ga0207676_10455717	Ga0207676_104557171	179
1957	3300030731	Ga0316177_1088114	Ga0316177_10881145	179
1958	3300030732	Ga0316176_1058550	Ga0316176_10585501	179
1959	3300030733	Ga0314311_1025656	Ga0314311_10256563	179
1960	3300032004	Ga0307414_10177997	Ga0307414_101779971	179
1961	3300032004	Ga0307414_10380040	Ga0307414_103800402	179
1962	3300041413	Ga0439465_0035903	Ga0439465_0035903_857_1426	179
1963	3300041494	Ga0451837_1033783	Ga0451837_1033783_141_731	179
1964	3300041494	Ga0451837_1621251	Ga0451837_1621251_538_1110	179
1965	3300042015	Ga0439462_0030040	Ga0439462_0030040_149_718	179
1966	3300046525	Ga0495663_0034220	Ga0495663_0034220_719_1300	179
1967	3300046539	Ga0495621_0004295	Ga0495621_0004295_1025_1606	179
1968	3300046615	Ga0495656_0011224	Ga0495656_0011224_1891_2481	179
1969	3300047318	Ga0495636_0047006	Ga0495636_0047006_832_1422	179
1970	3300047318	Ga0495636_0423079	Ga0495636_0423079_23_562	179
1971	3300048904	Ga0496101_0024485	Ga0496101_0024485_2581_3171	179
1972	3300048905	Ga0496102_0020726	Ga0496102_0020726_4518_5108	179
1973	3300048909	Ga0496106_0021873	Ga0496106_0021873_553_1143	179
1974	3300048910	Ga0496107_0075751	Ga0496107_0075751_767_1357	179
1975	3300048911	Ga0496108_0272794	Ga0496108_0272794_384_974	179
1976	3300048912	Ga0496109_0029720	Ga0496109_0029720_3408_3998	179
1977	3300048913	Ga0496110_0023385	Ga0496110_0023385_980_1570	179
1978	3300048916	Ga0496113_0157977	Ga0496113_0157977_496_1086	179
1979	3300048917	Ga0496114_0006354	Ga0496114_0006354_880_1470	179
1980	3300049571	Ga0501034_0109493	Ga0501034_0109493_628_1212	179
1981	3300049705	Ga0501225_0018260	Ga0501225_0018260_975_1559	179
1982	3300049760	Ga0501263_007535	Ga0501263_007535_32_610	179
1983	3300049765	Ga0501268_006952	Ga0501268_006952_959_1543	179
1984	iso_pu_bacteria	2919493220	2919494692	179
1985	iso_pu_bacteria	2919497567	2919501570	179
1986	iso_pu_bacteria	2919543075	2919546648	179
1987	iso_pu_bacteria	2923525760	2923526113	179
1988	iso_pu_bacteria	2995948881	2995950351	179
1989	3300001904	JGI24736J21556_1003356	JGI24736J21556_10033564	180
1990	3300001915	JGI24741J21665_1004672	JGI24741J21665_10046724	180
1991	3300001915	JGI24741J21665_1013326	JGI24741J21665_10133263	180
1992	3300001979	JGI24740J21852_10004454	JGI24740J21852_100044544	180
1993	3300001979	JGI24740J21852_10014944	JGI24740J21852_100149444	180
1994	3300003187	JGI25151J46595_10008142	JGI25151J46595_100081426	180
1995	3300003215	JGI25153J46596_10074476	JGI25153J46596_100744761	180
1996	3300003771	Ga0055526_1008227	Ga0055526_10082276	180
1997	3300003773	Ga0055537_1002867	Ga0055537_10028673	180
1998	3300003775	Ga0055524_1006155	Ga0055524_10061556	180
1999	3300003784	Ga0055534_1003215	Ga0055534_10032156	180
2000	3300003790	Ga0055528_1006600	Ga0055528_10066006	180
2001	3300004799	Ga0058863_10118331	Ga0058863_101183314	180
2002	3300004800	Ga0058861_10101296	Ga0058861_101012964	180
2003	3300004803	Ga0058862_10069052	Ga0058862_100690522	180
2004	3300005288	Ga0065714_10151095	Ga0065714_101510952	180
2005	3300005293	Ga0065715_10023465	Ga0065715_100234651	180
2006	3300005293	Ga0065715_10043051	Ga0065715_100430511	180
2007	3300005293	Ga0065715_10502129	Ga0065715_105021291	180
2008	3300005327	Ga0070658_10071967	Ga0070658_100719673	180
2009	3300005327	Ga0070658_10215702	Ga0070658_102157022	180
2010	3300005327	Ga0070658_10267292	Ga0070658_102672922	180
2011	3300005328	Ga0070676_10426122	Ga0070676_104261221	180
2012	3300005329	Ga0070683_100373014	Ga0070683_1003730141	180
2013	3300005330	Ga0070690_100560007	Ga0070690_1005600071	180
2014	3300005331	Ga0070670_100044271	Ga0070670_1000442713	180
2015	3300005335	Ga0070666_10214174	Ga0070666_102141742	180
2016	3300005335	Ga0070666_10244805	Ga0070666_102448053	180
2017	3300005336	Ga0070680_100074056	Ga0070680_1000740562	180
2018	3300005336	Ga0070680_100144953	Ga0070680_1001449532	180
2019	3300005336	Ga0070680_100201551	Ga0070680_1002015513	180
2020	3300005336	Ga0070680_100207524	Ga0070680_1002075244	180
2021	3300005337	Ga0070682_100022694	Ga0070682_1000226944	180
2022	3300005337	Ga0070682_100760773	Ga0070682_1007607731	180
2023	3300005339	Ga0070660_100206175	Ga0070660_1002061751	180
2024	3300005339	Ga0070660_100221372	Ga0070660_1002213723	180
2025	3300005339	Ga0070660_100226808	Ga0070660_1002268082	180
2026	3300005339	Ga0070660_100519594	Ga0070660_1005195941	180
2027	3300005341	Ga0070691_10013145	Ga0070691_100131454	180
2028	3300005344	Ga0070661_100035650	Ga0070661_1000356504	180
2029	3300005344	Ga0070661_100065491	Ga0070661_1000654914	180
2030	3300005344	Ga0070661_100339555	Ga0070661_1003395552	180
2031	3300005345	Ga0070692_10015429	Ga0070692_100154294	180
2032	3300005345	Ga0070692_10025320	Ga0070692_100253203	180
2033	3300005347	Ga0070668_100014264	Ga0070668_1000142643	180
2034	3300005353	Ga0070669_100025388	Ga0070669_1000253883	180
2035	3300005354	Ga0070675_100434326	Ga0070675_1004343262	180
2036	3300005355	Ga0070671_100155437	Ga0070671_1001554374	180
2037	3300005355	Ga0070671_100247300	Ga0070671_1002473001	180
2038	3300005364	Ga0070673_100666152	Ga0070673_1006661521	180
2039	3300005364	Ga0070673_101320993	Ga0070673_1013209931	180
2040	3300005366	Ga0070659_100020770	Ga0070659_1000207707	180
2041	3300005366	Ga0070659_100121687	Ga0070659_1001216873	180
2042	3300005366	Ga0070659_100273332	Ga0070659_1002733321	180
2043	3300005366	Ga0070659_100485711	Ga0070659_1004857112	180
2044	3300005455	Ga0070663_100058805	Ga0070663_1000588052	180
2045	3300005455	Ga0070663_100124474	Ga0070663_1001244744	180
2046	3300005455	Ga0070663_100246915	Ga0070663_1002469153	180
2047	3300005458	Ga0070681_10002821	Ga0070681_100028213	180
2048	3300005458	Ga0070681_10024210	Ga0070681_100242103	180
2049	3300005458	Ga0070681_10100999	Ga0070681_101009994	180
2050	3300005458	Ga0070681_10818532	Ga0070681_108185321	180
2051	3300005466	Ga0070685_10508224	Ga0070685_105082241	180
2052	3300005471	Ga0070698_100141211	Ga0070698_1001412114	180
2053	3300005530	Ga0070679_100103701	Ga0070679_1001037014	180
2054	3300005530	Ga0070679_100270521	Ga0070679_1002705214	180
2055	3300005530	Ga0070679_100306546	Ga0070679_1003065461	180
2056	3300005530	Ga0070679_100875761	Ga0070679_1008757611	180
2057	3300005535	Ga0070684_100326262	Ga0070684_1003262623	180
2058	3300005535	Ga0070684_100730995	Ga0070684_1007309951	180
2059	3300005539	Ga0068853_100044662	Ga0068853_1000446624	180
2060	3300005539	Ga0068853_100286540	Ga0068853_1002865403	180
2061	3300005539	Ga0068853_100495914	Ga0068853_1004959142	180
2062	3300005539	Ga0068853_100496841	Ga0068853_1004968412	180
2063	3300005543	Ga0070672_100096235	Ga0070672_1000962354	180
2064	3300005543	Ga0070672_100859678	Ga0070672_1008596781	180
2065	3300005546	Ga0070696_100243863	Ga0070696_1002438632	180
2066	3300005547	Ga0070693_100007592	Ga0070693_1000075926	180
2067	3300005563	Ga0068855_100135470	Ga0068855_1001354702	180
2068	3300005563	Ga0068855_100137338	Ga0068855_1001373384	180
2069	3300005563	Ga0068855_100613080	Ga0068855_1006130802	180
2070	3300005564	Ga0070664_100035912	Ga0070664_1000359129	180
2071	3300005564	Ga0070664_100105397	Ga0070664_1001053973	180
2072	3300005564	Ga0070664_100215508	Ga0070664_1002155082	180
2073	3300005564	Ga0070664_100400902	Ga0070664_1004009021	180
2074	3300005577	Ga0068857_101153036	Ga0068857_1011530361	180
2075	3300005578	Ga0068854_100043676	Ga0068854_1000436764	180
2076	3300005578	Ga0068854_100201090	Ga0068854_1002010902	180
2077	3300005578	Ga0068854_100352222	Ga0068854_1003522222	180
2078	3300005578	Ga0068854_100381568	Ga0068854_1003815681	180
2079	3300005614	Ga0068856_100309440	Ga0068856_1003094404	180
2080	3300005614	Ga0068856_100320045	Ga0068856_1003200452	180
2081	3300005616	Ga0068852_100043682	Ga0068852_1000436824	180
2082	3300005616	Ga0068852_100163627	Ga0068852_1001636273	180
2083	3300005616	Ga0068852_100227039	Ga0068852_1002270394	180
2084	3300005616	Ga0068852_100244530	Ga0068852_1002445302	180
2085	3300005616	Ga0068852_100262298	Ga0068852_1002622984	180
2086	3300005616	Ga0068852_100441708	Ga0068852_1004417083	180
2087	3300005616	Ga0068852_100759007	Ga0068852_1007590072	180
2088	3300005617	Ga0068859_100405272	Ga0068859_1004052722	180
2089	3300005618	Ga0068864_100067043	Ga0068864_1000670434	180
2090	3300005834	Ga0068851_10025641	Ga0068851_100256413	180
2091	3300005834	Ga0068851_10054949	Ga0068851_100549494	180
2092	3300005841	Ga0068863_100008984	Ga0068863_1000089844	180
2093	3300005843	Ga0068860_100102457	Ga0068860_1001024573	180
2094	3300005843	Ga0068860_100290974	Ga0068860_1002909742	180
2095	3300006038	Ga0075365_10027566	Ga0075365_100275662	180
2096	3300006051	Ga0075364_10213653	Ga0075364_102136532	180
2097	3300006237	Ga0097621_100109872	Ga0097621_1001098723	180
2098	3300006358	Ga0068871_100233719	Ga0068871_1002337194	180
2099	3300006358	Ga0068871_100461037	Ga0068871_1004610372	180
2100	3300006931	Ga0097620_100405260	Ga0097620_1004052602	180
2101	3300009093	Ga0105240_10225094	Ga0105240_102250942	180
2102	3300009093	Ga0105240_10388896	Ga0105240_103888962	180
2103	3300009093	Ga0105240_10644394	Ga0105240_106443942	180
2104	3300009093	Ga0105240_10840936	Ga0105240_108409361	180
2105	3300009093	Ga0105240_10897983	Ga0105240_108979832	180
2106	3300009174	Ga0105241_10435691	Ga0105241_104356912	180
2107	3300009174	Ga0105241_10452920	Ga0105241_104529202	180
2108	3300009176	Ga0105242_10732916	Ga0105242_107329161	180
2109	3300009177	Ga0105248_10111819	Ga0105248_101118194	180
2110	3300009177	Ga0105248_10681914	Ga0105248_106819142	180
2111	3300009545	Ga0105237_10066242	Ga0105237_100662422	180
2112	3300009545	Ga0105237_10175129	Ga0105237_101751293	180
2113	3300009551	Ga0105238_10031768	Ga0105238_100317686	180
2114	3300009551	Ga0105238_10313486	Ga0105238_103134862	180
2115	3300009979	Ga0105032_100739	Ga0105032_1007393	180
2116	3300010375	Ga0105239_10428657	Ga0105239_104286574	180
2117	3300011119	Ga0105246_10043410	Ga0105246_100434103	180
2118	3300011119	Ga0105246_10142610	Ga0105246_101426103	180
2119	3300013100	Ga0157373_10074160	Ga0157373_100741604	180
2120	3300013100	Ga0157373_10220520	Ga0157373_102205202	180
2121	3300013102	Ga0157371_10050552	Ga0157371_100505523	180
2122	3300013102	Ga0157371_10081932	Ga0157371_100819324	180
2123	3300013102	Ga0157371_10090670	Ga0157371_100906702	180
2124	3300013102	Ga0157371_10159743	Ga0157371_101597434	180
2125	3300013102	Ga0157371_10198988	Ga0157371_101989884	180
2126	3300013104	Ga0157370_10081101	Ga0157370_100811013	180
2127	3300013104	Ga0157370_10320819	Ga0157370_103208192	180
2128	3300013105	Ga0157369_10047440	Ga0157369_100474404	180
2129	3300013105	Ga0157369_10068956	Ga0157369_100689564	180
2130	3300013105	Ga0157369_10137986	Ga0157369_101379862	180
2131	3300013296	Ga0157374_10540921	Ga0157374_105409212	180
2132	3300013297	Ga0157378_10002252	Ga0157378_100022524	180
2133	3300013297	Ga0157378_10078261	Ga0157378_100782614	180
2134	3300013297	Ga0157378_10675766	Ga0157378_106757662	180
2135	3300013306	Ga0163162_11757281	Ga0163162_117572812	180
2136	3300013307	Ga0157372_10109152	Ga0157372_101091524	180
2137	3300013307	Ga0157372_10358449	Ga0157372_103584494	180
2138	3300013307	Ga0157372_10909382	Ga0157372_109093822	180
2139	3300013307	Ga0157372_10995356	Ga0157372_109953562	180
2140	3300014325	Ga0163163_10000304	Ga0163163_100003046	180
2141	3300014325	Ga0163163_10002238	Ga0163163_1000223811	180
2142	3300014326	Ga0157380_10415103	Ga0157380_104151033	180
2143	3300014497	Ga0182008_10068140	Ga0182008_100681403	180
2144	3300014497	Ga0182008_10156847	Ga0182008_101568473	180
2145	3300014968	Ga0157379_10027876	Ga0157379_100278766	180
2146	3300014969	Ga0157376_10286837	Ga0157376_102868374	180
2147	3300015689	Ga0183360_10001	Ga0183360_100012740	180
2148	3300020069	Ga0197907_11461921	Ga0197907_114619212	180
2149	3300020070	Ga0206356_11309913	Ga0206356_113099132	180
2150	3300020070	Ga0206356_11773737	Ga0206356_117737372	180
2151	3300020077	Ga0206351_10151579	Ga0206351_101515792	180
2152	3300020077	Ga0206351_10423965	Ga0206351_104239652	180
2153	3300020078	Ga0206352_10426777	Ga0206352_104267774	180
2154	3300020080	Ga0206350_10902162	Ga0206350_109021622	180
2155	3300020080	Ga0206350_11195945	Ga0206350_111959451	180
2156	3300020081	Ga0206354_10542630	Ga0206354_105426302	180
2157	3300020082	Ga0206353_10625963	Ga0206353_106259634	180
2158	3300020082	Ga0206353_10834072	Ga0206353_108340724	180
2159	3300020610	Ga0154015_1042565	Ga0154015_10425653	180
2160	3300020610	Ga0154015_1536303	Ga0154015_15363035	180
2161	3300022467	Ga0224712_10088180	Ga0224712_100881802	180
2162	3300025245	Ga0207425_1006106	Ga0207425_10061063	180
2163	3300025263	Ga0209565_1000001	Ga0209565_10000011133	180
2164	3300025273	Ga0209673_1000001	Ga0209673_10000011133	180
2165	3300025291	Ga0209675_1000001	Ga0209675_10000011400	180
2166	3300025294	Ga0209025_1000006	Ga0209025_100000635	180
2167	3300025295	Ga0209564_1000001	Ga0209564_10000011562	180
2168	3300025297	Ga0209758_1014771	Ga0209758_10147714	180
2169	3300025299	Ga0209256_1002493	Ga0209256_100249310	180
2170	3300025321	Ga0207656_10034750	Ga0207656_100347503	180
2171	3300025321	Ga0207656_10102111	Ga0207656_101021111	180
2172	3300025903	Ga0207680_10008634	Ga0207680_100086346	180
2173	3300025904	Ga0207647_10017860	Ga0207647_100178606	180
2174	3300025904	Ga0207647_10042642	Ga0207647_100426424	180
2175	3300025904	Ga0207647_10060669	Ga0207647_100606692	180
2176	3300025909	Ga0207705_10001937	Ga0207705_100019374	180
2177	3300025909	Ga0207705_10008038	Ga0207705_100080384	180
2178	3300025909	Ga0207705_10009186	Ga0207705_100091866	180
2179	3300025909	Ga0207705_10052989	Ga0207705_100529892	180
2180	3300025909	Ga0207705_10147273	Ga0207705_101472734	180
2181	3300025909	Ga0207705_10240746	Ga0207705_102407462	180
2182	3300025911	Ga0207654_10285983	Ga0207654_102859833	180
2183	3300025912	Ga0207707_10002633	Ga0207707_100026333	180
2184	3300025912	Ga0207707_10002946	Ga0207707_1000294610	180
2185	3300025912	Ga0207707_10100737	Ga0207707_101007373	180
2186	3300025912	Ga0207707_10182579	Ga0207707_101825792	180
2187	3300025912	Ga0207707_10303001	Ga0207707_103030013	180
2188	3300025913	Ga0207695_10000818	Ga0207695_1000081859	180
2189	3300025913	Ga0207695_10005720	Ga0207695_100057204	180
2190	3300025913	Ga0207695_10074159	Ga0207695_100741594	180
2191	3300025913	Ga0207695_10111930	Ga0207695_101119304	180
2192	3300025913	Ga0207695_10267239	Ga0207695_102672392	180
2193	3300025914	Ga0207671_10348767	Ga0207671_103487672	180
2194	3300025917	Ga0207660_10001404	Ga0207660_1000140411	180
2195	3300025917	Ga0207660_10004504	Ga0207660_100045045	180
2196	3300025917	Ga0207660_10037893	Ga0207660_100378933	180
2197	3300025917	Ga0207660_10060127	Ga0207660_100601272	180
2198	3300025917	Ga0207660_10249419	Ga0207660_102494192	180
2199	3300025919	Ga0207657_10085968	Ga0207657_100859683	180
2200	3300025920	Ga0207649_10002410	Ga0207649_100024107	180
2201	3300025920	Ga0207649_10004519	Ga0207649_100045196	180
2202	3300025920	Ga0207649_10148607	Ga0207649_101486072	180
2203	3300025920	Ga0207649_10230853	Ga0207649_102308531	180
2204	3300025920	Ga0207649_10393574	Ga0207649_103935741	180
2205	3300025921	Ga0207652_10002564	Ga0207652_1000256410	180
2206	3300025921	Ga0207652_10002764	Ga0207652_1000276410	180
2207	3300025921	Ga0207652_10080824	Ga0207652_100808243	180
2208	3300025921	Ga0207652_10177174	Ga0207652_101771742	180
2209	3300025921	Ga0207652_10181760	Ga0207652_101817603	180
2210	3300025921	Ga0207652_10231376	Ga0207652_102313764	180
2211	3300025921	Ga0207652_10271989	Ga0207652_102719892	180
2212	3300025921	Ga0207652_10442145	Ga0207652_104421452	180
2213	3300025923	Ga0207681_10122553	Ga0207681_101225533	180
2214	3300025924	Ga0207694_10454690	Ga0207694_104546902	180
2215	3300025924	Ga0207694_10556184	Ga0207694_105561841	180
2216	3300025925	Ga0207650_10823134	Ga0207650_108231342	180
2217	3300025932	Ga0207690_10001189	Ga0207690_100011894	180
2218	3300025932	Ga0207690_10001233	Ga0207690_1000123311	180
2219	3300025932	Ga0207690_10008624	Ga0207690_100086244	180
2220	3300025933	Ga0207706_10033044	Ga0207706_100330446	180
2221	3300025933	Ga0207706_10261829	Ga0207706_102618292	180
2222	3300025934	Ga0207686_10047572	Ga0207686_100475723	180
2223	3300025937	Ga0207669_10252075	Ga0207669_102520752	180
2224	3300025940	Ga0207691_10022595	Ga0207691_100225954	180
2225	3300025941	Ga0207711_10162589	Ga0207711_101625892	180
2226	3300025942	Ga0207689_10077986	Ga0207689_100779863	180
2227	3300025944	Ga0207661_10284860	Ga0207661_102848601	180
2228	3300025944	Ga0207661_10314448	Ga0207661_103144484	180
2229	3300025945	Ga0207679_10028435	Ga0207679_100284353	180
2230	3300025945	Ga0207679_10091426	Ga0207679_100914263	180
2231	3300025945	Ga0207679_10483657	Ga0207679_104836572	180
2232	3300025949	Ga0207667_10006669	Ga0207667_100066694	180
2233	3300025949	Ga0207667_10010404	Ga0207667_100104048	180
2234	3300025949	Ga0207667_10018825	Ga0207667_100188254	180
2235	3300025949	Ga0207667_10059771	Ga0207667_100597714	180
2236	3300025949	Ga0207667_10138024	Ga0207667_101380244	180
2237	3300025949	Ga0207667_10282425	Ga0207667_102824252	180
2238	3300025949	Ga0207667_10573031	Ga0207667_105730312	180
2239	3300025972	Ga0207668_10019129	Ga0207668_100191294	180
2240	3300025972	Ga0207668_10057549	Ga0207668_100575494	180
2241	3300025981	Ga0207640_10017365	Ga0207640_100173653	180
2242	3300025981	Ga0207640_10021791	Ga0207640_100217914	180
2243	3300025981	Ga0207640_10039154	Ga0207640_100391544	180
2244	3300025981	Ga0207640_10181283	Ga0207640_101812834	180
2245	3300025981	Ga0207640_10409205	Ga0207640_104092052	180
2246	3300026041	Ga0207639_10002455	Ga0207639_100024557	180
2247	3300026041	Ga0207639_10003444	Ga0207639_100034444	180
2248	3300026041	Ga0207639_10071930	Ga0207639_100719302	180
2249	3300026041	Ga0207639_10093184	Ga0207639_100931842	180
2250	3300026041	Ga0207639_10282081	Ga0207639_102820812	180
2251	3300026075	Ga0207708_11093915	Ga0207708_110939151	180
2252	3300026078	Ga0207702_10030270	Ga0207702_100302706	180
2253	3300026078	Ga0207702_10047233	Ga0207702_100472335	180
2254	3300026078	Ga0207702_10060035	Ga0207702_100600354	180
2255	3300026078	Ga0207702_10093601	Ga0207702_100936013	180
2256	3300026078	Ga0207702_10348563	Ga0207702_103485634	180
2257	3300026078	Ga0207702_10566484	Ga0207702_105664841	180
2258	3300026078	Ga0207702_10607742	Ga0207702_106077422	180
2259	3300026088	Ga0207641_10006475	Ga0207641_100064754	180
2260	3300026088	Ga0207641_10123527	Ga0207641_101235273	180
2261	3300026095	Ga0207676_10029716	Ga0207676_100297165	180
2262	3300026116	Ga0207674_10004758	Ga0207674_1000475811	180
2263	3300026116	Ga0207674_10102165	Ga0207674_101021653	180
2264	3300026118	Ga0207675_100203449	Ga0207675_1002034492	180
2265	3300026142	Ga0207698_10031854	Ga0207698_100318545	180
2266	3300026142	Ga0207698_10044265	Ga0207698_100442654	180
2267	3300026142	Ga0207698_10190970	Ga0207698_101909704	180
2268	3300026142	Ga0207698_10217152	Ga0207698_102171524	180
2269	3300026142	Ga0207698_10321538	Ga0207698_103215381	180
2270	3300026142	Ga0207698_10340257	Ga0207698_103402571	180
2271	3300026142	Ga0207698_10345475	Ga0207698_103454752	180
2272	3300027252	Ga0209973_1000651	Ga0209973_10006513	180
2273	3300027364	Ga0209967_1003102	Ga0209967_10031023	180
2274	3300027543	Ga0209999_1007190	Ga0209999_10071902	180
2275	3300027617	Ga0210002_1002230	Ga0210002_10022304	180
2276	3300027665	Ga0209983_1001182	Ga0209983_10011826	180
2277	3300027682	Ga0209971_1001747	Ga0209971_10017473	180
2278	3300027876	Ga0209974_10028237	Ga0209974_100282374	180
2279	3300028380	Ga0268265_10411812	Ga0268265_104118122	180
2280	3300028381	Ga0268264_10022866	Ga0268264_100228664	180
2281	3300028381	Ga0268264_10248343	Ga0268264_102483434	180
2282	3300030745	Ga0316182_1037902	Ga0316182_10379024	180
2283	3300031548	Ga0307408_100020277	Ga0307408_1000202773	180
2284	3300031730	Ga0307516_10181396	Ga0307516_101813964	180
2285	3300031731	Ga0307405_10232552	Ga0307405_102325522	180
2286	3300031824	Ga0307413_10010652	Ga0307413_100106524	180
2287	3300031824	Ga0307413_10096570	Ga0307413_100965703	180
2288	3300031824	Ga0307413_10170907	Ga0307413_101709072	180
2289	3300031901	Ga0307406_10014028	Ga0307406_100140282	180
2290	3300031901	Ga0307406_10157570	Ga0307406_101575701	180
2291	3300031911	Ga0307412_10331069	Ga0307412_103310692	180
2292	3300031911	Ga0307412_10867705	Ga0307412_108677051	180
2293	3300032004	Ga0307414_10037252	Ga0307414_100372525	180
2294	3300032004	Ga0307414_10063148	Ga0307414_100631484	180
2295	3300032004	Ga0307414_10088179	Ga0307414_100881794	180
2296	3300032004	Ga0307414_10133292	Ga0307414_101332924	180
2297	3300032004	Ga0307414_10189781	Ga0307414_101897812	180
2298	3300032004	Ga0307414_10763837	Ga0307414_107638371	180
2299	3300032004	Ga0307414_11001223	Ga0307414_110012231	180
2300	3300032004	Ga0307414_11058993	Ga0307414_110589931	180
2301	3300032168	Ga0316593_10060570	Ga0316593_100605701	180
2302	3300033541	Ga0316596_1011976	Ga0316596_10119763	180
2303	3300034818	Ga0373950_0040451	Ga0373950_0040451_133_765	180
2304	3300035086	Ga0373934_0192346	Ga0373934_0192346_26_625	180
2305	3300037312	Ga0395899_0013146	Ga0395899_0013146_857_1429	180
2306	3300037312	Ga0395899_0094791	Ga0395899_0094791_214_786	180
2307	3300037312	Ga0395899_0181528	Ga0395899_0181528_153_749	180
2308	3300037418	Ga0395900_0007701	Ga0395900_0007701_885_1457	180
2309	3300037418	Ga0395900_0018419	Ga0395900_0018419_1558_2130	180
2310	3300037418	Ga0395900_0059651	Ga0395900_0059651_804_1400	180
2311	3300037418	Ga0395900_0101953	Ga0395900_0101953_650_1222	180
2312	3300037466	Ga0395898_0380341	Ga0395898_0380341_582_1154	180
2313	3300038443	Ga0395901_0939099	Ga0395901_0939099_53_625	180
2314	3300039453	Ga0436362_1128374	Ga0436362_1128374_130_699	180
2315	3300041404	Ga0439436_0007411	Ga0439436_0007411_2009_2587	180
2316	3300041404	Ga0439436_0031260	Ga0439436_0031260_475_1056	180
2317	3300041406	Ga0439439_0091442	Ga0439439_0091442_60_635	180
2318	3300041413	Ga0439465_0003075	Ga0439465_0003075_928_1509	180
2319	3300041413	Ga0439465_0013442	Ga0439465_0013442_782_1363	180
2320	3300041460	Ga0451802_0888371	Ga0451802_0888371_927_1508	180
2321	3300041494	Ga0451837_0327342	Ga0451837_0327342_99_671	180
2322	3300041505	Ga0451849_0785659	Ga0451849_0785659_136_717	180
2323	3300042004	Ga0439445_0001711	Ga0439445_0001711_782_1363	180
2324	3300042007	Ga0439449_0002305	Ga0439449_0002305_6078_6659	180
2325	3300042007	Ga0439449_0018556	Ga0439449_0018556_985_1563	180
2326	3300042007	Ga0439449_0027723	Ga0439449_0027723_327_908	180
2327	3300042007	Ga0439449_0080821	Ga0439449_0080821_325_903	180
2328	3300042007	Ga0439449_0108662	Ga0439449_0108662_269_862	180
2329	3300042007	Ga0439449_0200023	Ga0439449_0200023_88_711	180
2330	3300046525	Ga0495663_0035776	Ga0495663_0035776_677_1261	180
2331	3300046537	Ga0495598_0001815	Ga0495598_0001815_666_1262	180
2332	3300046539	Ga0495621_0062012	Ga0495621_0062012_449_1045	180
2333	3300046539	Ga0495621_0084696	Ga0495621_0084696_106_690	180
2334	3300046616	Ga0495668_0019984	Ga0495668_0019984_2177_2752	180
2335	3300048912	Ga0496109_0310390	Ga0496109_0310390_362_982	180
2336	3300048917	Ga0496114_0136753	Ga0496114_0136753_1287_1868	180
2337	3300048920	Ga0496117_0155152	Ga0496117_0155152_727_1311	180
2338	3300048921	Ga0496118_0009630	Ga0496118_0009630_9081_9665	180
2339	3300048924	Ga0496121_0018787	Ga0496121_0018787_1703_2302	180
2340	3300048929	Ga0496126_0125836	Ga0496126_0125836_659_1240	180
2341	3300049130	Ga0501310_000893	Ga0501310_000893_1717_2295	180
2342	3300049568	Ga0501031_0065381	Ga0501031_0065381_318_923	180
2343	3300049569	Ga0501032_0102491	Ga0501032_0102491_1100_1705	180
2344	3300049571	Ga0501034_0010746	Ga0501034_0010746_727_1329	180
2345	3300049573	Ga0501037_0179841	Ga0501037_0179841_197_769	180
2346	3300049574	Ga0501038_0039430	Ga0501038_0039430_549_1154	180
2347	3300049575	Ga0501039_0120905	Ga0501039_0120905_785_1390	180
2348	3300049576	Ga0501040_0341704	Ga0501040_0341704_413_1018	180
2349	3300049579	Ga0501043_0104923	Ga0501043_0104923_446_1051	180
2350	3300049581	Ga0501047_0303853	Ga0501047_0303853_839_1411	180
2351	3300049582	Ga0501048_0546356	Ga0501048_0546356_173_778	180
2352	3300049585	Ga0501069_0116466	Ga0501069_0116466_90_665	180
2353	3300049585	Ga0501069_0152109	Ga0501069_0152109_263_835	180
2354	3300049586	Ga0501070_0017521	Ga0501070_0017521_4702_5274	180
2355	3300049586	Ga0501070_0048294	Ga0501070_0048294_2023_2598	180
2356	3300049586	Ga0501070_0054465	Ga0501070_0054465_630_1202	180
2357	3300049586	Ga0501070_0064217	Ga0501070_0064217_1945_2517	180
2358	3300049586	Ga0501070_0095941	Ga0501070_0095941_737_1309	180
2359	3300049586	Ga0501070_0112448	Ga0501070_0112448_436_1008	180
2360	3300049586	Ga0501070_0212755	Ga0501070_0212755_26_598	180
2361	3300049587	Ga0501071_0178158	Ga0501071_0178158_818_1390	180
2362	3300049589	Ga0501073_0020538	Ga0501073_0020538_2354_2926	180
2363	3300049590	Ga0501074_0074605	Ga0501074_0074605_27_599	180
2364	3300049593	Ga0501077_0144063	Ga0501077_0144063_10_582	180
2365	3300049661	Ga0501217_033887	Ga0501217_033887_421_996	180
2366	3300049663	Ga0501223_010780	Ga0501223_010780_750_1325	180
2367	3300049672	Ga0501239_003389	Ga0501239_003389_486_1061	180
2368	3300049680	Ga0501250_036292	Ga0501250_036292_65_640	180
2369	3300049705	Ga0501225_0021180	Ga0501225_0021180_570_1151	180
2370	3300049705	Ga0501225_0074914	Ga0501225_0074914_286_861	180
2371	3300049741	Ga0501079_0460270	Ga0501079_0460270_385_957	180
2372	3300049742	Ga0501080_0016830	Ga0501080_0016830_780_1352	180
2373	3300049742	Ga0501080_0076026	Ga0501080_0076026_185_757	180
2374	3300049742	Ga0501080_0106738	Ga0501080_0106738_1224_1799	180
2375	3300049742	Ga0501080_1187078	Ga0501080_1187078_53_625	180
2376	3300049772	Ga0501275_001031	Ga0501275_001031_1433_2020	180
2377	3300049822	Ga0501035_0035341	Ga0501035_0035341_3241_3846	180
2378	3300049822	Ga0501035_0064465	Ga0501035_0064465_1825_2397	180
2379	3300049822	Ga0501035_0240954	Ga0501035_0240954_762_1334	180
2380	3300049823	Ga0501044_0064287	Ga0501044_0064287_808_1380	180
2381	3300049823	Ga0501044_0150968	Ga0501044_0150968_1172_1777	180
2382	3300049823	Ga0501044_0419504	Ga0501044_0419504_171_743	180
2383	3300049823	Ga0501044_0443840	Ga0501044_0443840_360_932	180
2384	3300050491	nmdc:mga00v17_62772_c1	nmdc:mga00v17_62772_c1_780_1352	180
2385	iso_pu_bacteria	2916178963	2916183572	180
2386	iso_pu_bacteria	2941489479	2941490089	180
2387	2162886007	SwRhRL2b_contig_388725	SwRhRL2b_0693.00004110	181
2388	3300002737	JGI25162J39368_1000566	JGI25162J39368_100056623	181
2389	3300002737	JGI25162J39368_1001382	JGI25162J39368_10013829	181
2390	3300002771	JGI25163J39215_1000154	JGI25163J39215_10001543	181
2391	3300002772	JGI25164J39214_1000364	JGI25164J39214_100036423	181
2392	3300002773	JGI25152J39213_1000334	JGI25152J39213_10003343	181
2393	3300003751	Ga0055538_1000270	Ga0055538_100027023	181
2394	3300003752	Ga0055539_1000298	Ga0055539_100029823	181
2395	3300003756	Ga0055533_1000280	Ga0055533_100028023	181
2396	3300003759	Ga0055525_1000404	Ga0055525_100040423	181
2397	3300003841	Ga0055541_1000193	Ga0055541_100019323	181
2398	3300003856	Ga0058692_1011166	Ga0058692_10111663	181
2399	3300003856	Ga0058692_1016413	Ga0058692_10164133	181
2400	3300003856	Ga0058692_1016755	Ga0058692_10167552	181
2401	3300003856	Ga0058692_1025346	Ga0058692_10253462	181
2402	3300003856	Ga0058692_1028669	Ga0058692_10286691	181
2403	3300003856	Ga0058692_1030152	Ga0058692_10301521	181
2404	3300003856	Ga0058692_1040098	Ga0058692_10400981	181
2405	3300005272	Ga0065703_1021565	Ga0065703_10215652	181
2406	3300005288	Ga0065714_10068333	Ga0065714_100683336	181
2407	3300005289	Ga0065704_10002470	Ga0065704_100024708	181
2408	3300005289	Ga0065704_10016949	Ga0065704_100169492	181
2409	3300005289	Ga0065704_10091571	Ga0065704_100915712	181
2410	3300005289	Ga0065704_10174160	Ga0065704_101741602	181
2411	3300005289	Ga0065704_10371389	Ga0065704_103713891	181
2412	3300005328	Ga0070676_10119721	Ga0070676_101197212	181
2413	3300005336	Ga0070680_100399371	Ga0070680_1003993712	181
2414	3300005347	Ga0070668_100010246	Ga0070668_1000102463	181
2415	3300005353	Ga0070669_100065137	Ga0070669_1000651373	181
2416	3300005457	Ga0070662_100088023	Ga0070662_1000880233	181
2417	3300005548	Ga0070665_100019895	Ga0070665_1000198953	181
2418	3300005548	Ga0070665_100062280	Ga0070665_1000622804	181
2419	3300005577	Ga0068857_100000461	Ga0068857_1000004614	181
2420	3300005834	Ga0068851_10002978	Ga0068851_100029786	181
2421	3300006038	Ga0075365_10008175	Ga0075365_100081758	181
2422	3300006051	Ga0075364_10031524	Ga0075364_100315242	181
2423	3300006051	Ga0075364_10041591	Ga0075364_100415914	181
2424	3300006051	Ga0075364_10062277	Ga0075364_100622774	181
2425	3300006051	Ga0075364_10120507	Ga0075364_101205072	181
2426	3300006051	Ga0075364_10697963	Ga0075364_106979631	181
2427	3300006195	Ga0075366_10000617	Ga0075366_100006173	181
2428	3300006353	Ga0075370_10006883	Ga0075370_100068832	181
2429	3300006946	Ga0079104_1010623	Ga0079104_10106234	181
2430	3300006946	Ga0079104_1010962	Ga0079104_10109624	181
2431	3300006946	Ga0079104_1024588	Ga0079104_10245883	181
2432	3300006946	Ga0079104_1031139	Ga0079104_10311392	181
2433	3300009011	Ga0105251_10020617	Ga0105251_100206174	181
2434	3300009011	Ga0105251_10048395	Ga0105251_100483951	181
2435	3300009011	Ga0105251_10052841	Ga0105251_100528412	181
2436	3300009011	Ga0105251_10058383	Ga0105251_100583832	181
2437	3300009011	Ga0105251_10079043	Ga0105251_100790432	181
2438	3300009011	Ga0105251_10080013	Ga0105251_100800132	181
2439	3300009011	Ga0105251_10111765	Ga0105251_101117652	181
2440	3300009011	Ga0105251_10124227	Ga0105251_101242272	181
2441	3300009011	Ga0105251_10134296	Ga0105251_101342962	181
2442	3300009011	Ga0105251_10189963	Ga0105251_101899632	181
2443	3300009011	Ga0105251_10199981	Ga0105251_101999812	181
2444	3300009011	Ga0105251_10216946	Ga0105251_102169462	181
2445	3300009036	Ga0105244_10018149	Ga0105244_100181495	181
2446	3300009036	Ga0105244_10018170	Ga0105244_100181705	181
2447	3300009036	Ga0105244_10031119	Ga0105244_100311194	181
2448	3300009036	Ga0105244_10032223	Ga0105244_100322232	181
2449	3300009036	Ga0105244_10039254	Ga0105244_100392543	181
2450	3300009036	Ga0105244_10047092	Ga0105244_100470921	181
2451	3300009036	Ga0105244_10070190	Ga0105244_100701902	181
2452	3300009036	Ga0105244_10085721	Ga0105244_100857213	181
2453	3300009036	Ga0105244_10239709	Ga0105244_102397092	181
2454	3300009036	Ga0105244_10330242	Ga0105244_103302421	181
2455	3300009092	Ga0105250_10002892	Ga0105250_100028926	181
2456	3300009092	Ga0105250_10018596	Ga0105250_100185964	181
2457	3300009092	Ga0105250_10037277	Ga0105250_100372772	181
2458	3300009092	Ga0105250_10038870	Ga0105250_100388703	181
2459	3300009092	Ga0105250_10044405	Ga0105250_100444052	181
2460	3300009092	Ga0105250_10047063	Ga0105250_100470632	181
2461	3300009092	Ga0105250_10142962	Ga0105250_101429621	181
2462	3300009092	Ga0105250_10191231	Ga0105250_101912312	181
2463	3300009092	Ga0105250_10249229	Ga0105250_102492292	181
2464	3300009093	Ga0105240_10851491	Ga0105240_108514912	181
2465	3300009101	Ga0105247_10003712	Ga0105247_100037123	181
2466	3300009101	Ga0105247_10271701	Ga0105247_102717012	181
2467	3300009148	Ga0105243_10058406	Ga0105243_100584063	181
2468	3300009148	Ga0105243_10228340	Ga0105243_102283403	181
2469	3300009148	Ga0105243_10666023	Ga0105243_106660232	181
2470	3300009174	Ga0105241_10000449	Ga0105241_100004493	181
2471	3300009174	Ga0105241_10003481	Ga0105241_100034817	181
2472	3300009174	Ga0105241_10663577	Ga0105241_106635772	181
2473	3300009545	Ga0105237_10014180	Ga0105237_100141803	181
2474	3300009545	Ga0105237_10155852	Ga0105237_101558524	181
2475	3300010375	Ga0105239_11797138	Ga0105239_117971381	181
2476	3300011119	Ga0105246_10162691	Ga0105246_101626912	181
2477	3300013100	Ga0157373_10039043	Ga0157373_100390433	181
2478	3300013100	Ga0157373_10237607	Ga0157373_102376072	181
2479	3300013100	Ga0157373_10541027	Ga0157373_105410271	181
2480	3300013102	Ga0157371_10001231	Ga0157371_100012313	181
2481	3300013102	Ga0157371_10002740	Ga0157371_100027403	181
2482	3300013102	Ga0157371_10036785	Ga0157371_100367853	181
2483	3300013102	Ga0157371_10061445	Ga0157371_100614454	181
2484	3300013102	Ga0157371_10460327	Ga0157371_104603272	181
2485	3300013102	Ga0157371_10816397	Ga0157371_108163971	181
2486	3300013104	Ga0157370_10013884	Ga0157370_100138843	181
2487	3300013104	Ga0157370_10103903	Ga0157370_101039034	181
2488	3300013104	Ga0157370_10264033	Ga0157370_102640334	181
2489	3300013104	Ga0157370_10875814	Ga0157370_108758142	181
2490	3300013105	Ga0157369_10020428	Ga0157369_100204283	181
2491	3300013105	Ga0157369_11431280	Ga0157369_114312801	181
2492	3300013105	Ga0157369_11497667	Ga0157369_114976671	181
2493	3300013296	Ga0157374_10454332	Ga0157374_104543323	181
2494	3300013306	Ga0163162_10069094	Ga0163162_100690942	181
2495	3300013306	Ga0163162_10103665	Ga0163162_101036653	181
2496	3300013306	Ga0163162_10398189	Ga0163162_103981892	181
2497	3300013307	Ga0157372_10014121	Ga0157372_100141217	181
2498	3300013307	Ga0157372_10016993	Ga0157372_100169932	181
2499	3300013307	Ga0157372_10184632	Ga0157372_101846323	181
2500	3300013307	Ga0157372_11804675	Ga0157372_118046751	181
2501	3300013307	Ga0157372_11804676	Ga0157372_118046761	181
2502	3300014497	Ga0182008_10003699	Ga0182008_100036993	181
2503	3300014497	Ga0182008_10031766	Ga0182008_100317663	181
2504	3300014969	Ga0157376_10465754	Ga0157376_104657542	181
2505	3300015261	Ga0182006_1000574	Ga0182006_10005743	181
2506	3300015261	Ga0182006_1026763	Ga0182006_10267634	181
2507	3300015261	Ga0182006_1176099	Ga0182006_11760991	181
2508	3300015262	Ga0182007_10010950	Ga0182007_100109503	181
2509	3300015679	Ga0183366_1010	Ga0183366_10103	181
2510	3300015680	Ga0183370_1010	Ga0183370_10103	181
2511	3300015685	Ga0183369_1025	Ga0183369_10253	181
2512	3300015687	Ga0183368_1013	Ga0183368_10133	181
2513	3300017792	Ga0163161_10004249	Ga0163161_100042493	181
2514	3300017792	Ga0163161_10021406	Ga0163161_100214066	181
2515	3300017792	Ga0163161_10054417	Ga0163161_100544173	181
2516	3300020077	Ga0206351_10145385	Ga0206351_101453856	181
2517	3300021377	Ga0213874_10196679	Ga0213874_101966791	181
2518	3300021384	Ga0213876_10000387	Ga0213876_100003873	181
2519	3300025207	Ga0209760_100180	Ga0209760_10018013	181
2520	3300025207	Ga0209760_101217	Ga0209760_1012172	181
2521	3300025224	Ga0209784_100291	Ga0209784_1002913	181
2522	3300025225	Ga0209566_100498	Ga0209566_1004983	181
2523	3300025226	Ga0209674_100342	Ga0209674_1003423	181
2524	3300025230	Ga0209563_100230	Ga0209563_1002303	181
2525	3300025231	Ga0207427_100370	Ga0207427_1003703	181
2526	3300025233	Ga0209437_100515	Ga0209437_1005153	181
2527	3300025233	Ga0209437_100541	Ga0209437_1005413	181
2528	3300025253	Ga0209677_100373	Ga0209677_1003733	181
2529	3300025258	Ga0209129_1000464	Ga0209129_10004643	181
2530	3300025261	Ga0209233_1000946	Ga0209233_10009466	181
2531	3300025321	Ga0207656_10003933	Ga0207656_100039334	181
2532	3300025711	Ga0207696_1000512	Ga0207696_10005123	181
2533	3300025711	Ga0207696_1000531	Ga0207696_10005313	181
2534	3300025711	Ga0207696_1000593	Ga0207696_10005933	181
2535	3300025711	Ga0207696_1000597	Ga0207696_100059722	181
2536	3300025711	Ga0207696_1000599	Ga0207696_10005993	181
2537	3300025711	Ga0207696_1001158	Ga0207696_10011589	181
2538	3300025711	Ga0207696_1001209	Ga0207696_10012093	181
2539	3300025711	Ga0207696_1002273	Ga0207696_10022733	181
2540	3300025711	Ga0207696_1023203	Ga0207696_10232033	181
2541	3300025711	Ga0207696_1045573	Ga0207696_10455732	181
2542	3300025728	Ga0207655_1000805	Ga0207655_100080512	181
2543	3300025728	Ga0207655_1005044	Ga0207655_10050447	181
2544	3300025728	Ga0207655_1008349	Ga0207655_10083493	181
2545	3300025728	Ga0207655_1010779	Ga0207655_10107796	181
2546	3300025728	Ga0207655_1014338	Ga0207655_10143382	181
2547	3300025728	Ga0207655_1017007	Ga0207655_10170073	181
2548	3300025728	Ga0207655_1027767	Ga0207655_10277674	181
2549	3300025728	Ga0207655_1031010	Ga0207655_10310103	181
2550	3300025728	Ga0207655_1032332	Ga0207655_10323324	181
2551	3300025728	Ga0207655_1049189	Ga0207655_10491892	181
2552	3300025728	Ga0207655_1052126	Ga0207655_10521262	181
2553	3300025735	Ga0207713_1000712	Ga0207713_100071227	181
2554	3300025735	Ga0207713_1000931	Ga0207713_10009313	181
2555	3300025735	Ga0207713_1008383	Ga0207713_10083836	181
2556	3300025735	Ga0207713_1017633	Ga0207713_10176333	181
2557	3300025735	Ga0207713_1018372	Ga0207713_10183723	181
2558	3300025735	Ga0207713_1018417	Ga0207713_10184174	181
2559	3300025735	Ga0207713_1021327	Ga0207713_10213274	181
2560	3300025735	Ga0207713_1022394	Ga0207713_10223943	181
2561	3300025735	Ga0207713_1046396	Ga0207713_10463962	181
2562	3300025735	Ga0207713_1062375	Ga0207713_10623752	181
2563	3300025900	Ga0207710_10000424	Ga0207710_1000042423	181
2564	3300025911	Ga0207654_10000282	Ga0207654_100002823	181
2565	3300025911	Ga0207654_10000464	Ga0207654_1000046417	181
2566	3300025914	Ga0207671_10068036	Ga0207671_100680363	181
2567	3300025923	Ga0207681_10083330	Ga0207681_100833302	181
2568	3300025933	Ga0207706_10135385	Ga0207706_101353853	181
2569	3300025935	Ga0207709_10006449	Ga0207709_100064496	181
2570	3300025935	Ga0207709_10034933	Ga0207709_100349333	181
2571	3300025935	Ga0207709_10621165	Ga0207709_106211651	181
2572	3300025941	Ga0207711_10753926	Ga0207711_107539262	181
2573	3300025972	Ga0207668_10008501	Ga0207668_100085013	181
2574	3300026041	Ga0207639_10572602	Ga0207639_105726021	181
2575	3300026116	Ga0207674_10001609	Ga0207674_100016093	181
2576	3300027111	Ga0209281_1000581	Ga0209281_100058125	181
2577	3300027111	Ga0209281_1000756	Ga0209281_100075627	181
2578	3300027111	Ga0209281_1000803	Ga0209281_100080325	181
2579	3300027111	Ga0209281_1000810	Ga0209281_100081025	181
2580	3300027111	Ga0209281_1001632	Ga0209281_10016326	181
2581	3300027111	Ga0209281_1006505	Ga0209281_10065054	181
2582	3300027111	Ga0209281_1007130	Ga0209281_10071302	181
2583	3300027111	Ga0209281_1013013	Ga0209281_10130132	181
2584	3300027111	Ga0209281_1015375	Ga0209281_10153753	181
2585	3300027111	Ga0209281_1022024	Ga0209281_10220242	181
2586	3300027111	Ga0209281_1033283	Ga0209281_10332832	181
2587	3300027312	Ga0209371_1000656	Ga0209371_100065626	181
2588	3300027312	Ga0209371_1000680	Ga0209371_10006803	181
2589	3300027312	Ga0209371_1001128	Ga0209371_100112814	181
2590	3300027312	Ga0209371_1002769	Ga0209371_10027696	181
2591	3300027312	Ga0209371_1002801	Ga0209371_10028013	181
2592	3300027312	Ga0209371_1007177	Ga0209371_10071774	181
2593	3300027312	Ga0209371_1008096	Ga0209371_10080965	181
2594	3300027312	Ga0209371_1010069	Ga0209371_10100693	181
2595	3300027312	Ga0209371_1010622	Ga0209371_10106223	181
2596	3300027312	Ga0209371_1015739	Ga0209371_10157392	181
2597	3300027312	Ga0209371_1019313	Ga0209371_10193133	181
2598	3300027312	Ga0209371_1033105	Ga0209371_10331052	181
2599	3300028379	Ga0268266_10000079	Ga0268266_100000794	181
2600	3300028379	Ga0268266_10006932	Ga0268266_100069327	181
2601	3300030500	Ga0268256_1000584	Ga0268256_10005843	181
2602	3300030500	Ga0268256_1000623	Ga0268256_10006233	181
2603	3300030500	Ga0268256_1004154	Ga0268256_10041541	181
2604	3300030500	Ga0268256_1004426	Ga0268256_10044263	181
2605	3300030500	Ga0268256_1006331	Ga0268256_10063311	181
2606	3300030500	Ga0268256_1008378	Ga0268256_10083785	181
2607	3300030500	Ga0268256_1010748	Ga0268256_10107484	181
2608	3300030500	Ga0268256_1011253	Ga0268256_10112533	181
2609	3300030500	Ga0268256_1014204	Ga0268256_10142043	181
2610	3300030500	Ga0268256_1020526	Ga0268256_10205262	181
2611	3300030500	Ga0268256_1036385	Ga0268256_10363852	181
2612	3300030500	Ga0268256_1036901	Ga0268256_10369011	181
2613	3300032168	Ga0316593_10003485	Ga0316593_100034852	181
2614	3300032168	Ga0316593_10007068	Ga0316593_100070683	181
2615	3300032168	Ga0316593_10015158	Ga0316593_100151583	181
2616	3300032168	Ga0316593_10047649	Ga0316593_100476491	181
2617	3300032168	Ga0316593_10231884	Ga0316593_102318841	181
2618	3300039062	Ga0400483_059643	Ga0400483_059643_22379_22927	181
2619	3300039062	Ga0400483_242937	Ga0400483_242937_703_1251	181
2620	3300039093	Ga0400489_45645	Ga0400489_45645_741_1289	181
2621	3300039437	Ga0436365_0628801	Ga0436365_0628801_35731_36276	181
2622	3300039437	Ga0436365_0857921	Ga0436365_0857921_1531_2106	181
2623	3300039450	Ga0436363_0574461	Ga0436363_0574461_481_1056	181
2624	3300041405	Ga0439438_000065	Ga0439438_000065_24503_25048	181
2625	3300041405	Ga0439438_002016	Ga0439438_002016_7217_7762	181
2626	3300041405	Ga0439438_002194	Ga0439438_002194_7164_7709	181
2627	3300041405	Ga0439438_005052	Ga0439438_005052_3549_4094	181
2628	3300041405	Ga0439438_015549	Ga0439438_015549_1523_2068	181
2629	3300041407	Ga0439447_001007	Ga0439447_001007_735_1280	181
2630	3300041407	Ga0439447_002531	Ga0439447_002531_5341_5886	181
2631	3300041407	Ga0439447_007199	Ga0439447_007199_855_1400	181
2632	3300041411	Ga0439466_0000114	Ga0439466_0000114_5929_6474	181
2633	3300041486	Ga0451807_1079531	Ga0451807_1079531_110_655	181
2634	3300042006	Ga0439432_014481	Ga0439432_014481_976_1521	181
2635	3300042006	Ga0439432_034951	Ga0439432_034951_735_1280	181
2636	3300042006	Ga0439432_045642	Ga0439432_045642_18_563	181
2637	3300042006	Ga0439432_059295	Ga0439432_059295_398_943	181
2638	3300042007	Ga0439449_0010785	Ga0439449_0010785_1698_2243	181
2639	3300042010	Ga0439452_000335	Ga0439452_000335_77_622	181
2640	3300042010	Ga0439452_000392	Ga0439452_000392_24750_25295	181
2641	3300042010	Ga0439452_002113	Ga0439452_002113_6161_6706	181
2642	3300042010	Ga0439452_011107	Ga0439452_011107_667_1212	181
2643	3300042010	Ga0439452_033283	Ga0439452_033283_668_1213	181
2644	3300042010	Ga0439452_047881	Ga0439452_047881_379_924	181
2645	3300042013	Ga0439456_051564	Ga0439456_051564_213_758	181
2646	3300042127	Ga0450890_017206	Ga0450890_017206_305_850	181
2647	3300042137	Ga0450902_000769	Ga0450902_000769_3077_3622	181
2648	3300042146	Ga0450907_001482	Ga0450907_001482_3717_4262	181
2649	3300042439	Ga0439464_0000183	Ga0439464_0000183_2550_3095	181
2650	3300042439	Ga0439464_0000850	Ga0439464_0000850_5418_5963	181
2651	3300042439	Ga0439464_0006735	Ga0439464_0006735_2110_2655	181
2652	3300044669	Ga0466981_0000054	Ga0466981_0000054_788_1333	181
2653	3300044673	Ga0453683_0398435	Ga0453683_0398435_227_781	181
2654	3300046453	Ga0495627_000477	Ga0495627_000477_26247_26792	181
2655	3300046458	Ga0495591_000543	Ga0495591_000543_744_1289	181
2656	3300046458	Ga0495591_002788	Ga0495591_002788_999_1544	181
2657	3300046460	Ga0495638_0076004	Ga0495638_0076004_753_1298	181
2658	3300046471	Ga0495650_0000892	Ga0495650_0000892_5983_6528	181
2659	3300046471	Ga0495650_0001118	Ga0495650_0001118_27979_28524	181
2660	3300046471	Ga0495650_0001197	Ga0495650_0001197_795_1340	181
2661	3300046474	Ga0495605_0096853	Ga0495605_0096853_456_1001	181
2662	3300046491	Ga0495584_0007053	Ga0495584_0007053_1528_2073	181
2663	3300046500	Ga0495596_0005528	Ga0495596_0005528_3186_3731	181
2664	3300046501	Ga0495607_0042497	Ga0495607_0042497_1128_1673	181
2665	3300046507	Ga0495606_0016276	Ga0495606_0016276_3894_4439	181
2666	3300046513	Ga0495616_0022270	Ga0495616_0022270_963_1508	181
2667	3300046518	Ga0495631_0017419	Ga0495631_0017419_511_1056	181
2668	3300046523	Ga0495644_0009544	Ga0495644_0009544_742_1287	181
2669	3300046524	Ga0495648_0010675	Ga0495648_0010675_4858_5403	181
2670	3300046530	Ga0495654_0000419	Ga0495654_0000419_28510_29055	181
2671	3300046530	Ga0495654_0030855	Ga0495654_0030855_375_920	181
2672	3300046542	Ga0495597_0000561	Ga0495597_0000561_29494_30039	181
2673	3300046674	Ga0495588_0075821	Ga0495588_0075821_830_1375	181
2674	3300046692	Ga0495671_0001092	Ga0495671_0001092_3227_3772	181
2675	3300046794	Ga0495589_0000511	Ga0495589_0000511_25709_26254	181
2676	3300046794	Ga0495589_0016531	Ga0495589_0016531_769_1314	181
2677	3300046810	Ga0495660_0000413	Ga0495660_0000413_7089_7634	181
2678	3300046810	Ga0495660_0000474	Ga0495660_0000474_6782_7327	181
2679	3300046810	Ga0495660_0024423	Ga0495660_0024423_748_1293	181
2680	3300047320	Ga0495672_0000679	Ga0495672_0000679_30695_31240	181
2681	3300047320	Ga0495672_0000719	Ga0495672_0000719_7140_7685	181
2682	3300047320	Ga0495672_0000881	Ga0495672_0000881_24612_25157	181
2683	3300047323	Ga0495683_0028991	Ga0495683_0028991_786_1331	181
2684	3300047446	Ga0495679_000077	Ga0495679_000077_8331_8876	181
2685	3300047446	Ga0495679_007017	Ga0495679_007017_721_1266	181
2686	3300047446	Ga0495679_035293	Ga0495679_035293_322_867	181
2687	3300047469	Ga0495673_0000581	Ga0495673_0000581_7519_8064	181
2688	3300047469	Ga0495673_0000827	Ga0495673_0000827_739_1284	181
2689	3300048903	Ga0496100_0055454	Ga0496100_0055454_861_1406	181
2690	3300048905	Ga0496102_0134141	Ga0496102_0134141_781_1326	181
2691	3300048907	Ga0496104_0000670	Ga0496104_0000670_28014_28559	181
2692	3300048907	Ga0496104_0049579	Ga0496104_0049579_2658_3203	181
2693	3300048908	Ga0496105_0114093	Ga0496105_0114093_27_572	181
2694	3300048908	Ga0496105_0194074	Ga0496105_0194074_89_634	181
2695	3300048913	Ga0496110_0060639	Ga0496110_0060639_792_1337	181
2696	3300048916	Ga0496113_0059816	Ga0496113_0059816_2284_2829	181
2697	3300048917	Ga0496114_0162862	Ga0496114_0162862_102_677	181
2698	3300048918	Ga0496115_0000256	Ga0496115_0000256_22933_23508	181
2699	3300048919	Ga0496116_0001114	Ga0496116_0001114_30378_30923	181
2700	3300048919	Ga0496116_0001347	Ga0496116_0001347_761_1306	181
2701	3300048919	Ga0496116_0006433	Ga0496116_0006433_5620_6165	181
2702	3300048919	Ga0496116_0007604	Ga0496116_0007604_8293_8838	181
2703	3300048919	Ga0496116_0031269	Ga0496116_0031269_2095_2640	181
2704	3300048919	Ga0496116_0050388	Ga0496116_0050388_76_621	181
2705	3300048919	Ga0496116_0054507	Ga0496116_0054507_1330_1875	181
2706	3300048919	Ga0496116_0093398	Ga0496116_0093398_537_1082	181
2707	3300048919	Ga0496116_0117890	Ga0496116_0117890_26_571	181
2708	3300048920	Ga0496117_0001935	Ga0496117_0001935_761_1306	181
2709	3300048920	Ga0496117_0002080	Ga0496117_0002080_19477_20022	181
2710	3300048920	Ga0496117_0009196	Ga0496117_0009196_779_1324	181
2711	3300048920	Ga0496117_0040227	Ga0496117_0040227_578_1123	181
2712	3300048920	Ga0496117_0071854	Ga0496117_0071854_788_1333	181
2713	3300048920	Ga0496117_0131170	Ga0496117_0131170_456_1001	181
2714	3300048920	Ga0496117_0166084	Ga0496117_0166084_588_1133	181
2715	3300048920	Ga0496117_0395167	Ga0496117_0395167_56_601	181
2716	3300048921	Ga0496118_0006752	Ga0496118_0006752_11114_11659	181
2717	3300048921	Ga0496118_0009809	Ga0496118_0009809_767_1312	181
2718	3300048921	Ga0496118_0017106	Ga0496118_0017106_5290_5835	181
2719	3300048921	Ga0496118_0018317	Ga0496118_0018317_761_1306	181
2720	3300048921	Ga0496118_0044470	Ga0496118_0044470_2399_2974	181
2721	3300048921	Ga0496118_0092545	Ga0496118_0092545_775_1320	181
2722	3300048921	Ga0496118_0098907	Ga0496118_0098907_645_1190	181
2723	3300048921	Ga0496118_0203765	Ga0496118_0203765_381_926	181
2724	3300048922	Ga0496119_0001676	Ga0496119_0001676_24613_25158	181
2725	3300048922	Ga0496119_0012809	Ga0496119_0012809_763_1308	181
2726	3300048922	Ga0496119_0013010	Ga0496119_0013010_5312_5857	181
2727	3300048922	Ga0496119_0025070	Ga0496119_0025070_2471_3016	181
2728	3300048922	Ga0496119_0027480	Ga0496119_0027480_755_1300	181
2729	3300048922	Ga0496119_0035104	Ga0496119_0035104_2451_2996	181
2730	3300048922	Ga0496119_0036271	Ga0496119_0036271_859_1404	181
2731	3300048922	Ga0496119_0080908	Ga0496119_0080908_540_1085	181
2732	3300048922	Ga0496119_0095460	Ga0496119_0095460_754_1299	181
2733	3300048922	Ga0496119_0148831	Ga0496119_0148831_295_840	181
2734	3300048922	Ga0496119_0275997	Ga0496119_0275997_85_630	181
2735	3300048923	Ga0496120_0001292	Ga0496120_0001292_28847_29392	181
2736	3300048923	Ga0496120_0001793	Ga0496120_0001793_6764_7309	181
2737	3300048923	Ga0496120_0003484	Ga0496120_0003484_11950_12495	181
2738	3300048923	Ga0496120_0005871	Ga0496120_0005871_8333_8878	181
2739	3300048923	Ga0496120_0009583	Ga0496120_0009583_6288_6833	181
2740	3300048923	Ga0496120_0021238	Ga0496120_0021238_1764_2309	181
2741	3300048923	Ga0496120_0042458	Ga0496120_0042458_1014_1559	181
2742	3300048923	Ga0496120_0132067	Ga0496120_0132067_295_840	181
2743	3300048923	Ga0496120_0132069	Ga0496120_0132069_438_983	181
2744	3300048924	Ga0496121_0005739	Ga0496121_0005739_8760_9305	181
2745	3300048924	Ga0496121_0006044	Ga0496121_0006044_13491_14036	181
2746	3300048924	Ga0496121_0012288	Ga0496121_0012288_770_1315	181
2747	3300048924	Ga0496121_0147981	Ga0496121_0147981_217_762	181
2748	3300048924	Ga0496121_0245597	Ga0496121_0245597_451_996	181
2749	3300048925	Ga0496122_0002332	Ga0496122_0002332_26071_26616	181
2750	3300048925	Ga0496122_0038209	Ga0496122_0038209_3241_3786	181
2751	3300048925	Ga0496122_0039727	Ga0496122_0039727_748_1293	181
2752	3300048925	Ga0496122_0052996	Ga0496122_0052996_1036_1581	181
2753	3300048925	Ga0496122_0054166	Ga0496122_0054166_443_988	181
2754	3300048925	Ga0496122_0056653	Ga0496122_0056653_1605_2150	181
2755	3300048925	Ga0496122_0105579	Ga0496122_0105579_788_1333	181
2756	3300048926	Ga0496123_0008275	Ga0496123_0008275_755_1300	181
2757	3300048926	Ga0496123_0013804	Ga0496123_0013804_748_1293	181
2758	3300048926	Ga0496123_0017937	Ga0496123_0017937_3896_4441	181
2759	3300048926	Ga0496123_0033088	Ga0496123_0033088_3067_3612	181
2760	3300048926	Ga0496123_0047037	Ga0496123_0047037_770_1315	181
2761	3300048926	Ga0496123_0087239	Ga0496123_0087239_788_1333	181
2762	3300048927	Ga0496124_0000632	Ga0496124_0000632_22532_23077	181
2763	3300048927	Ga0496124_0001727	Ga0496124_0001727_810_1355	181
2764	3300048927	Ga0496124_0002542	Ga0496124_0002542_22362_22907	181
2765	3300048927	Ga0496124_0008243	Ga0496124_0008243_763_1308	181
2766	3300048927	Ga0496124_0010014	Ga0496124_0010014_826_1371	181
2767	3300048927	Ga0496124_0076505	Ga0496124_0076505_1604_2149	181
2768	3300048927	Ga0496124_0098142	Ga0496124_0098142_1058_1603	181
2769	3300048927	Ga0496124_0235176	Ga0496124_0235176_92_637	181
2770	3300048927	Ga0496124_0246814	Ga0496124_0246814_328_873	181
2771	3300048928	Ga0496125_0001897	Ga0496125_0001897_19679_20224	181
2772	3300048928	Ga0496125_0002049	Ga0496125_0002049_25928_26473	181
2773	3300048928	Ga0496125_0014774	Ga0496125_0014774_748_1293	181
2774	3300048928	Ga0496125_0040899	Ga0496125_0040899_1702_2247	181
2775	3300048928	Ga0496125_0067059	Ga0496125_0067059_760_1305	181
2776	3300048929	Ga0496126_0002533	Ga0496126_0002533_794_1369	181
2777	3300048929	Ga0496126_0002654	Ga0496126_0002654_22402_22947	181
2778	3300048929	Ga0496126_0023902	Ga0496126_0023902_3812_4357	181
2779	3300048929	Ga0496126_0061738	Ga0496126_0061738_974_1519	181
2780	3300048929	Ga0496126_0083282	Ga0496126_0083282_1702_2247	181
2781	3300048929	Ga0496126_0165330	Ga0496126_0165330_688_1233	181
2782	3300048929	Ga0496126_0181532	Ga0496126_0181532_853_1398	181
2783	3300048929	Ga0496126_0250380	Ga0496126_0250380_117_662	181
2784	3300048929	Ga0496126_0350476	Ga0496126_0350476_571_1116	181
2785	3300049459	Ga0495678_006854	Ga0495678_006854_3866_4411	181
2786	3300049459	Ga0495678_040746	Ga0495678_040746_1303_1848	181
2787	3300049460	Ga0495682_0000831	Ga0495682_0000831_17445_17990	181
2788	3300049569	Ga0501032_0159259	Ga0501032_0159259_83_655	181
2789	3300049571	Ga0501034_0047606	Ga0501034_0047606_2066_2638	181
2790	3300049571	Ga0501034_0148511	Ga0501034_0148511_1412_1990	181
2791	3300049571	Ga0501034_0277854	Ga0501034_0277854_331_909	181
2792	3300049572	Ga0501036_0020291	Ga0501036_0020291_2526_3104	181
2793	3300049572	Ga0501036_0230528	Ga0501036_0230528_386_958	181
2794	3300049575	Ga0501039_0412417	Ga0501039_0412417_32_610	181
2795	3300049579	Ga0501043_0111464	Ga0501043_0111464_1425_2003	181
2796	3300049579	Ga0501043_0184256	Ga0501043_0184256_452_1030	181
2797	3300049580	Ga0501046_0072771	Ga0501046_0072771_1884_2462	181
2798	3300049581	Ga0501047_0039200	Ga0501047_0039200_2231_2809	181
2799	3300049581	Ga0501047_0080066	Ga0501047_0080066_1967_2539	181
2800	3300049581	Ga0501047_0163219	Ga0501047_0163219_670_1248	181
2801	3300049584	Ga0501068_0030728	Ga0501068_0030728_2089_2661	181
2802	3300049586	Ga0501070_0129103	Ga0501070_0129103_706_1284	181
2803	3300049586	Ga0501070_0353415	Ga0501070_0353415_425_1003	181
2804	3300049589	Ga0501073_0021358	Ga0501073_0021358_3470_4042	181
2805	3300049589	Ga0501073_0049711	Ga0501073_0049711_579_1157	181
2806	3300049590	Ga0501074_0013772	Ga0501074_0013772_874_1452	181
2807	3300049590	Ga0501074_0150893	Ga0501074_0150893_673_1251	181
2808	3300049742	Ga0501080_0016783	Ga0501080_0016783_625_1197	181
2809	3300049742	Ga0501080_0132487	Ga0501080_0132487_1070_1648	181
2810	3300049742	Ga0501080_0298124	Ga0501080_0298124_179_757	181
2811	3300049744	Ga0501083_0001675	Ga0501083_0001675_2190_2762	181
2812	3300050491	nmdc:mga00v17_105616_c1	nmdc:mga00v17_105616_c1_207_752	181
2813	3300050491	nmdc:mga00v17_35978_c1	nmdc:mga00v17_35978_c1_750_1295	181
2814	3300050491	nmdc:mga00v17_99787_c1	nmdc:mga00v17_99787_c1_770_1315	181
2815	3300050492	nmdc:mga0yw44_2510_c1	nmdc:mga0yw44_2510_c1_5260_5820	181
2816	3300050493	nmdc:mga0k408_1334_c1	nmdc:mga0k408_1334_c1_55_600	181
2817	3300050494	nmdc:mga06z11_36378_c1	nmdc:mga06z11_36378_c1_889_1464	181
2818	3300050496	nmdc:mga07m45_9450_c2	nmdc:mga07m45_9450_c2_573_1127	181
2819	3300053126	Ga0500621_000030	Ga0500621_000030_7154_7699	181
2820	iso_pu_bacteria	2887630918	2887633763	181

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02357

NusG

Transcription termination factor nusG

27

141

0.91 PF00467

KOW

KOW motif

159

194

0.86 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
5xog-assembly1.cif.gz_W	rna polymerase ii elongation complex bound with spt5 kow5 and elf1	0.9272	130	181
4ytl-assembly2.cif.gz_B	structure of the kow2-kow3 domain of transcription elongation factor spt5.	0.9158	128	180
5xfq-assembly1.cif.gz_B	ternary complex of phf1, a dna duplex and a histone peptide	0.9145	128	180
8h43-assembly3.cif.gz_C	crystal structure of phf1 tudor domain in complex with hit 1	0.9126	128	180
7pks-assembly1.cif.gz_Z	structural basis of integrator-mediated transcription regulation	0.9114	130	181

ID	Description	Score	Start	End	Superfamily
af_Q10BA7_272_328_2.30.30.30	Mainly Beta;Roll;SH3 type barrels.;	0.9908	128	181	2.30.30.30
2xhcA03	Mainly Beta;Roll;SH3 type barrels.;	0.9745	128	180	2.30.30.30
2lq8A02	Mainly Beta;Roll;SH3 type barrels.;	0.9451	128	180	2.30.30.30
af_Q94AA3_277_328_2.30.30.30	Mainly Beta;Roll;SH3 type barrels.;	0.9441	128	179	2.30.30.30
4zn1A02	Mainly Beta;Roll;SH3 type barrels.;	0.9426	128	181	2.30.30.30

ID	Description	Score	Start	End	GO Terms
AF-A0A3R7WK22-F1-model_v4	deleted	1.004	128	181
AF-A0A7V5R2C2-F1-model_v4	KOW domain-containing protein	0.9904	125	180	GO:0032784
AF-A0A3R7WK22-F1-model_v4	deleted	0.9853	128	181
AF-A0A4Q6CKU3-F1-model_v4	Transcription termination/antitermination protein NusG	0.9802	125	180	GO:0005829 GO:0006353 GO:0031564 GO:0032784
AF-A0A3D5CEE0-F1-model_v4	Transcription termination/antitermination protein NusG	0.9766	128	181	GO:0005829 GO:0006353 GO:0031564 GO:0032784

Feature Viewer

pLDDT	pTM	Quality
81.72	0.55	Medium

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F497082

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF02357

NusG

Transcription termination factor nusG

27

141

0.91

PF00467

KOW

KOW motif

159

194

0.86

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map