metagRoot

F497068

General Info

Members	Datasets	Scaffolds	Average Seq Length
2801	817	5602	216

Family's Representative Sequence

Representative Sequence	3300031249\|Ga0265339_10028333\|Ga0265339_100283332
Length	215
Sequence	MSVAIVDYGSGNLHSAHKAFERAAREAGLDCVVKVTSDPEYVQRAEHVVLPGVGAFADCRRGLDAAPGMVEALEDAVRRRGRPFLGICVGMQLMATRGLEHQVVAGLDWIRGDVAKIPEAPGLKIPHMGWNTLQVRRDHPLLAGIAVGEAGLHAYFVHSFQLEPADPADLVAIADYGGPVTAMVGRENVVGTQFHPEKSQKLGLALIANFLRWRP

Samples

	Sample ID	Description	Type	Environment
1	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
2	2010549000	Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes	Metagenome	Endosphere
3	3300000042	Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young	Metagenome	Rhizosphere
4	3300000043	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere	Metagenome	Rhizosphere
5	3300000652	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA	Metagenome	Rhizosphere
6	3300001978	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6	Metagenome	Rhizosphere
7	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
8	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
9	3300001990	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3	Metagenome	Rhizosphere
10	3300001991	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2	Metagenome	Rhizosphere
11	3300002067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1	Metagenome	Rhizosphere
12	3300002070	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4	Metagenome	Rhizosphere
13	3300002073	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4	Metagenome	Rhizosphere
14	3300002074	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1	Metagenome	Rhizosphere
15	3300002075	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4	Metagenome	Rhizosphere
16	3300002076	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3	Metagenome	Rhizosphere
17	3300002077	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3	Metagenome	Rhizosphere
18	3300002126	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5	Metagenome	Rhizosphere
19	3300002155	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7	Metagenome	Rhizosphere
20	3300002244	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1	Metagenome	Rhizosphere
21	3300002459	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6	Metagenome	Rhizosphere
22	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
23	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
24	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
25	3300003659	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
26	3300003752	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2	Metagenome	Endosphere
27	3300003762	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2	Metagenome	Endosphere
28	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
29	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
30	3300005277	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2)	Metagenome	Rhizosphere
31	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
32	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
33	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
34	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
35	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
36	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
37	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
38	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
39	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
40	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
41	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
42	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
43	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
44	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
45	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
46	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
47	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
48	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
49	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
50	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
51	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
52	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
53	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
54	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
55	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
56	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
57	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
58	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
59	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
60	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
61	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
62	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
63	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
64	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
65	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
66	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
67	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
68	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
69	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
70	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
71	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
72	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
73	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
74	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
75	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
76	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
77	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
78	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
79	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
80	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
81	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
82	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
83	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
84	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
85	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
86	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
87	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
88	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
89	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
90	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
91	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
92	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
93	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
94	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
95	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
96	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
97	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
98	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
99	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
100	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
101	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
102	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
103	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
104	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
105	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
106	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
107	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
108	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
109	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
110	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
111	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
112	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
113	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
114	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
115	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
116	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
117	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
118	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
119	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
120	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
121	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
122	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
123	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
124	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
125	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
126	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
127	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
128	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
129	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
130	3300006942	Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW	Metagenome	Nodule
131	3300006943	Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW	Metagenome	Nodule
132	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
133	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
134	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
135	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
136	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
137	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
138	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
139	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
140	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
141	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
142	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
143	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
144	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
145	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
146	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
147	3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Metagenome	Rhizosphere
148	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
149	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
150	3300012488	Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610	Metagenome	Rhizosphere
151	3300012492	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610	Metagenome	Rhizosphere
152	3300012494	Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610	Metagenome	Rhizosphere
153	3300012503	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R	Metagenome	Rhizosphere
154	3300012507	Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610	Metagenome	Rhizosphere
155	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
156	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
157	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
158	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
159	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
160	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
161	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
162	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
163	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
164	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
165	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
166	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
167	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
168	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
169	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
170	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
171	3300020081	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
172	3300020082	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
173	3300021320	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3	Metagenome	Nodule
174	3300021321	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1	Metagenome	Nodule
175	3300021324	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4	Metagenome	Nodule
176	3300021327	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2	Metagenome	Nodule
177	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
178	3300021377	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7	Metagenome	Unclassified
179	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
180	3300021441	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1	Metagenome	Rhizosphere
181	3300022467	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
182	3300024225	Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5	Metagenome	Rhizosphere
183	3300024227	Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4	Metagenome	Rhizosphere
184	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
185	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
186	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
187	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
188	3300025271	Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
189	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
190	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
191	3300025290	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2)	Metagenome	Rhizosphere
192	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
193	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
194	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
195	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
196	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
197	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
198	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
199	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
200	3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
201	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
202	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
203	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
204	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
205	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
206	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
207	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
208	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
209	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
210	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
211	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
212	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
213	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
214	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
215	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
216	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
217	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
218	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
219	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
220	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
221	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
222	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
223	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
224	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
225	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
226	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
227	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
228	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
229	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
230	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
231	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
232	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
233	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
234	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
235	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
236	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
237	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
238	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
239	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
240	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
241	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
242	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
243	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
244	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
245	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
246	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
247	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
248	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
249	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
250	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
251	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
252	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
253	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
254	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
255	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
256	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
257	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
258	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
259	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
260	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
261	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
262	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
263	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
264	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
265	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
266	3300027296	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2)	Metagenome	Nodule
267	3300027357	Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2)	Metagenome	Nodule
268	3300027361	Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2)	Metagenome	Nodule
269	3300027363	Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2)	Metagenome	Nodule
270	3300027512	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2)	Metagenome	Rhizosphere
271	3300027671	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2)	Metagenome	Rhizosphere
272	3300027682	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
273	3300027695	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2)	Metagenome	Rhizosphere
274	3300027717	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
275	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
276	3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
277	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
278	3300028023	Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5	Metagenome	Rhizosphere
279	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
280	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
281	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
282	3300028556	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG	Metagenome	Rhizosphere
283	3300028558	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG	Metagenome	Rhizosphere
284	3300028563	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG	Metagenome	Rhizosphere
285	3300028573	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG	Metagenome	Rhizosphere
286	3300028577	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG	Metagenome	Rhizosphere
287	3300028653	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG	Metagenome	Rhizosphere
288	3300028654	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG	Metagenome	Rhizosphere
289	3300028666	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG	Metagenome	Rhizosphere
290	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
291	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
292	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
293	3300029957	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG	Metagenome	Rhizosphere
294	3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Metagenome	Unclassified
295	3300030760	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
296	3300031090	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
297	3300031235	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG	Metagenome	Rhizosphere
298	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
299	3300031239	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG	Metagenome	Rhizosphere
300	3300031240	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG	Metagenome	Rhizosphere
301	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
302	3300031242	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG	Metagenome	Rhizosphere
303	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
304	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
305	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
306	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
307	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
308	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
309	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
310	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
311	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
312	3300031665	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3	Metagenome	Rhizosphere
313	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
314	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
315	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
316	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
317	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
318	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
319	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
320	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
321	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
322	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
323	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
324	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
325	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
326	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
327	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
328	3300032133	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA	Metagenome	Rhizosphere
329	3300032137	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC	Metagenome	Rhizosphere
330	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
331	3300033442	Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1	Metagenome	Nodule
332	3300034816	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3	Metagenome	Rhizosphere
333	3300034817	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1	Metagenome	Rhizosphere
334	3300034818	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3	Metagenome	Rhizosphere
335	3300034819	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1	Metagenome	Rhizosphere
336	3300034820	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2	Metagenome	Rhizosphere
337	3300034957	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2	Metagenome	Rhizosphere
338	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
339	3300035084	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1	Metagenome	Rhizosphere
340	3300035085	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2	Metagenome	Rhizosphere
341	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
342	3300035088	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4	Metagenome	Rhizosphere
343	3300035089	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2	Metagenome	Rhizosphere
344	3300035090	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2	Metagenome	Rhizosphere
345	3300035091	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4	Metagenome	Rhizosphere
346	3300035092	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11	Metagenome	Rhizosphere
347	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
348	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
349	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
350	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
351	3300035115	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11	Metagenome	Rhizosphere
352	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
353	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
354	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
355	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
356	3300035120	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5	Metagenome	Rhizosphere
357	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
358	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
359	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
360	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
361	3300035207	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16	Metagenome	Rhizosphere
362	3300035241	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4	Metagenome	Rhizosphere
363	3300035242	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11	Metagenome	Rhizosphere
364	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
365	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
366	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
367	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
368	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
369	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
370	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
371	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
372	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
373	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
374	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
375	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
376	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
377	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
378	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
379	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
380	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
381	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
382	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
383	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
384	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
385	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
386	3300041441	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG	Metagenome	Rhizoplane
387	3300041491	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG	Metagenome	Unclassified
388	3300041496	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG	Metagenome	Unclassified
389	3300042001	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542	Metagenome	Rhizosphere
390	3300042005	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216	Metagenome	Rhizosphere
391	3300042008	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219	Metagenome	Rhizosphere
392	3300042016	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357	Metagenome	Rhizosphere
393	3300042439	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363	Metagenome	Rhizosphere
394	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
395	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
396	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
397	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
398	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
399	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
400	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
401	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
402	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
403	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
404	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
405	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
406	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
407	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
408	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
409	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
410	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
411	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
412	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
413	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
414	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
415	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
416	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
417	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
418	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
419	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
420	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
421	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
422	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
423	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
424	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
425	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
426	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
427	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
428	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
429	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
430	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
431	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
432	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
433	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
434	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
435	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
436	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
437	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
438	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
439	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
440	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
441	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
442	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
443	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
444	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
445	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
446	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
447	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
448	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
449	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
450	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
451	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
452	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
453	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
454	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
455	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
456	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
457	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
458	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
459	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
460	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
461	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
462	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
463	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
464	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
465	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
466	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
467	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
468	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
469	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
470	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
471	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
472	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
473	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
474	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
475	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
476	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
477	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
478	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
479	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
480	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
481	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
482	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
483	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
484	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
485	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
486	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
487	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
488	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
489	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
490	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
491	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
492	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
493	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
494	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
495	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
496	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
497	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
498	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
499	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
500	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
501	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
502	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
503	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
504	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
505	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
506	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
507	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
508	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
509	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
510	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
511	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
512	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
513	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
514	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
515	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
516	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
517	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
518	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
519	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
520	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
521	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
522	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
523	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
524	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
525	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
526	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
527	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
528	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
529	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
530	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
531	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
532	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
533	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
534	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
535	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
536	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
537	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
538	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
539	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
540	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
541	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
542	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
543	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
544	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
545	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
546	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
547	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
548	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
549	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
550	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
551	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
552	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
553	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
554	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
555	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
556	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
557	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
558	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
559	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
560	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
561	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
562	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
563	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
564	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
565	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
566	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
567	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
568	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
569	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
570	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
571	3300053080	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere	Metagenome	Endosphere
572	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
573	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
574	3300053086	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere	Metagenome	Endosphere
575	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
576	3300053088	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere	Metagenome	Endosphere
577	3300053090	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere	Metagenome	Endosphere
578	3300053091	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere	Metagenome	Endosphere
579	3300053092	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere	Metagenome	Endosphere
580	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
581	3300053094	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere	Metagenome	Endosphere
582	3300053095	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere	Metagenome	Endosphere
583	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
584	3300053098	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere	Metagenome	Endosphere
585	3300053103	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere	Metagenome	Endosphere
586	3300053104	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere	Metagenome	Endosphere
587	3300053105	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere	Metagenome	Endosphere
588	3300053108	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere	Metagenome	Endosphere
589	3300053109	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere	Metagenome	Endosphere
590	3300053111	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere	Metagenome	Endosphere
591	3300053118	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere	Metagenome	Endosphere
592	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
593	3300053121	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere	Metagenome	Endosphere
594	3300053122	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere	Metagenome	Endosphere
595	3300053123	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere	Metagenome	Endosphere
596	3300053126	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere	Metagenome	Endosphere
597	3300053130	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere	Metagenome	Endosphere
598	3300053131	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere	Metagenome	Endosphere
599	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
600	3300053140	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere	Metagenome	Endosphere
601	3300053147	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere	Metagenome	Endosphere
602	3300053148	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere	Metagenome	Endosphere
603	3300053150	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere	Metagenome	Endosphere
604	3300053151	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere	Metagenome	Endosphere
605	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
606	3300053155	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere	Metagenome	Endosphere
607	3300053158	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere	Metagenome	Endosphere
608	3300053159	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere	Metagenome	Endosphere
609	3300053161	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere	Metagenome	Endosphere
610	3300053162	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere	Metagenome	Endosphere
611	3300053163	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere	Metagenome	Endosphere
612	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
613	3300053178	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere	Metagenome	Endosphere
614	3300053725	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere	Metagenome	Endosphere
615	3300053729	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere	Metagenome	Endosphere
616	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
617	3300053731	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere	Metagenome	Endosphere
618	3300053732	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere	Metagenome	Endosphere
619	3300053735	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere	Metagenome	Endosphere
620	3300053736	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere	Metagenome	Endosphere
621	3300053737	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere	Metagenome	Endosphere
622	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
623	3300055283	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere	Metagenome	Endosphere
624	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
625	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
626	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere
627	2507262055	Bradyrhizobium sp. WSM1417	Isolate	Nodule
628	2508501009	Bradyrhizobium sp. WSM471	Isolate	Nodule
629	2508501042	Bradyrhizobium sp. WSM1253	Isolate	Nodule
630	2508501128	Bradyrhizobium sp. ARR65	Isolate	Nodule
631	2513237092	Bradyrhizobium sp. WSM1743	Isolate	Nodule
632	2513237094	Bradyrhizobium sp. WSM3983	Isolate	Nodule
633	2513237095	Bradyrhizobium diazoefficiens USDA 122	Isolate	Nodule
634	2513237096	Bradyrhizobium pachyrhizi USDA 3259	Isolate	Nodule
635	2513237098	Bradyrhizobium elkanii WSM2783	Isolate	Nodule
636	2513237101	Bradyrhizobium murdochi WSM1741	Isolate	Nodule
637	2513237102	Bradyrhizobium japonicum USDA 135	Isolate	Nodule
638	2513237104	Bradyrhizobium sp. EC3.3	Isolate	Nodule
639	2513237137	Bradyrhizobium elkanii USDA 94	Isolate	Nodule
640	2513237139	Bradyrhizobium ottawaense USDA 4	Isolate	Nodule
641	2513237141	Bradyrhizobium sp. TV2a.2	Isolate	Nodule
642	2513237145	Bradyrhizobium elkanii USDA 3254	Isolate	Nodule
643	2513237161	Bradyrhizobium sp. WSM2793	Isolate	Nodule
644	2515154112	Bradyrhizobium sp. WSM4349	Isolate	Nodule
645	2517093001	Bradyrhizobium japonicum USDA 124	Isolate	Nodule
646	2517572143	Bradyrhizobium elkanii USDA 76	Isolate	Nodule
647	2524023205	Bradyrhizobium sp. Cp5.3	Isolate	Nodule
648	2524023210	Bradyrhizobium sp. Ai1a-2	Isolate	Nodule
649	2524023228	Bradyrhizobium sp. Th.b2	Isolate	Nodule
650	2582581316	Agrobacterium rhizogenes OK036	Isolate	Rhizosphere
651	2617270735	Bradyrhizobium shewense ERR11	Isolate	Nodule
652	2617270741	Bradyrhizobium yuanmingense CCBAU 10071	Isolate	Nodule
653	2643221568	Rhizobium sp. Root564	Isolate	Unclassified
654	2643221591	Devosia sp. Root685	Isolate	Unclassified
655	2643221651	Afipia sp. Root123D2	Isolate	Unclassified
656	2643221689	Rhizobium sp. Root483D2	Isolate	Unclassified
657	2667528175	Rhizobium tropici NFR14	Isolate	Rhizoplane
658	2721755755	Bradyrhizobium icense LMTR 13	Isolate	Nodule
659	2728368998	Bradyrhizobium macuxiense BR 10303	Isolate	Nodule
660	2744054633	Bradyrhizobium neotropicale BR 10247	Isolate	Unclassified
661	2791355196	Bradyrhizobium sp. Y36	Isolate	Nodule
662	2791355197	Bradyrhizobium sp. C9	Isolate	Nodule
663	2791355199
664	2802429603	Bradyrhizobium ottawaense L2	Isolate	Nodule
665	2816332527	Bradyrhizobium diazoefficiens Y21	Isolate	Nodule
666	2824600985	Bradyrhizobium sp.HAMBI 2135	Isolate	Unclassified
667	2824609381	Bradyrhizobium sp. HAMBI 2134	Isolate	Unclassified
668	2824617872	Bradyrhizobium sp. HAMBI 2133	Isolate	Unclassified
669	2824626560	Bradyrhizobium sp. HAMBI 2149	Isolate	Unclassified
670	2824635225	Bradyrhizobium sp. HAMBI 2136	Isolate	Unclassified
671	2824644064	Bradyrhizobium sp. HAMBI 2137	Isolate	Unclassified
672	2824653114	Bradyrhizobium sp. HAMBI 2142	Isolate	Unclassified
673	2824671348	Bradyrhizobium sp. HAMBI 2125	Isolate	Unclassified
674	2824679649	Bradyrhizobium sp.HAMBI 2116	Isolate	Unclassified
675	2824687955	Bradyrhizobium sp. HAMBI 2126	Isolate	Unclassified
676	2824696289	Bradyrhizobium sp. HAMBI 2127	Isolate	Unclassified
677	2824704595	Bradyrhizobium sp. HAMBI 2150	Isolate	Unclassified
678	2824714736	Bradyrhizobium sp. HAMBI 2151	Isolate	Unclassified
679	2824723954	Bradyrhizobium sp. HAMBI 2152	Isolate	Unclassified
680	2824732956	Bradyrhizobium sp. HAMBI 2153	Isolate	Unclassified
681	2824746037	Bradyrhizobium sp. HAMBI 2299	Isolate	Unclassified
682	2824753945	Bradyrhizobium sp. HAMBI 2128	Isolate	Unclassified
683	2824763712	Bradyrhizobium sp. HAMBI 2129	Isolate	Unclassified
684	2824773399	Bradyrhizobium sp. HAMBI 2130	Isolate	Unclassified
685	2829745981	Methylorubrum rhodinum DSM 2163	Isolate	Rhizosphere
686	2838122688	Bradyrhizobium sp. CIR3A	Isolate	Nodule
687	2841941048	Bradyrhizobium sp. SBR1B	Isolate	Nodule
688	2841949485	Bradyrhizobium sp. ERR14	Isolate	Nodule
689	2841957949	Bradyrhizobium sp. CIR1	Isolate	Nodule
690	2841966195	Bradyrhizobium sp. CIR18	Isolate	Nodule
691	2841974524	Bradyrhizobium sp. CIR48	Isolate	Nodule
692	2841983080	Bradyrhizobium sp. IAR9	Isolate	Nodule
693	2842038055	Bradyrhizobium centrosematis SEMIA 424	Isolate	Nodule
694	2842045827	Bradyrhizobium centrosematis SEMIA 431	Isolate	Nodule
695	2842482326	Rhizobium lusitanum SEMIA 4060	Isolate	Nodule
696	2844315083	Bradyrhizobium guangzhouense CCBAU 51670	Isolate	Unclassified
697	2847930680	Bradyrhizobium zhanjiangense CCBAU 51778	Isolate	Unclassified
698	2847939898	Bradyrhizobium ottawaense OO99	Isolate	Unclassified
699	2849076700	Bradyrhizobium symbiodeficiens 85S1MB	Isolate	Nodule
700	2857509624	Bradyrhizobium sp. R-73088	Isolate	Unclassified
701	2874590934	Bradyrhizobium canariense UBMA181	Isolate	Nodule
702	2874604998	Bradyrhizobium sp. LMTR 3	Isolate	Nodule
703	2874612657	Bradyrhizobium forestalis INPA54B	Isolate	Nodule
704	2874620515	Bradyrhizobium nanningense CCBAU 53390	Isolate	Unclassified
705	2874628541	Bradyrhizobium betae Opo-243	Isolate	Unclassified
706	2874645413	Bradyrhizobium canariense UBMA122	Isolate	Nodule
707	2876761206	Bradyrhizobium centrolobii BR 10245	Isolate	Nodule
708	2876771140	Bradyrhizobium canariense UBMA192	Isolate	Nodule
709	2876818435	Bradyrhizobium canariense UBMA195	Isolate	Nodule
710	2879074833	Bradyrhizobium canariense UBMA171	Isolate	Nodule
711	2879083081	Bradyrhizobium zhanjiangense CCBAU 51787	Isolate	Unclassified
712	2879110137	Bradyrhizobium algeriense RST91	Isolate	Nodule
713	2879127579	Bradyrhizobium canariense UBMA052	Isolate	Nodule
714	2879142872	Bradyrhizobium canariense UBMA061	Isolate	Nodule
715	2881364244	Bradyrhizobium sp. RP6	Isolate	Unclassified
716	2881665667	Bradyrhizobium vignae LMG 28791	Isolate	Unclassified
717	2885366525	Bradyrhizobium sp. LVM 105	Isolate	Unclassified
718	2885374607	Bradyrhizobium sp. NAS96.2	Isolate	Unclassified
719	2885383462	Bradyrhizobium sp. Leo170	Isolate	Unclassified
720	2885409591	Bradyrhizobium sp. NAS80.1	Isolate	Unclassified
721	2888378607	Bradyrhizobium sp. LCT2	Isolate	Unclassified
722	2888388044	Bradyrhizobium cosmicum 58S1	Isolate	Unclassified
723	2888419890	Bradyrhizobium sp. 1(2017) 63S1MB	Isolate	Unclassified
724	2889033259	Bradyrhizobium sp. CCBAU 051011	Isolate	Unclassified
725	2903727486	Bradyrhizobium guangzhouense CCBAU 53424	Isolate	Unclassified
726	2903748898	Bradyrhizobium uaiense UFLA 03-164	Isolate	Nodule
727	2903768456	Bradyrhizobium sp. Leo121	Isolate	Unclassified
728	2904666416	Bradyrhizobium nanningense CCBAU 51757	Isolate	Unclassified
729	2904690495	Bradyrhizobium ivorense CI-1B	Isolate	Nodule
730	2904699407
731	2904711408	Bradyrhizobium sp. USDA 3456	Isolate	Unclassified
732	2906602504	Bradyrhizobium guangzhouense CCBAU 53426	Isolate	Unclassified
733	2906610324
734	2906626472	Bradyrhizobium hipponense aSej3	Isolate	Unclassified
735	2906635258	Bradyrhizobium sp. USDA 3458	Isolate	Unclassified
736	2906643746	Bradyrhizobium genosp. SA-3 Rp7b	Isolate	Unclassified
737	2906660503	Bradyrhizobium brasilense UFLA 03-321	Isolate	Unclassified
738	2908739725	Bradyrhizobium sp. UFLA03-84	Isolate	Nodule
739	2908756301	Bradyrhizobium ivorense CI-41S	Isolate	Nodule
740	2908775508	Bradyrhizobium sp. SUTN9-2	Isolate	Unclassified
741	2920760137	Ensifer psoraleae CCBAU 65732	Isolate	Unclassified
742	2920822456	Ensifer sesbaniae CCBAU 65729	Isolate	Unclassified
743	2922361189	Bradyrhizobium australiense WSM 1791	Isolate	Nodule
744	2922386360	Bradyrhizobium archetypum WSM 1744	Isolate	Nodule
745	2922393267	Bradyrhizobium sp. WBAH10	Isolate	Nodule
746	2922425934
747	2932794094	Bradyrhizobium sp. S3.2.6	Isolate	Nodule
748	2932801729	Bradyrhizobium sp. S3.3.6	Isolate	Nodule
749	2935608549	Bradyrhizobium sp. RT6a	Isolate	Nodule
750	2935630451	Bradyrhizobium sp. I1.14.4	Isolate	Nodule
751	2935648319	Bradyrhizobium sp. JR4.3	Isolate	Nodule
752	2935656913	Bradyrhizobium sp. JR5.3	Isolate	Nodule
753	2935769743	Bradyrhizobium sp. LB12.1	Isolate	Nodule
754	2935777560	Bradyrhizobium sp. LB14.3	Isolate	Nodule
755	2935785616	Bradyrhizobium sp. LB5.2	Isolate	Nodule
756	2935793552	Bradyrhizobium sp. LB8.2	Isolate	Nodule
757	2935819856	Bradyrhizobium sp. RT3b	Isolate	Nodule
758	2935847175	Bradyrhizobium sp. RT5a	Isolate	Nodule
759	2935883170	Bradyrhizobium sp. S3.12.5	Isolate	Nodule
760	2935908558	Bradyrhizobium sp. F1.1.1	Isolate	Nodule
761	2935916978	Bradyrhizobium sp. F1.13.3	Isolate	Nodule
762	2935926038	Bradyrhizobium sp. F1.2.1	Isolate	Nodule
763	2935934488	Bradyrhizobium sp. F1.2.2	Isolate	Nodule
764	2935942939	Bradyrhizobium sp. F1.2.6	Isolate	Nodule
765	2935951376	Bradyrhizobium sp. F1.2.8	Isolate	Nodule
766	2935959822	Bradyrhizobium sp. F1.4.3	Isolate	Nodule
767	2935967501	Bradyrhizobium sp. F1.6.2	Isolate	Nodule
768	2935975950	Bradyrhizobium sp. GM2.2	Isolate	Nodule
769	2935984226	Bradyrhizobium sp. i1.15.2	Isolate	Nodule
770	2936011229	Bradyrhizobium sp. JR1.1	Isolate	Nodule
771	2936019824	Bradyrhizobium sp. JR1.5	Isolate	Nodule
772	2936028420	Bradyrhizobium sp. JR1.7	Isolate	Nodule
773	2936046547	Bradyrhizobium sp. JR3.12	Isolate	Nodule
774	2936055302	Bradyrhizobium sp. JR4.1	Isolate	Nodule
775	2941507105	Bradyrhizobium sp. i1.12.3	Isolate	Nodule
776	2941515067	Bradyrhizobium sp. i1.14.1	Isolate	Nodule
777	2941523033	Bradyrhizobium sp. i1.8.4	Isolate	Nodule
778	2941531003	Bradyrhizobium sp. LB11.1	Isolate	Nodule
779	3005474847	Bradyrhizobium sp. CCBAU 53421	Isolate	Nodule
780	3005483717	Bradyrhizobium agreste CNPSo 4010	Isolate	Unclassified
781	3005506211	Bradyrhizobium diazoefficiens SZCCT0449	Isolate	Unclassified
782	3005587118	Bradyrhizobium glycinis CNPSo 4016	Isolate	Unclassified
783	3005594810	Bradyrhizobium sp. CCBAU 53340	Isolate	Nodule
784	3005710791	Bradyrhizobium genosp. B BDV5040	Isolate	Unclassified
785	3005718088	Bradyrhizobium sp. CCBAU 53338	Isolate	Nodule
786	643692032	Sinorhizobium fredii NGR234	Isolate	Nodule
787	8006926726	Bradyrhizobium guangdongense SM32	Isolate	Unclassified
788	8006933436	Bradyrhizobium septentrionale 7(2017)	Isolate	Unclassified
789	8006964411	Bradyrhizobium sp. sBnM-33	Isolate	Nodule
790	8006973647	Bradyrhizobium septentrionale 162S2	Isolate	Nodule
791	8006984368	Bradyrhizobium sp. SRL28	Isolate	Unclassified
792	8006994254	Bradyrhizobium sp. sGM-13	Isolate	Nodule
793	8016522445	Bradyrhizobium sp. LM6.9	Isolate	Nodule
794	8016548790	Bradyrhizobium sp. LM3.6	Isolate	Nodule
795	8016557553	Bradyrhizobium sp. LM3.4	Isolate	Nodule
796	8016575299	Bradyrhizobium sp. LM2.9	Isolate	Nodule
797	8016583857	Bradyrhizobium sp. LM2.7	Isolate	Nodule
798	8016595262	Bradyrhizobium sp. LM2.3	Isolate	Nodule
799	8016603502	Bradyrhizobium sp. LB7.2	Isolate	Nodule
800	8016613128	Bradyrhizobium sp. LB7.1	Isolate	Nodule
801	8016622563	Bradyrhizobium sp. LB13.1	Isolate	Nodule
802	8016630954	Bradyrhizobium sp. F1.13.1	Isolate	Nodule
803	8019530166	Bradyrhizobium sp. LM4.3	Isolate	Nodule
804	8019538911	Bradyrhizobium sp. LB9.1b	Isolate	Nodule
805	8019547302	Bradyrhizobium sp. LB1.3	Isolate	Nodule
806	8019565922	Bradyrhizobium sp. JR3.5	Isolate	Nodule
807	8019619141	Bradyrhizobium sp. GM7.3	Isolate	Nodule
808	8019629233	Bradyrhizobium sp. GM6.1	Isolate	Nodule
809	8019638758	Bradyrhizobium sp. GM5.1	Isolate	Nodule
810	8019659431	Bradyrhizobium sp. GM22.5	Isolate	Nodule
811	8019668869	Bradyrhizobium sp. GM2.4	Isolate	Nodule
812	8019687851	Bradyrhizobium sp. F1.13.4	Isolate	Nodule
813	8049293176	Ensifer alkalisoli YIC4027	Isolate	Nodule
814	8056673599	Bradyrhizobium hereditatis WSM 1738	Isolate	Nodule
815	8056681323	Bradyrhizobium cenepequi CNPSo 4026	Isolate	Nodule
816	8056689827	Bradyrhizobium semiaridum WSM 1704	Isolate	Nodule
817	8056967851	Bradyrhizobium zhengyangense WYCCWR 12678	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	93.14
Metatranscriptomes	0.18
Isolates	6.69

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	6.25
Nodule	5.07
Rhizoplane	6.53
Rhizosphere	75.69
Stem	0
Stem Tuber	0
Unclassified	0

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	Ga0265339_10028333	3300031249	Bacteria	3187
2	RicEn_C8699	2010549000	Bacteria	1527
3	ARSoilYngRDRAFT_c00154	3300000042	Bacteria	11756
4	ARcpr5yngRDRAFT_c000045	3300000043	Bacteria	19814
5	ARCol0yngRDRAFT_1000240	3300000652	Bacteria	8876
6	JGI24747J21853_1001654	3300001978	Bacteria	1705
7	JGI24740J21852_10018437	3300001979	Bacteria	2474
8	JGI24740J21852_10038555	3300001979	Bacteria	1465
9	JGI24739J22299_10001535	3300001989	Bacteria	8719
10	JGI24739J22299_10003170	3300001989	Bacteria	6278
11	JGI24737J22298_10000622	3300001990	Bacteria	12491
12	JGI24737J22298_10011436	3300001990	Bacteria	2909
13	JGI24743J22301_10006875	3300001991	Bacteria	1956
14	JGI24735J21928_10046659	3300002067	Bacteria	1257
15	JGI24750J21931_1000065	3300002070	Bacteria	15383
16	JGI24745J21846_1000050	3300002073	Bacteria	8168
17	JGI24748J21848_1000186	3300002074	Bacteria	8002
18	JGI24738J21930_10003533	3300002075	Bacteria	3929
19	JGI24738J21930_10016718	3300002075	Bacteria	1547
20	JGI24749J21850_1017867	3300002076	Bacteria	1000
21	JGI24744J21845_10000135	3300002077	Bacteria	10400
22	JGI24035J26624_1000006	3300002126	Bacteria	14718
23	JGI24033J26618_1000182	3300002155	Bacteria	7634
24	JGI24742J22300_10000073	3300002244	Bacteria	14180
25	JGI24751J29686_10038358	3300002459	Bacteria	992
26	JGI25165J46597_1020020	3300003214	Bacteria	878
27	JGI25153J46596_10000221	3300003215	Bacteria	49033
28	JGI25153J46596_10001035	3300003215	Bacteria	16956
29	JGI25153J46596_10001691	3300003215	Bacteria	13084
30	JGI25153J46596_10021265	3300003215	Bacteria	2423
31	JGI25160J50197_1001121	3300003354	Bacteria	13681
32	JGI25160J50197_1002067	3300003354	Bacteria	9554
33	JGI25404J52841_10007671	3300003659	Bacteria	2287
34	JGI25404J52841_10013140	3300003659	Bacteria	1796
35	JGI25404J52841_10013218	3300003659	Bacteria	1790
36	JGI25404J52841_10030971	3300003659	Bacteria	1144
37	Ga0055539_1002659	3300003752	Bacteria	2661
38	Ga0055542_1008613	3300003762	Bacteria	1983
39	Ga0055543_1013017	3300004625	Bacteria	1655
40	Ga0065165_1003932	3300005262	Bacteria	9781
41	Ga0065165_1045987	3300005262	Bacteria	1268
42	Ga0065165_1046288	3300005262	Bacteria	1262
43	Ga0065716_1001804	3300005277	Bacteria	3320
44	Ga0065712_10000851	3300005290	Bacteria	16498
45	Ga0065712_10069079	3300005290	Bacteria	8071
46	Ga0065712_10069690	3300005290	Bacteria	6873
47	Ga0065715_10000356	3300005293	Bacteria	13268
48	Ga0065715_10001058	3300005293	Bacteria	11127
49	Ga0070658_10126929	3300005327	Bacteria	2124
50	Ga0070658_10668400	3300005327	Bacteria	901
51	Ga0070676_10005882	3300005328	Bacteria	6547
52	Ga0070676_10240498	3300005328	Bacteria	1204
53	Ga0070676_10280024	3300005328	Bacteria	1123
54	Ga0070683_100003076	3300005329	Bacteria	13434
55	Ga0070683_100008779	3300005329	Bacteria	8593
56	Ga0070683_100231684	3300005329	Bacteria	1756
57	Ga0070683_100422789	3300005329	Bacteria	1271
58	Ga0070690_100000643	3300005330	Bacteria	17767
59	Ga0070690_100030226	3300005330	Bacteria	3365
60	Ga0070690_100042568	3300005330	Bacteria	2877
61	Ga0070690_100224546	3300005330	Bacteria	1317
62	Ga0070690_100338484	3300005330	Bacteria	1089
63	Ga0070690_100654545	3300005330	Bacteria	803
64	Ga0070690_100743663	3300005330	Bacteria	756
65	Ga0070670_100000827	3300005331	Bacteria	24178
66	Ga0070670_100016594	3300005331	Bacteria	6319
67	Ga0070670_100051178	3300005331	Bacteria	3548
68	Ga0070670_100184422	3300005331	Bacteria	1812
69	Ga0070670_100783189	3300005331	Bacteria	861
70	Ga0070677_10000540	3300005333	Bacteria	12939
71	Ga0068869_100000013	3300005334	Bacteria	73970
72	Ga0068869_100215603	3300005334	Bacteria	1519
73	Ga0070666_10001503	3300005335	Bacteria	14159
74	Ga0070666_10299407	3300005335	Bacteria	1145
75	Ga0070666_10305811	3300005335	Bacteria	1133
76	Ga0070680_100002249	3300005336	Bacteria	14255
77	Ga0070680_100021893	3300005336	Bacteria	5085
78	Ga0070680_100045032	3300005336	Bacteria	3586
79	Ga0070680_100101595	3300005336	Bacteria	2387
80	Ga0070680_100126061	3300005336	Bacteria	2139
81	Ga0070680_100315981	3300005336	Bacteria	1326
82	Ga0070682_100001195	3300005337	Bacteria	14796
83	Ga0070682_100034028	3300005337	Bacteria	3100
84	Ga0070682_100229762	3300005337	Bacteria	1325
85	Ga0070682_100336274	3300005337	Bacteria	1121
86	Ga0068868_100002373	3300005338	Bacteria	13039
87	Ga0068868_100054989	3300005338	Bacteria	3139
88	Ga0068868_100154727	3300005338	Bacteria	1890
89	Ga0068868_100221909	3300005338	Bacteria	1583
90	Ga0070660_100001856	3300005339	Bacteria	14539
91	Ga0070660_100009056	3300005339	Bacteria	6986
92	Ga0070660_100012544	3300005339	Bacteria	6054
93	Ga0070660_100012919	3300005339	Bacteria	5975
94	Ga0070660_100122651	3300005339	Bacteria	2074
95	Ga0070660_100366070	3300005339	Bacteria	1189
96	Ga0070689_100002355	3300005340	Bacteria	12305
97	Ga0070689_100015433	3300005340	Bacteria	5570
98	Ga0070689_100148307	3300005340	Bacteria	1890
99	Ga0070689_100192655	3300005340	Bacteria	1660
100	Ga0070691_10000101	3300005341	Bacteria	25190
101	Ga0070691_10018986	3300005341	Bacteria	3169
102	Ga0070691_10024622	3300005341	Bacteria	2798
103	Ga0070687_100000662	3300005343	Bacteria	11478
104	Ga0070687_100091090	3300005343	Bacteria	1687
105	Ga0070661_100001285	3300005344	Bacteria	17639
106	Ga0070661_100142603	3300005344	Bacteria	1806
107	Ga0070661_100150669	3300005344	Bacteria	1758
108	Ga0070661_100190163	3300005344	Bacteria	1565
109	Ga0070692_10000014	3300005345	Bacteria	35936
110	Ga0070692_10339636	3300005345	Bacteria	930
111	Ga0070692_10456864	3300005345	Bacteria	819
112	Ga0070668_100000629	3300005347	Bacteria	23731
113	Ga0070668_100221590	3300005347	Bacteria	1560
114	Ga0070668_100261828	3300005347	Bacteria	1438
115	Ga0070668_100316534	3300005347	Bacteria	1312
116	Ga0070668_100443698	3300005347	Bacteria	1114
117	Ga0070668_101013713	3300005347	Bacteria	746
118	Ga0070669_100000289	3300005353	Bacteria	39576
119	Ga0070669_100073209	3300005353	Bacteria	2538
120	Ga0070669_100349167	3300005353	Bacteria	1200
121	Ga0070675_100000501	3300005354	Bacteria	26898
122	Ga0070675_100027784	3300005354	Bacteria	4549
123	Ga0070675_100125329	3300005354	Bacteria	2184
124	Ga0070675_100205094	3300005354	Bacteria	1712
125	Ga0070675_100504051	3300005354	Bacteria	1091
126	Ga0070671_100001647	3300005355	Bacteria	16881
127	Ga0070671_100006150	3300005355	Bacteria	9559
128	Ga0070671_100017504	3300005355	Bacteria	5807
129	Ga0070671_100090568	3300005355	Bacteria	2561
130	Ga0070671_100169969	3300005355	Bacteria	1844
131	Ga0070671_100174257	3300005355	Bacteria	1820
132	Ga0070671_100358752	3300005355	Bacteria	1244
133	Ga0070674_100000392	3300005356	Bacteria	21972
134	Ga0070674_100053579	3300005356	Bacteria	2786
135	Ga0070674_100583487	3300005356	Bacteria	942
136	Ga0070674_100638859	3300005356	Bacteria	904
137	Ga0070673_100001752	3300005364	Bacteria	12936
138	Ga0070673_100021295	3300005364	Bacteria	4697
139	Ga0070673_100034218	3300005364	Bacteria	3842
140	Ga0070673_100176883	3300005364	Bacteria	1824
141	Ga0070688_100001270	3300005365	Bacteria	12575
142	Ga0070688_100024224	3300005365	Bacteria	3578
143	Ga0070688_100035642	3300005365	Bacteria	3023
144	Ga0070688_100059018	3300005365	Bacteria	2418
145	Ga0070659_100001872	3300005366	Bacteria	15083
146	Ga0070659_100022353	3300005366	Bacteria	4828
147	Ga0070659_100028298	3300005366	Bacteria	4327
148	Ga0070659_100119531	3300005366	Bacteria	2133
149	Ga0070659_100161441	3300005366	Bacteria	1832
150	Ga0070659_100244076	3300005366	Bacteria	1487
151	Ga0070667_100002667	3300005367	Bacteria	15448
152	Ga0070667_100013419	3300005367	Bacteria	6772
153	Ga0070667_100099525	3300005367	Bacteria	2510
154	Ga0070667_100113981	3300005367	Bacteria	2347
155	Ga0070667_100122223	3300005367	Bacteria	2265
156	Ga0070667_100343148	3300005367	Bacteria	1351
157	Ga0070709_10000584	3300005434	Bacteria	21359
158	Ga0070709_10002047	3300005434	Bacteria	10949
159	Ga0070709_10039065	3300005434	Bacteria	2910
160	Ga0070714_100004130	3300005435	Bacteria	10917
161	Ga0070714_100008856	3300005435	Bacteria	7872
162	Ga0070714_100014031	3300005435	Bacteria	6428
163	Ga0070714_100024145	3300005435	Bacteria	5000
164	Ga0070714_100086890	3300005435	Bacteria	2734
165	Ga0070714_100185039	3300005435	Bacteria	1897
166	Ga0070714_100403813	3300005435	Bacteria	1292
167	Ga0070714_100611988	3300005435	Bacteria	1047
168	Ga0070713_100000749	3300005436	Bacteria	20796
169	Ga0070713_100002056	3300005436	Bacteria	12998
170	Ga0070713_100002424	3300005436	Bacteria	12160
171	Ga0070713_100007367	3300005436	Bacteria	7714
172	Ga0070713_100078945	3300005436	Bacteria	2803
173	Ga0070713_100181510	3300005436	Bacteria	1891
174	Ga0070713_100193403	3300005436	Bacteria	1834
175	Ga0070713_100276203	3300005436	Bacteria	1540
176	Ga0070713_100325261	3300005436	Bacteria	1421
177	Ga0070713_100507263	3300005436	Bacteria	1139
178	Ga0070713_100882792	3300005436	Bacteria	859
179	Ga0070713_101124307	3300005436	Bacteria	759
180	Ga0070710_10001359	3300005437	Bacteria	11546
181	Ga0070710_10001602	3300005437	Bacteria	10681
182	Ga0070710_10002631	3300005437	Bacteria	8527
183	Ga0070710_10013215	3300005437	Bacteria	4127
184	Ga0070710_10022987	3300005437	Bacteria	3270
185	Ga0070701_10000008	3300005438	Bacteria	53317
186	Ga0070711_100002340	3300005439	Bacteria	10769
187	Ga0070711_100018919	3300005439	Bacteria	4407
188	Ga0070711_100026383	3300005439	Bacteria	3807
189	Ga0070711_100043573	3300005439	Bacteria	3040
190	Ga0070711_100065687	3300005439	Bacteria	2539
191	Ga0070711_100131605	3300005439	Bacteria	1864
192	Ga0070711_100253326	3300005439	Bacteria	1382
193	Ga0070705_100001317	3300005440	Bacteria	13300
194	Ga0070705_100016215	3300005440	Bacteria	3869
195	Ga0070705_100026359	3300005440	Bacteria	3163
196	Ga0070705_100886168	3300005440	Bacteria	717
197	Ga0070700_100000486	3300005441	Bacteria	19940
198	Ga0070700_100005870	3300005441	Bacteria	6522
199	Ga0070700_100249010	3300005441	Bacteria	1273
200	Ga0070700_100498042	3300005441	Bacteria	936
201	Ga0070700_100794326	3300005441	Bacteria	761
202	Ga0070700_100856294	3300005441	Bacteria	737
203	Ga0070694_100000463	3300005444	Bacteria	22164
204	Ga0070694_100185683	3300005444	Bacteria	1540
205	Ga0070708_100162822	3300005445	Bacteria	2079
206	Ga0070708_100416083	3300005445	Bacteria	1268
207	Ga0070663_100000944	3300005455	Bacteria	15811
208	Ga0070663_100007267	3300005455	Bacteria	6733
209	Ga0070663_100083279	3300005455	Bacteria	2355
210	Ga0070663_100115225	3300005455	Bacteria	2024
211	Ga0070663_100116311	3300005455	Bacteria	2015
212	Ga0070663_100238764	3300005455	Bacteria	1434
213	Ga0070663_100781379	3300005455	Bacteria	817
214	Ga0070678_100002870	3300005456	Bacteria	9543
215	Ga0070678_100079882	3300005456	Bacteria	2475
216	Ga0070678_100327703	3300005456	Bacteria	1310
217	Ga0070678_100415488	3300005456	Bacteria	1171
218	Ga0070678_100946185	3300005456	Bacteria	789
219	Ga0070662_100002420	3300005457	Bacteria	11478
220	Ga0070662_100004831	3300005457	Bacteria	8542
221	Ga0070662_100137112	3300005457	Bacteria	1893
222	Ga0070662_100185399	3300005457	Bacteria	1643
223	Ga0070662_100330203	3300005457	Bacteria	1246
224	Ga0070662_100392811	3300005457	Bacteria	1143
225	Ga0070681_10002062	3300005458	Bacteria	18223
226	Ga0070681_10007607	3300005458	Bacteria	10591
227	Ga0070681_10038172	3300005458	Bacteria	4817
228	Ga0070681_10039716	3300005458	Bacteria	4716
229	Ga0070681_10046167	3300005458	Bacteria	4356
230	Ga0070681_10058550	3300005458	Bacteria	3832
231	Ga0070681_10075830	3300005458	Bacteria	3323
232	Ga0070681_10097121	3300005458	Bacteria	2894
233	Ga0070681_10113825	3300005458	Bacteria	2644
234	Ga0070681_10352694	3300005458	Bacteria	1381
235	Ga0068867_100000303	3300005459	Bacteria	32425
236	Ga0068867_100208097	3300005459	Bacteria	1569
237	Ga0068867_100391587	3300005459	Bacteria	1170
238	Ga0068867_100516836	3300005459	Bacteria	1029
239	Ga0070685_10001417	3300005466	Bacteria	12575
240	Ga0070685_10003573	3300005466	Bacteria	7892
241	Ga0070685_10027913	3300005466	Bacteria	3124
242	Ga0070685_10403940	3300005466	Bacteria	947
243	Ga0070685_10456642	3300005466	Bacteria	896
244	Ga0070698_100155406	3300005471	Bacteria	2233
245	Ga0070679_100005343	3300005530	Bacteria	11885
246	Ga0070679_100032033	3300005530	Bacteria	5198
247	Ga0070679_100039539	3300005530	Bacteria	4687
248	Ga0070679_100043536	3300005530	Bacteria	4471
249	Ga0070679_100217121	3300005530	Bacteria	1874
250	Ga0070679_100242504	3300005530	Bacteria	1759
251	Ga0070679_100279839	3300005530	Bacteria	1621
252	Ga0070679_100356179	3300005530	Bacteria	1411
253	Ga0070679_100638063	3300005530	Bacteria	1008
254	Ga0070684_100001817	3300005535	Bacteria	15613
255	Ga0070684_100006680	3300005535	Bacteria	8942
256	Ga0070684_100018170	3300005535	Bacteria	5787
257	Ga0070684_100030415	3300005535	Bacteria	4587
258	Ga0070684_100086425	3300005535	Bacteria	2783
259	Ga0070684_100617971	3300005535	Bacteria	1008
260	Ga0068853_100000726	3300005539	Bacteria	22782
261	Ga0068853_100005594	3300005539	Bacteria	9870
262	Ga0068853_100010459	3300005539	Bacteria	7510
263	Ga0068853_100041526	3300005539	Bacteria	3930
264	Ga0068853_100065184	3300005539	Bacteria	3161
265	Ga0068853_100135742	3300005539	Bacteria	2205
266	Ga0068853_100250980	3300005539	Bacteria	1623
267	Ga0068853_100270085	3300005539	Bacteria	1566
268	Ga0068853_100294942	3300005539	Bacteria	1497
269	Ga0068853_100301278	3300005539	Bacteria	1482
270	Ga0068853_100451228	3300005539	Bacteria	1209
271	Ga0068853_100514078	3300005539	Bacteria	1131
272	Ga0068853_100529599	3300005539	Bacteria	1115
273	Ga0068853_100628400	3300005539	Bacteria	1021
274	Ga0070672_100000469	3300005543	Bacteria	23426
275	Ga0070672_100483374	3300005543	Bacteria	1069
276	Ga0070672_100492236	3300005543	Bacteria	1060
277	Ga0070672_100646984	3300005543	Bacteria	923
278	Ga0070686_100002391	3300005544	Bacteria	10342
279	Ga0070686_100005540	3300005544	Bacteria	6986
280	Ga0070686_100160573	3300005544	Bacteria	1582
281	Ga0070686_100213643	3300005544	Bacteria	1390
282	Ga0070695_100524403	3300005545	Bacteria	920
283	Ga0070696_100002292	3300005546	Bacteria	12613
284	Ga0070693_100000411	3300005547	Bacteria	19398
285	Ga0070693_100164323	3300005547	Bacteria	1416
286	Ga0070693_100169275	3300005547	Bacteria	1398
287	Ga0070693_100236785	3300005547	Bacteria	1204
288	Ga0070693_100278578	3300005547	Bacteria	1119
289	Ga0070693_100449517	3300005547	Bacteria	904
290	Ga0070693_100845515	3300005547	Bacteria	682
291	Ga0070665_100061030	3300005548	Bacteria	3779
292	Ga0070665_100182052	3300005548	Bacteria	2102
293	Ga0070665_100218270	3300005548	Bacteria	1907
294	Ga0070665_100266384	3300005548	Bacteria	1715
295	Ga0070665_100274196	3300005548	Bacteria	1688
296	Ga0070665_100364948	3300005548	Bacteria	1450
297	Ga0070665_100731556	3300005548	Bacteria	1002
298	Ga0070665_101517015	3300005548	Bacteria	679
299	Ga0070704_100002020	3300005549	Bacteria	11240
300	Ga0070704_100070760	3300005549	Bacteria	2532
301	Ga0068855_100006336	3300005563	Bacteria	14418
302	Ga0068855_100033421	3300005563	Bacteria	6138
303	Ga0068855_100045265	3300005563	Bacteria	5205
304	Ga0068855_100100694	3300005563	Bacteria	3327
305	Ga0068855_100129932	3300005563	Bacteria	2877
306	Ga0068855_100138570	3300005563	Bacteria	2775
307	Ga0068855_100167826	3300005563	Bacteria	2487
308	Ga0068855_100273082	3300005563	Bacteria	1879
309	Ga0068855_100649029	3300005563	Bacteria	1133
310	Ga0068855_100686775	3300005563	Bacteria	1097
311	Ga0068855_100931150	3300005563	Bacteria	916
312	Ga0068855_101132738	3300005563	Bacteria	816
313	Ga0070664_100001745	3300005564	Bacteria	17407
314	Ga0070664_100019262	3300005564	Bacteria	5614
315	Ga0070664_100152355	3300005564	Bacteria	2042
316	Ga0070664_100202509	3300005564	Bacteria	1772
317	Ga0070664_100247252	3300005564	Bacteria	1602
318	Ga0070664_100250334	3300005564	Bacteria	1593
319	Ga0070664_100328725	3300005564	Bacteria	1386
320	Ga0068857_100013105	3300005577	Bacteria	7224
321	Ga0068857_100026860	3300005577	Bacteria	5076
322	Ga0068857_100106987	3300005577	Bacteria	2512
323	Ga0068857_100128570	3300005577	Bacteria	2284
324	Ga0068857_100213611	3300005577	Bacteria	1761
325	Ga0068857_100366785	3300005577	Bacteria	1336
326	Ga0068854_100000761	3300005578	Bacteria	19144
327	Ga0068854_100003752	3300005578	Bacteria	9498
328	Ga0068854_100008844	3300005578	Bacteria	6481
329	Ga0068854_100176251	3300005578	Bacteria	1667
330	Ga0068854_100316169	3300005578	Bacteria	1268
331	Ga0068856_100003904	3300005614	Bacteria	14952
332	Ga0068856_100006298	3300005614	Bacteria	11641
333	Ga0068856_100011349	3300005614	Bacteria	8643
334	Ga0068856_100108247	3300005614	Bacteria	2775
335	Ga0068856_100222198	3300005614	Bacteria	1904
336	Ga0068856_100281482	3300005614	Bacteria	1680
337	Ga0068856_100380417	3300005614	Bacteria	1431
338	Ga0068856_100586776	3300005614	Bacteria	1136
339	Ga0068856_100633923	3300005614	Bacteria	1089
340	Ga0070702_100000661	3300005615	Bacteria	12855
341	Ga0070702_100005669	3300005615	Bacteria	5843
342	Ga0070702_100232920	3300005615	Bacteria	1238
343	Ga0068852_100000151	3300005616	Bacteria	46414
344	Ga0068852_100030996	3300005616	Bacteria	4407
345	Ga0068852_100059203	3300005616	Bacteria	3321
346	Ga0068852_100060314	3300005616	Bacteria	3293
347	Ga0068852_100060856	3300005616	Bacteria	3279
348	Ga0068852_100119230	3300005616	Bacteria	2412
349	Ga0068852_100257643	3300005616	Bacteria	1674
350	Ga0068852_100640631	3300005616	Bacteria	1070
351	Ga0068859_100004424	3300005617	Bacteria	14336
352	Ga0068859_100054214	3300005617	Bacteria	4032
353	Ga0068859_100064554	3300005617	Bacteria	3694
354	Ga0068859_100288995	3300005617	Bacteria	1732
355	Ga0068859_100346894	3300005617	Bacteria	1579
356	Ga0068859_100488384	3300005617	Bacteria	1327
357	Ga0068864_100001020	3300005618	Bacteria	23442
358	Ga0068864_100236672	3300005618	Bacteria	1690
359	Ga0068864_100366012	3300005618	Bacteria	1363
360	Ga0068864_100489617	3300005618	Bacteria	1181
361	Ga0068864_100747726	3300005618	Bacteria	958
362	Ga0068866_10000049	3300005718	Bacteria	45908
363	Ga0068866_10575712	3300005718	Bacteria	756
364	Ga0068861_100000471	3300005719	Bacteria	23427
365	Ga0068861_100026621	3300005719	Bacteria	4207
366	Ga0068861_100220611	3300005719	Bacteria	1602
367	Ga0068861_100247641	3300005719	Bacteria	1519
368	Ga0068861_100449421	3300005719	Bacteria	1154
369	Ga0068861_100479896	3300005719	Bacteria	1120
370	Ga0068851_10000408	3300005834	Bacteria	19412
371	Ga0068851_10339185	3300005834	Bacteria	872
372	Ga0068870_10001002	3300005840	Bacteria	11150
373	Ga0068870_10524279	3300005840	Bacteria	793
374	Ga0068870_10600751	3300005840	Bacteria	748
375	Ga0068863_100000418	3300005841	Bacteria	43162
376	Ga0068863_100127017	3300005841	Bacteria	2433
377	Ga0068863_100324191	3300005841	Bacteria	1497
378	Ga0068863_100773002	3300005841	Bacteria	957
379	Ga0068858_100002238	3300005842	Bacteria	19549
380	Ga0068858_100144409	3300005842	Bacteria	2235
381	Ga0068858_100242248	3300005842	Bacteria	1711
382	Ga0068858_100306658	3300005842	Bacteria	1515
383	Ga0068858_100386104	3300005842	Bacteria	1344
384	Ga0068858_100565262	3300005842	Bacteria	1101
385	Ga0068860_100000835	3300005843	Bacteria	34457
386	Ga0068860_100002578	3300005843	Bacteria	18969
387	Ga0068860_100101237	3300005843	Bacteria	2749
388	Ga0068860_100280720	3300005843	Bacteria	1627
389	Ga0068860_101013002	3300005843	Bacteria	849
390	Ga0068862_100001613	3300005844	Bacteria	20538
391	Ga0068862_100028043	3300005844	Bacteria	4742
392	Ga0068862_100140132	3300005844	Bacteria	2146
393	Ga0068862_100183444	3300005844	Bacteria	1879
394	Ga0068862_100317800	3300005844	Bacteria	1436
395	Ga0068862_100719700	3300005844	Bacteria	968
396	Ga0068862_101006350	3300005844	Bacteria	824
397	Ga0081455_10007101	3300005937	Bacteria	11861
398	Ga0081455_10012686	3300005937	Bacteria	8387
399	Ga0081455_10030923	3300005937	Bacteria	4855
400	Ga0081455_10034429	3300005937	Bacteria	4537
401	Ga0081455_10050365	3300005937	Bacteria	3583
402	Ga0081455_10150940	3300005937	Bacteria	1792
403	Ga0081455_10169092	3300005937	Bacteria	1667
404	Ga0081538_10044577	3300005981	Bacteria	2764
405	Ga0081538_10067457	3300005981	Bacteria	1997
406	Ga0081540_1002549	3300005983	Bacteria	14782
407	Ga0081540_1003522	3300005983	Bacteria	12352
408	Ga0081540_1005183	3300005983	Bacteria	9759
409	Ga0081540_1009347	3300005983	Bacteria	6761
410	Ga0081540_1012550	3300005983	Bacteria	5568
411	Ga0081540_1015783	3300005983	Bacteria	4764
412	Ga0081540_1018894	3300005983	Bacteria	4210
413	Ga0081540_1064448	3300005983	Bacteria	1729
414	Ga0081540_1067154	3300005983	Bacteria	1677
415	Ga0081540_1075387	3300005983	Bacteria	1542
416	Ga0081539_10002259	3300005985	Bacteria	28018
417	Ga0081539_10033245	3300005985	Bacteria	3145
418	Ga0081539_10096710	3300005985	Bacteria	1513
419	Ga0070717_10000598	3300006028	Bacteria	23163
420	Ga0070717_10001460	3300006028	Bacteria	16328
421	Ga0070717_10023337	3300006028	Bacteria	4900
422	Ga0070717_10067526	3300006028	Bacteria	2975
423	Ga0070717_10169579	3300006028	Bacteria	1898
424	Ga0070717_10236685	3300006028	Bacteria	1609
425	Ga0070717_10372929	3300006028	Bacteria	1279
426	Ga0070717_10618328	3300006028	Bacteria	983
427	Ga0075365_10018847	3300006038	Bacteria	4251
428	Ga0075365_10087003	3300006038	Bacteria	2124
429	Ga0075365_10198978	3300006038	Bacteria	1403
430	Ga0075365_10487224	3300006038	Bacteria	871
431	Ga0075368_10005988	3300006042	Bacteria	4217
432	Ga0075368_10022450	3300006042	Bacteria	2403
433	Ga0075368_10222703	3300006042	Bacteria	802
434	Ga0075363_100008692	3300006048	Bacteria	4741
435	Ga0075363_100013057	3300006048	Bacteria	4016
436	Ga0075363_100018701	3300006048	Bacteria	3455
437	Ga0075363_100050670	3300006048	Bacteria	2213
438	Ga0075363_100148193	3300006048	Bacteria	1324
439	Ga0075363_100177600	3300006048	Bacteria	1210
440	Ga0075363_100405367	3300006048	Bacteria	802
441	Ga0075364_10507009	3300006051	Bacteria	825
442	Ga0070715_10001673	3300006163	Bacteria	6581
443	Ga0070715_10037875	3300006163	Bacteria	1999
444	Ga0070715_10056817	3300006163	Bacteria	1703
445	Ga0070716_100011397	3300006173	Bacteria	4474
446	Ga0070716_100077216	3300006173	Bacteria	1976
447	Ga0070712_100034599	3300006175	Bacteria	3425
448	Ga0070712_100043417	3300006175	Bacteria	3095
449	Ga0070712_100070281	3300006175	Bacteria	2501
450	Ga0070712_100085273	3300006175	Bacteria	2299
451	Ga0070712_100132241	3300006175	Bacteria	1892
452	Ga0070712_100182425	3300006175	Bacteria	1637
453	Ga0075362_10180907	3300006177	Bacteria	1022
454	Ga0075367_10003520	3300006178	Bacteria	7484
455	Ga0075367_10007715	3300006178	Bacteria	5531
456	Ga0075367_10092705	3300006178	Bacteria	1839
457	Ga0075367_10208621	3300006178	Bacteria	1221
458	Ga0075369_10194794	3300006186	Bacteria	934
459	Ga0097621_100000012	3300006237	Bacteria	105108
460	Ga0097621_100025865	3300006237	Bacteria	4597
461	Ga0097621_100081753	3300006237	Bacteria	2689
462	Ga0097621_100395532	3300006237	Bacteria	1236
463	Ga0075370_10031153	3300006353	Bacteria	2977
464	Ga0075370_10138880	3300006353	Bacteria	1420
465	Ga0068871_100000611	3300006358	Bacteria	24571
466	Ga0068871_100013433	3300006358	Bacteria	6079
467	Ga0068871_100068569	3300006358	Bacteria	2912
468	Ga0075428_100109695	3300006844	Bacteria	3006
469	Ga0075428_100204376	3300006844	Bacteria	2135
470	Ga0075428_100351720	3300006844	Bacteria	1581
471	Ga0075428_100508019	3300006844	Bacteria	1289
472	Ga0075428_100586767	3300006844	Bacteria	1191
473	Ga0075428_100701598	3300006844	Bacteria	1078
474	Ga0075430_100068552	3300006846	Bacteria	2976
475	Ga0075430_100273896	3300006846	Bacteria	1397
476	Ga0075430_100280233	3300006846	Bacteria	1379
477	Ga0075431_100138032	3300006847	Bacteria	2514
478	Ga0075431_100486813	3300006847	Bacteria	1226
479	Ga0075431_101015306	3300006847	Bacteria	796
480	Ga0075433_10002873	3300006852	Bacteria	13201
481	Ga0075433_10007157	3300006852	Bacteria	8835
482	Ga0075433_10183351	3300006852	Bacteria	1863
483	Ga0075433_10267280	3300006852	Bacteria	1516
484	Ga0075433_10319059	3300006852	Bacteria	1375
485	Ga0075434_100000193	3300006871	Bacteria	40605
486	Ga0075434_100009281	3300006871	Bacteria	9166
487	Ga0075434_100029193	3300006871	Bacteria	5423
488	Ga0075434_100123660	3300006871	Bacteria	2604
489	Ga0075434_100294096	3300006871	Bacteria	1644
490	Ga0075434_100454210	3300006871	Bacteria	1302
491	Ga0075434_100568225	3300006871	Bacteria	1153
492	Ga0075434_100609365	3300006871	Bacteria	1111
493	Ga0075429_100165702	3300006880	Bacteria	1936
494	Ga0068865_100002025	3300006881	Bacteria	11960
495	Ga0068865_100424799	3300006881	Bacteria	1094
496	Ga0068865_100580964	3300006881	Bacteria	945
497	Ga0075436_100124340	3300006914	Bacteria	1806
498	Ga0075436_100320201	3300006914	Bacteria	1114
499	Ga0075436_100534075	3300006914	Bacteria	860
500	Ga0097620_100004424	3300006931	Bacteria	14336
501	Ga0097620_100054213	3300006931	Bacteria	4032
502	Ga0097620_100064555	3300006931	Bacteria	3694
503	Ga0097620_100288971	3300006931	Bacteria	1732
504	Ga0097620_100346884	3300006931	Bacteria	1579
505	Ga0097620_100488408	3300006931	Bacteria	1327
506	Ga0099824_1014421	3300006942	Bacteria	7852
507	Ga0099822_1000827	3300006943	Bacteria	32648
508	Ga0075435_100044405	3300007076	Bacteria	3560
509	Ga0075435_100099462	3300007076	Bacteria	2408
510	Ga0105251_10018764	3300009011	Bacteria	3668
511	Ga0105251_10070658	3300009011	Bacteria	1625
512	Ga0105250_10015189	3300009092	Bacteria	3155
513	Ga0105240_10003692	3300009093	Bacteria	23676
514	Ga0105240_10006014	3300009093	Bacteria	17940
515	Ga0105240_10048039	3300009093	Bacteria	5397
516	Ga0105240_10058527	3300009093	Bacteria	4811
517	Ga0105240_10058928	3300009093	Bacteria	4793
518	Ga0105240_10070189	3300009093	Bacteria	4334
519	Ga0105240_10109244	3300009093	Bacteria	3350
520	Ga0105240_10232402	3300009093	Bacteria	2142
521	Ga0105240_10245972	3300009093	Bacteria	2071
522	Ga0105240_10744111	3300009093	Bacteria	1066
523	Ga0111539_10000679	3300009094	Bacteria	44034
524	Ga0111539_10010362	3300009094	Bacteria	11736
525	Ga0111539_10011215	3300009094	Bacteria	11261
526	Ga0111539_10088267	3300009094	Bacteria	3643
527	Ga0111539_10138586	3300009094	Bacteria	2849
528	Ga0111539_10239235	3300009094	Bacteria	2113
529	Ga0111539_10530365	3300009094	Bacteria	1372
530	Ga0111539_10627783	3300009094	Bacteria	1251
531	Ga0111539_10890893	3300009094	Bacteria	1035
532	Ga0105245_10000090	3300009098	Bacteria	90378
533	Ga0105245_10157389	3300009098	Bacteria	2153
534	Ga0105245_10214346	3300009098	Bacteria	1855
535	Ga0105245_10531198	3300009098	Bacteria	1196
536	Ga0105245_10870436	3300009098	Bacteria	942
537	Ga0105245_11264432	3300009098	Bacteria	787
538	Ga0105245_11448833	3300009098	Bacteria	737
539	Ga0105247_10002243	3300009101	Bacteria	13299
540	Ga0105247_10011628	3300009101	Bacteria	5302
541	Ga0105247_10048692	3300009101	Bacteria	2604
542	Ga0105247_10121211	3300009101	Bacteria	1694
543	Ga0105247_10129165	3300009101	Bacteria	1645
544	Ga0114129_10006668	3300009147	Bacteria	16397
545	Ga0114129_10027853	3300009147	Bacteria	8002
546	Ga0105243_10003044	3300009148	Bacteria	13819
547	Ga0105243_10059907	3300009148	Bacteria	3040
548	Ga0105243_10125743	3300009148	Bacteria	2168
549	Ga0105243_10415639	3300009148	Bacteria	1253
550	Ga0105243_10550675	3300009148	Bacteria	1102
551	Ga0105243_10691520	3300009148	Bacteria	993
552	Ga0105243_11000428	3300009148	Bacteria	839
553	Ga0105243_11328402	3300009148	Bacteria	737
554	Ga0105241_10003924	3300009174	Bacteria	11014
555	Ga0105241_10019512	3300009174	Bacteria	5000
556	Ga0105241_10031270	3300009174	Bacteria	3986
557	Ga0105241_10037882	3300009174	Bacteria	3634
558	Ga0105241_10073022	3300009174	Bacteria	2668
559	Ga0105241_10129938	3300009174	Bacteria	2038
560	Ga0105241_10495888	3300009174	Bacteria	1088
561	Ga0105242_10005355	3300009176	Bacteria	9921
562	Ga0105242_10023846	3300009176	Bacteria	4827
563	Ga0105242_11069294	3300009176	Bacteria	819
564	Ga0105248_10003797	3300009177	Bacteria	16742
565	Ga0105248_10004778	3300009177	Bacteria	14992
566	Ga0105248_10035792	3300009177	Bacteria	5553
567	Ga0105248_10636921	3300009177	Bacteria	1203
568	Ga0105248_10698214	3300009177	Bacteria	1145
569	Ga0105237_10004589	3300009545	Bacteria	15948
570	Ga0105237_10027348	3300009545	Bacteria	5823
571	Ga0105237_10075926	3300009545	Bacteria	3351
572	Ga0105237_10109729	3300009545	Bacteria	2751
573	Ga0105237_10135650	3300009545	Bacteria	2455
574	Ga0105237_10212365	3300009545	Bacteria	1935
575	Ga0105237_10260777	3300009545	Bacteria	1736
576	Ga0105237_10450079	3300009545	Bacteria	1294
577	Ga0105237_10584688	3300009545	Bacteria	1123
578	Ga0105238_10005022	3300009551	Bacteria	13079
579	Ga0105238_10007571	3300009551	Bacteria	10881
580	Ga0105238_10073433	3300009551	Bacteria	3415
581	Ga0105238_10099826	3300009551	Bacteria	2886
582	Ga0105238_10108677	3300009551	Bacteria	2755
583	Ga0105238_10142764	3300009551	Bacteria	2371
584	Ga0105238_10344930	3300009551	Bacteria	1478
585	Ga0105249_10001085	3300009553	Bacteria	24172
586	Ga0105249_10004401	3300009553	Bacteria	12182
587	Ga0105249_10405875	3300009553	Bacteria	1394
588	Ga0105249_10519751	3300009553	Bacteria	1237
589	Ga0105249_10616242	3300009553	Bacteria	1141
590	Ga0105249_10859107	3300009553	Bacteria	973
591	Ga0099796_10001099	3300010159	Bacteria	5180
592	Ga0099796_10057533	3300010159	Bacteria	1368
593	Ga0099796_10063315	3300010159	Bacteria	1317
594	Ga0105239_10024639	3300010375	Bacteria	6628
595	Ga0105239_10041875	3300010375	Bacteria	5019
596	Ga0105239_10081881	3300010375	Bacteria	3553
597	Ga0105239_10082895	3300010375	Bacteria	3531
598	Ga0105239_10095813	3300010375	Bacteria	3278
599	Ga0105239_10196081	3300010375	Bacteria	2262
600	Ga0105239_10335492	3300010375	Bacteria	1706
601	Ga0105239_10773310	3300010375	Bacteria	1099
602	Ga0105246_10000052	3300011119	Bacteria	46290
603	Ga0105246_10119144	3300011119	Bacteria	1953
604	Ga0105246_10136861	3300011119	Bacteria	1837
605	Ga0105246_10171964	3300011119	Bacteria	1660
606	Ga0105246_10192529	3300011119	Bacteria	1579
607	Ga0105246_10233457	3300011119	Bacteria	1450
608	Ga0105246_10421474	3300011119	Bacteria	1114
609	Ga0105246_10829235	3300011119	Bacteria	823
610	Ga0105246_11215663	3300011119	Bacteria	694
611	Ga0157343_1004133	3300012488	Bacteria	886
612	Ga0157335_1006798	3300012492	Bacteria	839
613	Ga0157341_1006251	3300012494	Bacteria	918
614	Ga0157313_1012619	3300012503	Bacteria	754
615	Ga0157313_1014166	3300012503	Bacteria	733
616	Ga0157342_1007304	3300012507	Bacteria	1068
617	Ga0157373_10038620	3300013100	Bacteria	3421
618	Ga0157373_10388979	3300013100	Bacteria	998
619	Ga0157373_10454944	3300013100	Bacteria	921
620	Ga0157371_10003401	3300013102	Bacteria	14457
621	Ga0157371_10190487	3300013102	Bacteria	1468
622	Ga0157370_10090465	3300013104	Bacteria	2874
623	Ga0157370_10091836	3300013104	Bacteria	2850
624	Ga0157370_10226000	3300013104	Bacteria	1733
625	Ga0157369_10001511	3300013105	Bacteria	28540
626	Ga0157369_10034718	3300013105	Bacteria	5532
627	Ga0157369_10095205	3300013105	Bacteria	3178
628	Ga0157369_10141449	3300013105	Bacteria	2546
629	Ga0157369_10177553	3300013105	Bacteria	2242
630	Ga0157374_10001210	3300013296	Bacteria	22071
631	Ga0157374_10033000	3300013296	Bacteria	4720
632	Ga0157374_10082621	3300013296	Bacteria	3051
633	Ga0157374_10085571	3300013296	Bacteria	2998
634	Ga0157374_10123455	3300013296	Bacteria	2501
635	Ga0157374_11053254	3300013296	Bacteria	833
636	Ga0157374_11268623	3300013296	Bacteria	758
637	Ga0157378_10002713	3300013297	Bacteria	15762
638	Ga0157378_10026970	3300013297	Bacteria	5067
639	Ga0157378_10071984	3300013297	Bacteria	3105
640	Ga0157378_10204429	3300013297	Bacteria	1870
641	Ga0157378_10411100	3300013297	Bacteria	1335
642	Ga0157378_10626389	3300013297	Bacteria	1089
643	Ga0163162_10000308	3300013306	Bacteria	45253
644	Ga0163162_10725450	3300013306	Bacteria	1114
645	Ga0163162_11617318	3300013306	Bacteria	739
646	Ga0157372_10002370	3300013307	Bacteria	20397
647	Ga0157372_10083580	3300013307	Bacteria	3617
648	Ga0157372_10207062	3300013307	Bacteria	2273
649	Ga0157372_10599237	3300013307	Bacteria	1284
650	Ga0157372_10803404	3300013307	Bacteria	1093
651	Ga0157372_11165579	3300013307	Bacteria	891
652	Ga0157372_11182252	3300013307	Bacteria	884
653	Ga0157375_10027778	3300013308	Bacteria	5294
654	Ga0157375_10052612	3300013308	Bacteria	4004
655	Ga0157375_10274068	3300013308	Bacteria	1849
656	Ga0163163_10002008	3300014325	Bacteria	17189
657	Ga0163163_10002377	3300014325	Bacteria	15920
658	Ga0163163_10103930	3300014325	Bacteria	2865
659	Ga0163163_10344325	3300014325	Bacteria	1546
660	Ga0163163_10405781	3300014325	Bacteria	1421
661	Ga0163163_10406571	3300014325	Bacteria	1420
662	Ga0163163_10505709	3300014325	Bacteria	1270
663	Ga0163163_10696394	3300014325	Bacteria	1080
664	Ga0163163_11169781	3300014325	Bacteria	832
665	Ga0157380_10000122	3300014326	Bacteria	43303
666	Ga0157380_10034627	3300014326	Bacteria	3896
667	Ga0157380_10417771	3300014326	Bacteria	1278
668	Ga0157380_10454794	3300014326	Bacteria	1231
669	Ga0182008_10064722	3300014497	Bacteria	1800
670	Ga0182008_10227460	3300014497	Bacteria	956
671	Ga0157377_10000996	3300014745	Bacteria	11936
672	Ga0157377_10365293	3300014745	Bacteria	973
673	Ga0157379_10000261	3300014968	Bacteria	41455
674	Ga0157379_10015326	3300014968	Bacteria	6724
675	Ga0157379_10126224	3300014968	Bacteria	2302
676	Ga0157379_10239561	3300014968	Bacteria	1645
677	Ga0157379_10250504	3300014968	Bacteria	1608
678	Ga0157379_10267297	3300014968	Bacteria	1555
679	Ga0157379_10310121	3300014968	Bacteria	1439
680	Ga0157379_10531500	3300014968	Bacteria	1092
681	Ga0157379_10609705	3300014968	Bacteria	1019
682	Ga0157376_10033090	3300014969	Bacteria	4158
683	Ga0157376_10221869	3300014969	Bacteria	1751
684	Ga0163161_10000199	3300017792	Bacteria	55004
685	Ga0163161_10420872	3300017792	Bacteria	1075
686	Ga0163161_10838685	3300017792	Bacteria	775
687	Ga0206354_10371782	3300020081	Bacteria	1381
688	Ga0206353_10910564	3300020082	Bacteria	826
689	Ga0214544_1000016	3300021320	Bacteria	204278
690	Ga0214544_1032668	3300021320	Bacteria	1602
691	Ga0214542_1000016	3300021321	Bacteria	210332
692	Ga0214545_1000008	3300021324	Bacteria	215190
693	Ga0214545_1038742	3300021324	Bacteria	1374
694	Ga0214543_1001466	3300021327	Bacteria	45567
695	Ga0213872_10011243	3300021361	Bacteria	4239
696	Ga0213872_10078139	3300021361	Bacteria	1487
697	Ga0213874_10004209	3300021377	Bacteria	3257
698	Ga0213874_10008008	3300021377	Bacteria	2560
699	Ga0213876_10018184	3300021384	Bacteria	3709
700	Ga0213876_10107392	3300021384	Bacteria	1481
701	Ga0213876_10137374	3300021384	Bacteria	1300
702	Ga0213871_10037183	3300021441	Bacteria	1294
703	Ga0224712_10109068	3300022467	Bacteria	1185
704	Ga0224572_1021438	3300024225	Bacteria	1240
705	Ga0228598_1011365	3300024227	Bacteria	1771
706	Ga0209563_105644	3300025230	Bacteria	2238
707	Ga0209677_101536	3300025253	Bacteria	9845
708	Ga0209677_101892	3300025253	Bacteria	8453
709	Ga0209148_1000275	3300025254	Bacteria	80696
710	Ga0209233_1007954	3300025261	Bacteria	3317
711	Ga0209233_1014430	3300025261	Bacteria	2224
712	Ga0209233_1019817	3300025261	Bacteria	1778
713	Ga0207666_1000105	3300025271	Bacteria	13184
714	Ga0209455_1001363	3300025272	Bacteria	11189
715	Ga0209455_1002070	3300025272	Bacteria	8101
716	Ga0209673_1069235	3300025273	Bacteria	847
717	Ga0207673_1000602	3300025290	Bacteria	3823
718	Ga0209564_1006362	3300025295	Bacteria	6400
719	Ga0209758_1000069	3300025297	Bacteria	286161
720	Ga0209758_1000635	3300025297	Bacteria	53736
721	Ga0209758_1000695	3300025297	Bacteria	49852
722	Ga0209758_1006620	3300025297	Bacteria	8210
723	Ga0209758_1008516	3300025297	Bacteria	6616
724	Ga0209758_1017993	3300025297	Bacteria	3487
725	Ga0209758_1102205	3300025297	Bacteria	812
726	Ga0209256_1006920	3300025299	Bacteria	5802
727	Ga0209256_1010781	3300025299	Bacteria	3767
728	Ga0209256_1026394	3300025299	Bacteria	1674
729	Ga0207426_1000826	3300025302	Bacteria	33158
730	Ga0207426_1002297	3300025302	Bacteria	12602
731	Ga0207426_1005144	3300025302	Bacteria	6090
732	Ga0209051_1070417	3300025303	Bacteria	1055
733	Ga0209257_1000473	3300025304	Bacteria	73323
734	Ga0207697_10001388	3300025315	Bacteria	13265
735	Ga0207697_10001632	3300025315	Bacteria	12134
736	Ga0207697_10019378	3300025315	Bacteria	2786
737	Ga0207656_10000909	3300025321	Bacteria	9633
738	Ga0207656_10209532	3300025321	Bacteria	944
739	Ga0207653_10006165	3300025885	Bacteria	3736
740	Ga0207653_10007363	3300025885	Bacteria	3430
741	Ga0207682_10000042	3300025893	Bacteria	52333
742	Ga0207692_10001284	3300025898	Bacteria	9322
743	Ga0207692_10008079	3300025898	Bacteria	4342
744	Ga0207692_10015342	3300025898	Bacteria	3369
745	Ga0207692_10040580	3300025898	Bacteria	2297
746	Ga0207692_10321308	3300025898	Bacteria	947
747	Ga0207642_10000065	3300025899	Bacteria	29318
748	Ga0207710_10000734	3300025900	Bacteria	18097
749	Ga0207710_10001358	3300025900	Bacteria	12296
750	Ga0207710_10014083	3300025900	Bacteria	3368
751	Ga0207710_10022169	3300025900	Bacteria	2725
752	Ga0207710_10136068	3300025900	Bacteria	1183
753	Ga0207710_10194890	3300025900	Bacteria	999
754	Ga0207688_10000053	3300025901	Bacteria	41441
755	Ga0207680_10009595	3300025903	Bacteria	4807
756	Ga0207680_10075958	3300025903	Bacteria	2097
757	Ga0207647_10002277	3300025904	Bacteria	14628
758	Ga0207647_10002478	3300025904	Bacteria	13980
759	Ga0207647_10038999	3300025904	Bacteria	3000
760	Ga0207685_10005136	3300025905	Bacteria	3419
761	Ga0207685_10018372	3300025905	Bacteria	2282
762	Ga0207699_10001061	3300025906	Bacteria	12978
763	Ga0207699_10002409	3300025906	Bacteria	8833
764	Ga0207699_10007678	3300025906	Bacteria	5281
765	Ga0207699_10017623	3300025906	Bacteria	3765
766	Ga0207699_10020586	3300025906	Bacteria	3539
767	Ga0207699_10043414	3300025906	Bacteria	2611
768	Ga0207699_10048715	3300025906	Bacteria	2490
769	Ga0207699_10091984	3300025906	Bacteria	1906
770	Ga0207699_10148040	3300025906	Bacteria	1550
771	Ga0207645_10002934	3300025907	Bacteria	13184
772	Ga0207645_10038584	3300025907	Bacteria	3062
773	Ga0207645_10223024	3300025907	Bacteria	1243
774	Ga0207645_10342197	3300025907	Bacteria	1000
775	Ga0207643_10000082	3300025908	Bacteria	62322
776	Ga0207643_10341461	3300025908	Bacteria	939
777	Ga0207705_10125785	3300025909	Bacteria	1905
778	Ga0207705_10213923	3300025909	Bacteria	1462
779	Ga0207705_10376588	3300025909	Bacteria	1096
780	Ga0207684_10072422	3300025910	Bacteria	2927
781	Ga0207654_10000341	3300025911	Bacteria	27815
782	Ga0207654_10003143	3300025911	Bacteria	8351
783	Ga0207654_10061554	3300025911	Bacteria	2197
784	Ga0207654_10095007	3300025911	Bacteria	1825
785	Ga0207654_10448894	3300025911	Bacteria	904
786	Ga0207707_10000100	3300025912	Bacteria	85682
787	Ga0207707_10004287	3300025912	Bacteria	12624
788	Ga0207707_10005522	3300025912	Bacteria	11055
789	Ga0207707_10030069	3300025912	Bacteria	4749
790	Ga0207707_10030393	3300025912	Bacteria	4726
791	Ga0207707_10058072	3300025912	Bacteria	3367
792	Ga0207707_10140830	3300025912	Bacteria	2109
793	Ga0207707_10204133	3300025912	Bacteria	1723
794	Ga0207707_10237025	3300025912	Bacteria	1587
795	Ga0207707_10284223	3300025912	Bacteria	1432
796	Ga0207707_10475865	3300025912	Bacteria	1067
797	Ga0207707_10770601	3300025912	Bacteria	803
798	Ga0207695_10000107	3300025913	Bacteria	252606
799	Ga0207695_10000453	3300025913	Bacteria	89314
800	Ga0207695_10021123	3300025913	Bacteria	7436
801	Ga0207695_10033190	3300025913	Bacteria	5637
802	Ga0207695_10104625	3300025913	Bacteria	2819
803	Ga0207695_10165664	3300025913	Bacteria	2139
804	Ga0207695_10255092	3300025913	Bacteria	1653
805	Ga0207695_10364668	3300025913	Bacteria	1331
806	Ga0207695_10498337	3300025913	Bacteria	1100
807	Ga0207695_10940911	3300025913	Bacteria	744
808	Ga0207671_10009240	3300025914	Bacteria	8259
809	Ga0207671_10020910	3300025914	Bacteria	4976
810	Ga0207671_10036979	3300025914	Bacteria	3620
811	Ga0207671_10101355	3300025914	Bacteria	2181
812	Ga0207671_10113801	3300025914	Bacteria	2061
813	Ga0207671_10131296	3300025914	Bacteria	1923
814	Ga0207671_10146359	3300025914	Bacteria	1823
815	Ga0207671_10210714	3300025914	Bacteria	1520
816	Ga0207671_10271557	3300025914	Bacteria	1336
817	Ga0207671_10371457	3300025914	Bacteria	1136
818	Ga0207671_10578122	3300025914	Bacteria	896
819	Ga0207693_10003195	3300025915	Bacteria	14067
820	Ga0207693_10003559	3300025915	Bacteria	13306
821	Ga0207693_10006870	3300025915	Bacteria	9396
822	Ga0207693_10110346	3300025915	Bacteria	2157
823	Ga0207693_10151462	3300025915	Bacteria	1824
824	Ga0207693_10189196	3300025915	Bacteria	1620
825	Ga0207693_10266053	3300025915	Bacteria	1344
826	Ga0207693_10620738	3300025915	Bacteria	841
827	Ga0207663_10000404	3300025916	Bacteria	18698
828	Ga0207663_10005157	3300025916	Bacteria	6570
829	Ga0207663_10007470	3300025916	Bacteria	5670
830	Ga0207663_10017529	3300025916	Bacteria	3993
831	Ga0207663_10236115	3300025916	Bacteria	1338
832	Ga0207660_10000083	3300025917	Bacteria	50279
833	Ga0207660_10001366	3300025917	Bacteria	16351
834	Ga0207660_10038196	3300025917	Bacteria	3351
835	Ga0207660_10119066	3300025917	Bacteria	1998
836	Ga0207660_10165050	3300025917	Bacteria	1711
837	Ga0207660_10260726	3300025917	Bacteria	1371
838	Ga0207660_10389355	3300025917	Bacteria	1121
839	Ga0207662_10000989	3300025918	Bacteria	13264
840	Ga0207662_10055979	3300025918	Bacteria	2354
841	Ga0207662_10074498	3300025918	Bacteria	2060
842	Ga0207657_10004153	3300025919	Bacteria	15356
843	Ga0207657_10004786	3300025919	Bacteria	14281
844	Ga0207657_10008044	3300025919	Bacteria	10753
845	Ga0207657_10014940	3300025919	Bacteria	7545
846	Ga0207657_10073412	3300025919	Bacteria	2891
847	Ga0207657_10115685	3300025919	Bacteria	2210
848	Ga0207657_10135181	3300025919	Bacteria	2018
849	Ga0207657_10171286	3300025919	Bacteria	1758
850	Ga0207657_10250051	3300025919	Bacteria	1413
851	Ga0207649_10000643	3300025920	Bacteria	23321
852	Ga0207649_10101258	3300025920	Bacteria	1907
853	Ga0207649_10221979	3300025920	Bacteria	1346
854	Ga0207652_10000557	3300025921	Bacteria	37611
855	Ga0207652_10001889	3300025921	Bacteria	18142
856	Ga0207652_10002952	3300025921	Bacteria	14213
857	Ga0207652_10030169	3300025921	Bacteria	4539
858	Ga0207652_10031974	3300025921	Bacteria	4420
859	Ga0207652_10040820	3300025921	Bacteria	3942
860	Ga0207652_10219577	3300025921	Bacteria	1713
861	Ga0207652_10240986	3300025921	Bacteria	1630
862	Ga0207652_10273893	3300025921	Bacteria	1522
863	Ga0207652_10456051	3300025921	Bacteria	1152
864	Ga0207652_10549136	3300025921	Bacteria	1038
865	Ga0207652_10663154	3300025921	Bacteria	932
866	Ga0207646_10140083	3300025922	Bacteria	2178
867	Ga0207681_10000271	3300025923	Bacteria	38955
868	Ga0207681_10029377	3300025923	Bacteria	3570
869	Ga0207681_10065884	3300025923	Bacteria	2506
870	Ga0207681_10111785	3300025923	Bacteria	1988
871	Ga0207681_10646783	3300025923	Bacteria	876
872	Ga0207694_10001512	3300025924	Bacteria	19799
873	Ga0207694_10002704	3300025924	Bacteria	14352
874	Ga0207694_10006429	3300025924	Bacteria	8953
875	Ga0207694_10075818	3300025924	Bacteria	2633
876	Ga0207694_10082295	3300025924	Bacteria	2530
877	Ga0207694_10106951	3300025924	Bacteria	2222
878	Ga0207694_10245655	3300025924	Bacteria	1463
879	Ga0207694_10377039	3300025924	Bacteria	1177
880	Ga0207694_10404352	3300025924	Bacteria	1135
881	Ga0207650_10006111	3300025925	Bacteria	8203
882	Ga0207650_10007967	3300025925	Bacteria	7222
883	Ga0207650_10132246	3300025925	Bacteria	1954
884	Ga0207650_10343847	3300025925	Bacteria	1226
885	Ga0207659_10000161	3300025926	Bacteria	39821
886	Ga0207659_10000460	3300025926	Bacteria	24451
887	Ga0207659_10071731	3300025926	Bacteria	2530
888	Ga0207659_10153808	3300025926	Bacteria	1799
889	Ga0207659_10183090	3300025926	Bacteria	1661
890	Ga0207659_10784047	3300025926	Bacteria	818
891	Ga0207687_10000063	3300025927	Bacteria	83105
892	Ga0207687_10039457	3300025927	Bacteria	3233
893	Ga0207687_10104991	3300025927	Bacteria	2086
894	Ga0207687_10469445	3300025927	Bacteria	1046
895	Ga0207687_10697452	3300025927	Bacteria	861
896	Ga0207700_10001725	3300025928	Bacteria	12413
897	Ga0207700_10003639	3300025928	Bacteria	8987
898	Ga0207700_10005508	3300025928	Bacteria	7591
899	Ga0207700_10019767	3300025928	Bacteria	4556
900	Ga0207700_10028048	3300025928	Bacteria	3951
901	Ga0207700_10059459	3300025928	Bacteria	2891
902	Ga0207700_10075892	3300025928	Bacteria	2606
903	Ga0207700_10120590	3300025928	Bacteria	2126
904	Ga0207700_10303613	3300025928	Bacteria	1379
905	Ga0207700_10391688	3300025928	Bacteria	1216
906	Ga0207700_10431039	3300025928	Bacteria	1159
907	Ga0207700_10765219	3300025928	Bacteria	863
908	Ga0207700_10780121	3300025928	Bacteria	854
909	Ga0207664_10005345	3300025929	Bacteria	8772
910	Ga0207664_10012728	3300025929	Bacteria	6021
911	Ga0207664_10017118	3300025929	Bacteria	5304
912	Ga0207664_10019486	3300025929	Bacteria	5015
913	Ga0207664_10049710	3300025929	Bacteria	3303
914	Ga0207664_10245761	3300025929	Bacteria	1560
915	Ga0207664_10350388	3300025929	Bacteria	1307
916	Ga0207644_10000591	3300025931	Bacteria	23144
917	Ga0207644_10005027	3300025931	Bacteria	8634
918	Ga0207644_10020869	3300025931	Bacteria	4457
919	Ga0207644_10039521	3300025931	Bacteria	3330
920	Ga0207644_10093923	3300025931	Bacteria	2240
921	Ga0207644_10130097	3300025931	Bacteria	1926
922	Ga0207644_10230971	3300025931	Bacteria	1470
923	Ga0207644_10485231	3300025931	Bacteria	1018
924	Ga0207644_10700440	3300025931	Bacteria	844
925	Ga0207690_10000897	3300025932	Bacteria	19010
926	Ga0207690_10012047	3300025932	Bacteria	5170
927	Ga0207690_10057304	3300025932	Bacteria	2632
928	Ga0207690_10061857	3300025932	Bacteria	2546
929	Ga0207690_10205631	3300025932	Bacteria	1498
930	Ga0207690_10236616	3300025932	Bacteria	1405
931	Ga0207690_10276387	3300025932	Bacteria	1307
932	Ga0207706_10004384	3300025933	Bacteria	13264
933	Ga0207706_10006410	3300025933	Bacteria	10931
934	Ga0207706_10012728	3300025933	Bacteria	7659
935	Ga0207706_10031159	3300025933	Bacteria	4753
936	Ga0207706_10138887	3300025933	Bacteria	2137
937	Ga0207706_10260866	3300025933	Bacteria	1513
938	Ga0207706_10707175	3300025933	Bacteria	861
939	Ga0207686_10000614	3300025934	Bacteria	22208
940	Ga0207686_10324033	3300025934	Bacteria	1152
941	Ga0207709_10000429	3300025935	Bacteria	40094
942	Ga0207709_10032140	3300025935	Bacteria	3071
943	Ga0207709_10048634	3300025935	Bacteria	2585
944	Ga0207709_10140044	3300025935	Bacteria	1662
945	Ga0207670_10000485	3300025936	Bacteria	21952
946	Ga0207670_10058924	3300025936	Bacteria	2610
947	Ga0207669_10000019	3300025937	Bacteria	111630
948	Ga0207669_10017263	3300025937	Bacteria	3697
949	Ga0207669_10080009	3300025937	Bacteria	2088
950	Ga0207669_10198116	3300025937	Bacteria	1455
951	Ga0207669_10241402	3300025937	Bacteria	1339
952	Ga0207669_10661434	3300025937	Bacteria	855
953	Ga0207669_10730195	3300025937	Bacteria	816
954	Ga0207704_10004559	3300025938	Bacteria	6340
955	Ga0207704_10714084	3300025938	Bacteria	831
956	Ga0207665_10001034	3300025939	Bacteria	18732
957	Ga0207665_10004382	3300025939	Bacteria	9380
958	Ga0207665_10043812	3300025939	Bacteria	2993
959	Ga0207665_10051444	3300025939	Bacteria	2773
960	Ga0207665_10297966	3300025939	Bacteria	1204
961	Ga0207665_10349423	3300025939	Bacteria	1116
962	Ga0207665_10358539	3300025939	Bacteria	1102
963	Ga0207665_10542837	3300025939	Bacteria	902
964	Ga0207665_10632815	3300025939	Bacteria	837
965	Ga0207691_10004668	3300025940	Bacteria	13264
966	Ga0207691_10303183	3300025940	Bacteria	1372
967	Ga0207691_10351246	3300025940	Bacteria	1261
968	Ga0207691_10442956	3300025940	Bacteria	1106
969	Ga0207691_10476302	3300025940	Bacteria	1061
970	Ga0207691_10669490	3300025940	Bacteria	876
971	Ga0207711_10009466	3300025941	Bacteria	8129
972	Ga0207711_10031429	3300025941	Bacteria	4481
973	Ga0207711_10242333	3300025941	Bacteria	1653
974	Ga0207711_10426052	3300025941	Bacteria	1234
975	Ga0207711_10527228	3300025941	Bacteria	1101
976	Ga0207711_10689337	3300025941	Bacteria	953
977	Ga0207689_10001364	3300025942	Bacteria	23406
978	Ga0207689_10262663	3300025942	Bacteria	1428
979	Ga0207689_10550363	3300025942	Bacteria	969
980	Ga0207689_10744764	3300025942	Bacteria	827
981	Ga0207661_10000281	3300025944	Bacteria	32639
982	Ga0207661_10006554	3300025944	Bacteria	8230
983	Ga0207661_10007064	3300025944	Bacteria	7970
984	Ga0207661_10010090	3300025944	Bacteria	6787
985	Ga0207679_10000026	3300025945	Bacteria	200073
986	Ga0207679_10095346	3300025945	Bacteria	2313
987	Ga0207679_10110177	3300025945	Bacteria	2171
988	Ga0207679_10118749	3300025945	Bacteria	2101
989	Ga0207679_10158661	3300025945	Bacteria	1850
990	Ga0207679_10251683	3300025945	Bacteria	1502
991	Ga0207679_10381079	3300025945	Bacteria	1236
992	Ga0207667_10002324	3300025949	Bacteria	23814
993	Ga0207667_10004064	3300025949	Bacteria	17974
994	Ga0207667_10007600	3300025949	Bacteria	12999
995	Ga0207667_10015590	3300025949	Bacteria	8623
996	Ga0207667_10043137	3300025949	Bacteria	4787
997	Ga0207667_10067257	3300025949	Bacteria	3733
998	Ga0207667_10126419	3300025949	Bacteria	2633
999	Ga0207667_10652603	3300025949	Bacteria	1058
1000	Ga0207667_10690693	3300025949	Bacteria	1023
1001	Ga0207651_10000101	3300025960	Bacteria	37898
1002	Ga0207651_10016951	3300025960	Bacteria	4288
1003	Ga0207651_10129801	3300025960	Bacteria	1927
1004	Ga0207651_10152310	3300025960	Bacteria	1802
1005	Ga0207712_10000908	3300025961	Bacteria	21454
1006	Ga0207712_10039033	3300025961	Bacteria	3251
1007	Ga0207712_10155086	3300025961	Bacteria	1773
1008	Ga0207712_10191767	3300025961	Bacteria	1614
1009	Ga0207712_10243597	3300025961	Bacteria	1449
1010	Ga0207712_10380492	3300025961	Bacteria	1181
1011	Ga0207712_10700924	3300025961	Bacteria	884
1012	Ga0207668_10000726	3300025972	Bacteria	20155
1013	Ga0207668_10119178	3300025972	Bacteria	1995
1014	Ga0207668_10145280	3300025972	Bacteria	1829
1015	Ga0207668_10193823	3300025972	Bacteria	1612
1016	Ga0207668_10200311	3300025972	Bacteria	1589
1017	Ga0207668_10276534	3300025972	Bacteria	1375
1018	Ga0207668_10282609	3300025972	Bacteria	1361
1019	Ga0207640_10000596	3300025981	Bacteria	21479
1020	Ga0207640_10034701	3300025981	Bacteria	3150
1021	Ga0207640_10080170	3300025981	Bacteria	2227
1022	Ga0207640_10259139	3300025981	Bacteria	1354
1023	Ga0207658_10008906	3300025986	Bacteria	6807
1024	Ga0207658_10028857	3300025986	Bacteria	3911
1025	Ga0207658_10072998	3300025986	Bacteria	2603
1026	Ga0207658_10098069	3300025986	Bacteria	2289
1027	Ga0207677_10000651	3300026023	Bacteria	20869
1028	Ga0207677_10127552	3300026023	Bacteria	1925
1029	Ga0207703_10001717	3300026035	Bacteria	19677
1030	Ga0207703_10035069	3300026035	Bacteria	3986
1031	Ga0207703_10078142	3300026035	Bacteria	2748
1032	Ga0207703_10588283	3300026035	Bacteria	1052
1033	Ga0207703_10661403	3300026035	Bacteria	991
1034	Ga0207639_10002467	3300026041	Bacteria	12402
1035	Ga0207639_10009146	3300026041	Bacteria	6829
1036	Ga0207639_10033329	3300026041	Bacteria	3799
1037	Ga0207639_10058662	3300026041	Bacteria	2962
1038	Ga0207639_10127731	3300026041	Bacteria	2099
1039	Ga0207639_10242186	3300026041	Bacteria	1569
1040	Ga0207639_10319160	3300026041	Bacteria	1379
1041	Ga0207639_10397411	3300026041	Bacteria	1241
1042	Ga0207678_10002308	3300026067	Bacteria	17274
1043	Ga0207678_10003998	3300026067	Bacteria	13264
1044	Ga0207678_10014165	3300026067	Bacteria	7011
1045	Ga0207678_10069768	3300026067	Bacteria	3013
1046	Ga0207678_10073693	3300026067	Bacteria	2926
1047	Ga0207678_10088949	3300026067	Bacteria	2640
1048	Ga0207678_10121226	3300026067	Bacteria	2232
1049	Ga0207678_10236693	3300026067	Bacteria	1564
1050	Ga0207678_10260684	3300026067	Bacteria	1486
1051	Ga0207678_10262057	3300026067	Bacteria	1481
1052	Ga0207708_10002606	3300026075	Bacteria	13264
1053	Ga0207708_10003659	3300026075	Bacteria	11345
1054	Ga0207708_10095163	3300026075	Bacteria	2300
1055	Ga0207708_10312865	3300026075	Bacteria	1280
1056	Ga0207708_11010123	3300026075	Bacteria	723
1057	Ga0207702_10000004	3300026078	Bacteria	422182
1058	Ga0207702_10008573	3300026078	Bacteria	8618
1059	Ga0207702_10011218	3300026078	Bacteria	7473
1060	Ga0207702_10046751	3300026078	Bacteria	3644
1061	Ga0207702_10136551	3300026078	Bacteria	2213
1062	Ga0207702_10509343	3300026078	Bacteria	1174
1063	Ga0207641_10002162	3300026088	Bacteria	18511
1064	Ga0207641_10152915	3300026088	Bacteria	2091
1065	Ga0207641_10427024	3300026088	Bacteria	1277
1066	Ga0207641_10432374	3300026088	Bacteria	1269
1067	Ga0207641_10496776	3300026088	Bacteria	1184
1068	Ga0207641_10508572	3300026088	Bacteria	1170
1069	Ga0207648_10003986	3300026089	Bacteria	15325
1070	Ga0207648_10022099	3300026089	Bacteria	5714
1071	Ga0207648_10043824	3300026089	Bacteria	3927
1072	Ga0207648_10227698	3300026089	Bacteria	1658
1073	Ga0207648_10758961	3300026089	Bacteria	901
1074	Ga0207648_10794980	3300026089	Bacteria	880
1075	Ga0207676_10000563	3300026095	Bacteria	30791
1076	Ga0207676_10147248	3300026095	Bacteria	2023
1077	Ga0207676_10421936	3300026095	Bacteria	1251
1078	Ga0207676_10573009	3300026095	Bacteria	1081
1079	Ga0207676_10789750	3300026095	Bacteria	925
1080	Ga0207676_10837167	3300026095	Bacteria	899
1081	Ga0207674_10000890	3300026116	Bacteria	39065
1082	Ga0207674_10004798	3300026116	Bacteria	16196
1083	Ga0207674_10007670	3300026116	Bacteria	12563
1084	Ga0207674_10017171	3300026116	Bacteria	7899
1085	Ga0207674_10046238	3300026116	Bacteria	4470
1086	Ga0207674_10065909	3300026116	Bacteria	3649
1087	Ga0207674_10102592	3300026116	Bacteria	2840
1088	Ga0207674_10305663	3300026116	Bacteria	1540
1089	Ga0207674_11099974	3300026116	Bacteria	764
1090	Ga0207675_100004624	3300026118	Bacteria	13264
1091	Ga0207675_100006125	3300026118	Bacteria	11434
1092	Ga0207675_100114943	3300026118	Bacteria	2542
1093	Ga0207675_100176776	3300026118	Bacteria	2042
1094	Ga0207675_100330734	3300026118	Bacteria	1489
1095	Ga0207675_100857017	3300026118	Bacteria	924
1096	Ga0207683_10000324	3300026121	Bacteria	43461
1097	Ga0207683_10004461	3300026121	Bacteria	12084
1098	Ga0207683_10111418	3300026121	Bacteria	2451
1099	Ga0207683_10115944	3300026121	Bacteria	2401
1100	Ga0207683_10128189	3300026121	Bacteria	2281
1101	Ga0207683_10244893	3300026121	Bacteria	1635
1102	Ga0207683_10441989	3300026121	Bacteria	1198
1103	Ga0207683_10717431	3300026121	Bacteria	927
1104	Ga0207683_10781664	3300026121	Bacteria	886
1105	Ga0207698_10000634	3300026142	Bacteria	20408
1106	Ga0207698_10006435	3300026142	Bacteria	7332
1107	Ga0207698_10017851	3300026142	Bacteria	4823
1108	Ga0207698_10229818	3300026142	Bacteria	1683
1109	Ga0207698_10319859	3300026142	Bacteria	1453
1110	Ga0207698_10497569	3300026142	Bacteria	1186
1111	Ga0207698_10678663	3300026142	Bacteria	1023
1112	Ga0209389_1000033	3300027296	Bacteria	131516
1113	Ga0209389_1000182	3300027296	Bacteria	48705
1114	Ga0209589_1000021	3300027357	Bacteria	186431
1115	Ga0209589_1000040	3300027357	Bacteria	126550
1116	Ga0209489_100028	3300027361	Bacteria	186431
1117	Ga0209489_100045	3300027361	Bacteria	158225
1118	Ga0209489_100209	3300027361	Bacteria	96349
1119	Ga0209700_100011	3300027363	Bacteria	362159
1120	Ga0209700_100037	3300027363	Bacteria	186431
1121	Ga0209179_1005574	3300027512	Bacteria	1979
1122	Ga0209588_1017691	3300027671	Bacteria	2212
1123	Ga0209971_1004317	3300027682	Bacteria	3376
1124	Ga0209971_1032528	3300027682	Bacteria	1252
1125	Ga0209966_1000958	3300027695	Bacteria	5417
1126	Ga0209998_10001202	3300027717	Bacteria	6371
1127	Ga0209998_10002977	3300027717	Bacteria	3776
1128	Ga0209998_10008168	3300027717	Bacteria	2171
1129	Ga0209813_10005435	3300027866	Bacteria	3091
1130	Ga0209813_10039420	3300027866	Bacteria	1432
1131	Ga0209813_10049642	3300027866	Bacteria	1307
1132	Ga0209974_10002004	3300027876	Bacteria	7432
1133	Ga0209974_10012636	3300027876	Bacteria	2821
1134	Ga0209974_10077819	3300027876	Bacteria	1137
1135	Ga0207428_10000130	3300027907	Bacteria	104457
1136	Ga0207428_10009156	3300027907	Bacteria	8896
1137	Ga0265357_1000519	3300028023	Bacteria	2299
1138	Ga0268266_10006104	3300028379	Bacteria	11096
1139	Ga0268266_10014618	3300028379	Bacteria	6746
1140	Ga0268266_10040428	3300028379	Bacteria	3974
1141	Ga0268266_10099347	3300028379	Bacteria	2562
1142	Ga0268266_10156625	3300028379	Bacteria	2058
1143	Ga0268266_10219664	3300028379	Bacteria	1746
1144	Ga0268266_10230541	3300028379	Bacteria	1705
1145	Ga0268266_10249093	3300028379	Bacteria	1643
1146	Ga0268266_10460105	3300028379	Bacteria	1210
1147	Ga0268266_10529214	3300028379	Bacteria	1128
1148	Ga0268265_10018250	3300028380	Bacteria	4859
1149	Ga0268265_10028336	3300028380	Bacteria	4008
1150	Ga0268265_10044934	3300028380	Bacteria	3292
1151	Ga0268265_10052133	3300028380	Bacteria	3092
1152	Ga0268265_10107232	3300028380	Bacteria	2271
1153	Ga0268265_10134157	3300028380	Bacteria	2063
1154	Ga0268265_10210216	3300028380	Bacteria	1695
1155	Ga0268265_10507613	3300028380	Bacteria	1137
1156	Ga0268265_10657426	3300028380	Bacteria	1008
1157	Ga0268264_10000157	3300028381	Bacteria	155163
1158	Ga0268264_10003472	3300028381	Bacteria	13591
1159	Ga0268264_10107873	3300028381	Bacteria	2433
1160	Ga0268264_10117569	3300028381	Bacteria	2338
1161	Ga0268264_10176788	3300028381	Bacteria	1935
1162	Ga0268264_10409098	3300028381	Bacteria	1306
1163	Ga0268264_10521668	3300028381	Bacteria	1162
1164	Ga0265337_1001317	3300028556	Bacteria	12368
1165	Ga0265337_1013194	3300028556	Bacteria	2783
1166	Ga0265326_10006634	3300028558	Bacteria	3581
1167	Ga0265319_1022443	3300028563	Bacteria	2300
1168	Ga0265334_10023967	3300028573	Bacteria	2479
1169	Ga0265334_10029725	3300028573	Bacteria	2189
1170	Ga0265334_10052720	3300028573	Bacteria	1556
1171	Ga0265318_10014886	3300028577	Bacteria	3253
1172	Ga0265323_10005150	3300028653	Bacteria	5568
1173	Ga0265322_10017458	3300028654	Bacteria	2067
1174	Ga0265336_10003307	3300028666	Bacteria	6353
1175	Ga0307517_10001338	3300028786	Bacteria	41372
1176	Ga0307517_10223001	3300028786	Bacteria	1143
1177	Ga0307515_10036525	3300028794	Bacteria	7944
1178	Ga0307515_10489800	3300028794	Bacteria	841
1179	Ga0265338_10000598	3300028800	Bacteria	63497
1180	Ga0265338_10088835	3300028800	Bacteria	2563
1181	Ga0265338_10490925	3300028800	Bacteria	865
1182	Ga0265324_10005026	3300029957	Bacteria	5812
1183	Ga0307511_10053449	3300030521	Bacteria	3201
1184	Ga0265762_1046068	3300030760	Bacteria	864
1185	Ga0265760_10149896	3300031090	Bacteria	764
1186	Ga0265330_10016402	3300031235	Bacteria	3418
1187	Ga0265330_10181089	3300031235	Bacteria	893
1188	Ga0265332_10002811	3300031238	Bacteria	8649
1189	Ga0265332_10095651	3300031238	Bacteria	1255
1190	Ga0265332_10241352	3300031238	Bacteria	748
1191	Ga0265328_10000008	3300031239	Bacteria	208282
1192	Ga0265320_10160895	3300031240	Bacteria	1011
1193	Ga0265325_10000011	3300031241	Bacteria	150631
1194	Ga0265325_10000229	3300031241	Bacteria	39809
1195	Ga0265325_10017277	3300031241	Bacteria	4012
1196	Ga0265325_10017337	3300031241	Bacteria	4004
1197	Ga0265325_10018145	3300031241	Bacteria	3903
1198	Ga0265325_10086699	3300031241	Bacteria	1549
1199	Ga0265325_10122923	3300031241	Bacteria	1249
1200	Ga0265325_10218455	3300031241	Bacteria	873
1201	Ga0265329_10036114	3300031242	Bacteria	1594
1202	Ga0265340_10003064	3300031247	Bacteria	9498
1203	Ga0265340_10102176	3300031247	Bacteria	1331
1204	Ga0265339_10000068	3300031249	Bacteria	91555
1205	Ga0265339_10039428	3300031249	Bacteria	2630
1206	Ga0265339_10065542	3300031249	Bacteria	1947
1207	Ga0265339_10088945	3300031249	Bacteria	1621
1208	Ga0265339_10183264	3300031249	Bacteria	1041
1209	Ga0265331_10001410	3300031250	Bacteria	17644
1210	Ga0265331_10002631	3300031250	Bacteria	12053
1211	Ga0265331_10010008	3300031250	Bacteria	5273
1212	Ga0265331_10019125	3300031250	Bacteria	3540
1213	Ga0265331_10024962	3300031250	Bacteria	3019
1214	Ga0265327_10190517	3300031251	Bacteria	933
1215	Ga0265327_10198548	3300031251	Bacteria	909
1216	Ga0265316_10000387	3300031344	Bacteria	50269
1217	Ga0265316_10019064	3300031344	Bacteria	5878
1218	Ga0307513_10158328	3300031456	Bacteria	2161
1219	Ga0307509_10052266	3300031507	Bacteria	4362
1220	Ga0307509_10414274	3300031507	Bacteria	1050
1221	Ga0307509_10541199	3300031507	Bacteria	843
1222	Ga0307408_100086876	3300031548	Bacteria	2351
1223	Ga0307408_100147996	3300031548	Bacteria	1851
1224	Ga0307408_100383207	3300031548	Bacteria	1202
1225	Ga0307408_100405170	3300031548	Bacteria	1172
1226	Ga0265313_10000088	3300031595	Bacteria	90711
1227	Ga0265313_10000227	3300031595	Bacteria	60770
1228	Ga0265313_10009907	3300031595	Bacteria	6120
1229	Ga0265313_10082909	3300031595	Bacteria	1452
1230	Ga0307508_10000002	3300031616	Bacteria	407635
1231	Ga0307508_10097319	3300031616	Bacteria	2535
1232	Ga0307508_10128550	3300031616	Bacteria	2137
1233	Ga0307508_10153375	3300031616	Bacteria	1908
1234	Ga0307508_10389397	3300031616	Bacteria	985
1235	Ga0316575_10164724	3300031665	Bacteria	917
1236	Ga0265314_10003337	3300031711	Bacteria	15632
1237	Ga0265314_10007615	3300031711	Bacteria	9373
1238	Ga0265314_10015101	3300031711	Bacteria	6142
1239	Ga0265314_10037169	3300031711	Bacteria	3531
1240	Ga0265314_10041056	3300031711	Bacteria	3315
1241	Ga0265342_10000625	3300031712	Bacteria	37152
1242	Ga0265342_10003978	3300031712	Bacteria	11831
1243	Ga0265342_10034285	3300031712	Bacteria	3115
1244	Ga0265342_10090779	3300031712	Bacteria	1751
1245	Ga0265342_10113841	3300031712	Bacteria	1529
1246	Ga0265342_10128398	3300031712	Bacteria	1422
1247	Ga0265342_10158093	3300031712	Bacteria	1254
1248	Ga0316576_10262138	3300031727	Bacteria	1296
1249	Ga0307516_10008231	3300031730	Bacteria	11840
1250	Ga0307516_10055028	3300031730	Bacteria	3886
1251	Ga0307516_10189841	3300031730	Bacteria	1781
1252	Ga0307516_10210294	3300031730	Bacteria	1660
1253	Ga0307516_10291589	3300031730	Bacteria	1310
1254	Ga0307405_10176360	3300031731	Bacteria	1530
1255	Ga0307405_10365299	3300031731	Bacteria	1118
1256	Ga0307405_10649528	3300031731	Bacteria	867
1257	Ga0307413_10130389	3300031824	Bacteria	1720
1258	Ga0307413_10261047	3300031824	Bacteria	1291
1259	Ga0307410_10164480	3300031852	Bacteria	1666
1260	Ga0307410_10354546	3300031852	Bacteria	1173
1261	Ga0307406_10172386	3300031901	Bacteria	1567
1262	Ga0307406_10418685	3300031901	Bacteria	1067
1263	Ga0307406_10668705	3300031901	Bacteria	864
1264	Ga0307407_10007791	3300031903	Bacteria	4873
1265	Ga0307407_10085386	3300031903	Bacteria	1920
1266	Ga0307407_10787524	3300031903	Bacteria	722
1267	Ga0307412_10250128	3300031911	Bacteria	1376
1268	Ga0307409_100081591	3300031995	Bacteria	2615
1269	Ga0307409_100194809	3300031995	Bacteria	1807
1270	Ga0307409_100420687	3300031995	Bacteria	1282
1271	Ga0307416_100142560	3300032002	Bacteria	2181
1272	Ga0307416_100602636	3300032002	Bacteria	1178
1273	Ga0307414_10165978	3300032004	Bacteria	1760
1274	Ga0307414_10784177	3300032004	Bacteria	868
1275	Ga0307411_10044467	3300032005	Bacteria	2849
1276	Ga0307411_10080393	3300032005	Bacteria	2241
1277	Ga0307411_10239826	3300032005	Bacteria	1418
1278	Ga0307415_100343032	3300032126	Bacteria	1254
1279	Ga0307415_100381945	3300032126	Bacteria	1196
1280	Ga0316583_10003757	3300032133	Bacteria	5374
1281	Ga0316585_10037711	3300032137	Bacteria	1534
1282	Ga0307510_10001271	3300033180	Bacteria	27493
1283	Ga0307510_10014252	3300033180	Bacteria	9415
1284	Ga0307510_10021608	3300033180	Bacteria	7499
1285	Ga0307510_10406491	3300033180	Bacteria	804
1286	Ga0315911_1000008	3300033442	Bacteria	381285
1287	Ga0373930_0009343	3300034816	Bacteria	1735
1288	Ga0373948_0005713	3300034817	Bacteria	2027
1289	Ga0373950_0019951	3300034818	Bacteria	1175
1290	Ga0373950_0036305	3300034818	Bacteria	929
1291	Ga0373958_0002447	3300034819	Bacteria	2602
1292	Ga0373958_0041140	3300034819	Bacteria	945
1293	Ga0373959_0009627	3300034820	Bacteria	1672
1294	Ga0373959_0032312	3300034820	Bacteria	1063
1295	Ga0373938_0000042	3300034957	Bacteria	16588
1296	Ga0373938_0001766	3300034957	Bacteria	3450
1297	Ga0373938_0035384	3300034957	Bacteria	1089
1298	Ga0373938_0052099	3300034957	Bacteria	937
1299	Ga0373926_0025017	3300035083	Bacteria	2082
1300	Ga0373926_0052456	3300035083	Bacteria	1474
1301	Ga0373926_0064211	3300035083	Bacteria	1341
1302	Ga0373928_0011842	3300035084	Bacteria	1734
1303	Ga0373928_0076840	3300035084	Bacteria	835
1304	Ga0373929_0001918	3300035085	Bacteria	3887
1305	Ga0373929_0019411	3300035085	Bacteria	1361
1306	Ga0373929_0096809	3300035085	Bacteria	739
1307	Ga0373934_0005590	3300035086	Bacteria	4654
1308	Ga0373934_0013739	3300035086	Bacteria	3064
1309	Ga0373934_0068079	3300035086	Bacteria	1422
1310	Ga0373934_0153946	3300035086	Bacteria	942
1311	Ga0373940_0008323	3300035088	Bacteria	2375
1312	Ga0373944_0030650	3300035089	Bacteria	1614
1313	Ga0373949_0001046	3300035090	Bacteria	8465
1314	Ga0373951_0000165	3300035091	Bacteria	24248
1315	Ga0373951_0002799	3300035091	Bacteria	4351
1316	Ga0373951_0004702	3300035091	Bacteria	3226
1317	Ga0373952_0000216	3300035092	Bacteria	9133
1318	Ga0373952_0045084	3300035092	Bacteria	1032
1319	Ga0373923_0019315	3300035111	Bacteria	2637
1320	Ga0373923_0039673	3300035111	Bacteria	1934
1321	Ga0373923_0105160	3300035111	Bacteria	1248
1322	Ga0373923_0105192	3300035111	Bacteria	1248
1323	Ga0373932_0000221	3300035112	Bacteria	16961
1324	Ga0373932_0001262	3300035112	Bacteria	7177
1325	Ga0373932_0009986	3300035112	Bacteria	2290
1326	Ga0373936_0021525	3300035113	Bacteria	2508
1327	Ga0373936_0070408	3300035113	Bacteria	1441
1328	Ga0373936_0107922	3300035113	Bacteria	1180
1329	Ga0373939_0000178	3300035114	Bacteria	17639
1330	Ga0373939_0004830	3300035114	Bacteria	3195
1331	Ga0373939_0019208	3300035114	Bacteria	1841
1332	Ga0373941_0000085	3300035115	Bacteria	15179
1333	Ga0373941_0000099	3300035115	Bacteria	14313
1334	Ga0373941_0000551	3300035115	Bacteria	7473
1335	Ga0373941_0024123	3300035115	Bacteria	1744
1336	Ga0373945_0007081	3300035116	Bacteria	3629
1337	Ga0373945_0017250	3300035116	Bacteria	2443
1338	Ga0373945_0021550	3300035116	Bacteria	2215
1339	Ga0373945_0059049	3300035116	Bacteria	1427
1340	Ga0373945_0113471	3300035116	Bacteria	1071
1341	Ga0373953_0071458	3300035117	Bacteria	1432
1342	Ga0373954_0001748	3300035118	Bacteria	8920
1343	Ga0373954_0003458	3300035118	Bacteria	6697
1344	Ga0373954_0015991	3300035118	Bacteria	3355
1345	Ga0373954_0048377	3300035118	Bacteria	1992
1346	Ga0373954_0239809	3300035118	Bacteria	892
1347	Ga0373954_0260490	3300035118	Bacteria	854
1348	Ga0373956_0006087	3300035119	Bacteria	4829
1349	Ga0373956_0006272	3300035119	Bacteria	4760
1350	Ga0373956_0011231	3300035119	Bacteria	3687
1351	Ga0373956_0042531	3300035119	Bacteria	2020
1352	Ga0373956_0047798	3300035119	Bacteria	1915
1353	Ga0373957_0002246	3300035120	Bacteria	5473
1354	Ga0373957_0003256	3300035120	Bacteria	4776
1355	Ga0373957_0012026	3300035120	Bacteria	2904
1356	Ga0373957_0032237	3300035120	Bacteria	1928
1357	Ga0373957_0043310	3300035120	Bacteria	1701
1358	Ga0373960_0000555	3300035121	Bacteria	7550
1359	Ga0373960_0003642	3300035121	Bacteria	3496
1360	Ga0373943_0013206	3300035170	Bacteria	3727
1361	Ga0373943_0023882	3300035170	Bacteria	2846
1362	Ga0373943_0024337	3300035170	Bacteria	2822
1363	Ga0373943_0046090	3300035170	Bacteria	2126
1364	Ga0373943_0089429	3300035170	Bacteria	1592
1365	Ga0373943_0126197	3300035170	Bacteria	1365
1366	Ga0373946_0008257	3300035171	Bacteria	3822
1367	Ga0373946_0023941	3300035171	Bacteria	2389
1368	Ga0373946_0038515	3300035171	Bacteria	1947
1369	Ga0373946_0085133	3300035171	Bacteria	1391
1370	Ga0373955_0001535	3300035172	Bacteria	9868
1371	Ga0373955_0005503	3300035172	Bacteria	5696
1372	Ga0373955_0008692	3300035172	Bacteria	4726
1373	Ga0373955_0079877	3300035172	Bacteria	1846
1374	Ga0373955_0116728	3300035172	Bacteria	1548
1375	Ga0373955_0121272	3300035172	Bacteria	1520
1376	Ga0373955_0215167	3300035172	Bacteria	1146
1377	Ga0373942_0001735	3300035207	Bacteria	5530
1378	Ga0373961_0003797	3300035241	Bacteria	3692
1379	Ga0373961_0005195	3300035241	Bacteria	3132
1380	Ga0373961_0090382	3300035241	Bacteria	977
1381	Ga0373962_0001051	3300035242	Bacteria	6419
1382	Ga0373962_0005997	3300035242	Bacteria	2932
1383	Ga0373962_0082097	3300035242	Bacteria	980
1384	Ga0373924_0006222	3300035410	Bacteria	4268
1385	Ga0373924_0021110	3300035410	Bacteria	2539
1386	Ga0373924_0036594	3300035410	Bacteria	1996
1387	Ga0373924_0070645	3300035410	Bacteria	1472
1388	Ga0373924_0086817	3300035410	Bacteria	1335
1389	Ga0373931_0003317	3300035691	Bacteria	7208
1390	Ga0373931_0006849	3300035691	Bacteria	5359
1391	Ga0373931_0011604	3300035691	Bacteria	4257
1392	Ga0373931_0035865	3300035691	Bacteria	2581
1393	Ga0373931_0163764	3300035691	Bacteria	1305
1394	Ga0373935_0006896	3300035692	Bacteria	6779
1395	Ga0373935_0025625	3300035692	Bacteria	3634
1396	Ga0373935_0046065	3300035692	Bacteria	2754
1397	Ga0373935_0054343	3300035692	Bacteria	2549
1398	Ga0373935_0153765	3300035692	Bacteria	1563
1399	Ga0373935_0291548	3300035692	Bacteria	1151
1400	Ga0373935_0295541	3300035692	Bacteria	1143
1401	Ga0373935_0329112	3300035692	Bacteria	1085
1402	Ga0373935_0631901	3300035692	Bacteria	784
1403	Ga0373927_0001486	3300035695	Bacteria	17658
1404	Ga0373927_0001909	3300035695	Bacteria	15400
1405	Ga0373927_0008042	3300035695	Bacteria	7121
1406	Ga0373927_0021841	3300035695	Bacteria	4194
1407	Ga0373927_0025092	3300035695	Bacteria	3897
1408	Ga0373927_0041289	3300035695	Bacteria	2992
1409	Ga0373927_0049298	3300035695	Bacteria	2723
1410	Ga0373927_0079638	3300035695	Bacteria	2123
1411	Ga0373927_0139313	3300035695	Bacteria	1586
1412	Ga0373927_0172428	3300035695	Bacteria	1418
1413	Ga0373927_0177526	3300035695	Bacteria	1397
1414	Ga0373927_0230970	3300035695	Bacteria	1215
1415	Ga0373927_0233276	3300035695	Bacteria	1209
1416	Ga0373927_0314125	3300035695	Bacteria	1032
1417	Ga0373927_0524920	3300035695	Bacteria	782
1418	Ga0373933_0000031	3300035724	Bacteria	85038
1419	Ga0373933_0002649	3300035724	Bacteria	10026
1420	Ga0373933_0004860	3300035724	Bacteria	7334
1421	Ga0373933_0005821	3300035724	Bacteria	6707
1422	Ga0373933_0027834	3300035724	Bacteria	3258
1423	Ga0373933_0030411	3300035724	Bacteria	3126
1424	Ga0373933_0050638	3300035724	Bacteria	2480
1425	Ga0373933_0080550	3300035724	Bacteria	1996
1426	Ga0373933_0087420	3300035724	Bacteria	1920
1427	Ga0373933_0136203	3300035724	Bacteria	1547
1428	Ga0373947_0001274	3300035725	Bacteria	15527
1429	Ga0373947_0003819	3300035725	Bacteria	8871
1430	Ga0373947_0014833	3300035725	Bacteria	4471
1431	Ga0373947_0016858	3300035725	Bacteria	4196
1432	Ga0373947_0088017	3300035725	Bacteria	1932
1433	Ga0373947_0157113	3300035725	Bacteria	1468
1434	Ga0373947_0204052	3300035725	Bacteria	1294
1435	Ga0373937_0000231	3300036401	Bacteria	54437
1436	Ga0373937_0002237	3300036401	Bacteria	16169
1437	Ga0373937_0021789	3300036401	Bacteria	5752
1438	Ga0373937_0022492	3300036401	Bacteria	5669
1439	Ga0373937_0024272	3300036401	Bacteria	5466
1440	Ga0373937_0030861	3300036401	Bacteria	4854
1441	Ga0373937_0056247	3300036401	Bacteria	3613
1442	Ga0373937_0095550	3300036401	Bacteria	2755
1443	Ga0373937_0185013	3300036401	Bacteria	1956
1444	Ga0373937_0257462	3300036401	Bacteria	1645
1445	Ga0316582_0213817	3300036647	Bacteria	1317
1446	Ga0316584_0037099	3300036712	Bacteria	3620
1447	Ga0373925_0001594	3300037068	Bacteria	19170
1448	Ga0373925_0019133	3300037068	Bacteria	4979
1449	Ga0373925_0030654	3300037068	Bacteria	3948
1450	Ga0373925_0039040	3300037068	Bacteria	3512
1451	Ga0373925_0048289	3300037068	Bacteria	3171
1452	Ga0373925_0055883	3300037068	Bacteria	2956
1453	Ga0373925_0057142	3300037068	Bacteria	2924
1454	Ga0373925_0064515	3300037068	Bacteria	2756
1455	Ga0373925_0436293	3300037068	Bacteria	1071
1456	Ga0395899_0070459	3300037312	Bacteria	2559
1457	Ga0395899_0218957	3300037312	Bacteria	1319
1458	Ga0395899_0361679	3300037312	Bacteria	968
1459	Ga0395900_0010736	3300037418	Bacteria	9368
1460	Ga0395900_0019797	3300037418	Bacteria	6858
1461	Ga0395900_0134177	3300037418	Bacteria	2536
1462	Ga0395900_0242343	3300037418	Bacteria	1808
1463	Ga0395900_0247240	3300037418	Bacteria	1786
1464	Ga0395900_0278786	3300037418	Bacteria	1664
1465	Ga0395900_0436885	3300037418	Bacteria	1267
1466	Ga0395900_0643903	3300037418	Bacteria	997
1467	Ga0395898_0006210	3300037466	Bacteria	12801
1468	Ga0395898_0016118	3300037466	Bacteria	7654
1469	Ga0395898_0030124	3300037466	Bacteria	5432
1470	Ga0395898_0044161	3300037466	Bacteria	4390
1471	Ga0395898_0050822	3300037466	Bacteria	4056
1472	Ga0395898_0093688	3300037466	Bacteria	2886
1473	Ga0395898_0165902	3300037466	Bacteria	2112
1474	Ga0395898_0219210	3300037466	Bacteria	1815
1475	Ga0395898_0321435	3300037466	Bacteria	1476
1476	Ga0395898_0559944	3300037466	Bacteria	1085
1477	Ga0395905_0001904	3300037471	Bacteria	24039
1478	Ga0395905_0123475	3300037471	Bacteria	2435
1479	Ga0395905_0240755	3300037471	Bacteria	1691
1480	Ga0395905_0307741	3300037471	Bacteria	1473
1481	Ga0436364_0146171	3300037853	Bacteria	1120
1482	Ga0436364_0282116	3300037853	Bacteria	1960
1483	Ga0436364_0898947	3300037853	Bacteria	1706
1484	Ga0436364_0933374	3300037853	Bacteria	2188
1485	Ga0436364_1276004	3300037853	Bacteria	9626
1486	Ga0436364_1362242	3300037853	Bacteria	686
1487	Ga0395901_0002704	3300038443	Bacteria	17874
1488	Ga0395901_0005911	3300038443	Bacteria	12389
1489	Ga0395901_0021452	3300038443	Bacteria	6617
1490	Ga0395901_0022711	3300038443	Bacteria	6432
1491	Ga0395901_0049662	3300038443	Bacteria	4359
1492	Ga0395901_0105778	3300038443	Bacteria	2954
1493	Ga0395901_0304099	3300038443	Bacteria	1653
1494	Ga0395901_0760584	3300038443	Bacteria	961
1495	Ga0436365_0584651	3300039437	Bacteria	1448
1496	Ga0436365_0587835	3300039437	Bacteria	3088
1497	Ga0436365_0830896	3300039437	Bacteria	2872
1498	Ga0436365_0940586	3300039437	Bacteria	3155
1499	Ga0436365_1140540	3300039437	Bacteria	1209
1500	Ga0436365_1154205	3300039437	Bacteria	6237
1501	Ga0436365_1194348	3300039437	Bacteria	1140
1502	Ga0436365_1477089	3300039437	Bacteria	4726
1503	Ga0436365_1621052	3300039437	Bacteria	2840
1504	Ga0436365_1707658	3300039437	Bacteria	1497
1505	Ga0436365_1779987	3300039437	Bacteria	3012
1506	Ga0436365_1896179	3300039437	Bacteria	1936
1507	Ga0436365_1924787	3300039437	Bacteria	1632
1508	Ga0436360_0091873	3300039438	Bacteria	1046
1509	Ga0436360_0159422	3300039438	Bacteria	3821
1510	Ga0436360_0830088	3300039438	Bacteria	1537
1511	Ga0436360_1291098	3300039438	Bacteria	1459
1512	Ga0436361_0998265	3300039447	Bacteria	1264
1513	Ga0436363_0320221	3300039450	Bacteria	16971
1514	Ga0436363_0435462	3300039450	Bacteria	1312
1515	Ga0436363_0720235	3300039450	Bacteria	1178
1516	Ga0436363_1422428	3300039450	Bacteria	1308
1517	Ga0436363_1527418	3300039450	Bacteria	2859
1518	Ga0436362_0847603	3300039453	Bacteria	2862
1519	Ga0436362_0890549	3300039453	Bacteria	1520
1520	Ga0439465_0011810	3300041413	Bacteria	2736
1521	Ga0439465_0036993	3300041413	Bacteria	1569
1522	Ga0451787_673092	3300041441	Bacteria	2120
1523	Ga0451833_0006471	3300041491	Bacteria	992
1524	Ga0451833_0785209	3300041491	Bacteria	1249
1525	Ga0451839_0976358	3300041496	Bacteria	1835
1526	Ga0439441_056416	3300042001	Bacteria	819
1527	Ga0439448_0042000	3300042005	Bacteria	1481
1528	Ga0439448_0082885	3300042005	Bacteria	1078
1529	Ga0439450_002734	3300042008	Bacteria	2819
1530	Ga0439463_026071	3300042016	Bacteria	1468
1531	Ga0439464_0006231	3300042439	Bacteria	3104
1532	Ga0451577_0039140	3300042876	Bacteria	4262
1533	Ga0466972_0000119	3300044658	Bacteria	66620
1534	Ga0466972_0020974	3300044658	Bacteria	3262
1535	Ga0466966_0000998	3300044684	Bacteria	18088
1536	Ga0466966_0098998	3300044684	Bacteria	1805
1537	Ga0466966_0115750	3300044684	Bacteria	1650
1538	Ga0466966_0124701	3300044684	Bacteria	1580
1539	Ga0466966_0385057	3300044684	Bacteria	842
1540	Ga0466961_0000139	3300044693	Bacteria	48781
1541	Ga0466961_0121667	3300044693	Bacteria	1638
1542	Ga0466963_0007130	3300044694	Bacteria	6660
1543	Ga0466963_0048293	3300044694	Bacteria	2811
1544	Ga0466963_0145567	3300044694	Bacteria	1643
1545	Ga0466964_0120332	3300044706	Bacteria	1183
1546	Ga0466964_0146725	3300044706	Bacteria	1090
1547	Ga0453684_0453716	3300044712	Bacteria	1427
1548	Ga0466971_0061041	3300044719	Bacteria	1704
1549	Ga0466968_0052809	3300044735	Bacteria	1739
1550	Ga0466968_0303687	3300044735	Bacteria	768
1551	Ga0466970_0047732	3300044765	Bacteria	2282
1552	Ga0466970_0264479	3300044765	Bacteria	965
1553	Ga0466970_0327424	3300044765	Bacteria	867
1554	Ga0466957_0095986	3300044842	Bacteria	1862
1555	Ga0466960_0017761	3300044901	Bacteria	3108
1556	Ga0466960_0093599	3300044901	Bacteria	1536
1557	Ga0466960_0096832	3300044901	Bacteria	1513
1558	Ga0466959_0006266	3300045049	Bacteria	8218
1559	Ga0466959_0009665	3300045049	Bacteria	6865
1560	Ga0466959_0016385	3300045049	Bacteria	5414
1561	Ga0466959_0152454	3300045049	Bacteria	1628
1562	Ga0451576_0019176	3300045051	Bacteria	7471
1563	Ga0451576_0127087	3300045051	Bacteria	2656
1564	Ga0451576_0982862	3300045051	Bacteria	885
1565	Ga0466958_0101724	3300045836	Bacteria	1787
1566	Ga0466958_0105299	3300045836	Bacteria	1757
1567	Ga0466958_0301972	3300045836	Bacteria	1028
1568	Ga0466958_0425359	3300045836	Bacteria	859
1569	Ga0466967_0006174	3300045976	Bacteria	8440
1570	Ga0466967_0284812	3300045976	Bacteria	1586
1571	Ga0466967_0340806	3300045976	Bacteria	1450
1572	Ga0466967_0671404	3300045976	Bacteria	1025
1573	Ga0495592_0001103	3300046454	Bacteria	18750
1574	Ga0495592_0012597	3300046454	Bacteria	6429
1575	Ga0495592_0016964	3300046454	Bacteria	5528
1576	Ga0495592_0020485	3300046454	Bacteria	5030
1577	Ga0495592_0055418	3300046454	Bacteria	2933
1578	Ga0495592_0082393	3300046454	Bacteria	2325
1579	Ga0495592_0085283	3300046454	Bacteria	2277
1580	Ga0495592_0102112	3300046454	Bacteria	2042
1581	Ga0495592_0112702	3300046454	Bacteria	1922
1582	Ga0495592_0312795	3300046454	Bacteria	1017
1583	Ga0495603_0000047	3300046455	Bacteria	53081
1584	Ga0495603_0003797	3300046455	Bacteria	8993
1585	Ga0495603_0006275	3300046455	Bacteria	7111
1586	Ga0495603_0036056	3300046455	Bacteria	2969
1587	Ga0495603_0040505	3300046455	Bacteria	2788
1588	Ga0495603_0171284	3300046455	Bacteria	1257
1589	Ga0495603_0185255	3300046455	Bacteria	1204
1590	Ga0495590_0099290	3300046457	Bacteria	1034
1591	Ga0495629_0000320	3300046459	Bacteria	41151
1592	Ga0495629_0000588	3300046459	Bacteria	29503
1593	Ga0495629_0001972	3300046459	Bacteria	15994
1594	Ga0495629_0008845	3300046459	Bacteria	7404
1595	Ga0495629_0011428	3300046459	Bacteria	6449
1596	Ga0495629_0076574	3300046459	Bacteria	2336
1597	Ga0495629_0106768	3300046459	Bacteria	1953
1598	Ga0495629_0225584	3300046459	Bacteria	1292
1599	Ga0495638_0014041	3300046460	Bacteria	5427
1600	Ga0495638_0162753	3300046460	Bacteria	1286
1601	Ga0495641_0003618	3300046461	Bacteria	11446
1602	Ga0495641_0015429	3300046461	Bacteria	4079
1603	Ga0495641_0035071	3300046461	Bacteria	2368
1604	Ga0495651_0001342	3300046462	Bacteria	19049
1605	Ga0495651_0003655	3300046462	Bacteria	11783
1606	Ga0495651_0041841	3300046462	Bacteria	3558
1607	Ga0495651_0042721	3300046462	Bacteria	3518
1608	Ga0495651_0044189	3300046462	Bacteria	3453
1609	Ga0495651_0152784	3300046462	Bacteria	1662
1610	Ga0495651_0152988	3300046462	Bacteria	1660
1611	Ga0495651_0230855	3300046462	Bacteria	1274
1612	Ga0495651_0241214	3300046462	Bacteria	1239
1613	Ga0495651_0294987	3300046462	Bacteria	1090
1614	Ga0495653_0002188	3300046463	Bacteria	15461
1615	Ga0495653_0011013	3300046463	Bacteria	7396
1616	Ga0495653_0025211	3300046463	Bacteria	4783
1617	Ga0495653_0048735	3300046463	Bacteria	3269
1618	Ga0495653_0056514	3300046463	Bacteria	2991
1619	Ga0495653_0177436	3300046463	Bacteria	1465
1620	Ga0495653_0192858	3300046463	Bacteria	1388
1621	Ga0495653_0238147	3300046463	Bacteria	1214
1622	Ga0495653_0288662	3300046463	Bacteria	1074
1623	Ga0495650_0041792	3300046471	Bacteria	1958
1624	Ga0495580_0003812	3300046472	Bacteria	12769
1625	Ga0495580_0011284	3300046472	Bacteria	6914
1626	Ga0495580_0307011	3300046472	Bacteria	1080
1627	Ga0495580_0389549	3300046472	Bacteria	941
1628	Ga0495582_0000043	3300046473	Bacteria	63647
1629	Ga0495582_0008940	3300046473	Bacteria	5529
1630	Ga0495582_0018684	3300046473	Bacteria	3789
1631	Ga0495582_0090856	3300046473	Bacteria	1702
1632	Ga0495582_0137832	3300046473	Bacteria	1381
1633	Ga0495582_0170472	3300046473	Bacteria	1239
1634	Ga0495605_0043121	3300046474	Bacteria	2238
1635	Ga0495605_0092929	3300046474	Bacteria	1396
1636	Ga0495639_0000091	3300046475	Bacteria	44027
1637	Ga0495639_0003629	3300046475	Bacteria	6655
1638	Ga0495639_0012361	3300046475	Bacteria	3682
1639	Ga0495639_0061431	3300046475	Bacteria	1723
1640	Ga0495662_0001246	3300046476	Bacteria	12549
1641	Ga0495662_0023573	3300046476	Bacteria	2971
1642	Ga0495662_0084222	3300046476	Bacteria	1547
1643	Ga0495662_0088906	3300046476	Bacteria	1505
1644	Ga0495664_0000368	3300046477	Bacteria	21935
1645	Ga0495664_0004663	3300046477	Bacteria	7497
1646	Ga0495664_0007170	3300046477	Bacteria	6179
1647	Ga0495664_0010366	3300046477	Bacteria	5228
1648	Ga0495664_0027429	3300046477	Bacteria	3320
1649	Ga0495664_0044564	3300046477	Bacteria	2629
1650	Ga0495664_0048686	3300046477	Bacteria	2516
1651	Ga0495664_0054006	3300046477	Bacteria	2389
1652	Ga0495664_0061763	3300046477	Bacteria	2230
1653	Ga0495664_0163541	3300046477	Bacteria	1350
1654	Ga0495664_0254240	3300046477	Bacteria	1062
1655	Ga0495664_0301411	3300046477	Bacteria	967
1656	Ga0495664_0336272	3300046477	Bacteria	910
1657	Ga0495584_0080852	3300046491	Bacteria	1635
1658	Ga0495584_0177960	3300046491	Bacteria	1081
1659	Ga0495584_0229227	3300046491	Bacteria	944
1660	Ga0495585_0031755	3300046492	Bacteria	2996
1661	Ga0495585_0317793	3300046492	Bacteria	762
1662	Ga0495594_0000453	3300046499	Bacteria	20836
1663	Ga0495594_0016889	3300046499	Bacteria	3850
1664	Ga0495594_0050450	3300046499	Bacteria	2288
1665	Ga0495594_0075422	3300046499	Bacteria	1880
1666	Ga0495594_0117478	3300046499	Bacteria	1502
1667	Ga0495594_0131094	3300046499	Bacteria	1420
1668	Ga0495594_0152219	3300046499	Bacteria	1313
1669	Ga0495606_0049371	3300046507	Bacteria	2760
1670	Ga0495608_0002745	3300046511	Bacteria	12639
1671	Ga0495608_0004901	3300046511	Bacteria	9585
1672	Ga0495608_0016534	3300046511	Bacteria	5105
1673	Ga0495608_0024793	3300046511	Bacteria	4098
1674	Ga0495608_0059645	3300046511	Bacteria	2513
1675	Ga0495608_0068498	3300046511	Bacteria	2320
1676	Ga0495610_0065515	3300046512	Bacteria	1714
1677	Ga0495616_0017135	3300046513	Bacteria	3998
1678	Ga0495616_0087862	3300046513	Bacteria	1476
1679	Ga0495618_0011732	3300046514	Bacteria	5319
1680	Ga0495618_0031187	3300046514	Bacteria	3333
1681	Ga0495618_0343442	3300046514	Bacteria	921
1682	Ga0495620_0053465	3300046515	Bacteria	1710
1683	Ga0495628_0000249	3300046516	Bacteria	47492
1684	Ga0495628_0008859	3300046516	Bacteria	8612
1685	Ga0495628_0012958	3300046516	Bacteria	7021
1686	Ga0495628_0018664	3300046516	Bacteria	5741
1687	Ga0495628_0052034	3300046516	Bacteria	3235
1688	Ga0495628_0078400	3300046516	Bacteria	2569
1689	Ga0495628_0191036	3300046516	Bacteria	1546
1690	Ga0495630_0010214	3300046517	Bacteria	6772
1691	Ga0495630_0021128	3300046517	Bacteria	4805
1692	Ga0495630_0028264	3300046517	Bacteria	4167
1693	Ga0495630_0521187	3300046517	Bacteria	911
1694	Ga0495630_0599893	3300046517	Bacteria	844
1695	Ga0495631_0133831	3300046518	Bacteria	1065
1696	Ga0495631_0193501	3300046518	Bacteria	870
1697	Ga0495632_0167956	3300046519	Bacteria	1009
1698	Ga0495632_0210006	3300046519	Bacteria	883
1699	Ga0495643_0015773	3300046522	Bacteria	4456
1700	Ga0495643_0163563	3300046522	Bacteria	1093
1701	Ga0495644_0061669	3300046523	Bacteria	1409
1702	Ga0495644_0070378	3300046523	Bacteria	1314
1703	Ga0495648_0000286	3300046524	Bacteria	57430
1704	Ga0495648_0009724	3300046524	Bacteria	7408
1705	Ga0495648_0188196	3300046524	Bacteria	1043
1706	Ga0495666_0005355	3300046526	Bacteria	6469
1707	Ga0495666_0045541	3300046526	Bacteria	2116
1708	Ga0495666_0089011	3300046526	Bacteria	1458
1709	Ga0495666_0130831	3300046526	Bacteria	1173
1710	Ga0495652_0003992	3300046529	Bacteria	14286
1711	Ga0495652_0047305	3300046529	Bacteria	3689
1712	Ga0495652_0049252	3300046529	Bacteria	3607
1713	Ga0495652_0052813	3300046529	Bacteria	3465
1714	Ga0495652_0054601	3300046529	Bacteria	3401
1715	Ga0495652_0056843	3300046529	Bacteria	3321
1716	Ga0495652_0241702	3300046529	Bacteria	1343
1717	Ga0495665_0001445	3300046531	Bacteria	12728
1718	Ga0495665_0031827	3300046531	Bacteria	2822
1719	Ga0495665_0321162	3300046531	Bacteria	791
1720	Ga0495640_0002500	3300046533	Bacteria	14791
1721	Ga0495640_0002756	3300046533	Bacteria	14127
1722	Ga0495640_0003340	3300046533	Bacteria	12919
1723	Ga0495640_0027868	3300046533	Bacteria	4069
1724	Ga0495640_0037580	3300046533	Bacteria	3415
1725	Ga0495640_0061087	3300046533	Bacteria	2561
1726	Ga0495640_0091988	3300046533	Bacteria	2001
1727	Ga0495640_0221860	3300046533	Bacteria	1192
1728	Ga0495586_0032499	3300046535	Bacteria	2797
1729	Ga0495586_0042618	3300046535	Bacteria	2444
1730	Ga0495587_0000753	3300046536	Bacteria	21591
1731	Ga0495587_0018095	3300046536	Bacteria	4370
1732	Ga0495587_0044230	3300046536	Bacteria	2649
1733	Ga0495587_0075332	3300046536	Bacteria	1959
1734	Ga0495587_0078684	3300046536	Bacteria	1912
1735	Ga0495587_0100228	3300046536	Bacteria	1669
1736	Ga0495609_0046262	3300046538	Bacteria	1949
1737	Ga0495609_0151950	3300046538	Bacteria	984
1738	Ga0495621_0063339	3300046539	Bacteria	1347
1739	Ga0495597_0069278	3300046542	Bacteria	1523
1740	Ga0495645_0001006	3300046543	Bacteria	19191
1741	Ga0495645_0007542	3300046543	Bacteria	7567
1742	Ga0495645_0009296	3300046543	Bacteria	6874
1743	Ga0495645_0027563	3300046543	Bacteria	4128
1744	Ga0495645_0046496	3300046543	Bacteria	3163
1745	Ga0495645_0119987	3300046543	Bacteria	1852
1746	Ga0495645_0138963	3300046543	Bacteria	1696
1747	Ga0495622_0001046	3300046557	Bacteria	14732
1748	Ga0495622_0017504	3300046557	Bacteria	3336
1749	Ga0495622_0104779	3300046557	Bacteria	1295
1750	Ga0495622_0126395	3300046557	Bacteria	1166
1751	Ga0495622_0139741	3300046557	Bacteria	1100
1752	Ga0495633_0139380	3300046558	Bacteria	1121
1753	Ga0495667_0000450	3300046559	Bacteria	26281
1754	Ga0495667_0000464	3300046559	Bacteria	25814
1755	Ga0495667_0002539	3300046559	Bacteria	12188
1756	Ga0495667_0011945	3300046559	Bacteria	5884
1757	Ga0495667_0014536	3300046559	Bacteria	5317
1758	Ga0495667_0017698	3300046559	Bacteria	4814
1759	Ga0495667_0123635	3300046559	Bacteria	1670
1760	Ga0495667_0204422	3300046559	Bacteria	1263
1761	Ga0495656_0053684	3300046615	Bacteria	1732
1762	Ga0495656_0073658	3300046615	Bacteria	1523
1763	Ga0495656_0087165	3300046615	Bacteria	1421
1764	Ga0495668_0045453	3300046616	Bacteria	2441
1765	Ga0495668_0162825	3300046616	Bacteria	1222
1766	Ga0495668_0217353	3300046616	Bacteria	1046
1767	Ga0495668_0236561	3300046616	Bacteria	1000
1768	Ga0495634_0005621	3300046642	Bacteria	9611
1769	Ga0495634_0012021	3300046642	Bacteria	6276
1770	Ga0495634_0015968	3300046642	Bacteria	5378
1771	Ga0495634_0025578	3300046642	Bacteria	4127
1772	Ga0495634_0028663	3300046642	Bacteria	3863
1773	Ga0495634_0059938	3300046642	Bacteria	2533
1774	Ga0495634_0101233	3300046642	Bacteria	1861
1775	Ga0495634_0111613	3300046642	Bacteria	1757
1776	Ga0495634_0158149	3300046642	Bacteria	1430
1777	Ga0495634_0205735	3300046642	Bacteria	1220
1778	Ga0495611_0190024	3300046648	Bacteria	959
1779	Ga0495625_0099193	3300046660	Bacteria	2003
1780	Ga0495635_0001078	3300046663	Bacteria	18109
1781	Ga0495635_0001541	3300046663	Bacteria	15439
1782	Ga0495635_0001788	3300046663	Bacteria	14525
1783	Ga0495635_0006792	3300046663	Bacteria	7999
1784	Ga0495635_0017099	3300046663	Bacteria	5064
1785	Ga0495635_0024492	3300046663	Bacteria	4206
1786	Ga0495635_0028492	3300046663	Bacteria	3882
1787	Ga0495635_0029504	3300046663	Bacteria	3815
1788	Ga0495635_0098978	3300046663	Bacteria	1993
1789	Ga0495635_0117916	3300046663	Bacteria	1811
1790	Ga0495635_0180138	3300046663	Bacteria	1436
1791	Ga0495661_0052476	3300046665	Bacteria	2457
1792	Ga0495588_0010476	3300046674	Bacteria	4311
1793	Ga0495588_0112937	3300046674	Bacteria	1431
1794	Ga0495588_0272831	3300046674	Bacteria	891
1795	Ga0495657_0003059	3300046675	Bacteria	13843
1796	Ga0495657_0003417	3300046675	Bacteria	12959
1797	Ga0495657_0006240	3300046675	Bacteria	9345
1798	Ga0495657_0011180	3300046675	Bacteria	6724
1799	Ga0495657_0011746	3300046675	Bacteria	6530
1800	Ga0495657_0016134	3300046675	Bacteria	5446
1801	Ga0495657_0020615	3300046675	Bacteria	4738
1802	Ga0495657_0112342	3300046675	Bacteria	1725
1803	Ga0495657_0206029	3300046675	Bacteria	1197
1804	Ga0495599_0001153	3300046678	Bacteria	14977
1805	Ga0495599_0002496	3300046678	Bacteria	10716
1806	Ga0495599_0021801	3300046678	Bacteria	3999
1807	Ga0495599_0025730	3300046678	Bacteria	3686
1808	Ga0495599_0081414	3300046678	Bacteria	2022
1809	Ga0495599_0308495	3300046678	Bacteria	954
1810	Ga0495623_0003470	3300046679	Bacteria	10438
1811	Ga0495623_0003477	3300046679	Bacteria	10429
1812	Ga0495623_0006142	3300046679	Bacteria	7806
1813	Ga0495623_0018620	3300046679	Bacteria	4484
1814	Ga0495623_0035659	3300046679	Bacteria	3188
1815	Ga0495623_0079516	3300046679	Bacteria	2031
1816	Ga0495623_0090682	3300046679	Bacteria	1876
1817	Ga0495646_0005764	3300046680	Bacteria	7855
1818	Ga0495646_0013771	3300046680	Bacteria	5142
1819	Ga0495646_0018667	3300046680	Bacteria	4392
1820	Ga0495646_0019141	3300046680	Bacteria	4335
1821	Ga0495646_0066765	3300046680	Bacteria	2127
1822	Ga0495646_0098427	3300046680	Bacteria	1680
1823	Ga0495646_0102184	3300046680	Bacteria	1642
1824	Ga0495646_0104878	3300046680	Bacteria	1616
1825	Ga0495646_0166207	3300046680	Bacteria	1218
1826	Ga0495646_0171871	3300046680	Bacteria	1194
1827	Ga0495646_0189457	3300046680	Bacteria	1125
1828	Ga0495647_0000650	3300046681	Bacteria	10304
1829	Ga0495647_0021621	3300046681	Bacteria	2318
1830	Ga0495647_0034196	3300046681	Bacteria	1903
1831	Ga0495647_0066955	3300046681	Bacteria	1429
1832	Ga0495658_0000601	3300046683	Bacteria	19735
1833	Ga0495658_0003457	3300046683	Bacteria	7807
1834	Ga0495658_0010758	3300046683	Bacteria	4583
1835	Ga0495658_0011655	3300046683	Bacteria	4429
1836	Ga0495658_0052951	3300046683	Bacteria	2303
1837	Ga0495658_0083725	3300046683	Bacteria	1877
1838	Ga0495658_0110685	3300046683	Bacteria	1651
1839	Ga0495658_0278366	3300046683	Bacteria	1055
1840	Ga0495669_0002088	3300046684	Bacteria	8182
1841	Ga0495613_0001794	3300046689	Bacteria	16314
1842	Ga0495613_0005839	3300046689	Bacteria	9210
1843	Ga0495613_0028537	3300046689	Bacteria	4151
1844	Ga0495613_0028714	3300046689	Bacteria	4138
1845	Ga0495613_0052589	3300046689	Bacteria	2999
1846	Ga0495613_0088512	3300046689	Bacteria	2244
1847	Ga0495613_0140604	3300046689	Bacteria	1725
1848	Ga0495613_0243149	3300046689	Bacteria	1258
1849	Ga0495624_0000694	3300046690	Bacteria	26424
1850	Ga0495624_0005977	3300046690	Bacteria	8690
1851	Ga0495624_0131945	3300046690	Bacteria	1531
1852	Ga0495624_0514759	3300046690	Bacteria	715
1853	Ga0495670_0024498	3300046691	Bacteria	2983
1854	Ga0495670_0114546	3300046691	Bacteria	1397
1855	Ga0495649_0027332	3300046694	Bacteria	3166
1856	Ga0495649_0144229	3300046694	Bacteria	1252
1857	Ga0495600_0000311	3300046809	Bacteria	25806
1858	Ga0495600_0001179	3300046809	Bacteria	14283
1859	Ga0495600_0008832	3300046809	Bacteria	6205
1860	Ga0495600_0016340	3300046809	Bacteria	4708
1861	Ga0495600_0057358	3300046809	Bacteria	2543
1862	Ga0495600_0067269	3300046809	Bacteria	2342
1863	Ga0495600_0075385	3300046809	Bacteria	2203
1864	Ga0495600_0084241	3300046809	Bacteria	2075
1865	Ga0495600_0085247	3300046809	Bacteria	2061
1866	Ga0495600_0401227	3300046809	Bacteria	853
1867	Ga0495660_0316197	3300046810	Bacteria	703
1868	Ga0495581_0000783	3300047315	Bacteria	16873
1869	Ga0495581_0007372	3300047315	Bacteria	6358
1870	Ga0495581_0034166	3300047315	Bacteria	2942
1871	Ga0495581_0064497	3300047315	Bacteria	2116
1872	Ga0495581_0077630	3300047315	Bacteria	1922
1873	Ga0495581_0089347	3300047315	Bacteria	1787
1874	Ga0495581_0129680	3300047315	Bacteria	1469
1875	Ga0495604_0001199	3300047317	Bacteria	21407
1876	Ga0495604_0004173	3300047317	Bacteria	11457
1877	Ga0495604_0004906	3300047317	Bacteria	10603
1878	Ga0495604_0005181	3300047317	Bacteria	10324
1879	Ga0495604_0019288	3300047317	Bacteria	5458
1880	Ga0495604_0036395	3300047317	Bacteria	3880
1881	Ga0495604_0134004	3300047317	Bacteria	1777
1882	Ga0495604_0152407	3300047317	Bacteria	1641
1883	Ga0495604_0279255	3300047317	Bacteria	1129
1884	Ga0495604_0314009	3300047317	Bacteria	1049
1885	Ga0495636_0157580	3300047318	Bacteria	1021
1886	Ga0495674_0004075	3300047319	Bacteria	14133
1887	Ga0495674_0005504	3300047319	Bacteria	12157
1888	Ga0495674_0006080	3300047319	Bacteria	11587
1889	Ga0495674_0010329	3300047319	Bacteria	8840
1890	Ga0495674_0024613	3300047319	Bacteria	5528
1891	Ga0495674_0033265	3300047319	Bacteria	4671
1892	Ga0495674_0058656	3300047319	Bacteria	3364
1893	Ga0495674_0075062	3300047319	Bacteria	2910
1894	Ga0495674_0089054	3300047319	Bacteria	2638
1895	Ga0495674_0127147	3300047319	Bacteria	2149
1896	Ga0495674_0326701	3300047319	Bacteria	1248
1897	Ga0495674_0453415	3300047319	Bacteria	1030
1898	Ga0495674_0705154	3300047319	Bacteria	792
1899	Ga0495674_0721924	3300047319	Bacteria	780
1900	Ga0495672_0009502	3300047320	Bacteria	7041
1901	Ga0495672_0046725	3300047320	Bacteria	2580
1902	Ga0495672_0123830	3300047320	Bacteria	1370
1903	Ga0495676_0018062	3300047321	Bacteria	6222
1904	Ga0495676_0049262	3300047321	Bacteria	3389
1905	Ga0495676_0058535	3300047321	Bacteria	3031
1906	Ga0495676_0118944	3300047321	Bacteria	1926
1907	Ga0495676_0461664	3300047321	Bacteria	837
1908	Ga0495680_0000285	3300047322	Bacteria	56843
1909	Ga0495680_0000689	3300047322	Bacteria	37846
1910	Ga0495680_0003027	3300047322	Bacteria	16758
1911	Ga0495680_0015129	3300047322	Bacteria	6663
1912	Ga0495680_0017208	3300047322	Bacteria	6183
1913	Ga0495680_0022179	3300047322	Bacteria	5299
1914	Ga0495680_0049222	3300047322	Bacteria	3301
1915	Ga0495680_0066584	3300047322	Bacteria	2756
1916	Ga0495680_0080972	3300047322	Bacteria	2452
1917	Ga0495680_0096870	3300047322	Bacteria	2203
1918	Ga0495680_0119425	3300047322	Bacteria	1948
1919	Ga0495683_0059851	3300047323	Bacteria	1889
1920	Ga0495683_0094838	3300047323	Bacteria	1441
1921	Ga0495687_017157	3300047443	Bacteria	3621
1922	Ga0495675_0003430	3300047444	Bacteria	9547
1923	Ga0495675_0010733	3300047444	Bacteria	5735
1924	Ga0495675_0032125	3300047444	Bacteria	3350
1925	Ga0495675_0042219	3300047444	Bacteria	2905
1926	Ga0495675_0053308	3300047444	Bacteria	2567
1927	Ga0495675_0150248	3300047444	Bacteria	1439
1928	Ga0495675_0324281	3300047444	Bacteria	911
1929	Ga0495673_0132978	3300047469	Bacteria	976
1930	Ga0495684_0001940	3300047471	Bacteria	16582
1931	Ga0495684_0004560	3300047471	Bacteria	10830
1932	Ga0495684_0012120	3300047471	Bacteria	6650
1933	Ga0495684_0024992	3300047471	Bacteria	4594
1934	Ga0495684_0038931	3300047471	Bacteria	3644
1935	Ga0495684_0063608	3300047471	Bacteria	2805
1936	Ga0495684_0182696	3300047471	Bacteria	1554
1937	Ga0495684_0217705	3300047471	Bacteria	1401
1938	Ga0495684_0525333	3300047471	Bacteria	810
1939	Ga0495686_0044749	3300047472	Bacteria	2802
1940	Ga0495686_0203888	3300047472	Bacteria	1133
1941	Ga0495686_0209852	3300047472	Bacteria	1113
1942	Ga0495593_0000005	3300047673	Bacteria	93984
1943	Ga0495593_0000693	3300047673	Bacteria	19452
1944	Ga0495593_0008505	3300047673	Bacteria	5967
1945	Ga0495593_0252734	3300047673	Bacteria	882
1946	Ga0495602_0002384	3300048088	Bacteria	19072
1947	Ga0495602_0005990	3300048088	Bacteria	12765
1948	Ga0495602_0007083	3300048088	Bacteria	11769
1949	Ga0495602_0011209	3300048088	Bacteria	9270
1950	Ga0495602_0062647	3300048088	Bacteria	3226
1951	Ga0495602_0089225	3300048088	Bacteria	2564
1952	Ga0495602_0109804	3300048088	Bacteria	2243
1953	Ga0495602_0117607	3300048088	Bacteria	2145
1954	Ga0495602_0206375	3300048088	Bacteria	1495
1955	Ga0495602_0253821	3300048088	Bacteria	1309
1956	Ga0495614_0020718	3300048089	Bacteria	2842
1957	Ga0495614_0030653	3300048089	Bacteria	2315
1958	Ga0495614_0045908	3300048089	Bacteria	1873
1959	Ga0495626_0103375	3300048091	Bacteria	1240
1960	Ga0496100_0002261	3300048903	Bacteria	9732
1961	Ga0496100_0033360	3300048903	Bacteria	3221
1962	Ga0496100_0118971	3300048903	Bacteria	1846
1963	Ga0496100_0136121	3300048903	Bacteria	1735
1964	Ga0496100_0185373	3300048903	Bacteria	1507
1965	Ga0496100_0348060	3300048903	Bacteria	1118
1966	Ga0496100_0497021	3300048903	Bacteria	939
1967	Ga0496101_0000468	3300048904	Bacteria	25464
1968	Ga0496101_0073682	3300048904	Bacteria	2508
1969	Ga0496101_0088672	3300048904	Bacteria	2298
1970	Ga0496101_0106001	3300048904	Bacteria	2110
1971	Ga0496101_0169186	3300048904	Bacteria	1679
1972	Ga0496101_0236371	3300048904	Bacteria	1421
1973	Ga0496101_0636935	3300048904	Bacteria	842
1974	Ga0496102_0005586	3300048905	Bacteria	10678
1975	Ga0496102_0006543	3300048905	Bacteria	9947
1976	Ga0496102_0010497	3300048905	Bacteria	7974
1977	Ga0496102_0020716	3300048905	Bacteria	5810
1978	Ga0496102_0033921	3300048905	Bacteria	4589
1979	Ga0496102_0064807	3300048905	Bacteria	3347
1980	Ga0496102_0099477	3300048905	Bacteria	2699
1981	Ga0496102_0235023	3300048905	Bacteria	1728
1982	Ga0496102_0347373	3300048905	Bacteria	1397
1983	Ga0496102_0487909	3300048905	Bacteria	1154
1984	Ga0496102_0515886	3300048905	Bacteria	1118
1985	Ga0496102_0578786	3300048905	Bacteria	1046
1986	Ga0496102_0707443	3300048905	Bacteria	930
1987	Ga0496102_0818429	3300048905	Bacteria	853
1988	Ga0496102_0842452	3300048905	Bacteria	839
1989	Ga0496103_0000693	3300048906	Bacteria	25096
1990	Ga0496103_0054323	3300048906	Bacteria	2482
1991	Ga0496103_0060961	3300048906	Bacteria	2345
1992	Ga0496103_0274141	3300048906	Bacteria	1085
1993	Ga0496104_0000239	3300048907	Bacteria	48386
1994	Ga0496104_0003329	3300048907	Bacteria	13872
1995	Ga0496104_0007292	3300048907	Bacteria	9757
1996	Ga0496104_0044346	3300048907	Bacteria	4178
1997	Ga0496104_0077576	3300048907	Bacteria	3165
1998	Ga0496104_0120402	3300048907	Bacteria	2520
1999	Ga0496104_0211431	3300048907	Bacteria	1851
2000	Ga0496104_0374043	3300048907	Bacteria	1337
2001	Ga0496104_0414881	3300048907	Bacteria	1258
2002	Ga0496104_0507167	3300048907	Bacteria	1117
2003	Ga0496104_0675986	3300048907	Bacteria	941
2004	Ga0496104_0702504	3300048907	Bacteria	919
2005	Ga0496105_0000324	3300048908	Bacteria	31277
2006	Ga0496105_0028180	3300048908	Bacteria	4593
2007	Ga0496105_0037811	3300048908	Bacteria	3975
2008	Ga0496105_0056596	3300048908	Bacteria	3236
2009	Ga0496105_0131636	3300048908	Bacteria	2062
2010	Ga0496105_0149875	3300048908	Bacteria	1917
2011	Ga0496105_0336070	3300048908	Bacteria	1208
2012	Ga0496105_0393817	3300048908	Bacteria	1100
2013	Ga0496105_0453764	3300048908	Bacteria	1012
2014	Ga0496106_0001014	3300048909	Bacteria	20581
2015	Ga0496106_0001270	3300048909	Bacteria	18908
2016	Ga0496106_0003850	3300048909	Bacteria	11185
2017	Ga0496106_0007160	3300048909	Bacteria	8238
2018	Ga0496106_0039896	3300048909	Bacteria	3515
2019	Ga0496106_0043845	3300048909	Bacteria	3357
2020	Ga0496106_0048340	3300048909	Bacteria	3204
2021	Ga0496106_0062218	3300048909	Bacteria	2833
2022	Ga0496106_0109698	3300048909	Bacteria	2147
2023	Ga0496106_0163075	3300048909	Bacteria	1763
2024	Ga0496106_0190953	3300048909	Bacteria	1628
2025	Ga0496106_0191001	3300048909	Bacteria	1628
2026	Ga0496106_0497384	3300048909	Bacteria	979
2027	Ga0496107_0000965	3300048910	Bacteria	17064
2028	Ga0496107_0001220	3300048910	Bacteria	15676
2029	Ga0496107_0006048	3300048910	Bacteria	8303
2030	Ga0496107_0014694	3300048910	Bacteria	5481
2031	Ga0496107_0018971	3300048910	Bacteria	4849
2032	Ga0496107_0072936	3300048910	Bacteria	2496
2033	Ga0496107_0132870	3300048910	Bacteria	1838
2034	Ga0496107_0242627	3300048910	Bacteria	1341
2035	Ga0496107_0248176	3300048910	Bacteria	1324
2036	Ga0496107_0316744	3300048910	Bacteria	1161
2037	Ga0496107_0359714	3300048910	Bacteria	1083
2038	Ga0496107_0425239	3300048910	Bacteria	987
2039	Ga0496108_0000274	3300048911	Bacteria	44298
2040	Ga0496108_0001543	3300048911	Bacteria	18244
2041	Ga0496108_0001651	3300048911	Bacteria	17685
2042	Ga0496108_0033903	3300048911	Bacteria	4241
2043	Ga0496108_0034651	3300048911	Bacteria	4194
2044	Ga0496108_0036616	3300048911	Bacteria	4083
2045	Ga0496108_0069200	3300048911	Bacteria	2978
2046	Ga0496108_0087899	3300048911	Bacteria	2640
2047	Ga0496108_0095587	3300048911	Bacteria	2530
2048	Ga0496108_0103475	3300048911	Bacteria	2429
2049	Ga0496108_0183634	3300048911	Bacteria	1812
2050	Ga0496108_0381699	3300048911	Bacteria	1230
2051	Ga0496108_0849374	3300048911	Bacteria	786
2052	Ga0496109_0000414	3300048912	Bacteria	37873
2053	Ga0496109_0004282	3300048912	Bacteria	11922
2054	Ga0496109_0051680	3300048912	Bacteria	3743
2055	Ga0496109_0075762	3300048912	Bacteria	3093
2056	Ga0496109_0079592	3300048912	Bacteria	3019
2057	Ga0496109_0098427	3300048912	Bacteria	2711
2058	Ga0496109_0241153	3300048912	Bacteria	1701
2059	Ga0496109_0250923	3300048912	Bacteria	1666
2060	Ga0496109_0265937	3300048912	Bacteria	1616
2061	Ga0496109_0292625	3300048912	Bacteria	1535
2062	Ga0496109_0304789	3300048912	Bacteria	1502
2063	Ga0496109_0552279	3300048912	Bacteria	1086
2064	Ga0496110_0011294	3300048913	Bacteria	7302
2065	Ga0496110_0030873	3300048913	Bacteria	4621
2066	Ga0496110_0038340	3300048913	Bacteria	4169
2067	Ga0496110_0066458	3300048913	Bacteria	3189
2068	Ga0496110_0069632	3300048913	Bacteria	3116
2069	Ga0496110_0074835	3300048913	Bacteria	3008
2070	Ga0496110_0093880	3300048913	Bacteria	2686
2071	Ga0496110_0118470	3300048913	Bacteria	2384
2072	Ga0496110_0135243	3300048913	Bacteria	2227
2073	Ga0496110_0142659	3300048913	Bacteria	2166
2074	Ga0496110_0142953	3300048913	Bacteria	2163
2075	Ga0496110_0484872	3300048913	Bacteria	1126
2076	Ga0496110_0958162	3300048913	Bacteria	762
2077	Ga0496111_0004013	3300048914	Bacteria	9240
2078	Ga0496111_0014051	3300048914	Bacteria	5461
2079	Ga0496111_0025889	3300048914	Bacteria	4139
2080	Ga0496111_0050186	3300048914	Bacteria	3008
2081	Ga0496111_0058173	3300048914	Bacteria	2798
2082	Ga0496111_0081150	3300048914	Bacteria	2367
2083	Ga0496111_0135580	3300048914	Bacteria	1823
2084	Ga0496111_0146308	3300048914	Bacteria	1752
2085	Ga0496111_0259287	3300048914	Bacteria	1290
2086	Ga0496111_0303988	3300048914	Bacteria	1182
2087	Ga0496111_0327159	3300048914	Bacteria	1135
2088	Ga0496111_0424721	3300048914	Bacteria	982
2089	Ga0496112_0005625	3300048915	Bacteria	10873
2090	Ga0496112_0011307	3300048915	Bacteria	8145
2091	Ga0496112_0014598	3300048915	Bacteria	7298
2092	Ga0496112_0031512	3300048915	Bacteria	5144
2093	Ga0496112_0031708	3300048915	Bacteria	5126
2094	Ga0496112_0124216	3300048915	Bacteria	2552
2095	Ga0496112_0134053	3300048915	Bacteria	2447
2096	Ga0496112_0137947	3300048915	Bacteria	2409
2097	Ga0496112_0195281	3300048915	Bacteria	1984
2098	Ga0496112_0216568	3300048915	Bacteria	1871
2099	Ga0496112_0252452	3300048915	Bacteria	1714
2100	Ga0496112_0336520	3300048915	Bacteria	1453
2101	Ga0496113_0006117	3300048916	Bacteria	7596
2102	Ga0496113_0016478	3300048916	Bacteria	5106
2103	Ga0496113_0034060	3300048916	Bacteria	3713
2104	Ga0496113_0046666	3300048916	Bacteria	3216
2105	Ga0496113_0152956	3300048916	Bacteria	1821
2106	Ga0496113_0168189	3300048916	Bacteria	1735
2107	Ga0496113_0230018	3300048916	Bacteria	1478
2108	Ga0496113_0279592	3300048916	Bacteria	1334
2109	Ga0496113_0339669	3300048916	Bacteria	1204
2110	Ga0496113_0390358	3300048916	Bacteria	1117
2111	Ga0496113_0421963	3300048916	Bacteria	1071
2112	Ga0496113_0434583	3300048916	Bacteria	1054
2113	Ga0496113_0437746	3300048916	Bacteria	1050
2114	Ga0496113_0526082	3300048916	Bacteria	949
2115	Ga0496113_0545448	3300048916	Bacteria	930
2116	Ga0496113_0562037	3300048916	Bacteria	915
2117	Ga0496113_0629065	3300048916	Bacteria	859
2118	Ga0496114_0003058	3300048917	Bacteria	12813
2119	Ga0496114_0008301	3300048917	Bacteria	8230
2120	Ga0496114_0119866	3300048917	Bacteria	2262
2121	Ga0496114_0420663	3300048917	Bacteria	1183
2122	Ga0496114_0541293	3300048917	Bacteria	1029
2123	Ga0496114_0589588	3300048917	Bacteria	980
2124	Ga0496114_0768815	3300048917	Bacteria	841
2125	Ga0496115_0006705	3300048918	Bacteria	8444
2126	Ga0496115_0009376	3300048918	Bacteria	7274
2127	Ga0496115_0010108	3300048918	Bacteria	7039
2128	Ga0496115_0015055	3300048918	Bacteria	5862
2129	Ga0496115_0020999	3300048918	Bacteria	5039
2130	Ga0496115_0043792	3300048918	Bacteria	3569
2131	Ga0496115_0068394	3300048918	Bacteria	2875
2132	Ga0496115_0101903	3300048918	Bacteria	2354
2133	Ga0496115_0115673	3300048918	Bacteria	2205
2134	Ga0496115_0210718	3300048918	Bacteria	1605
2135	Ga0496115_0255833	3300048918	Bacteria	1441
2136	Ga0496115_0258113	3300048918	Bacteria	1433
2137	Ga0496115_0278237	3300048918	Bacteria	1374
2138	Ga0496115_0361595	3300048918	Bacteria	1182
2139	Ga0496115_0608584	3300048918	Bacteria	868
2140	Ga0496115_0705827	3300048918	Bacteria	792
2141	Ga0496116_0058882	3300048919	Bacteria	2502
2142	Ga0496116_0078091	3300048919	Bacteria	2066
2143	Ga0496117_0034639	3300048920	Bacteria	3802
2144	Ga0496117_0120686	3300048920	Bacteria	1611
2145	Ga0496118_0006290	3300048921	Bacteria	13129
2146	Ga0496118_0009149	3300048921	Bacteria	10069
2147	Ga0496118_0030372	3300048921	Bacteria	4511
2148	Ga0496118_0180939	3300048921	Bacteria	1274
2149	Ga0496118_0222276	3300048921	Bacteria	1098
2150	Ga0496119_0020471	3300048922	Bacteria	4828
2151	Ga0496119_0026661	3300048922	Bacteria	3998
2152	Ga0496119_0062834	3300048922	Bacteria	2211
2153	Ga0496119_0105123	3300048922	Bacteria	1578
2154	Ga0496119_0183610	3300048922	Bacteria	1095
2155	Ga0496119_0297232	3300048922	Bacteria	797
2156	Ga0496120_0124471	3300048923	Bacteria	1329
2157	Ga0496121_0000270	3300048924	Bacteria	108787
2158	Ga0496121_0000370	3300048924	Bacteria	92397
2159	Ga0496121_0024961	3300048924	Bacteria	5693
2160	Ga0496121_0037967	3300048924	Bacteria	4272
2161	Ga0496121_0056471	3300048924	Bacteria	3261
2162	Ga0496121_0065236	3300048924	Bacteria	2964
2163	Ga0496121_0068084	3300048924	Bacteria	2882
2164	Ga0496121_0076636	3300048924	Bacteria	2666
2165	Ga0496121_0136863	3300048924	Bacteria	1823
2166	Ga0496121_0180268	3300048924	Bacteria	1525
2167	Ga0496121_0258582	3300048924	Bacteria	1203
2168	Ga0496121_0342038	3300048924	Bacteria	999
2169	Ga0496124_0000235	3300048927	Bacteria	107983
2170	Ga0496124_0000294	3300048927	Bacteria	93153
2171	Ga0496124_0059769	3300048927	Bacteria	3200
2172	Ga0496124_0208349	3300048927	Bacteria	1481
2173	Ga0496124_0265201	3300048927	Bacteria	1261
2174	Ga0496125_0000053	3300048928	Bacteria	279909
2175	Ga0496125_0000328	3300048928	Bacteria	91806
2176	Ga0496125_0028321	3300048928	Bacteria	5063
2177	Ga0496125_0029286	3300048928	Bacteria	4952
2178	Ga0496125_0036451	3300048928	Bacteria	4294
2179	Ga0496125_0042674	3300048928	Bacteria	3860
2180	Ga0496125_0043278	3300048928	Bacteria	3825
2181	Ga0496125_0060878	3300048928	Bacteria	3031
2182	Ga0496126_0002460	3300048929	Bacteria	24974
2183	Ga0496126_0002944	3300048929	Bacteria	22128
2184	Ga0496126_0005304	3300048929	Bacteria	14797
2185	Ga0496126_0017043	3300048929	Bacteria	7248
2186	Ga0496126_0024056	3300048929	Bacteria	5886
2187	Ga0496126_0033707	3300048929	Bacteria	4816
2188	Ga0496126_0039249	3300048929	Bacteria	4395
2189	Ga0496126_0069744	3300048929	Bacteria	3134
2190	Ga0496126_0090215	3300048929	Bacteria	2697
2191	Ga0496126_0111231	3300048929	Bacteria	2385
2192	Ga0496126_0141708	3300048929	Bacteria	2068
2193	Ga0496126_0144445	3300048929	Bacteria	2045
2194	Ga0496126_0154552	3300048929	Bacteria	1964
2195	Ga0496126_0161406	3300048929	Bacteria	1915
2196	Ga0496126_0174376	3300048929	Bacteria	1830
2197	Ga0496126_0189594	3300048929	Bacteria	1742
2198	Ga0496126_0208468	3300048929	Bacteria	1646
2199	Ga0496126_0299481	3300048929	Bacteria	1327
2200	Ga0496126_0334817	3300048929	Bacteria	1241
2201	Ga0496126_0337326	3300048929	Bacteria	1235
2202	Ga0496126_0365016	3300048929	Bacteria	1178
2203	Ga0495678_035346	3300049459	Bacteria	2049
2204	Ga0495682_0033729	3300049460	Bacteria	1889
2205	Ga0501031_0031678	3300049568	Bacteria	3449
2206	Ga0501031_0032907	3300049568	Bacteria	3380
2207	Ga0501031_0039490	3300049568	Bacteria	3080
2208	Ga0501031_0042532	3300049568	Bacteria	2965
2209	Ga0501032_0005395	3300049569	Bacteria	9512
2210	Ga0501032_0029554	3300049569	Bacteria	3760
2211	Ga0501032_0073240	3300049569	Bacteria	2282
2212	Ga0501032_0186078	3300049569	Bacteria	1358
2213	Ga0501032_0366800	3300049569	Bacteria	927
2214	Ga0501033_0000440	3300049570	Bacteria	39822
2215	Ga0501033_0053579	3300049570	Bacteria	2987
2216	Ga0501033_0100447	3300049570	Bacteria	2111
2217	Ga0501033_0143234	3300049570	Bacteria	1728
2218	Ga0501033_0197773	3300049570	Bacteria	1437
2219	Ga0501033_0210893	3300049570	Bacteria	1385
2220	Ga0501033_0354427	3300049570	Bacteria	1027
2221	Ga0501034_0000286	3300049571	Bacteria	90126
2222	Ga0501034_0004004	3300049571	Bacteria	16529
2223	Ga0501034_0011589	3300049571	Bacteria	9129
2224	Ga0501034_0073352	3300049571	Bacteria	3431
2225	Ga0501034_0076316	3300049571	Bacteria	3358
2226	Ga0501034_0192425	3300049571	Bacteria	2001
2227	Ga0501034_0231494	3300049571	Bacteria	1797
2228	Ga0501034_0232405	3300049571	Bacteria	1792
2229	Ga0501034_0252893	3300049571	Bacteria	1706
2230	Ga0501034_0300395	3300049571	Bacteria	1542
2231	Ga0501034_0304905	3300049571	Bacteria	1528
2232	Ga0501034_0336340	3300049571	Bacteria	1441
2233	Ga0501034_0549330	3300049571	Bacteria	1064
2234	Ga0501034_0695073	3300049571	Bacteria	916
2235	Ga0501034_1069349	3300049571	Bacteria	689
2236	Ga0501036_0000118	3300049572	Bacteria	49383
2237	Ga0501036_0017713	3300049572	Bacteria	5962
2238	Ga0501036_0060965	3300049572	Bacteria	3195
2239	Ga0501036_0138705	3300049572	Bacteria	2052
2240	Ga0501036_0141200	3300049572	Bacteria	2032
2241	Ga0501036_0383078	3300049572	Bacteria	1173
2242	Ga0501036_0787900	3300049572	Bacteria	783
2243	Ga0501037_0005763	3300049573	Bacteria	9042
2244	Ga0501037_0009392	3300049573	Bacteria	7176
2245	Ga0501037_0029633	3300049573	Bacteria	4043
2246	Ga0501037_0044786	3300049573	Bacteria	3249
2247	Ga0501037_0048807	3300049573	Bacteria	3100
2248	Ga0501037_0056863	3300049573	Bacteria	2856
2249	Ga0501037_0069854	3300049573	Bacteria	2556
2250	Ga0501037_0158437	3300049573	Bacteria	1615
2251	Ga0501037_0309214	3300049573	Bacteria	1096
2252	Ga0501038_0005087	3300049574	Bacteria	12222
2253	Ga0501038_0005534	3300049574	Bacteria	11731
2254	Ga0501038_0008403	3300049574	Bacteria	9494
2255	Ga0501038_0106099	3300049574	Bacteria	2332
2256	Ga0501038_0143621	3300049574	Bacteria	1950
2257	Ga0501038_0198010	3300049574	Bacteria	1614
2258	Ga0501038_0215831	3300049574	Bacteria	1533
2259	Ga0501038_0521481	3300049574	Bacteria	907
2260	Ga0501038_0542697	3300049574	Bacteria	885
2261	Ga0501039_0011559	3300049575	Bacteria	6720
2262	Ga0501039_0031179	3300049575	Bacteria	4110
2263	Ga0501039_0079612	3300049575	Bacteria	2549
2264	Ga0501039_0085706	3300049575	Bacteria	2453
2265	Ga0501039_0095018	3300049575	Bacteria	2324
2266	Ga0501039_0115167	3300049575	Bacteria	2104
2267	Ga0501039_0156649	3300049575	Bacteria	1789
2268	Ga0501039_0177642	3300049575	Bacteria	1674
2269	Ga0501039_0326698	3300049575	Bacteria	1206
2270	Ga0501040_0037818	3300049576	Bacteria	3280
2271	Ga0501040_0059527	3300049576	Bacteria	2624
2272	Ga0501040_0178048	3300049576	Bacteria	1507
2273	Ga0501040_0320889	3300049576	Bacteria	1108
2274	Ga0501041_0040615	3300049577	Bacteria	2824
2275	Ga0501041_0136853	3300049577	Bacteria	1526
2276	Ga0501041_0340107	3300049577	Bacteria	948
2277	Ga0501042_0003037	3300049578	Bacteria	10439
2278	Ga0501042_0103349	3300049578	Bacteria	2050
2279	Ga0501042_0672550	3300049578	Bacteria	753
2280	Ga0501043_0001889	3300049579	Bacteria	17947
2281	Ga0501043_0008016	3300049579	Bacteria	8337
2282	Ga0501043_0011643	3300049579	Bacteria	6884
2283	Ga0501043_0053584	3300049579	Bacteria	3167
2284	Ga0501043_0071865	3300049579	Bacteria	2717
2285	Ga0501043_0104188	3300049579	Bacteria	2229
2286	Ga0501043_0259578	3300049579	Bacteria	1337
2287	Ga0501043_0317108	3300049579	Bacteria	1189
2288	Ga0501043_0356828	3300049579	Bacteria	1110
2289	Ga0501043_0521508	3300049579	Bacteria	885
2290	Ga0501046_0029784	3300049580	Bacteria	4436
2291	Ga0501046_0034691	3300049580	Bacteria	4070
2292	Ga0501046_0036997	3300049580	Bacteria	3924
2293	Ga0501046_0052525	3300049580	Bacteria	3212
2294	Ga0501046_0061131	3300049580	Bacteria	2946
2295	Ga0501046_0065025	3300049580	Bacteria	2846
2296	Ga0501046_0082303	3300049580	Bacteria	2486
2297	Ga0501047_0000097	3300049581	Bacteria	107310
2298	Ga0501047_0026637	3300049581	Bacteria	5564
2299	Ga0501047_0035690	3300049581	Bacteria	4803
2300	Ga0501047_0059149	3300049581	Bacteria	3700
2301	Ga0501047_0059428	3300049581	Bacteria	3691
2302	Ga0501047_0071829	3300049581	Bacteria	3331
2303	Ga0501047_0080484	3300049581	Bacteria	3131
2304	Ga0501047_0140661	3300049581	Bacteria	2292
2305	Ga0501047_0197854	3300049581	Bacteria	1871
2306	Ga0501047_0288288	3300049581	Bacteria	1485
2307	Ga0501047_0365487	3300049581	Bacteria	1278
2308	Ga0501047_0384564	3300049581	Bacteria	1237
2309	Ga0501048_0000471	3300049582	Bacteria	28313
2310	Ga0501048_0071082	3300049582	Bacteria	2457
2311	Ga0501048_0125510	3300049582	Bacteria	1814
2312	Ga0501048_0156372	3300049582	Bacteria	1613
2313	Ga0501048_0266047	3300049582	Bacteria	1218
2314	Ga0501067_0041019	3300049583	Bacteria	2570
2315	Ga0501067_0041067	3300049583	Bacteria	2568
2316	Ga0501067_0078484	3300049583	Bacteria	1830
2317	Ga0501068_0104382	3300049584	Bacteria	1758
2318	Ga0501068_0178560	3300049584	Bacteria	1342
2319	Ga0501069_0039858	3300049585	Bacteria	2595
2320	Ga0501069_0070141	3300049585	Bacteria	1963
2321	Ga0501069_0095707	3300049585	Bacteria	1682
2322	Ga0501070_0003250	3300049586	Bacteria	14106
2323	Ga0501070_0005826	3300049586	Bacteria	10511
2324	Ga0501070_0014334	3300049586	Bacteria	6672
2325	Ga0501070_0044402	3300049586	Bacteria	3698
2326	Ga0501070_0055900	3300049586	Bacteria	3272
2327	Ga0501070_0072913	3300049586	Bacteria	2842
2328	Ga0501070_0073326	3300049586	Bacteria	2832
2329	Ga0501070_0094611	3300049586	Bacteria	2472
2330	Ga0501070_0104245	3300049586	Bacteria	2345
2331	Ga0501070_0123182	3300049586	Bacteria	2142
2332	Ga0501070_0129116	3300049586	Bacteria	2088
2333	Ga0501070_0149009	3300049586	Bacteria	1930
2334	Ga0501070_0150587	3300049586	Bacteria	1919
2335	Ga0501070_0572726	3300049586	Bacteria	902
2336	Ga0501071_0070460	3300049587	Bacteria	2547
2337	Ga0501071_0082264	3300049587	Bacteria	2357
2338	Ga0501072_0002898	3300049588	Bacteria	12907
2339	Ga0501072_0081740	3300049588	Bacteria	2561
2340	Ga0501072_0114743	3300049588	Bacteria	2144
2341	Ga0501072_0277669	3300049588	Bacteria	1333
2342	Ga0501072_0397945	3300049588	Bacteria	1093
2343	Ga0501072_0469351	3300049588	Bacteria	996
2344	Ga0501073_0042461	3300049589	Bacteria	3209
2345	Ga0501073_0056321	3300049589	Bacteria	2750
2346	Ga0501073_0059230	3300049589	Bacteria	2675
2347	Ga0501073_0101485	3300049589	Bacteria	1998
2348	Ga0501073_0151453	3300049589	Bacteria	1608
2349	Ga0501073_0168334	3300049589	Bacteria	1517
2350	Ga0501073_0251159	3300049589	Bacteria	1221
2351	Ga0501073_0458190	3300049589	Bacteria	881
2352	Ga0501074_0003990	3300049590	Bacteria	10519
2353	Ga0501074_0035817	3300049590	Bacteria	3595
2354	Ga0501074_0048389	3300049590	Bacteria	3071
2355	Ga0501074_0051339	3300049590	Bacteria	2976
2356	Ga0501075_0027432	3300049591	Bacteria	4197
2357	Ga0501075_0187771	3300049591	Bacteria	1576
2358	Ga0501075_0212599	3300049591	Bacteria	1475
2359	Ga0501075_0225109	3300049591	Bacteria	1431
2360	Ga0501076_0007597	3300049592	Bacteria	7893
2361	Ga0501076_0102281	3300049592	Bacteria	2310
2362	Ga0501076_0112735	3300049592	Bacteria	2200
2363	Ga0501076_0256598	3300049592	Bacteria	1431
2364	Ga0501076_0290540	3300049592	Bacteria	1339
2365	Ga0501076_0302111	3300049592	Bacteria	1312
2366	Ga0501076_0326004	3300049592	Bacteria	1260
2367	Ga0501077_0192898	3300049593	Bacteria	1294
2368	Ga0501077_0235716	3300049593	Bacteria	1163
2369	Ga0501077_0288705	3300049593	Bacteria	1044
2370	Ga0501079_0112134	3300049741	Bacteria	2120
2371	Ga0501079_0122281	3300049741	Bacteria	2024
2372	Ga0501079_0122492	3300049741	Bacteria	2022
2373	Ga0501079_0134898	3300049741	Bacteria	1922
2374	Ga0501079_0154873	3300049741	Bacteria	1786
2375	Ga0501079_0165997	3300049741	Bacteria	1722
2376	Ga0501080_0000047	3300049742	Bacteria	76956
2377	Ga0501080_0002360	3300049742	Bacteria	16457
2378	Ga0501080_0007608	3300049742	Bacteria	9793
2379	Ga0501080_0020846	3300049742	Bacteria	6066
2380	Ga0501080_0080116	3300049742	Bacteria	3035
2381	Ga0501081_0051061	3300049743	Bacteria	2851
2382	Ga0501081_0410290	3300049743	Bacteria	1003
2383	Ga0501083_0000857	3300049744	Bacteria	20028
2384	Ga0501083_0022090	3300049744	Bacteria	4416
2385	Ga0501083_0094941	3300049744	Bacteria	1968
2386	Ga0501083_0130711	3300049744	Bacteria	1646
2387	Ga0501035_0001181	3300049822	Bacteria	27196
2388	Ga0501035_0006394	3300049822	Bacteria	11080
2389	Ga0501035_0019511	3300049822	Bacteria	6233
2390	Ga0501035_0065941	3300049822	Bacteria	3213
2391	Ga0501035_0078031	3300049822	Bacteria	2926
2392	Ga0501035_0097341	3300049822	Bacteria	2584
2393	Ga0501035_0139114	3300049822	Bacteria	2112
2394	Ga0501035_0158096	3300049822	Bacteria	1963
2395	Ga0501035_0269915	3300049822	Bacteria	1440
2396	Ga0501035_0468452	3300049822	Bacteria	1040
2397	Ga0501035_0502744	3300049822	Bacteria	997
2398	Ga0501044_0006535	3300049823	Bacteria	12874
2399	Ga0501044_0009895	3300049823	Bacteria	10362
2400	Ga0501044_0014838	3300049823	Bacteria	8397
2401	Ga0501044_0035410	3300049823	Bacteria	5227
2402	Ga0501044_0040396	3300049823	Bacteria	4861
2403	Ga0501044_0091490	3300049823	Bacteria	3068
2404	Ga0501044_0091559	3300049823	Bacteria	3067
2405	Ga0501044_0114032	3300049823	Bacteria	2709
2406	Ga0501044_0161741	3300049823	Bacteria	2215
2407	Ga0501044_0211406	3300049823	Bacteria	1894
2408	Ga0501044_0219298	3300049823	Bacteria	1853
2409	Ga0501044_0312161	3300049823	Bacteria	1499
2410	Ga0501044_0427060	3300049823	Bacteria	1235
2411	Ga0501044_0550335	3300049823	Bacteria	1051
2412	Ga0501045_0026458	3300049824	Bacteria	4173
2413	Ga0501045_0183570	3300049824	Bacteria	1559
2414	Ga0501045_0276111	3300049824	Bacteria	1251
2415	nmdc:mga03683_69826_c1	3300050489	Bacteria	1499
2416	nmdc:mga03683_87002_c1	3300050489	Bacteria	1357
2417	nmdc:mga03n38_18540_c1	3300050490	Bacteria	2749
2418	nmdc:mga03n38_306889_c1	3300050490	Bacteria	854
2419	nmdc:mga03n38_35814_c1	3300050490	Bacteria	2129
2420	nmdc:mga03n38_46519_c1	3300050490	Bacteria	1916
2421	nmdc:mga0yw44_19569_c1	3300050492	Bacteria	3736
2422	nmdc:mga0yw44_217680_c1	3300050492	Bacteria	1265
2423	nmdc:mga0yw44_72673_c1	3300050492	Bacteria	2139
2424	nmdc:mga0k408_436502_c1	3300050493	Bacteria	778
2425	nmdc:mga06z11_11930_c1	3300050494	Bacteria	3764
2426	nmdc:mga06z11_121704_c1	3300050494	Bacteria	1456
2427	nmdc:mga06z11_85785_c1	3300050494	Bacteria	1699
2428	nmdc:mga04h51_12847_c1	3300050495	Bacteria	2359
2429	nmdc:mga04h51_2520_c1	3300050495	Bacteria	4361
2430	nmdc:mga04h51_3991_c1	3300050495	Bacteria	3633
2431	nmdc:mga07m45_61463_c2	3300050496	Bacteria	1025
2432	nmdc:mga05p37_814706_c1	3300050507	Bacteria	1019
2433	nmdc:mga09592_547423_c1	3300050508	Bacteria	994
2434	nmdc:mga0qj67_27437_c1	3300050509	Bacteria	4415
2435	nmdc:mga0qj67_53487_c1	3300050509	Bacteria	3197
2436	nmdc:mga0qj67_60507_c1	3300050509	Bacteria	3006
2437	nmdc:mga0qj67_96203_c1	3300050509	Bacteria	2384
2438	nmdc:mga06r32_40738_c1	3300050510	Bacteria	4411
2439	nmdc:mga06r32_410765_c1	3300050510	Bacteria	1335
2440	nmdc:mga06r32_48682_c1	3300050510	Bacteria	4053
2441	nmdc:mga06r32_505648_c1	3300050510	Bacteria	1185
2442	nmdc:mga08y16_102080_c1	3300050511	Bacteria	2986
2443	nmdc:mga08y16_247502_c1	3300050511	Bacteria	1842
2444	nmdc:mga08y16_27032_c1	3300050511	Bacteria	6047
2445	nmdc:mga08y16_3076_c1	3300050511	Bacteria	17248
2446	nmdc:mga08y16_404141_c1	3300050511	Bacteria	1397
2447	nmdc:mga08y16_4733_c1	3300050511	Bacteria	14195
2448	nmdc:mga0n895_24914_c1	3300050512	Bacteria	5645
2449	nmdc:mga0n895_350542_c1	3300050512	Bacteria	1495
2450	nmdc:mga0n895_55_c1	3300050512	Bacteria	66529
2451	nmdc:mga0n895_83709_c1	3300050512	Bacteria	3182
2452	nmdc:mga0rr50_110878_c1	3300050513	Bacteria	2171
2453	nmdc:mga0rr50_12618_c1	3300050513	Bacteria	5470
2454	nmdc:mga0rr50_315463_c1	3300050513	Bacteria	1310
2455	nmdc:mga0rr50_58710_c1	3300050513	Bacteria	2884
2456	nmdc:mga0rr50_676436_c1	3300050513	Bacteria	881
2457	nmdc:mga08x19_118680_c1	3300050514	Bacteria	1771
2458	nmdc:mga08x19_294253_c1	3300050514	Bacteria	1127
2459	nmdc:mga0a205_127781_c1	3300050515	Bacteria	2441
2460	nmdc:mga0a205_170785_c1	3300050515	Bacteria	2070
2461	nmdc:mga0a205_26538_c1	3300050515	Bacteria	5526
2462	nmdc:mga0a205_343309_c1	3300050515	Bacteria	1361
2463	nmdc:mga0a205_622965_c1	3300050515	Bacteria	931
2464	nmdc:mga0a205_768_c4	3300050515	Bacteria	16460
2465	nmdc:mga0sz30_7938_c1	3300050516	Bacteria	3994
2466	Ga0495601_0002541	3300053077	Bacteria	10366
2467	Ga0495601_0013100	3300053077	Bacteria	4984
2468	Ga0495601_0015968	3300053077	Bacteria	4543
2469	Ga0495601_0019662	3300053077	Bacteria	4120
2470	Ga0495601_0021106	3300053077	Bacteria	3985
2471	Ga0495601_0104698	3300053077	Bacteria	1829
2472	Ga0495601_0146301	3300053077	Bacteria	1542
2473	Ga0495601_0300860	3300053077	Bacteria	1045
2474	Ga0495612_0000243	3300053078	Bacteria	22586
2475	Ga0495612_0000733	3300053078	Bacteria	13321
2476	Ga0495612_0006404	3300053078	Bacteria	4839
2477	Ga0495612_0014879	3300053078	Bacteria	3121
2478	Ga0495612_0023113	3300053078	Bacteria	2493
2479	Ga0495612_0036509	3300053078	Bacteria	1994
2480	Ga0495612_0081950	3300053078	Bacteria	1356
2481	Ga0500635_0050731	3300053080	Bacteria	1420
2482	Ga0495595_0000578	3300053084	Bacteria	14020
2483	Ga0495595_0001643	3300053084	Bacteria	8751
2484	Ga0495595_0003604	3300053084	Bacteria	6151
2485	Ga0495595_0003714	3300053084	Bacteria	6068
2486	Ga0495595_0008735	3300053084	Bacteria	4170
2487	Ga0495595_0013364	3300053084	Bacteria	3469
2488	Ga0495595_0030242	3300053084	Bacteria	2428
2489	Ga0495595_0167095	3300053084	Bacteria	1087
2490	Ga0495595_0192737	3300053084	Bacteria	1013
2491	Ga0495595_0201766	3300053084	Bacteria	990
2492	Ga0495619_0000139	3300053085	Bacteria	54165
2493	Ga0495619_0000330	3300053085	Bacteria	33168
2494	Ga0495619_0000365	3300053085	Bacteria	31256
2495	Ga0495619_0001830	3300053085	Bacteria	14136
2496	Ga0495619_0002914	3300053085	Bacteria	11117
2497	Ga0495619_0004517	3300053085	Bacteria	8888
2498	Ga0495619_0021688	3300053085	Bacteria	4103
2499	Ga0495619_0027803	3300053085	Bacteria	3647
2500	Ga0495619_0067140	3300053085	Bacteria	2394
2501	Ga0495619_0083526	3300053085	Bacteria	2154
2502	Ga0495619_0093266	3300053085	Bacteria	2041
2503	Ga0495619_0139183	3300053085	Bacteria	1670
2504	Ga0495619_0159432	3300053085	Bacteria	1558
2505	Ga0495619_0176402	3300053085	Bacteria	1478
2506	Ga0495619_0306511	3300053085	Bacteria	1100
2507	Ga0495619_0514654	3300053085	Bacteria	822
2508	Ga0500578_0060510	3300053086	Bacteria	2419
2509	Ga0500578_0156075	3300053086	Bacteria	1419
2510	Ga0500643_000063	3300053087	Bacteria	122135
2511	Ga0500643_002099	3300053087	Bacteria	10607
2512	Ga0500644_0001257	3300053088	Bacteria	6924
2513	Ga0500644_0029965	3300053088	Bacteria	1717
2514	Ga0500646_0082239	3300053090	Bacteria	984
2515	Ga0500646_0096926	3300053090	Bacteria	921
2516	Ga0500647_0011835	3300053091	Bacteria	3911
2517	Ga0500583_0056163	3300053092	Bacteria	1844
2518	Ga0500651_0053527	3300053093	Bacteria	2531
2519	Ga0500566_0000151	3300053094	Bacteria	35674
2520	Ga0500566_0000236	3300053094	Bacteria	29461
2521	Ga0500566_0295756	3300053094	Bacteria	764
2522	Ga0500640_033763	3300053095	Bacteria	2245
2523	Ga0500641_0007070	3300053096	Bacteria	3996
2524	Ga0500641_0018085	3300053096	Bacteria	2646
2525	Ga0500641_0082546	3300053096	Bacteria	1365
2526	Ga0500650_0178993	3300053098	Bacteria	972
2527	Ga0500555_004818	3300053103	Bacteria	3830
2528	Ga0500555_012245	3300053103	Bacteria	2467
2529	Ga0500556_0000092	3300053104	Bacteria	83297
2530	Ga0500557_000037	3300053105	Bacteria	71114
2531	Ga0500562_006897	3300053108	Bacteria	2866
2532	Ga0500569_019901	3300053109	Bacteria	1753
2533	Ga0500569_089982	3300053109	Bacteria	993
2534	Ga0500572_000200	3300053111	Bacteria	21263
2535	Ga0500594_0095086	3300053118	Bacteria	910
2536	Ga0500594_0106698	3300053118	Bacteria	867
2537	Ga0500594_0132896	3300053118	Bacteria	789
2538	Ga0500595_000001	3300053119	Bacteria	1088438
2539	Ga0500595_000265	3300053119	Bacteria	34660
2540	Ga0500595_001612	3300053119	Bacteria	11886
2541	Ga0500595_007591	3300053119	Bacteria	4492
2542	Ga0500595_022450	3300053119	Bacteria	2234
2543	Ga0500595_034349	3300053119	Bacteria	1677
2544	Ga0500595_075670	3300053119	Bacteria	992
2545	Ga0500607_019113	3300053121	Bacteria	3882
2546	Ga0500608_044642	3300053122	Bacteria	2128
2547	Ga0500608_093901	3300053122	Bacteria	1398
2548	Ga0500614_024140	3300053123	Bacteria	1434
2549	Ga0500614_096039	3300053123	Bacteria	848
2550	Ga0500621_085094	3300053126	Bacteria	1264
2551	Ga0500621_122899	3300053126	Bacteria	1003
2552	Ga0500642_0000062	3300053130	Bacteria	58970
2553	Ga0500642_0062887	3300053130	Bacteria	1671
2554	Ga0500652_000090	3300053131	Bacteria	38615
2555	Ga0500652_025903	3300053131	Bacteria	2253
2556	Ga0500559_0000179	3300053136	Bacteria	50232
2557	Ga0500559_0018563	3300053136	Bacteria	2938
2558	Ga0500559_0028885	3300053136	Bacteria	2371
2559	Ga0500559_0109842	3300053136	Bacteria	1277
2560	Ga0500559_0314922	3300053136	Bacteria	734
2561	Ga0500573_0073330	3300053140	Bacteria	1950
2562	Ga0500589_073187	3300053147	Bacteria	1546
2563	Ga0500590_168107	3300053148	Bacteria	968
2564	Ga0500590_196312	3300053148	Bacteria	859
2565	Ga0500603_000295	3300053150	Bacteria	13130
2566	Ga0500603_092290	3300053150	Bacteria	890
2567	Ga0500604_0091197	3300053151	Bacteria	995
2568	Ga0500616_0000001	3300053153	Bacteria	1986011
2569	Ga0500616_0020033	3300053153	Bacteria	3761
2570	Ga0500616_0257557	3300053153	Bacteria	742
2571	Ga0500620_000467	3300053155	Bacteria	7193
2572	Ga0500627_0172286	3300053158	Bacteria	975
2573	Ga0500630_022191	3300053159	Bacteria	3135
2574	Ga0500634_0094860	3300053161	Bacteria	1506
2575	Ga0500634_0234416	3300053161	Bacteria	776
2576	Ga0500638_000059	3300053162	Bacteria	20593
2577	Ga0500638_013587	3300053162	Bacteria	3689
2578	Ga0500638_070509	3300053162	Bacteria	1671
2579	Ga0500638_158443	3300053162	Bacteria	999
2580	Ga0500639_028697	3300053163	Bacteria	2940
2581	Ga0500639_046032	3300053163	Bacteria	2282
2582	Ga0500636_0009392	3300053177	Bacteria	5682
2583	Ga0500636_0026529	3300053177	Bacteria	3422
2584	Ga0500636_0052209	3300053177	Bacteria	2401
2585	Ga0500636_0144605	3300053177	Bacteria	1312
2586	Ga0500637_0002081	3300053178	Bacteria	8764
2587	Ga0500576_066041	3300053725	Bacteria	1569
2588	Ga0500625_012606	3300053729	Bacteria	3867
2589	Ga0500645_000109	3300053730	Bacteria	65892
2590	Ga0500645_042081	3300053730	Bacteria	1348
2591	Ga0500609_027369	3300053731	Bacteria	781
2592	Ga0500656_007131	3300053732	Bacteria	1154
2593	Ga0500596_001346	3300053735	Bacteria	4942
2594	Ga0500596_002026	3300053735	Bacteria	4050
2595	Ga0500599_001321	3300053736	Bacteria	2836
2596	Ga0500601_000544	3300053737	Bacteria	5588
2597	Ga0501084_0031614	3300054114	Bacteria	4424
2598	Ga0501084_0070618	3300054114	Bacteria	2924
2599	Ga0501084_0095881	3300054114	Bacteria	2491
2600	Ga0501084_0302354	3300054114	Bacteria	1351
2601	Ga0501084_0337157	3300054114	Bacteria	1274
2602	Ga0500661_000282	3300055283	Bacteria	9220
2603	Ga0501082_0141449	3300060353	Bacteria	2088
2604	Ga0501082_0156073	3300060353	Bacteria	1983
2605	Ga0501082_0178913	3300060353	Bacteria	1844
2606	Ga0501082_0186060	3300060353	Bacteria	1807
2607	Ga0466962_0063016	3300061719	Bacteria	1770
2608	Ga0530510_0184325	3300061734	Bacteria	1548
2609	Ga0530510_0250045	3300061734	Bacteria	1321
2610	Ga0530510_0254466	3300061734	Bacteria	1309
2611	2507505223	2507262055	Bacteria	8048963
2612	2508539144	2508501009	Bacteria	7784016
2613	2508695387	2508501042	Bacteria	8719808
2614	2509152614	2508501128	Bacteria	8613869
2615	2513629059	2513237092	Bacteria	8341956
2616	2513644143	2513237094	Bacteria	8789602
2617	2513651538	2513237095	Bacteria	8976980
2618	2513658791	2513237096	Bacteria	8722461
2619	2513674608	2513237098	Bacteria	9902361
2620	2513695089	2513237101	Bacteria	7952346
2621	2513704410	2513237102	Bacteria	7703324
2622	2513720326	2513237104	Bacteria	10034502
2623	2513860798	2513237137	Bacteria	9558895
2624	2513873550	2513237139	Bacteria	8737671
2625	2513888746	2513237141	Bacteria	8496279
2626	2513921055	2513237145	Bacteria	8979722
2627	2514012463	2513237161	Bacteria	8871253
2628	2515627420	2515154112	Bacteria	8294334
2629	2517107733	2517093001	Bacteria	9002274
2630	2517888820	2517572143	Bacteria	9484767
2631	2524440912	2524023205	Bacteria	8918781
2632	2524467828	2524023210	Bacteria	9029266
2633	2524537076	2524023228	Bacteria	10118060
2634	2585334047	2582581316	Bacteria	7774528
2635	2617352376	2617270735	Bacteria	9163226
2636	2617373738	2617270741	Bacteria	8201522
2637	2643854776	2643221568	Bacteria	5187270
2638	2643966623	2643221591	Bacteria	4397626
2639	2644290925	2643221651	Bacteria	4798932
2640	2644501303	2643221689	Bacteria	6042950
2641	2671119966	2667528175	Bacteria	7532676
2642	2723841621	2721755755	Bacteria	8322773
2643	2728754968	2728368998	Bacteria	8720350
2644	2745081667	2744054633	Bacteria	8678936
2645	2793062020	2791355196	Bacteria	7323613
2646	2793072908	2791355197	Bacteria	8420563
2647	2793082773
2648	2805915634	2802429603	Bacteria	8777136
2649	2818237627	2816332527	Bacteria	8933356
2650	2824604607	2824600985	Bacteria	8488197
2651	2824612302	2824609381	Bacteria	8672835
2652	2824624477	2824617872	Bacteria	8814715
2653	2824633392	2824626560	Bacteria	8813858
2654	2824640311	2824635225	Bacteria	8785348
2655	2824647255	2824644064	Bacteria	8743947
2656	2824655167	2824653114	Bacteria	8493680
2657	2824676647	2824671348	Bacteria	8369588
2658	2824684082	2824679649	Bacteria	8248951
2659	2824694745	2824687955	Bacteria	8360029
2660	2824702843	2824696289	Bacteria	8335049
2661	2824712736	2824704595	Bacteria	9667483
2662	2824717429	2824714736	Bacteria	8717648
2663	2824727608	2824723954	Bacteria	8758240
2664	2824739192	2824732956	Bacteria	7810675
2665	2824752566	2824746037	Bacteria	7911610
2666	2824757642	2824753945	Bacteria	9787441
2667	2824773150	2824763712	Bacteria	9792355
2668	2824775544	2824773399	Bacteria	8360218
2669	2829747135	2829745981	Bacteria	5406054
2670	2838124491	2838122688	Bacteria	8803140
2671	2841945177	2841941048	Bacteria	8688029
2672	2841951959	2841949485	Bacteria	8680857
2673	2841965412	2841957949	Bacteria	8652217
2674	2841970646	2841966195	Bacteria	8673214
2675	2841979995	2841974524	Bacteria	8931498
2676	2841985174	2841983080	Bacteria	8395090
2677	2842043532	2842038055	Bacteria	8002051
2678	2842052478	2842045827	Bacteria	8006841
2679	2842485339	2842482326	Bacteria	7212537
2680	2844315315	2844315083	Bacteria	8138177
2681	2847931050	2847930680	Bacteria	9342022
2682	2847942133	2847939898	Bacteria	8606328
2683	2849083014	2849076700	Bacteria	7039503
2684	2857511902	2857509624	Bacteria	7472071
2685	2874594423	2874590934	Bacteria	8299676
2686	2874608085	2874604998	Bacteria	7834745
2687	2874613458	2874612657	Bacteria	8252029
2688	2874624759	2874620515	Bacteria	8290088
2689	2874628817	2874628541	Bacteria	8630250
2690	2874649796	2874645413	Bacteria	8214782
2691	2876769712	2876761206	Bacteria	10111113
2692	2876773915	2876771140	Bacteria	8287509
2693	2876821795	2876818435	Bacteria	8274608
2694	2879078361	2879074833	Bacteria	8279565
2695	2879085884	2879083081	Bacteria	8587928
2696	2879112148	2879110137	Bacteria	8907982
2697	2879130622	2879127579	Bacteria	8294491
2698	2879147101	2879142872	Bacteria	8267021
2699	2881365340	2881364244	Bacteria	7710352
2700	2881668207	2881665667	Bacteria	8175609
2701	2885371050	2885366525	Bacteria	8326213
2702	2885376162	2885374607	Bacteria	8927485
2703	2885385082	2885383462	Bacteria	9473874
2704	2885411684	2885409591	Bacteria	9235467
2705	2888379616	2888378607	Bacteria	9652610
2706	2888390703	2888388044	Bacteria	7304136
2707	2888420329	2888419890	Bacteria	7857137
2708	2889035514	2889033259	Bacteria	9099371
2709	2903732176	2903727486	Bacteria	8281579
2710	2903748976	2903748898	Bacteria	9972761
2711	2903770782	2903768456	Bacteria	9749579
2712	2904670286	2904666416	Bacteria	8226587
2713	2904694488	2904690495	Bacteria	9412302
2714	2904708802
2715	2904713156	2904711408	Bacteria	9771557
2716	2906604253	2906602504	Bacteria	8295279
2717	2906613852
2718	2906628979	2906626472	Bacteria	8826946
2719	2906642355	2906635258	Bacteria	8601019
2720	2906649401	2906643746	Bacteria	8722424
2721	2906667383	2906660503	Bacteria	8595048
2722	2908747421	2908739725	Bacteria	8628932
2723	2908756609	2908756301	Bacteria	8864324
2724	2908776255	2908775508	Bacteria	8092255
2725	2920760155	2920760137	Bacteria	7427611
2726	2920826118	2920822456	Bacteria	6897201
2727	2922364023	2922361189	Bacteria	7436256
2728	2922392544	2922386360	Bacteria	7017218
2729	2922394217	2922393267	Bacteria	8285685
2730	2922434248
2731	2932794339	2932794094	Bacteria	7915132
2732	2932808067	2932801729	Bacteria	7987968
2733	2935615748	2935608549	Bacteria	8203142
2734	2935636607	2935630451	Bacteria	8169952
2735	2935656120	2935648319	Bacteria	8801166
2736	2935664955	2935656913	Bacteria	8965014
2737	2935773065	2935769743	Bacteria	7878163
2738	2935783008	2935777560	Bacteria	8077691
2739	2935787946	2935785616	Bacteria	7962367
2740	2935796478	2935793552	Bacteria	8012592
2741	2935825454	2935819856	Bacteria	8261050
2742	2935853243	2935847175	Bacteria	8228321
2743	2935890127	2935883170	Bacteria	7964738
2744	2935914715	2935908558	Bacteria	8568796
2745	2935918692	2935916978	Bacteria	9113783
2746	2935931592	2935926038	Bacteria	8601059
2747	2935940189	2935934488	Bacteria	8602579
2748	2935947464	2935942939	Bacteria	8599779
2749	2935956236	2935951376	Bacteria	8602333
2750	2935962615	2935959822	Bacteria	7869783
2751	2935973029	2935967501	Bacteria	8603075
2752	2935980726	2935975950	Bacteria	8347125
2753	2935985045	2935984226	Bacteria	8302647
2754	2936019013	2936011229	Bacteria	8801034
2755	2936027595	2936019824	Bacteria	8804134
2756	2936036418	2936028420	Bacteria	8965941
2757	2936054544	2936046547	Bacteria	8903709
2758	2936056214	2936055302	Bacteria	8785755
2759	2941513243	2941507105	Bacteria	8166816
2760	2941521102	2941515067	Bacteria	8166720
2761	2941528961	2941523033	Bacteria	8169134
2762	2941535536	2941531003	Bacteria	7653939
2763	3005475039	3005474847	Bacteria	9259049
2764	3005486876	3005483717	Bacteria	7877331
2765	3005509185	3005506211	Bacteria	6943378
2766	3005592233	3005587118	Bacteria	7794411
2767	3005595028	3005594810	Bacteria	8716512
2768	3005710977	3005710791	Bacteria	7622528
2769	3005718282	3005718088	Bacteria	8283608
2770	643827586	643692032	Bacteria	6891900
2771	8006927868	8006926726	Bacteria	6749210
2772	8006936257	8006933436	Bacteria	10410654
2773	8006969339	8006964411	Bacteria	8966052
2774	8006976202	8006973647	Bacteria	10679141
2775	8006990900	8006984368	Bacteria	9651211
2776	8006996532	8006994254	Bacteria	8309700
2777	8016526116	8016522445	Bacteria	8156687
2778	8016549274	8016548790	Bacteria	8155074
2779	8016557702	8016557553	Bacteria	8154380
2780	8016582050	8016575299	Bacteria	8154085
2781	8016586400	8016583857	Bacteria	10421953
2782	8016595733	8016595262	Bacteria	8149947
2783	8016606589	8016603502	Bacteria	8731218
2784	8016618490	8016613128	Bacteria	8794220
2785	8016623182	8016622563	Bacteria	7999408
2786	8016635780	8016630954	Bacteria	9217207
2787	8019531006	8019530166	Bacteria	8155624
2788	8019540578	8019538911	Bacteria	7872763
2789	8019550198	8019547302	Bacteria	7996444
2790	8019572456	8019565922	Bacteria	9639779
2791	8019622947	8019619141	Bacteria	9218857
2792	8019630160	8019629233	Bacteria	8687553
2793	8019640452	8019638758	Bacteria	9062356
2794	8019666993	8019659431	Bacteria	8577854
2795	8019676749	8019668869	Bacteria	8791617
2796	8019696266	8019687851	Bacteria	8712826
2797	8049296454	8049293176	Bacteria	6128433
2798	8056675721	8056673599	Bacteria	7871253
2799	8056687414	8056681323	Bacteria	8472857
2800	8056693380	8056689827	Bacteria	6712655
2801	8056971267	8056967851	Bacteria	9038162
2802	Ga0265339_10028333
2803	RicEn_C8699
2804	ARSoilYngRDRAFT_c00154
2805	ARcpr5yngRDRAFT_c000045
2806	ARCol0yngRDRAFT_1000240
2807	JGI24747J21853_1001654
2808	JGI24740J21852_10018437
2809	JGI24740J21852_10038555
2810	JGI24739J22299_10001535
2811	JGI24739J22299_10003170
2812	JGI24737J22298_10000622
2813	JGI24737J22298_10011436
2814	JGI24743J22301_10006875
2815	JGI24735J21928_10046659
2816	JGI24750J21931_1000065
2817	JGI24745J21846_1000050
2818	JGI24748J21848_1000186
2819	JGI24738J21930_10003533
2820	JGI24738J21930_10016718
2821	JGI24749J21850_1017867
2822	JGI24744J21845_10000135
2823	JGI24035J26624_1000006
2824	JGI24033J26618_1000182
2825	JGI24742J22300_10000073
2826	JGI24751J29686_10038358
2827	JGI25165J46597_1020020
2828	JGI25153J46596_10000221
2829	JGI25153J46596_10001035
2830	JGI25153J46596_10001691
2831	JGI25153J46596_10021265
2832	JGI25160J50197_1001121
2833	JGI25160J50197_1002067
2834	JGI25404J52841_10007671
2835	JGI25404J52841_10013140
2836	JGI25404J52841_10013218
2837	JGI25404J52841_10030971
2838	Ga0055539_1002659
2839	Ga0055542_1008613
2840	Ga0055543_1013017
2841	Ga0065165_1003932
2842	Ga0065165_1045987
2843	Ga0065165_1046288
2844	Ga0065716_1001804
2845	Ga0065712_10000851
2846	Ga0065712_10069079
2847	Ga0065712_10069690
2848	Ga0065715_10000356
2849	Ga0065715_10001058
2850	Ga0070658_10126929
2851	Ga0070658_10668400
2852	Ga0070676_10005882
2853	Ga0070676_10240498
2854	Ga0070676_10280024
2855	Ga0070683_100003076
2856	Ga0070683_100008779
2857	Ga0070683_100231684
2858	Ga0070683_100422789
2859	Ga0070690_100000643
2860	Ga0070690_100030226
2861	Ga0070690_100042568
2862	Ga0070690_100224546
2863	Ga0070690_100338484
2864	Ga0070690_100654545
2865	Ga0070690_100743663
2866	Ga0070670_100000827
2867	Ga0070670_100016594
2868	Ga0070670_100051178
2869	Ga0070670_100184422
2870	Ga0070670_100783189
2871	Ga0070677_10000540
2872	Ga0068869_100000013
2873	Ga0068869_100215603
2874	Ga0070666_10001503
2875	Ga0070666_10299407
2876	Ga0070666_10305811
2877	Ga0070680_100002249
2878	Ga0070680_100021893
2879	Ga0070680_100045032
2880	Ga0070680_100101595
2881	Ga0070680_100126061
2882	Ga0070680_100315981
2883	Ga0070682_100001195
2884	Ga0070682_100034028
2885	Ga0070682_100229762
2886	Ga0070682_100336274
2887	Ga0068868_100002373
2888	Ga0068868_100054989
2889	Ga0068868_100154727
2890	Ga0068868_100221909
2891	Ga0070660_100001856
2892	Ga0070660_100009056
2893	Ga0070660_100012544
2894	Ga0070660_100012919
2895	Ga0070660_100122651
2896	Ga0070660_100366070
2897	Ga0070689_100002355
2898	Ga0070689_100015433
2899	Ga0070689_100148307
2900	Ga0070689_100192655
2901	Ga0070691_10000101
2902	Ga0070691_10018986
2903	Ga0070691_10024622
2904	Ga0070687_100000662
2905	Ga0070687_100091090
2906	Ga0070661_100001285
2907	Ga0070661_100142603
2908	Ga0070661_100150669
2909	Ga0070661_100190163
2910	Ga0070692_10000014
2911	Ga0070692_10339636
2912	Ga0070692_10456864
2913	Ga0070668_100000629
2914	Ga0070668_100221590
2915	Ga0070668_100261828
2916	Ga0070668_100316534
2917	Ga0070668_100443698
2918	Ga0070668_101013713
2919	Ga0070669_100000289
2920	Ga0070669_100073209
2921	Ga0070669_100349167
2922	Ga0070675_100000501
2923	Ga0070675_100027784
2924	Ga0070675_100125329
2925	Ga0070675_100205094
2926	Ga0070675_100504051
2927	Ga0070671_100001647
2928	Ga0070671_100006150
2929	Ga0070671_100017504
2930	Ga0070671_100090568
2931	Ga0070671_100169969
2932	Ga0070671_100174257
2933	Ga0070671_100358752
2934	Ga0070674_100000392
2935	Ga0070674_100053579
2936	Ga0070674_100583487
2937	Ga0070674_100638859
2938	Ga0070673_100001752
2939	Ga0070673_100021295
2940	Ga0070673_100034218
2941	Ga0070673_100176883
2942	Ga0070688_100001270
2943	Ga0070688_100024224
2944	Ga0070688_100035642
2945	Ga0070688_100059018
2946	Ga0070659_100001872
2947	Ga0070659_100022353
2948	Ga0070659_100028298
2949	Ga0070659_100119531
2950	Ga0070659_100161441
2951	Ga0070659_100244076
2952	Ga0070667_100002667
2953	Ga0070667_100013419
2954	Ga0070667_100099525
2955	Ga0070667_100113981
2956	Ga0070667_100122223
2957	Ga0070667_100343148
2958	Ga0070709_10000584
2959	Ga0070709_10002047
2960	Ga0070709_10039065
2961	Ga0070714_100004130
2962	Ga0070714_100008856
2963	Ga0070714_100014031
2964	Ga0070714_100024145
2965	Ga0070714_100086890
2966	Ga0070714_100185039
2967	Ga0070714_100403813
2968	Ga0070714_100611988
2969	Ga0070713_100000749
2970	Ga0070713_100002056
2971	Ga0070713_100002424
2972	Ga0070713_100007367
2973	Ga0070713_100078945
2974	Ga0070713_100181510
2975	Ga0070713_100193403
2976	Ga0070713_100276203
2977	Ga0070713_100325261
2978	Ga0070713_100507263
2979	Ga0070713_100882792
2980	Ga0070713_101124307
2981	Ga0070710_10001359
2982	Ga0070710_10001602
2983	Ga0070710_10002631
2984	Ga0070710_10013215
2985	Ga0070710_10022987
2986	Ga0070701_10000008
2987	Ga0070711_100002340
2988	Ga0070711_100018919
2989	Ga0070711_100026383
2990	Ga0070711_100043573
2991	Ga0070711_100065687
2992	Ga0070711_100131605
2993	Ga0070711_100253326
2994	Ga0070705_100001317
2995	Ga0070705_100016215
2996	Ga0070705_100026359
2997	Ga0070705_100886168
2998	Ga0070700_100000486
2999	Ga0070700_100005870
3000	Ga0070700_100249010
3001	Ga0070700_100498042
3002	Ga0070700_100794326
3003	Ga0070700_100856294
3004	Ga0070694_100000463
3005	Ga0070694_100185683
3006	Ga0070708_100162822
3007	Ga0070708_100416083
3008	Ga0070663_100000944
3009	Ga0070663_100007267
3010	Ga0070663_100083279
3011	Ga0070663_100115225
3012	Ga0070663_100116311
3013	Ga0070663_100238764
3014	Ga0070663_100781379
3015	Ga0070678_100002870
3016	Ga0070678_100079882
3017	Ga0070678_100327703
3018	Ga0070678_100415488
3019	Ga0070678_100946185
3020	Ga0070662_100002420
3021	Ga0070662_100004831
3022	Ga0070662_100137112
3023	Ga0070662_100185399
3024	Ga0070662_100330203
3025	Ga0070662_100392811
3026	Ga0070681_10002062
3027	Ga0070681_10007607
3028	Ga0070681_10038172
3029	Ga0070681_10039716
3030	Ga0070681_10046167
3031	Ga0070681_10058550
3032	Ga0070681_10075830
3033	Ga0070681_10097121
3034	Ga0070681_10113825
3035	Ga0070681_10352694
3036	Ga0068867_100000303
3037	Ga0068867_100208097
3038	Ga0068867_100391587
3039	Ga0068867_100516836
3040	Ga0070685_10001417
3041	Ga0070685_10003573
3042	Ga0070685_10027913
3043	Ga0070685_10403940
3044	Ga0070685_10456642
3045	Ga0070698_100155406
3046	Ga0070679_100005343
3047	Ga0070679_100032033
3048	Ga0070679_100039539
3049	Ga0070679_100043536
3050	Ga0070679_100217121
3051	Ga0070679_100242504
3052	Ga0070679_100279839
3053	Ga0070679_100356179
3054	Ga0070679_100638063
3055	Ga0070684_100001817
3056	Ga0070684_100006680
3057	Ga0070684_100018170
3058	Ga0070684_100030415
3059	Ga0070684_100086425
3060	Ga0070684_100617971
3061	Ga0068853_100000726
3062	Ga0068853_100005594
3063	Ga0068853_100010459
3064	Ga0068853_100041526
3065	Ga0068853_100065184
3066	Ga0068853_100135742
3067	Ga0068853_100250980
3068	Ga0068853_100270085
3069	Ga0068853_100294942
3070	Ga0068853_100301278
3071	Ga0068853_100451228
3072	Ga0068853_100514078
3073	Ga0068853_100529599
3074	Ga0068853_100628400
3075	Ga0070672_100000469
3076	Ga0070672_100483374
3077	Ga0070672_100492236
3078	Ga0070672_100646984
3079	Ga0070686_100002391
3080	Ga0070686_100005540
3081	Ga0070686_100160573
3082	Ga0070686_100213643
3083	Ga0070695_100524403
3084	Ga0070696_100002292
3085	Ga0070693_100000411
3086	Ga0070693_100164323
3087	Ga0070693_100169275
3088	Ga0070693_100236785
3089	Ga0070693_100278578
3090	Ga0070693_100449517
3091	Ga0070693_100845515
3092	Ga0070665_100061030
3093	Ga0070665_100182052
3094	Ga0070665_100218270
3095	Ga0070665_100266384
3096	Ga0070665_100274196
3097	Ga0070665_100364948
3098	Ga0070665_100731556
3099	Ga0070665_101517015
3100	Ga0070704_100002020
3101	Ga0070704_100070760
3102	Ga0068855_100006336
3103	Ga0068855_100033421
3104	Ga0068855_100045265
3105	Ga0068855_100100694
3106	Ga0068855_100129932
3107	Ga0068855_100138570
3108	Ga0068855_100167826
3109	Ga0068855_100273082
3110	Ga0068855_100649029
3111	Ga0068855_100686775
3112	Ga0068855_100931150
3113	Ga0068855_101132738
3114	Ga0070664_100001745
3115	Ga0070664_100019262
3116	Ga0070664_100152355
3117	Ga0070664_100202509
3118	Ga0070664_100247252
3119	Ga0070664_100250334
3120	Ga0070664_100328725
3121	Ga0068857_100013105
3122	Ga0068857_100026860
3123	Ga0068857_100106987
3124	Ga0068857_100128570
3125	Ga0068857_100213611
3126	Ga0068857_100366785
3127	Ga0068854_100000761
3128	Ga0068854_100003752
3129	Ga0068854_100008844
3130	Ga0068854_100176251
3131	Ga0068854_100316169
3132	Ga0068856_100003904
3133	Ga0068856_100006298
3134	Ga0068856_100011349
3135	Ga0068856_100108247
3136	Ga0068856_100222198
3137	Ga0068856_100281482
3138	Ga0068856_100380417
3139	Ga0068856_100586776
3140	Ga0068856_100633923
3141	Ga0070702_100000661
3142	Ga0070702_100005669
3143	Ga0070702_100232920
3144	Ga0068852_100000151
3145	Ga0068852_100030996
3146	Ga0068852_100059203
3147	Ga0068852_100060314
3148	Ga0068852_100060856
3149	Ga0068852_100119230
3150	Ga0068852_100257643
3151	Ga0068852_100640631
3152	Ga0068859_100004424
3153	Ga0068859_100054214
3154	Ga0068859_100064554
3155	Ga0068859_100288995
3156	Ga0068859_100346894
3157	Ga0068859_100488384
3158	Ga0068864_100001020
3159	Ga0068864_100236672
3160	Ga0068864_100366012
3161	Ga0068864_100489617
3162	Ga0068864_100747726
3163	Ga0068866_10000049
3164	Ga0068866_10575712
3165	Ga0068861_100000471
3166	Ga0068861_100026621
3167	Ga0068861_100220611
3168	Ga0068861_100247641
3169	Ga0068861_100449421
3170	Ga0068861_100479896
3171	Ga0068851_10000408
3172	Ga0068851_10339185
3173	Ga0068870_10001002
3174	Ga0068870_10524279
3175	Ga0068870_10600751
3176	Ga0068863_100000418
3177	Ga0068863_100127017
3178	Ga0068863_100324191
3179	Ga0068863_100773002
3180	Ga0068858_100002238
3181	Ga0068858_100144409
3182	Ga0068858_100242248
3183	Ga0068858_100306658
3184	Ga0068858_100386104
3185	Ga0068858_100565262
3186	Ga0068860_100000835
3187	Ga0068860_100002578
3188	Ga0068860_100101237
3189	Ga0068860_100280720
3190	Ga0068860_101013002
3191	Ga0068862_100001613
3192	Ga0068862_100028043
3193	Ga0068862_100140132
3194	Ga0068862_100183444
3195	Ga0068862_100317800
3196	Ga0068862_100719700
3197	Ga0068862_101006350
3198	Ga0081455_10007101
3199	Ga0081455_10012686
3200	Ga0081455_10030923
3201	Ga0081455_10034429
3202	Ga0081455_10050365
3203	Ga0081455_10150940
3204	Ga0081455_10169092
3205	Ga0081538_10044577
3206	Ga0081538_10067457
3207	Ga0081540_1002549
3208	Ga0081540_1003522
3209	Ga0081540_1005183
3210	Ga0081540_1009347
3211	Ga0081540_1012550
3212	Ga0081540_1015783
3213	Ga0081540_1018894
3214	Ga0081540_1064448
3215	Ga0081540_1067154
3216	Ga0081540_1075387
3217	Ga0081539_10002259
3218	Ga0081539_10033245
3219	Ga0081539_10096710
3220	Ga0070717_10000598
3221	Ga0070717_10001460
3222	Ga0070717_10023337
3223	Ga0070717_10067526
3224	Ga0070717_10169579
3225	Ga0070717_10236685
3226	Ga0070717_10372929
3227	Ga0070717_10618328
3228	Ga0075365_10018847
3229	Ga0075365_10087003
3230	Ga0075365_10198978
3231	Ga0075365_10487224
3232	Ga0075368_10005988
3233	Ga0075368_10022450
3234	Ga0075368_10222703
3235	Ga0075363_100008692
3236	Ga0075363_100013057
3237	Ga0075363_100018701
3238	Ga0075363_100050670
3239	Ga0075363_100148193
3240	Ga0075363_100177600
3241	Ga0075363_100405367
3242	Ga0075364_10507009
3243	Ga0070715_10001673
3244	Ga0070715_10037875
3245	Ga0070715_10056817
3246	Ga0070716_100011397
3247	Ga0070716_100077216
3248	Ga0070712_100034599
3249	Ga0070712_100043417
3250	Ga0070712_100070281
3251	Ga0070712_100085273
3252	Ga0070712_100132241
3253	Ga0070712_100182425
3254	Ga0075362_10180907
3255	Ga0075367_10003520
3256	Ga0075367_10007715
3257	Ga0075367_10092705
3258	Ga0075367_10208621
3259	Ga0075369_10194794
3260	Ga0097621_100000012
3261	Ga0097621_100025865
3262	Ga0097621_100081753
3263	Ga0097621_100395532
3264	Ga0075370_10031153
3265	Ga0075370_10138880
3266	Ga0068871_100000611
3267	Ga0068871_100013433
3268	Ga0068871_100068569
3269	Ga0075428_100109695
3270	Ga0075428_100204376
3271	Ga0075428_100351720
3272	Ga0075428_100508019
3273	Ga0075428_100586767
3274	Ga0075428_100701598
3275	Ga0075430_100068552
3276	Ga0075430_100273896
3277	Ga0075430_100280233
3278	Ga0075431_100138032
3279	Ga0075431_100486813
3280	Ga0075431_101015306
3281	Ga0075433_10002873
3282	Ga0075433_10007157
3283	Ga0075433_10183351
3284	Ga0075433_10267280
3285	Ga0075433_10319059
3286	Ga0075434_100000193
3287	Ga0075434_100009281
3288	Ga0075434_100029193
3289	Ga0075434_100123660
3290	Ga0075434_100294096
3291	Ga0075434_100454210
3292	Ga0075434_100568225
3293	Ga0075434_100609365
3294	Ga0075429_100165702
3295	Ga0068865_100002025
3296	Ga0068865_100424799
3297	Ga0068865_100580964
3298	Ga0075436_100124340
3299	Ga0075436_100320201
3300	Ga0075436_100534075
3301	Ga0097620_100004424
3302	Ga0097620_100054213
3303	Ga0097620_100064555
3304	Ga0097620_100288971
3305	Ga0097620_100346884
3306	Ga0097620_100488408
3307	Ga0099824_1014421
3308	Ga0099822_1000827
3309	Ga0075435_100044405
3310	Ga0075435_100099462
3311	Ga0105251_10018764
3312	Ga0105251_10070658
3313	Ga0105250_10015189
3314	Ga0105240_10003692
3315	Ga0105240_10006014
3316	Ga0105240_10048039
3317	Ga0105240_10058527
3318	Ga0105240_10058928
3319	Ga0105240_10070189
3320	Ga0105240_10109244
3321	Ga0105240_10232402
3322	Ga0105240_10245972
3323	Ga0105240_10744111
3324	Ga0111539_10000679
3325	Ga0111539_10010362
3326	Ga0111539_10011215
3327	Ga0111539_10088267
3328	Ga0111539_10138586
3329	Ga0111539_10239235
3330	Ga0111539_10530365
3331	Ga0111539_10627783
3332	Ga0111539_10890893
3333	Ga0105245_10000090
3334	Ga0105245_10157389
3335	Ga0105245_10214346
3336	Ga0105245_10531198
3337	Ga0105245_10870436
3338	Ga0105245_11264432
3339	Ga0105245_11448833
3340	Ga0105247_10002243
3341	Ga0105247_10011628
3342	Ga0105247_10048692
3343	Ga0105247_10121211
3344	Ga0105247_10129165
3345	Ga0114129_10006668
3346	Ga0114129_10027853
3347	Ga0105243_10003044
3348	Ga0105243_10059907
3349	Ga0105243_10125743
3350	Ga0105243_10415639
3351	Ga0105243_10550675
3352	Ga0105243_10691520
3353	Ga0105243_11000428
3354	Ga0105243_11328402
3355	Ga0105241_10003924
3356	Ga0105241_10019512
3357	Ga0105241_10031270
3358	Ga0105241_10037882
3359	Ga0105241_10073022
3360	Ga0105241_10129938
3361	Ga0105241_10495888
3362	Ga0105242_10005355
3363	Ga0105242_10023846
3364	Ga0105242_11069294
3365	Ga0105248_10003797
3366	Ga0105248_10004778
3367	Ga0105248_10035792
3368	Ga0105248_10636921
3369	Ga0105248_10698214
3370	Ga0105237_10004589
3371	Ga0105237_10027348
3372	Ga0105237_10075926
3373	Ga0105237_10109729
3374	Ga0105237_10135650
3375	Ga0105237_10212365
3376	Ga0105237_10260777
3377	Ga0105237_10450079
3378	Ga0105237_10584688
3379	Ga0105238_10005022
3380	Ga0105238_10007571
3381	Ga0105238_10073433
3382	Ga0105238_10099826
3383	Ga0105238_10108677
3384	Ga0105238_10142764
3385	Ga0105238_10344930
3386	Ga0105249_10001085
3387	Ga0105249_10004401
3388	Ga0105249_10405875
3389	Ga0105249_10519751
3390	Ga0105249_10616242
3391	Ga0105249_10859107
3392	Ga0099796_10001099
3393	Ga0099796_10057533
3394	Ga0099796_10063315
3395	Ga0105239_10024639
3396	Ga0105239_10041875
3397	Ga0105239_10081881
3398	Ga0105239_10082895
3399	Ga0105239_10095813
3400	Ga0105239_10196081
3401	Ga0105239_10335492
3402	Ga0105239_10773310
3403	Ga0105246_10000052
3404	Ga0105246_10119144
3405	Ga0105246_10136861
3406	Ga0105246_10171964
3407	Ga0105246_10192529
3408	Ga0105246_10233457
3409	Ga0105246_10421474
3410	Ga0105246_10829235
3411	Ga0105246_11215663
3412	Ga0157343_1004133
3413	Ga0157335_1006798
3414	Ga0157341_1006251
3415	Ga0157313_1012619
3416	Ga0157313_1014166
3417	Ga0157342_1007304
3418	Ga0157373_10038620
3419	Ga0157373_10388979
3420	Ga0157373_10454944
3421	Ga0157371_10003401
3422	Ga0157371_10190487
3423	Ga0157370_10090465
3424	Ga0157370_10091836
3425	Ga0157370_10226000
3426	Ga0157369_10001511
3427	Ga0157369_10034718
3428	Ga0157369_10095205
3429	Ga0157369_10141449
3430	Ga0157369_10177553
3431	Ga0157374_10001210
3432	Ga0157374_10033000
3433	Ga0157374_10082621
3434	Ga0157374_10085571
3435	Ga0157374_10123455
3436	Ga0157374_11053254
3437	Ga0157374_11268623
3438	Ga0157378_10002713
3439	Ga0157378_10026970
3440	Ga0157378_10071984
3441	Ga0157378_10204429
3442	Ga0157378_10411100
3443	Ga0157378_10626389
3444	Ga0163162_10000308
3445	Ga0163162_10725450
3446	Ga0163162_11617318
3447	Ga0157372_10002370
3448	Ga0157372_10083580
3449	Ga0157372_10207062
3450	Ga0157372_10599237
3451	Ga0157372_10803404
3452	Ga0157372_11165579
3453	Ga0157372_11182252
3454	Ga0157375_10027778
3455	Ga0157375_10052612
3456	Ga0157375_10274068
3457	Ga0163163_10002008
3458	Ga0163163_10002377
3459	Ga0163163_10103930
3460	Ga0163163_10344325
3461	Ga0163163_10405781
3462	Ga0163163_10406571
3463	Ga0163163_10505709
3464	Ga0163163_10696394
3465	Ga0163163_11169781
3466	Ga0157380_10000122
3467	Ga0157380_10034627
3468	Ga0157380_10417771
3469	Ga0157380_10454794
3470	Ga0182008_10064722
3471	Ga0182008_10227460
3472	Ga0157377_10000996
3473	Ga0157377_10365293
3474	Ga0157379_10000261
3475	Ga0157379_10015326
3476	Ga0157379_10126224
3477	Ga0157379_10239561
3478	Ga0157379_10250504
3479	Ga0157379_10267297
3480	Ga0157379_10310121
3481	Ga0157379_10531500
3482	Ga0157379_10609705
3483	Ga0157376_10033090
3484	Ga0157376_10221869
3485	Ga0163161_10000199
3486	Ga0163161_10420872
3487	Ga0163161_10838685
3488	Ga0206354_10371782
3489	Ga0206353_10910564
3490	Ga0214544_1000016
3491	Ga0214544_1032668
3492	Ga0214542_1000016
3493	Ga0214545_1000008
3494	Ga0214545_1038742
3495	Ga0214543_1001466
3496	Ga0213872_10011243
3497	Ga0213872_10078139
3498	Ga0213874_10004209
3499	Ga0213874_10008008
3500	Ga0213876_10018184
3501	Ga0213876_10107392
3502	Ga0213876_10137374
3503	Ga0213871_10037183
3504	Ga0224712_10109068
3505	Ga0224572_1021438
3506	Ga0228598_1011365
3507	Ga0209563_105644
3508	Ga0209677_101536
3509	Ga0209677_101892
3510	Ga0209148_1000275
3511	Ga0209233_1007954
3512	Ga0209233_1014430
3513	Ga0209233_1019817
3514	Ga0207666_1000105
3515	Ga0209455_1001363
3516	Ga0209455_1002070
3517	Ga0209673_1069235
3518	Ga0207673_1000602
3519	Ga0209564_1006362
3520	Ga0209758_1000069
3521	Ga0209758_1000635
3522	Ga0209758_1000695
3523	Ga0209758_1006620
3524	Ga0209758_1008516
3525	Ga0209758_1017993
3526	Ga0209758_1102205
3527	Ga0209256_1006920
3528	Ga0209256_1010781
3529	Ga0209256_1026394
3530	Ga0207426_1000826
3531	Ga0207426_1002297
3532	Ga0207426_1005144
3533	Ga0209051_1070417
3534	Ga0209257_1000473
3535	Ga0207697_10001388
3536	Ga0207697_10001632
3537	Ga0207697_10019378
3538	Ga0207656_10000909
3539	Ga0207656_10209532
3540	Ga0207653_10006165
3541	Ga0207653_10007363
3542	Ga0207682_10000042
3543	Ga0207692_10001284
3544	Ga0207692_10008079
3545	Ga0207692_10015342
3546	Ga0207692_10040580
3547	Ga0207692_10321308
3548	Ga0207642_10000065
3549	Ga0207710_10000734
3550	Ga0207710_10001358
3551	Ga0207710_10014083
3552	Ga0207710_10022169
3553	Ga0207710_10136068
3554	Ga0207710_10194890
3555	Ga0207688_10000053
3556	Ga0207680_10009595
3557	Ga0207680_10075958
3558	Ga0207647_10002277
3559	Ga0207647_10002478
3560	Ga0207647_10038999
3561	Ga0207685_10005136
3562	Ga0207685_10018372
3563	Ga0207699_10001061
3564	Ga0207699_10002409
3565	Ga0207699_10007678
3566	Ga0207699_10017623
3567	Ga0207699_10020586
3568	Ga0207699_10043414
3569	Ga0207699_10048715
3570	Ga0207699_10091984
3571	Ga0207699_10148040
3572	Ga0207645_10002934
3573	Ga0207645_10038584
3574	Ga0207645_10223024
3575	Ga0207645_10342197
3576	Ga0207643_10000082
3577	Ga0207643_10341461
3578	Ga0207705_10125785
3579	Ga0207705_10213923
3580	Ga0207705_10376588
3581	Ga0207684_10072422
3582	Ga0207654_10000341
3583	Ga0207654_10003143
3584	Ga0207654_10061554
3585	Ga0207654_10095007
3586	Ga0207654_10448894
3587	Ga0207707_10000100
3588	Ga0207707_10004287
3589	Ga0207707_10005522
3590	Ga0207707_10030069
3591	Ga0207707_10030393
3592	Ga0207707_10058072
3593	Ga0207707_10140830
3594	Ga0207707_10204133
3595	Ga0207707_10237025
3596	Ga0207707_10284223
3597	Ga0207707_10475865
3598	Ga0207707_10770601
3599	Ga0207695_10000107
3600	Ga0207695_10000453
3601	Ga0207695_10021123
3602	Ga0207695_10033190
3603	Ga0207695_10104625
3604	Ga0207695_10165664
3605	Ga0207695_10255092
3606	Ga0207695_10364668
3607	Ga0207695_10498337
3608	Ga0207695_10940911
3609	Ga0207671_10009240
3610	Ga0207671_10020910
3611	Ga0207671_10036979
3612	Ga0207671_10101355
3613	Ga0207671_10113801
3614	Ga0207671_10131296
3615	Ga0207671_10146359
3616	Ga0207671_10210714
3617	Ga0207671_10271557
3618	Ga0207671_10371457
3619	Ga0207671_10578122
3620	Ga0207693_10003195
3621	Ga0207693_10003559
3622	Ga0207693_10006870
3623	Ga0207693_10110346
3624	Ga0207693_10151462
3625	Ga0207693_10189196
3626	Ga0207693_10266053
3627	Ga0207693_10620738
3628	Ga0207663_10000404
3629	Ga0207663_10005157
3630	Ga0207663_10007470
3631	Ga0207663_10017529
3632	Ga0207663_10236115
3633	Ga0207660_10000083
3634	Ga0207660_10001366
3635	Ga0207660_10038196
3636	Ga0207660_10119066
3637	Ga0207660_10165050
3638	Ga0207660_10260726
3639	Ga0207660_10389355
3640	Ga0207662_10000989
3641	Ga0207662_10055979
3642	Ga0207662_10074498
3643	Ga0207657_10004153
3644	Ga0207657_10004786
3645	Ga0207657_10008044
3646	Ga0207657_10014940
3647	Ga0207657_10073412
3648	Ga0207657_10115685
3649	Ga0207657_10135181
3650	Ga0207657_10171286
3651	Ga0207657_10250051
3652	Ga0207649_10000643
3653	Ga0207649_10101258
3654	Ga0207649_10221979
3655	Ga0207652_10000557
3656	Ga0207652_10001889
3657	Ga0207652_10002952
3658	Ga0207652_10030169
3659	Ga0207652_10031974
3660	Ga0207652_10040820
3661	Ga0207652_10219577
3662	Ga0207652_10240986
3663	Ga0207652_10273893
3664	Ga0207652_10456051
3665	Ga0207652_10549136
3666	Ga0207652_10663154
3667	Ga0207646_10140083
3668	Ga0207681_10000271
3669	Ga0207681_10029377
3670	Ga0207681_10065884
3671	Ga0207681_10111785
3672	Ga0207681_10646783
3673	Ga0207694_10001512
3674	Ga0207694_10002704
3675	Ga0207694_10006429
3676	Ga0207694_10075818
3677	Ga0207694_10082295
3678	Ga0207694_10106951
3679	Ga0207694_10245655
3680	Ga0207694_10377039
3681	Ga0207694_10404352
3682	Ga0207650_10006111
3683	Ga0207650_10007967
3684	Ga0207650_10132246
3685	Ga0207650_10343847
3686	Ga0207659_10000161
3687	Ga0207659_10000460
3688	Ga0207659_10071731
3689	Ga0207659_10153808
3690	Ga0207659_10183090
3691	Ga0207659_10784047
3692	Ga0207687_10000063
3693	Ga0207687_10039457
3694	Ga0207687_10104991
3695	Ga0207687_10469445
3696	Ga0207687_10697452
3697	Ga0207700_10001725
3698	Ga0207700_10003639
3699	Ga0207700_10005508
3700	Ga0207700_10019767
3701	Ga0207700_10028048
3702	Ga0207700_10059459
3703	Ga0207700_10075892
3704	Ga0207700_10120590
3705	Ga0207700_10303613
3706	Ga0207700_10391688
3707	Ga0207700_10431039
3708	Ga0207700_10765219
3709	Ga0207700_10780121
3710	Ga0207664_10005345
3711	Ga0207664_10012728
3712	Ga0207664_10017118
3713	Ga0207664_10019486
3714	Ga0207664_10049710
3715	Ga0207664_10245761
3716	Ga0207664_10350388
3717	Ga0207644_10000591
3718	Ga0207644_10005027
3719	Ga0207644_10020869
3720	Ga0207644_10039521
3721	Ga0207644_10093923
3722	Ga0207644_10130097
3723	Ga0207644_10230971
3724	Ga0207644_10485231
3725	Ga0207644_10700440
3726	Ga0207690_10000897
3727	Ga0207690_10012047
3728	Ga0207690_10057304
3729	Ga0207690_10061857
3730	Ga0207690_10205631
3731	Ga0207690_10236616
3732	Ga0207690_10276387
3733	Ga0207706_10004384
3734	Ga0207706_10006410
3735	Ga0207706_10012728
3736	Ga0207706_10031159
3737	Ga0207706_10138887
3738	Ga0207706_10260866
3739	Ga0207706_10707175
3740	Ga0207686_10000614
3741	Ga0207686_10324033
3742	Ga0207709_10000429
3743	Ga0207709_10032140
3744	Ga0207709_10048634
3745	Ga0207709_10140044
3746	Ga0207670_10000485
3747	Ga0207670_10058924
3748	Ga0207669_10000019
3749	Ga0207669_10017263
3750	Ga0207669_10080009
3751	Ga0207669_10198116
3752	Ga0207669_10241402
3753	Ga0207669_10661434
3754	Ga0207669_10730195
3755	Ga0207704_10004559
3756	Ga0207704_10714084
3757	Ga0207665_10001034
3758	Ga0207665_10004382
3759	Ga0207665_10043812
3760	Ga0207665_10051444
3761	Ga0207665_10297966
3762	Ga0207665_10349423
3763	Ga0207665_10358539
3764	Ga0207665_10542837
3765	Ga0207665_10632815
3766	Ga0207691_10004668
3767	Ga0207691_10303183
3768	Ga0207691_10351246
3769	Ga0207691_10442956
3770	Ga0207691_10476302
3771	Ga0207691_10669490
3772	Ga0207711_10009466
3773	Ga0207711_10031429
3774	Ga0207711_10242333
3775	Ga0207711_10426052
3776	Ga0207711_10527228
3777	Ga0207711_10689337
3778	Ga0207689_10001364
3779	Ga0207689_10262663
3780	Ga0207689_10550363
3781	Ga0207689_10744764
3782	Ga0207661_10000281
3783	Ga0207661_10006554
3784	Ga0207661_10007064
3785	Ga0207661_10010090
3786	Ga0207679_10000026
3787	Ga0207679_10095346
3788	Ga0207679_10110177
3789	Ga0207679_10118749
3790	Ga0207679_10158661
3791	Ga0207679_10251683
3792	Ga0207679_10381079
3793	Ga0207667_10002324
3794	Ga0207667_10004064
3795	Ga0207667_10007600
3796	Ga0207667_10015590
3797	Ga0207667_10043137
3798	Ga0207667_10067257
3799	Ga0207667_10126419
3800	Ga0207667_10652603
3801	Ga0207667_10690693
3802	Ga0207651_10000101
3803	Ga0207651_10016951
3804	Ga0207651_10129801
3805	Ga0207651_10152310
3806	Ga0207712_10000908
3807	Ga0207712_10039033
3808	Ga0207712_10155086
3809	Ga0207712_10191767
3810	Ga0207712_10243597
3811	Ga0207712_10380492
3812	Ga0207712_10700924
3813	Ga0207668_10000726
3814	Ga0207668_10119178
3815	Ga0207668_10145280
3816	Ga0207668_10193823
3817	Ga0207668_10200311
3818	Ga0207668_10276534
3819	Ga0207668_10282609
3820	Ga0207640_10000596
3821	Ga0207640_10034701
3822	Ga0207640_10080170
3823	Ga0207640_10259139
3824	Ga0207658_10008906
3825	Ga0207658_10028857
3826	Ga0207658_10072998
3827	Ga0207658_10098069
3828	Ga0207677_10000651
3829	Ga0207677_10127552
3830	Ga0207703_10001717
3831	Ga0207703_10035069
3832	Ga0207703_10078142
3833	Ga0207703_10588283
3834	Ga0207703_10661403
3835	Ga0207639_10002467
3836	Ga0207639_10009146
3837	Ga0207639_10033329
3838	Ga0207639_10058662
3839	Ga0207639_10127731
3840	Ga0207639_10242186
3841	Ga0207639_10319160
3842	Ga0207639_10397411
3843	Ga0207678_10002308
3844	Ga0207678_10003998
3845	Ga0207678_10014165
3846	Ga0207678_10069768
3847	Ga0207678_10073693
3848	Ga0207678_10088949
3849	Ga0207678_10121226
3850	Ga0207678_10236693
3851	Ga0207678_10260684
3852	Ga0207678_10262057
3853	Ga0207708_10002606
3854	Ga0207708_10003659
3855	Ga0207708_10095163
3856	Ga0207708_10312865
3857	Ga0207708_11010123
3858	Ga0207702_10000004
3859	Ga0207702_10008573
3860	Ga0207702_10011218
3861	Ga0207702_10046751
3862	Ga0207702_10136551
3863	Ga0207702_10509343
3864	Ga0207641_10002162
3865	Ga0207641_10152915
3866	Ga0207641_10427024
3867	Ga0207641_10432374
3868	Ga0207641_10496776
3869	Ga0207641_10508572
3870	Ga0207648_10003986
3871	Ga0207648_10022099
3872	Ga0207648_10043824
3873	Ga0207648_10227698
3874	Ga0207648_10758961
3875	Ga0207648_10794980
3876	Ga0207676_10000563
3877	Ga0207676_10147248
3878	Ga0207676_10421936
3879	Ga0207676_10573009
3880	Ga0207676_10789750
3881	Ga0207676_10837167
3882	Ga0207674_10000890
3883	Ga0207674_10004798
3884	Ga0207674_10007670
3885	Ga0207674_10017171
3886	Ga0207674_10046238
3887	Ga0207674_10065909
3888	Ga0207674_10102592
3889	Ga0207674_10305663
3890	Ga0207674_11099974
3891	Ga0207675_100004624
3892	Ga0207675_100006125
3893	Ga0207675_100114943
3894	Ga0207675_100176776
3895	Ga0207675_100330734
3896	Ga0207675_100857017
3897	Ga0207683_10000324
3898	Ga0207683_10004461
3899	Ga0207683_10111418
3900	Ga0207683_10115944
3901	Ga0207683_10128189
3902	Ga0207683_10244893
3903	Ga0207683_10441989
3904	Ga0207683_10717431
3905	Ga0207683_10781664
3906	Ga0207698_10000634
3907	Ga0207698_10006435
3908	Ga0207698_10017851
3909	Ga0207698_10229818
3910	Ga0207698_10319859
3911	Ga0207698_10497569
3912	Ga0207698_10678663
3913	Ga0209389_1000033
3914	Ga0209389_1000182
3915	Ga0209589_1000021
3916	Ga0209589_1000040
3917	Ga0209489_100028
3918	Ga0209489_100045
3919	Ga0209489_100209
3920	Ga0209700_100011
3921	Ga0209700_100037
3922	Ga0209179_1005574
3923	Ga0209588_1017691
3924	Ga0209971_1004317
3925	Ga0209971_1032528
3926	Ga0209966_1000958
3927	Ga0209998_10001202
3928	Ga0209998_10002977
3929	Ga0209998_10008168
3930	Ga0209813_10005435
3931	Ga0209813_10039420
3932	Ga0209813_10049642
3933	Ga0209974_10002004
3934	Ga0209974_10012636
3935	Ga0209974_10077819
3936	Ga0207428_10000130
3937	Ga0207428_10009156
3938	Ga0265357_1000519
3939	Ga0268266_10006104
3940	Ga0268266_10014618
3941	Ga0268266_10040428
3942	Ga0268266_10099347
3943	Ga0268266_10156625
3944	Ga0268266_10219664
3945	Ga0268266_10230541
3946	Ga0268266_10249093
3947	Ga0268266_10460105
3948	Ga0268266_10529214
3949	Ga0268265_10018250
3950	Ga0268265_10028336
3951	Ga0268265_10044934
3952	Ga0268265_10052133
3953	Ga0268265_10107232
3954	Ga0268265_10134157
3955	Ga0268265_10210216
3956	Ga0268265_10507613
3957	Ga0268265_10657426
3958	Ga0268264_10000157
3959	Ga0268264_10003472
3960	Ga0268264_10107873
3961	Ga0268264_10117569
3962	Ga0268264_10176788
3963	Ga0268264_10409098
3964	Ga0268264_10521668
3965	Ga0265337_1001317
3966	Ga0265337_1013194
3967	Ga0265326_10006634
3968	Ga0265319_1022443
3969	Ga0265334_10023967
3970	Ga0265334_10029725
3971	Ga0265334_10052720
3972	Ga0265318_10014886
3973	Ga0265323_10005150
3974	Ga0265322_10017458
3975	Ga0265336_10003307
3976	Ga0307517_10001338
3977	Ga0307517_10223001
3978	Ga0307515_10036525
3979	Ga0307515_10489800
3980	Ga0265338_10000598
3981	Ga0265338_10088835
3982	Ga0265338_10490925
3983	Ga0265324_10005026
3984	Ga0307511_10053449
3985	Ga0265762_1046068
3986	Ga0265760_10149896
3987	Ga0265330_10016402
3988	Ga0265330_10181089
3989	Ga0265332_10002811
3990	Ga0265332_10095651
3991	Ga0265332_10241352
3992	Ga0265328_10000008
3993	Ga0265320_10160895
3994	Ga0265325_10000011
3995	Ga0265325_10000229
3996	Ga0265325_10017277
3997	Ga0265325_10017337
3998	Ga0265325_10018145
3999	Ga0265325_10086699
4000	Ga0265325_10122923
4001	Ga0265325_10218455
4002	Ga0265329_10036114
4003	Ga0265340_10003064
4004	Ga0265340_10102176
4005	Ga0265339_10000068
4006	Ga0265339_10039428
4007	Ga0265339_10065542
4008	Ga0265339_10088945
4009	Ga0265339_10183264
4010	Ga0265331_10001410
4011	Ga0265331_10002631
4012	Ga0265331_10010008
4013	Ga0265331_10019125
4014	Ga0265331_10024962
4015	Ga0265327_10190517
4016	Ga0265327_10198548
4017	Ga0265316_10000387
4018	Ga0265316_10019064
4019	Ga0307513_10158328
4020	Ga0307509_10052266
4021	Ga0307509_10414274
4022	Ga0307509_10541199
4023	Ga0307408_100086876
4024	Ga0307408_100147996
4025	Ga0307408_100383207
4026	Ga0307408_100405170
4027	Ga0265313_10000088
4028	Ga0265313_10000227
4029	Ga0265313_10009907
4030	Ga0265313_10082909
4031	Ga0307508_10000002
4032	Ga0307508_10097319
4033	Ga0307508_10128550
4034	Ga0307508_10153375
4035	Ga0307508_10389397
4036	Ga0316575_10164724
4037	Ga0265314_10003337
4038	Ga0265314_10007615
4039	Ga0265314_10015101
4040	Ga0265314_10037169
4041	Ga0265314_10041056
4042	Ga0265342_10000625
4043	Ga0265342_10003978
4044	Ga0265342_10034285
4045	Ga0265342_10090779
4046	Ga0265342_10113841
4047	Ga0265342_10128398
4048	Ga0265342_10158093
4049	Ga0316576_10262138
4050	Ga0307516_10008231
4051	Ga0307516_10055028
4052	Ga0307516_10189841
4053	Ga0307516_10210294
4054	Ga0307516_10291589
4055	Ga0307405_10176360
4056	Ga0307405_10365299
4057	Ga0307405_10649528
4058	Ga0307413_10130389
4059	Ga0307413_10261047
4060	Ga0307410_10164480
4061	Ga0307410_10354546
4062	Ga0307406_10172386
4063	Ga0307406_10418685
4064	Ga0307406_10668705
4065	Ga0307407_10007791
4066	Ga0307407_10085386
4067	Ga0307407_10787524
4068	Ga0307412_10250128
4069	Ga0307409_100081591
4070	Ga0307409_100194809
4071	Ga0307409_100420687
4072	Ga0307416_100142560
4073	Ga0307416_100602636
4074	Ga0307414_10165978
4075	Ga0307414_10784177
4076	Ga0307411_10044467
4077	Ga0307411_10080393
4078	Ga0307411_10239826
4079	Ga0307415_100343032
4080	Ga0307415_100381945
4081	Ga0316583_10003757
4082	Ga0316585_10037711
4083	Ga0307510_10001271
4084	Ga0307510_10014252
4085	Ga0307510_10021608
4086	Ga0307510_10406491
4087	Ga0315911_1000008
4088	Ga0373930_0009343
4089	Ga0373948_0005713
4090	Ga0373950_0019951
4091	Ga0373950_0036305
4092	Ga0373958_0002447
4093	Ga0373958_0041140
4094	Ga0373959_0009627
4095	Ga0373959_0032312
4096	Ga0373938_0000042
4097	Ga0373938_0001766
4098	Ga0373938_0035384
4099	Ga0373938_0052099
4100	Ga0373926_0025017
4101	Ga0373926_0052456
4102	Ga0373926_0064211
4103	Ga0373928_0011842
4104	Ga0373928_0076840
4105	Ga0373929_0001918
4106	Ga0373929_0019411
4107	Ga0373929_0096809
4108	Ga0373934_0005590
4109	Ga0373934_0013739
4110	Ga0373934_0068079
4111	Ga0373934_0153946
4112	Ga0373940_0008323
4113	Ga0373944_0030650
4114	Ga0373949_0001046
4115	Ga0373951_0000165
4116	Ga0373951_0002799
4117	Ga0373951_0004702
4118	Ga0373952_0000216
4119	Ga0373952_0045084
4120	Ga0373923_0019315
4121	Ga0373923_0039673
4122	Ga0373923_0105160
4123	Ga0373923_0105192
4124	Ga0373932_0000221
4125	Ga0373932_0001262
4126	Ga0373932_0009986
4127	Ga0373936_0021525
4128	Ga0373936_0070408
4129	Ga0373936_0107922
4130	Ga0373939_0000178
4131	Ga0373939_0004830
4132	Ga0373939_0019208
4133	Ga0373941_0000085
4134	Ga0373941_0000099
4135	Ga0373941_0000551
4136	Ga0373941_0024123
4137	Ga0373945_0007081
4138	Ga0373945_0017250
4139	Ga0373945_0021550
4140	Ga0373945_0059049
4141	Ga0373945_0113471
4142	Ga0373953_0071458
4143	Ga0373954_0001748
4144	Ga0373954_0003458
4145	Ga0373954_0015991
4146	Ga0373954_0048377
4147	Ga0373954_0239809
4148	Ga0373954_0260490
4149	Ga0373956_0006087
4150	Ga0373956_0006272
4151	Ga0373956_0011231
4152	Ga0373956_0042531
4153	Ga0373956_0047798
4154	Ga0373957_0002246
4155	Ga0373957_0003256
4156	Ga0373957_0012026
4157	Ga0373957_0032237
4158	Ga0373957_0043310
4159	Ga0373960_0000555
4160	Ga0373960_0003642
4161	Ga0373943_0013206
4162	Ga0373943_0023882
4163	Ga0373943_0024337
4164	Ga0373943_0046090
4165	Ga0373943_0089429
4166	Ga0373943_0126197
4167	Ga0373946_0008257
4168	Ga0373946_0023941
4169	Ga0373946_0038515
4170	Ga0373946_0085133
4171	Ga0373955_0001535
4172	Ga0373955_0005503
4173	Ga0373955_0008692
4174	Ga0373955_0079877
4175	Ga0373955_0116728
4176	Ga0373955_0121272
4177	Ga0373955_0215167
4178	Ga0373942_0001735
4179	Ga0373961_0003797
4180	Ga0373961_0005195
4181	Ga0373961_0090382
4182	Ga0373962_0001051
4183	Ga0373962_0005997
4184	Ga0373962_0082097
4185	Ga0373924_0006222
4186	Ga0373924_0021110
4187	Ga0373924_0036594
4188	Ga0373924_0070645
4189	Ga0373924_0086817
4190	Ga0373931_0003317
4191	Ga0373931_0006849
4192	Ga0373931_0011604
4193	Ga0373931_0035865
4194	Ga0373931_0163764
4195	Ga0373935_0006896
4196	Ga0373935_0025625
4197	Ga0373935_0046065
4198	Ga0373935_0054343
4199	Ga0373935_0153765
4200	Ga0373935_0291548
4201	Ga0373935_0295541
4202	Ga0373935_0329112
4203	Ga0373935_0631901
4204	Ga0373927_0001486
4205	Ga0373927_0001909
4206	Ga0373927_0008042
4207	Ga0373927_0021841
4208	Ga0373927_0025092
4209	Ga0373927_0041289
4210	Ga0373927_0049298
4211	Ga0373927_0079638
4212	Ga0373927_0139313
4213	Ga0373927_0172428
4214	Ga0373927_0177526
4215	Ga0373927_0230970
4216	Ga0373927_0233276
4217	Ga0373927_0314125
4218	Ga0373927_0524920
4219	Ga0373933_0000031
4220	Ga0373933_0002649
4221	Ga0373933_0004860
4222	Ga0373933_0005821
4223	Ga0373933_0027834
4224	Ga0373933_0030411
4225	Ga0373933_0050638
4226	Ga0373933_0080550
4227	Ga0373933_0087420
4228	Ga0373933_0136203
4229	Ga0373947_0001274
4230	Ga0373947_0003819
4231	Ga0373947_0014833
4232	Ga0373947_0016858
4233	Ga0373947_0088017
4234	Ga0373947_0157113
4235	Ga0373947_0204052
4236	Ga0373937_0000231
4237	Ga0373937_0002237
4238	Ga0373937_0021789
4239	Ga0373937_0022492
4240	Ga0373937_0024272
4241	Ga0373937_0030861
4242	Ga0373937_0056247
4243	Ga0373937_0095550
4244	Ga0373937_0185013
4245	Ga0373937_0257462
4246	Ga0316582_0213817
4247	Ga0316584_0037099
4248	Ga0373925_0001594
4249	Ga0373925_0019133
4250	Ga0373925_0030654
4251	Ga0373925_0039040
4252	Ga0373925_0048289
4253	Ga0373925_0055883
4254	Ga0373925_0057142
4255	Ga0373925_0064515
4256	Ga0373925_0436293
4257	Ga0395899_0070459
4258	Ga0395899_0218957
4259	Ga0395899_0361679
4260	Ga0395900_0010736
4261	Ga0395900_0019797
4262	Ga0395900_0134177
4263	Ga0395900_0242343
4264	Ga0395900_0247240
4265	Ga0395900_0278786
4266	Ga0395900_0436885
4267	Ga0395900_0643903
4268	Ga0395898_0006210
4269	Ga0395898_0016118
4270	Ga0395898_0030124
4271	Ga0395898_0044161
4272	Ga0395898_0050822
4273	Ga0395898_0093688
4274	Ga0395898_0165902
4275	Ga0395898_0219210
4276	Ga0395898_0321435
4277	Ga0395898_0559944
4278	Ga0395905_0001904
4279	Ga0395905_0123475
4280	Ga0395905_0240755
4281	Ga0395905_0307741
4282	Ga0436364_0146171
4283	Ga0436364_0282116
4284	Ga0436364_0898947
4285	Ga0436364_0933374
4286	Ga0436364_1276004
4287	Ga0436364_1362242
4288	Ga0395901_0002704
4289	Ga0395901_0005911
4290	Ga0395901_0021452
4291	Ga0395901_0022711
4292	Ga0395901_0049662
4293	Ga0395901_0105778
4294	Ga0395901_0304099
4295	Ga0395901_0760584
4296	Ga0436365_0584651
4297	Ga0436365_0587835
4298	Ga0436365_0830896
4299	Ga0436365_0940586
4300	Ga0436365_1140540
4301	Ga0436365_1154205
4302	Ga0436365_1194348
4303	Ga0436365_1477089
4304	Ga0436365_1621052
4305	Ga0436365_1707658
4306	Ga0436365_1779987
4307	Ga0436365_1896179
4308	Ga0436365_1924787
4309	Ga0436360_0091873
4310	Ga0436360_0159422
4311	Ga0436360_0830088
4312	Ga0436360_1291098
4313	Ga0436361_0998265
4314	Ga0436363_0320221
4315	Ga0436363_0435462
4316	Ga0436363_0720235
4317	Ga0436363_1422428
4318	Ga0436363_1527418
4319	Ga0436362_0847603
4320	Ga0436362_0890549
4321	Ga0439465_0011810
4322	Ga0439465_0036993
4323	Ga0451787_673092
4324	Ga0451833_0006471
4325	Ga0451833_0785209
4326	Ga0451839_0976358
4327	Ga0439441_056416
4328	Ga0439448_0042000
4329	Ga0439448_0082885
4330	Ga0439450_002734
4331	Ga0439463_026071
4332	Ga0439464_0006231
4333	Ga0451577_0039140
4334	Ga0466972_0000119
4335	Ga0466972_0020974
4336	Ga0466966_0000998
4337	Ga0466966_0098998
4338	Ga0466966_0115750
4339	Ga0466966_0124701
4340	Ga0466966_0385057
4341	Ga0466961_0000139
4342	Ga0466961_0121667
4343	Ga0466963_0007130
4344	Ga0466963_0048293
4345	Ga0466963_0145567
4346	Ga0466964_0120332
4347	Ga0466964_0146725
4348	Ga0453684_0453716
4349	Ga0466971_0061041
4350	Ga0466968_0052809
4351	Ga0466968_0303687
4352	Ga0466970_0047732
4353	Ga0466970_0264479
4354	Ga0466970_0327424
4355	Ga0466957_0095986
4356	Ga0466960_0017761
4357	Ga0466960_0093599
4358	Ga0466960_0096832
4359	Ga0466959_0006266
4360	Ga0466959_0009665
4361	Ga0466959_0016385
4362	Ga0466959_0152454
4363	Ga0451576_0019176
4364	Ga0451576_0127087
4365	Ga0451576_0982862
4366	Ga0466958_0101724
4367	Ga0466958_0105299
4368	Ga0466958_0301972
4369	Ga0466958_0425359
4370	Ga0466967_0006174
4371	Ga0466967_0284812
4372	Ga0466967_0340806
4373	Ga0466967_0671404
4374	Ga0495592_0001103
4375	Ga0495592_0012597
4376	Ga0495592_0016964
4377	Ga0495592_0020485
4378	Ga0495592_0055418
4379	Ga0495592_0082393
4380	Ga0495592_0085283
4381	Ga0495592_0102112
4382	Ga0495592_0112702
4383	Ga0495592_0312795
4384	Ga0495603_0000047
4385	Ga0495603_0003797
4386	Ga0495603_0006275
4387	Ga0495603_0036056
4388	Ga0495603_0040505
4389	Ga0495603_0171284
4390	Ga0495603_0185255
4391	Ga0495590_0099290
4392	Ga0495629_0000320
4393	Ga0495629_0000588
4394	Ga0495629_0001972
4395	Ga0495629_0008845
4396	Ga0495629_0011428
4397	Ga0495629_0076574
4398	Ga0495629_0106768
4399	Ga0495629_0225584
4400	Ga0495638_0014041
4401	Ga0495638_0162753
4402	Ga0495641_0003618
4403	Ga0495641_0015429
4404	Ga0495641_0035071
4405	Ga0495651_0001342
4406	Ga0495651_0003655
4407	Ga0495651_0041841
4408	Ga0495651_0042721
4409	Ga0495651_0044189
4410	Ga0495651_0152784
4411	Ga0495651_0152988
4412	Ga0495651_0230855
4413	Ga0495651_0241214
4414	Ga0495651_0294987
4415	Ga0495653_0002188
4416	Ga0495653_0011013
4417	Ga0495653_0025211
4418	Ga0495653_0048735
4419	Ga0495653_0056514
4420	Ga0495653_0177436
4421	Ga0495653_0192858
4422	Ga0495653_0238147
4423	Ga0495653_0288662
4424	Ga0495650_0041792
4425	Ga0495580_0003812
4426	Ga0495580_0011284
4427	Ga0495580_0307011
4428	Ga0495580_0389549
4429	Ga0495582_0000043
4430	Ga0495582_0008940
4431	Ga0495582_0018684
4432	Ga0495582_0090856
4433	Ga0495582_0137832
4434	Ga0495582_0170472
4435	Ga0495605_0043121
4436	Ga0495605_0092929
4437	Ga0495639_0000091
4438	Ga0495639_0003629
4439	Ga0495639_0012361
4440	Ga0495639_0061431
4441	Ga0495662_0001246
4442	Ga0495662_0023573
4443	Ga0495662_0084222
4444	Ga0495662_0088906
4445	Ga0495664_0000368
4446	Ga0495664_0004663
4447	Ga0495664_0007170
4448	Ga0495664_0010366
4449	Ga0495664_0027429
4450	Ga0495664_0044564
4451	Ga0495664_0048686
4452	Ga0495664_0054006
4453	Ga0495664_0061763
4454	Ga0495664_0163541
4455	Ga0495664_0254240
4456	Ga0495664_0301411
4457	Ga0495664_0336272
4458	Ga0495584_0080852
4459	Ga0495584_0177960
4460	Ga0495584_0229227
4461	Ga0495585_0031755
4462	Ga0495585_0317793
4463	Ga0495594_0000453
4464	Ga0495594_0016889
4465	Ga0495594_0050450
4466	Ga0495594_0075422
4467	Ga0495594_0117478
4468	Ga0495594_0131094
4469	Ga0495594_0152219
4470	Ga0495606_0049371
4471	Ga0495608_0002745
4472	Ga0495608_0004901
4473	Ga0495608_0016534
4474	Ga0495608_0024793
4475	Ga0495608_0059645
4476	Ga0495608_0068498
4477	Ga0495610_0065515
4478	Ga0495616_0017135
4479	Ga0495616_0087862
4480	Ga0495618_0011732
4481	Ga0495618_0031187
4482	Ga0495618_0343442
4483	Ga0495620_0053465
4484	Ga0495628_0000249
4485	Ga0495628_0008859
4486	Ga0495628_0012958
4487	Ga0495628_0018664
4488	Ga0495628_0052034
4489	Ga0495628_0078400
4490	Ga0495628_0191036
4491	Ga0495630_0010214
4492	Ga0495630_0021128
4493	Ga0495630_0028264
4494	Ga0495630_0521187
4495	Ga0495630_0599893
4496	Ga0495631_0133831
4497	Ga0495631_0193501
4498	Ga0495632_0167956
4499	Ga0495632_0210006
4500	Ga0495643_0015773
4501	Ga0495643_0163563
4502	Ga0495644_0061669
4503	Ga0495644_0070378
4504	Ga0495648_0000286
4505	Ga0495648_0009724
4506	Ga0495648_0188196
4507	Ga0495666_0005355
4508	Ga0495666_0045541
4509	Ga0495666_0089011
4510	Ga0495666_0130831
4511	Ga0495652_0003992
4512	Ga0495652_0047305
4513	Ga0495652_0049252
4514	Ga0495652_0052813
4515	Ga0495652_0054601
4516	Ga0495652_0056843
4517	Ga0495652_0241702
4518	Ga0495665_0001445
4519	Ga0495665_0031827
4520	Ga0495665_0321162
4521	Ga0495640_0002500
4522	Ga0495640_0002756
4523	Ga0495640_0003340
4524	Ga0495640_0027868
4525	Ga0495640_0037580
4526	Ga0495640_0061087
4527	Ga0495640_0091988
4528	Ga0495640_0221860
4529	Ga0495586_0032499
4530	Ga0495586_0042618
4531	Ga0495587_0000753
4532	Ga0495587_0018095
4533	Ga0495587_0044230
4534	Ga0495587_0075332
4535	Ga0495587_0078684
4536	Ga0495587_0100228
4537	Ga0495609_0046262
4538	Ga0495609_0151950
4539	Ga0495621_0063339
4540	Ga0495597_0069278
4541	Ga0495645_0001006
4542	Ga0495645_0007542
4543	Ga0495645_0009296
4544	Ga0495645_0027563
4545	Ga0495645_0046496
4546	Ga0495645_0119987
4547	Ga0495645_0138963
4548	Ga0495622_0001046
4549	Ga0495622_0017504
4550	Ga0495622_0104779
4551	Ga0495622_0126395
4552	Ga0495622_0139741
4553	Ga0495633_0139380
4554	Ga0495667_0000450
4555	Ga0495667_0000464
4556	Ga0495667_0002539
4557	Ga0495667_0011945
4558	Ga0495667_0014536
4559	Ga0495667_0017698
4560	Ga0495667_0123635
4561	Ga0495667_0204422
4562	Ga0495656_0053684
4563	Ga0495656_0073658
4564	Ga0495656_0087165
4565	Ga0495668_0045453
4566	Ga0495668_0162825
4567	Ga0495668_0217353
4568	Ga0495668_0236561
4569	Ga0495634_0005621
4570	Ga0495634_0012021
4571	Ga0495634_0015968
4572	Ga0495634_0025578
4573	Ga0495634_0028663
4574	Ga0495634_0059938
4575	Ga0495634_0101233
4576	Ga0495634_0111613
4577	Ga0495634_0158149
4578	Ga0495634_0205735
4579	Ga0495611_0190024
4580	Ga0495625_0099193
4581	Ga0495635_0001078
4582	Ga0495635_0001541
4583	Ga0495635_0001788
4584	Ga0495635_0006792
4585	Ga0495635_0017099
4586	Ga0495635_0024492
4587	Ga0495635_0028492
4588	Ga0495635_0029504
4589	Ga0495635_0098978
4590	Ga0495635_0117916
4591	Ga0495635_0180138
4592	Ga0495661_0052476
4593	Ga0495588_0010476
4594	Ga0495588_0112937
4595	Ga0495588_0272831
4596	Ga0495657_0003059
4597	Ga0495657_0003417
4598	Ga0495657_0006240
4599	Ga0495657_0011180
4600	Ga0495657_0011746
4601	Ga0495657_0016134
4602	Ga0495657_0020615
4603	Ga0495657_0112342
4604	Ga0495657_0206029
4605	Ga0495599_0001153
4606	Ga0495599_0002496
4607	Ga0495599_0021801
4608	Ga0495599_0025730
4609	Ga0495599_0081414
4610	Ga0495599_0308495
4611	Ga0495623_0003470
4612	Ga0495623_0003477
4613	Ga0495623_0006142
4614	Ga0495623_0018620
4615	Ga0495623_0035659
4616	Ga0495623_0079516
4617	Ga0495623_0090682
4618	Ga0495646_0005764
4619	Ga0495646_0013771
4620	Ga0495646_0018667
4621	Ga0495646_0019141
4622	Ga0495646_0066765
4623	Ga0495646_0098427
4624	Ga0495646_0102184
4625	Ga0495646_0104878
4626	Ga0495646_0166207
4627	Ga0495646_0171871
4628	Ga0495646_0189457
4629	Ga0495647_0000650
4630	Ga0495647_0021621
4631	Ga0495647_0034196
4632	Ga0495647_0066955
4633	Ga0495658_0000601
4634	Ga0495658_0003457
4635	Ga0495658_0010758
4636	Ga0495658_0011655
4637	Ga0495658_0052951
4638	Ga0495658_0083725
4639	Ga0495658_0110685
4640	Ga0495658_0278366
4641	Ga0495669_0002088
4642	Ga0495613_0001794
4643	Ga0495613_0005839
4644	Ga0495613_0028537
4645	Ga0495613_0028714
4646	Ga0495613_0052589
4647	Ga0495613_0088512
4648	Ga0495613_0140604
4649	Ga0495613_0243149
4650	Ga0495624_0000694
4651	Ga0495624_0005977
4652	Ga0495624_0131945
4653	Ga0495624_0514759
4654	Ga0495670_0024498
4655	Ga0495670_0114546
4656	Ga0495649_0027332
4657	Ga0495649_0144229
4658	Ga0495600_0000311
4659	Ga0495600_0001179
4660	Ga0495600_0008832
4661	Ga0495600_0016340
4662	Ga0495600_0057358
4663	Ga0495600_0067269
4664	Ga0495600_0075385
4665	Ga0495600_0084241
4666	Ga0495600_0085247
4667	Ga0495600_0401227
4668	Ga0495660_0316197
4669	Ga0495581_0000783
4670	Ga0495581_0007372
4671	Ga0495581_0034166
4672	Ga0495581_0064497
4673	Ga0495581_0077630
4674	Ga0495581_0089347
4675	Ga0495581_0129680
4676	Ga0495604_0001199
4677	Ga0495604_0004173
4678	Ga0495604_0004906
4679	Ga0495604_0005181
4680	Ga0495604_0019288
4681	Ga0495604_0036395
4682	Ga0495604_0134004
4683	Ga0495604_0152407
4684	Ga0495604_0279255
4685	Ga0495604_0314009
4686	Ga0495636_0157580
4687	Ga0495674_0004075
4688	Ga0495674_0005504
4689	Ga0495674_0006080
4690	Ga0495674_0010329
4691	Ga0495674_0024613
4692	Ga0495674_0033265
4693	Ga0495674_0058656
4694	Ga0495674_0075062
4695	Ga0495674_0089054
4696	Ga0495674_0127147
4697	Ga0495674_0326701
4698	Ga0495674_0453415
4699	Ga0495674_0705154
4700	Ga0495674_0721924
4701	Ga0495672_0009502
4702	Ga0495672_0046725
4703	Ga0495672_0123830
4704	Ga0495676_0018062
4705	Ga0495676_0049262
4706	Ga0495676_0058535
4707	Ga0495676_0118944
4708	Ga0495676_0461664
4709	Ga0495680_0000285
4710	Ga0495680_0000689
4711	Ga0495680_0003027
4712	Ga0495680_0015129
4713	Ga0495680_0017208
4714	Ga0495680_0022179
4715	Ga0495680_0049222
4716	Ga0495680_0066584
4717	Ga0495680_0080972
4718	Ga0495680_0096870
4719	Ga0495680_0119425
4720	Ga0495683_0059851
4721	Ga0495683_0094838
4722	Ga0495687_017157
4723	Ga0495675_0003430
4724	Ga0495675_0010733
4725	Ga0495675_0032125
4726	Ga0495675_0042219
4727	Ga0495675_0053308
4728	Ga0495675_0150248
4729	Ga0495675_0324281
4730	Ga0495673_0132978
4731	Ga0495684_0001940
4732	Ga0495684_0004560
4733	Ga0495684_0012120
4734	Ga0495684_0024992
4735	Ga0495684_0038931
4736	Ga0495684_0063608
4737	Ga0495684_0182696
4738	Ga0495684_0217705
4739	Ga0495684_0525333
4740	Ga0495686_0044749
4741	Ga0495686_0203888
4742	Ga0495686_0209852
4743	Ga0495593_0000005
4744	Ga0495593_0000693
4745	Ga0495593_0008505
4746	Ga0495593_0252734
4747	Ga0495602_0002384
4748	Ga0495602_0005990
4749	Ga0495602_0007083
4750	Ga0495602_0011209
4751	Ga0495602_0062647
4752	Ga0495602_0089225
4753	Ga0495602_0109804
4754	Ga0495602_0117607
4755	Ga0495602_0206375
4756	Ga0495602_0253821
4757	Ga0495614_0020718
4758	Ga0495614_0030653
4759	Ga0495614_0045908
4760	Ga0495626_0103375
4761	Ga0496100_0002261
4762	Ga0496100_0033360
4763	Ga0496100_0118971
4764	Ga0496100_0136121
4765	Ga0496100_0185373
4766	Ga0496100_0348060
4767	Ga0496100_0497021
4768	Ga0496101_0000468
4769	Ga0496101_0073682
4770	Ga0496101_0088672
4771	Ga0496101_0106001
4772	Ga0496101_0169186
4773	Ga0496101_0236371
4774	Ga0496101_0636935
4775	Ga0496102_0005586
4776	Ga0496102_0006543
4777	Ga0496102_0010497
4778	Ga0496102_0020716
4779	Ga0496102_0033921
4780	Ga0496102_0064807
4781	Ga0496102_0099477
4782	Ga0496102_0235023
4783	Ga0496102_0347373
4784	Ga0496102_0487909
4785	Ga0496102_0515886
4786	Ga0496102_0578786
4787	Ga0496102_0707443
4788	Ga0496102_0818429
4789	Ga0496102_0842452
4790	Ga0496103_0000693
4791	Ga0496103_0054323
4792	Ga0496103_0060961
4793	Ga0496103_0274141
4794	Ga0496104_0000239
4795	Ga0496104_0003329
4796	Ga0496104_0007292
4797	Ga0496104_0044346
4798	Ga0496104_0077576
4799	Ga0496104_0120402
4800	Ga0496104_0211431
4801	Ga0496104_0374043
4802	Ga0496104_0414881
4803	Ga0496104_0507167
4804	Ga0496104_0675986
4805	Ga0496104_0702504
4806	Ga0496105_0000324
4807	Ga0496105_0028180
4808	Ga0496105_0037811
4809	Ga0496105_0056596
4810	Ga0496105_0131636
4811	Ga0496105_0149875
4812	Ga0496105_0336070
4813	Ga0496105_0393817
4814	Ga0496105_0453764
4815	Ga0496106_0001014
4816	Ga0496106_0001270
4817	Ga0496106_0003850
4818	Ga0496106_0007160
4819	Ga0496106_0039896
4820	Ga0496106_0043845
4821	Ga0496106_0048340
4822	Ga0496106_0062218
4823	Ga0496106_0109698
4824	Ga0496106_0163075
4825	Ga0496106_0190953
4826	Ga0496106_0191001
4827	Ga0496106_0497384
4828	Ga0496107_0000965
4829	Ga0496107_0001220
4830	Ga0496107_0006048
4831	Ga0496107_0014694
4832	Ga0496107_0018971
4833	Ga0496107_0072936
4834	Ga0496107_0132870
4835	Ga0496107_0242627
4836	Ga0496107_0248176
4837	Ga0496107_0316744
4838	Ga0496107_0359714
4839	Ga0496107_0425239
4840	Ga0496108_0000274
4841	Ga0496108_0001543
4842	Ga0496108_0001651
4843	Ga0496108_0033903
4844	Ga0496108_0034651
4845	Ga0496108_0036616
4846	Ga0496108_0069200
4847	Ga0496108_0087899
4848	Ga0496108_0095587
4849	Ga0496108_0103475
4850	Ga0496108_0183634
4851	Ga0496108_0381699
4852	Ga0496108_0849374
4853	Ga0496109_0000414
4854	Ga0496109_0004282
4855	Ga0496109_0051680
4856	Ga0496109_0075762
4857	Ga0496109_0079592
4858	Ga0496109_0098427
4859	Ga0496109_0241153
4860	Ga0496109_0250923
4861	Ga0496109_0265937
4862	Ga0496109_0292625
4863	Ga0496109_0304789
4864	Ga0496109_0552279
4865	Ga0496110_0011294
4866	Ga0496110_0030873
4867	Ga0496110_0038340
4868	Ga0496110_0066458
4869	Ga0496110_0069632
4870	Ga0496110_0074835
4871	Ga0496110_0093880
4872	Ga0496110_0118470
4873	Ga0496110_0135243
4874	Ga0496110_0142659
4875	Ga0496110_0142953
4876	Ga0496110_0484872
4877	Ga0496110_0958162
4878	Ga0496111_0004013
4879	Ga0496111_0014051
4880	Ga0496111_0025889
4881	Ga0496111_0050186
4882	Ga0496111_0058173
4883	Ga0496111_0081150
4884	Ga0496111_0135580
4885	Ga0496111_0146308
4886	Ga0496111_0259287
4887	Ga0496111_0303988
4888	Ga0496111_0327159
4889	Ga0496111_0424721
4890	Ga0496112_0005625
4891	Ga0496112_0011307
4892	Ga0496112_0014598
4893	Ga0496112_0031512
4894	Ga0496112_0031708
4895	Ga0496112_0124216
4896	Ga0496112_0134053
4897	Ga0496112_0137947
4898	Ga0496112_0195281
4899	Ga0496112_0216568
4900	Ga0496112_0252452
4901	Ga0496112_0336520
4902	Ga0496113_0006117
4903	Ga0496113_0016478
4904	Ga0496113_0034060
4905	Ga0496113_0046666
4906	Ga0496113_0152956
4907	Ga0496113_0168189
4908	Ga0496113_0230018
4909	Ga0496113_0279592
4910	Ga0496113_0339669
4911	Ga0496113_0390358
4912	Ga0496113_0421963
4913	Ga0496113_0434583
4914	Ga0496113_0437746
4915	Ga0496113_0526082
4916	Ga0496113_0545448
4917	Ga0496113_0562037
4918	Ga0496113_0629065
4919	Ga0496114_0003058
4920	Ga0496114_0008301
4921	Ga0496114_0119866
4922	Ga0496114_0420663
4923	Ga0496114_0541293
4924	Ga0496114_0589588
4925	Ga0496114_0768815
4926	Ga0496115_0006705
4927	Ga0496115_0009376
4928	Ga0496115_0010108
4929	Ga0496115_0015055
4930	Ga0496115_0020999
4931	Ga0496115_0043792
4932	Ga0496115_0068394
4933	Ga0496115_0101903
4934	Ga0496115_0115673
4935	Ga0496115_0210718
4936	Ga0496115_0255833
4937	Ga0496115_0258113
4938	Ga0496115_0278237
4939	Ga0496115_0361595
4940	Ga0496115_0608584
4941	Ga0496115_0705827
4942	Ga0496116_0058882
4943	Ga0496116_0078091
4944	Ga0496117_0034639
4945	Ga0496117_0120686
4946	Ga0496118_0006290
4947	Ga0496118_0009149
4948	Ga0496118_0030372
4949	Ga0496118_0180939
4950	Ga0496118_0222276
4951	Ga0496119_0020471
4952	Ga0496119_0026661
4953	Ga0496119_0062834
4954	Ga0496119_0105123
4955	Ga0496119_0183610
4956	Ga0496119_0297232
4957	Ga0496120_0124471
4958	Ga0496121_0000270
4959	Ga0496121_0000370
4960	Ga0496121_0024961
4961	Ga0496121_0037967
4962	Ga0496121_0056471
4963	Ga0496121_0065236
4964	Ga0496121_0068084
4965	Ga0496121_0076636
4966	Ga0496121_0136863
4967	Ga0496121_0180268
4968	Ga0496121_0258582
4969	Ga0496121_0342038
4970	Ga0496124_0000235
4971	Ga0496124_0000294
4972	Ga0496124_0059769
4973	Ga0496124_0208349
4974	Ga0496124_0265201
4975	Ga0496125_0000053
4976	Ga0496125_0000328
4977	Ga0496125_0028321
4978	Ga0496125_0029286
4979	Ga0496125_0036451
4980	Ga0496125_0042674
4981	Ga0496125_0043278
4982	Ga0496125_0060878
4983	Ga0496126_0002460
4984	Ga0496126_0002944
4985	Ga0496126_0005304
4986	Ga0496126_0017043
4987	Ga0496126_0024056
4988	Ga0496126_0033707
4989	Ga0496126_0039249
4990	Ga0496126_0069744
4991	Ga0496126_0090215
4992	Ga0496126_0111231
4993	Ga0496126_0141708
4994	Ga0496126_0144445
4995	Ga0496126_0154552
4996	Ga0496126_0161406
4997	Ga0496126_0174376
4998	Ga0496126_0189594
4999	Ga0496126_0208468
5000	Ga0496126_0299481
5001	Ga0496126_0334817
5002	Ga0496126_0337326
5003	Ga0496126_0365016
5004	Ga0495678_035346
5005	Ga0495682_0033729
5006	Ga0501031_0031678
5007	Ga0501031_0032907
5008	Ga0501031_0039490
5009	Ga0501031_0042532
5010	Ga0501032_0005395
5011	Ga0501032_0029554
5012	Ga0501032_0073240
5013	Ga0501032_0186078
5014	Ga0501032_0366800
5015	Ga0501033_0000440
5016	Ga0501033_0053579
5017	Ga0501033_0100447
5018	Ga0501033_0143234
5019	Ga0501033_0197773
5020	Ga0501033_0210893
5021	Ga0501033_0354427
5022	Ga0501034_0000286
5023	Ga0501034_0004004
5024	Ga0501034_0011589
5025	Ga0501034_0073352
5026	Ga0501034_0076316
5027	Ga0501034_0192425
5028	Ga0501034_0231494
5029	Ga0501034_0232405
5030	Ga0501034_0252893
5031	Ga0501034_0300395
5032	Ga0501034_0304905
5033	Ga0501034_0336340
5034	Ga0501034_0549330
5035	Ga0501034_0695073
5036	Ga0501034_1069349
5037	Ga0501036_0000118
5038	Ga0501036_0017713
5039	Ga0501036_0060965
5040	Ga0501036_0138705
5041	Ga0501036_0141200
5042	Ga0501036_0383078
5043	Ga0501036_0787900
5044	Ga0501037_0005763
5045	Ga0501037_0009392
5046	Ga0501037_0029633
5047	Ga0501037_0044786
5048	Ga0501037_0048807
5049	Ga0501037_0056863
5050	Ga0501037_0069854
5051	Ga0501037_0158437
5052	Ga0501037_0309214
5053	Ga0501038_0005087
5054	Ga0501038_0005534
5055	Ga0501038_0008403
5056	Ga0501038_0106099
5057	Ga0501038_0143621
5058	Ga0501038_0198010
5059	Ga0501038_0215831
5060	Ga0501038_0521481
5061	Ga0501038_0542697
5062	Ga0501039_0011559
5063	Ga0501039_0031179
5064	Ga0501039_0079612
5065	Ga0501039_0085706
5066	Ga0501039_0095018
5067	Ga0501039_0115167
5068	Ga0501039_0156649
5069	Ga0501039_0177642
5070	Ga0501039_0326698
5071	Ga0501040_0037818
5072	Ga0501040_0059527
5073	Ga0501040_0178048
5074	Ga0501040_0320889
5075	Ga0501041_0040615
5076	Ga0501041_0136853
5077	Ga0501041_0340107
5078	Ga0501042_0003037
5079	Ga0501042_0103349
5080	Ga0501042_0672550
5081	Ga0501043_0001889
5082	Ga0501043_0008016
5083	Ga0501043_0011643
5084	Ga0501043_0053584
5085	Ga0501043_0071865
5086	Ga0501043_0104188
5087	Ga0501043_0259578
5088	Ga0501043_0317108
5089	Ga0501043_0356828
5090	Ga0501043_0521508
5091	Ga0501046_0029784
5092	Ga0501046_0034691
5093	Ga0501046_0036997
5094	Ga0501046_0052525
5095	Ga0501046_0061131
5096	Ga0501046_0065025
5097	Ga0501046_0082303
5098	Ga0501047_0000097
5099	Ga0501047_0026637
5100	Ga0501047_0035690
5101	Ga0501047_0059149
5102	Ga0501047_0059428
5103	Ga0501047_0071829
5104	Ga0501047_0080484
5105	Ga0501047_0140661
5106	Ga0501047_0197854
5107	Ga0501047_0288288
5108	Ga0501047_0365487
5109	Ga0501047_0384564
5110	Ga0501048_0000471
5111	Ga0501048_0071082
5112	Ga0501048_0125510
5113	Ga0501048_0156372
5114	Ga0501048_0266047
5115	Ga0501067_0041019
5116	Ga0501067_0041067
5117	Ga0501067_0078484
5118	Ga0501068_0104382
5119	Ga0501068_0178560
5120	Ga0501069_0039858
5121	Ga0501069_0070141
5122	Ga0501069_0095707
5123	Ga0501070_0003250
5124	Ga0501070_0005826
5125	Ga0501070_0014334
5126	Ga0501070_0044402
5127	Ga0501070_0055900
5128	Ga0501070_0072913
5129	Ga0501070_0073326
5130	Ga0501070_0094611
5131	Ga0501070_0104245
5132	Ga0501070_0123182
5133	Ga0501070_0129116
5134	Ga0501070_0149009
5135	Ga0501070_0150587
5136	Ga0501070_0572726
5137	Ga0501071_0070460
5138	Ga0501071_0082264
5139	Ga0501072_0002898
5140	Ga0501072_0081740
5141	Ga0501072_0114743
5142	Ga0501072_0277669
5143	Ga0501072_0397945
5144	Ga0501072_0469351
5145	Ga0501073_0042461
5146	Ga0501073_0056321
5147	Ga0501073_0059230
5148	Ga0501073_0101485
5149	Ga0501073_0151453
5150	Ga0501073_0168334
5151	Ga0501073_0251159
5152	Ga0501073_0458190
5153	Ga0501074_0003990
5154	Ga0501074_0035817
5155	Ga0501074_0048389
5156	Ga0501074_0051339
5157	Ga0501075_0027432
5158	Ga0501075_0187771
5159	Ga0501075_0212599
5160	Ga0501075_0225109
5161	Ga0501076_0007597
5162	Ga0501076_0102281
5163	Ga0501076_0112735
5164	Ga0501076_0256598
5165	Ga0501076_0290540
5166	Ga0501076_0302111
5167	Ga0501076_0326004
5168	Ga0501077_0192898
5169	Ga0501077_0235716
5170	Ga0501077_0288705
5171	Ga0501079_0112134
5172	Ga0501079_0122281
5173	Ga0501079_0122492
5174	Ga0501079_0134898
5175	Ga0501079_0154873
5176	Ga0501079_0165997
5177	Ga0501080_0000047
5178	Ga0501080_0002360
5179	Ga0501080_0007608
5180	Ga0501080_0020846
5181	Ga0501080_0080116
5182	Ga0501081_0051061
5183	Ga0501081_0410290
5184	Ga0501083_0000857
5185	Ga0501083_0022090
5186	Ga0501083_0094941
5187	Ga0501083_0130711
5188	Ga0501035_0001181
5189	Ga0501035_0006394
5190	Ga0501035_0019511
5191	Ga0501035_0065941
5192	Ga0501035_0078031
5193	Ga0501035_0097341
5194	Ga0501035_0139114
5195	Ga0501035_0158096
5196	Ga0501035_0269915
5197	Ga0501035_0468452
5198	Ga0501035_0502744
5199	Ga0501044_0006535
5200	Ga0501044_0009895
5201	Ga0501044_0014838
5202	Ga0501044_0035410
5203	Ga0501044_0040396
5204	Ga0501044_0091490
5205	Ga0501044_0091559
5206	Ga0501044_0114032
5207	Ga0501044_0161741
5208	Ga0501044_0211406
5209	Ga0501044_0219298
5210	Ga0501044_0312161
5211	Ga0501044_0427060
5212	Ga0501044_0550335
5213	Ga0501045_0026458
5214	Ga0501045_0183570
5215	Ga0501045_0276111
5216	nmdc:mga03683_69826_c1
5217	nmdc:mga03683_87002_c1
5218	nmdc:mga03n38_18540_c1
5219	nmdc:mga03n38_306889_c1
5220	nmdc:mga03n38_35814_c1
5221	nmdc:mga03n38_46519_c1
5222	nmdc:mga0yw44_19569_c1
5223	nmdc:mga0yw44_217680_c1
5224	nmdc:mga0yw44_72673_c1
5225	nmdc:mga0k408_436502_c1
5226	nmdc:mga06z11_11930_c1
5227	nmdc:mga06z11_121704_c1
5228	nmdc:mga06z11_85785_c1
5229	nmdc:mga04h51_12847_c1
5230	nmdc:mga04h51_2520_c1
5231	nmdc:mga04h51_3991_c1
5232	nmdc:mga07m45_61463_c2
5233	nmdc:mga05p37_814706_c1
5234	nmdc:mga09592_547423_c1
5235	nmdc:mga0qj67_27437_c1
5236	nmdc:mga0qj67_53487_c1
5237	nmdc:mga0qj67_60507_c1
5238	nmdc:mga0qj67_96203_c1
5239	nmdc:mga06r32_40738_c1
5240	nmdc:mga06r32_410765_c1
5241	nmdc:mga06r32_48682_c1
5242	nmdc:mga06r32_505648_c1
5243	nmdc:mga08y16_102080_c1
5244	nmdc:mga08y16_247502_c1
5245	nmdc:mga08y16_27032_c1
5246	nmdc:mga08y16_3076_c1
5247	nmdc:mga08y16_404141_c1
5248	nmdc:mga08y16_4733_c1
5249	nmdc:mga0n895_24914_c1
5250	nmdc:mga0n895_350542_c1
5251	nmdc:mga0n895_55_c1
5252	nmdc:mga0n895_83709_c1
5253	nmdc:mga0rr50_110878_c1
5254	nmdc:mga0rr50_12618_c1
5255	nmdc:mga0rr50_315463_c1
5256	nmdc:mga0rr50_58710_c1
5257	nmdc:mga0rr50_676436_c1
5258	nmdc:mga08x19_118680_c1
5259	nmdc:mga08x19_294253_c1
5260	nmdc:mga0a205_127781_c1
5261	nmdc:mga0a205_170785_c1
5262	nmdc:mga0a205_26538_c1
5263	nmdc:mga0a205_343309_c1
5264	nmdc:mga0a205_622965_c1
5265	nmdc:mga0a205_768_c4
5266	nmdc:mga0sz30_7938_c1
5267	Ga0495601_0002541
5268	Ga0495601_0013100
5269	Ga0495601_0015968
5270	Ga0495601_0019662
5271	Ga0495601_0021106
5272	Ga0495601_0104698
5273	Ga0495601_0146301
5274	Ga0495601_0300860
5275	Ga0495612_0000243
5276	Ga0495612_0000733
5277	Ga0495612_0006404
5278	Ga0495612_0014879
5279	Ga0495612_0023113
5280	Ga0495612_0036509
5281	Ga0495612_0081950
5282	Ga0500635_0050731
5283	Ga0495595_0000578
5284	Ga0495595_0001643
5285	Ga0495595_0003604
5286	Ga0495595_0003714
5287	Ga0495595_0008735
5288	Ga0495595_0013364
5289	Ga0495595_0030242
5290	Ga0495595_0167095
5291	Ga0495595_0192737
5292	Ga0495595_0201766
5293	Ga0495619_0000139
5294	Ga0495619_0000330
5295	Ga0495619_0000365
5296	Ga0495619_0001830
5297	Ga0495619_0002914
5298	Ga0495619_0004517
5299	Ga0495619_0021688
5300	Ga0495619_0027803
5301	Ga0495619_0067140
5302	Ga0495619_0083526
5303	Ga0495619_0093266
5304	Ga0495619_0139183
5305	Ga0495619_0159432
5306	Ga0495619_0176402
5307	Ga0495619_0306511
5308	Ga0495619_0514654
5309	Ga0500578_0060510
5310	Ga0500578_0156075
5311	Ga0500643_000063
5312	Ga0500643_002099
5313	Ga0500644_0001257
5314	Ga0500644_0029965
5315	Ga0500646_0082239
5316	Ga0500646_0096926
5317	Ga0500647_0011835
5318	Ga0500583_0056163
5319	Ga0500651_0053527
5320	Ga0500566_0000151
5321	Ga0500566_0000236
5322	Ga0500566_0295756
5323	Ga0500640_033763
5324	Ga0500641_0007070
5325	Ga0500641_0018085
5326	Ga0500641_0082546
5327	Ga0500650_0178993
5328	Ga0500555_004818
5329	Ga0500555_012245
5330	Ga0500556_0000092
5331	Ga0500557_000037
5332	Ga0500562_006897
5333	Ga0500569_019901
5334	Ga0500569_089982
5335	Ga0500572_000200
5336	Ga0500594_0095086
5337	Ga0500594_0106698
5338	Ga0500594_0132896
5339	Ga0500595_000001
5340	Ga0500595_000265
5341	Ga0500595_001612
5342	Ga0500595_007591
5343	Ga0500595_022450
5344	Ga0500595_034349
5345	Ga0500595_075670
5346	Ga0500607_019113
5347	Ga0500608_044642
5348	Ga0500608_093901
5349	Ga0500614_024140
5350	Ga0500614_096039
5351	Ga0500621_085094
5352	Ga0500621_122899
5353	Ga0500642_0000062
5354	Ga0500642_0062887
5355	Ga0500652_000090
5356	Ga0500652_025903
5357	Ga0500559_0000179
5358	Ga0500559_0018563
5359	Ga0500559_0028885
5360	Ga0500559_0109842
5361	Ga0500559_0314922
5362	Ga0500573_0073330
5363	Ga0500589_073187
5364	Ga0500590_168107
5365	Ga0500590_196312
5366	Ga0500603_000295
5367	Ga0500603_092290
5368	Ga0500604_0091197
5369	Ga0500616_0000001
5370	Ga0500616_0020033
5371	Ga0500616_0257557
5372	Ga0500620_000467
5373	Ga0500627_0172286
5374	Ga0500630_022191
5375	Ga0500634_0094860
5376	Ga0500634_0234416
5377	Ga0500638_000059
5378	Ga0500638_013587
5379	Ga0500638_070509
5380	Ga0500638_158443
5381	Ga0500639_028697
5382	Ga0500639_046032
5383	Ga0500636_0009392
5384	Ga0500636_0026529
5385	Ga0500636_0052209
5386	Ga0500636_0144605
5387	Ga0500637_0002081
5388	Ga0500576_066041
5389	Ga0500625_012606
5390	Ga0500645_000109
5391	Ga0500645_042081
5392	Ga0500609_027369
5393	Ga0500656_007131
5394	Ga0500596_001346
5395	Ga0500596_002026
5396	Ga0500599_001321
5397	Ga0500601_000544
5398	Ga0501084_0031614
5399	Ga0501084_0070618
5400	Ga0501084_0095881
5401	Ga0501084_0302354
5402	Ga0501084_0337157
5403	Ga0500661_000282
5404	Ga0501082_0141449
5405	Ga0501082_0156073
5406	Ga0501082_0178913
5407	Ga0501082_0186060
5408	Ga0466962_0063016
5409	Ga0530510_0184325
5410	Ga0530510_0250045
5411	Ga0530510_0254466
5412	2507505223
5413	2508539144
5414	2508695387
5415	2509152614
5416	2513629059
5417	2513644143
5418	2513651538
5419	2513658791
5420	2513674608
5421	2513695089
5422	2513704410
5423	2513720326
5424	2513860798
5425	2513873550
5426	2513888746
5427	2513921055
5428	2514012463
5429	2515627420
5430	2517107733
5431	2517888820
5432	2524440912
5433	2524467828
5434	2524537076
5435	2585334047
5436	2617352376
5437	2617373738
5438	2643854776
5439	2643966623
5440	2644290925
5441	2644501303
5442	2671119966
5443	2723841621
5444	2728754968
5445	2745081667
5446	2793062020
5447	2793072908
5448	2793082773
5449	2805915634
5450	2818237627
5451	2824604607
5452	2824612302
5453	2824624477
5454	2824633392
5455	2824640311
5456	2824647255
5457	2824655167
5458	2824676647
5459	2824684082
5460	2824694745
5461	2824702843
5462	2824712736
5463	2824717429
5464	2824727608
5465	2824739192
5466	2824752566
5467	2824757642
5468	2824773150
5469	2824775544
5470	2829747135
5471	2838124491
5472	2841945177
5473	2841951959
5474	2841965412
5475	2841970646
5476	2841979995
5477	2841985174
5478	2842043532
5479	2842052478
5480	2842485339
5481	2844315315
5482	2847931050
5483	2847942133
5484	2849083014
5485	2857511902
5486	2874594423
5487	2874608085
5488	2874613458
5489	2874624759
5490	2874628817
5491	2874649796
5492	2876769712
5493	2876773915
5494	2876821795
5495	2879078361
5496	2879085884
5497	2879112148
5498	2879130622
5499	2879147101
5500	2881365340
5501	2881668207
5502	2885371050
5503	2885376162
5504	2885385082
5505	2885411684
5506	2888379616
5507	2888390703
5508	2888420329
5509	2889035514
5510	2903732176
5511	2903748976
5512	2903770782
5513	2904670286
5514	2904694488
5515	2904708802
5516	2904713156
5517	2906604253
5518	2906613852
5519	2906628979
5520	2906642355
5521	2906649401
5522	2906667383
5523	2908747421
5524	2908756609
5525	2908776255
5526	2920760155
5527	2920826118
5528	2922364023
5529	2922392544
5530	2922394217
5531	2922434248
5532	2932794339
5533	2932808067
5534	2935615748
5535	2935636607
5536	2935656120
5537	2935664955
5538	2935773065
5539	2935783008
5540	2935787946
5541	2935796478
5542	2935825454
5543	2935853243
5544	2935890127
5545	2935914715
5546	2935918692
5547	2935931592
5548	2935940189
5549	2935947464
5550	2935956236
5551	2935962615
5552	2935973029
5553	2935980726
5554	2935985045
5555	2936019013
5556	2936027595
5557	2936036418
5558	2936054544
5559	2936056214
5560	2941513243
5561	2941521102
5562	2941528961
5563	2941535536
5564	3005475039
5565	3005486876
5566	3005509185
5567	3005592233
5568	3005595028
5569	3005710977
5570	3005718282
5571	643827586
5572	8006927868
5573	8006936257
5574	8006969339
5575	8006976202
5576	8006990900
5577	8006996532
5578	8016526116
5579	8016549274
5580	8016557702
5581	8016582050
5582	8016586400
5583	8016595733
5584	8016606589
5585	8016618490
5586	8016623182
5587	8016635780
5588	8019531006
5589	8019540578
5590	8019550198
5591	8019572456
5592	8019622947
5593	8019630160
5594	8019640452
5595	8019666993
5596	8019676749
5597	8019696266
5598	8049296454
5599	8056675721
5600	8056687414
5601	8056693380
5602	8056971267

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00117

GATase

Glutamine amidotransferase class-I

4

213

0.74 PF07722

Peptidase_C26

Peptidase C26

68

197

0.7 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
7ac8-assembly3.cif.gz_F	error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer'))	0.946	1	213
2wjz-assembly1.cif.gz_B	crystal structure of (hish) k181a y138a mutant of imidazoleglycerolphosphate synthase (hish hisf) which displays constitutive glutaminase activity	0.9439	1	213
2wjz-assembly3.cif.gz_D	crystal structure of (hish) k181a y138a mutant of imidazoleglycerolphosphate synthase (hish hisf) which displays constitutive glutaminase activity	0.9437	1	213
6ymu-assembly4.cif.gz_D	imidazole glycerol phosphate synthase	0.9437	1	213
4gud-assembly1.cif.gz_A	crystal structure of amidotransferase hish from vibrio cholerae	0.929	1	214

ID	Description	Score	Start	End	Superfamily
2wjzB00	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain	0.9439	1	213	3.40.50.880
af_Q57929_1_195_3.40.50.880	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain	0.9419	3	214	3.40.50.880
af_Q57929_1_195_3.40.50.880	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain	0.9325	3	214	3.40.50.880
4gudA00	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain	0.9253	1	214	3.40.50.880
2wjzB00	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain	0.9251	1	213	3.40.50.880

ID	Description	Score	Start	End	GO Terms
AF-A0A833G5U2-F1-model_v4	Imidazole glycerol phosphate synthase subunit HisH	0.9953	49	216	GO:0000105 GO:0000107 GO:0006541 GO:0016787 GO:0016829
AF-A0A443H1V7-F1-model_v4	deleted	0.9927	87	216
AF-A0A2N9ARJ9-F1-model_v4	Imidazole glycerol phosphate synthase subunit HisH (EC 4.3.2.10) (IGP synthase glutaminase subunit) (EC 3.5.1.2) (IGP synthase subunit HisH) (ImGP synthase subunit HisH) (IGPS subunit HisH)	0.9914	2	216	GO:0000105 GO:0000107 GO:0004359 GO:0005737 GO:0006541 GO:0016020 GO:0016829
AF-P58788-F1-model_v4	Imidazole glycerol phosphate synthase subunit HisH (EC 4.3.2.10) (IGP synthase glutaminase subunit) (EC 3.5.1.2) (IGP synthase subunit HisH) (ImGP synthase subunit HisH) (IGPS subunit HisH)	0.9908	1	216	GO:0000105 GO:0000107 GO:0004359 GO:0005737 GO:0016829
AF-A0A839F7Y1-F1-model_v4	Imidazole glycerol phosphate synthase subunit HisH (EC 4.3.2.10) (IGP synthase glutaminase subunit) (EC 3.5.1.2) (IGP synthase subunit HisH) (ImGP synthase subunit HisH) (IGPS subunit HisH)	0.9907	1	216	GO:0000105 GO:0000107 GO:0005737 GO:0006541 GO:0016787 GO:0016829

F497068

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00117

GATase

Glutamine amidotransferase class-I

4

213

0.74

PF07722

Peptidase_C26

Peptidase C26

68

197

0.7

Structural Annotation

Top 5 Hits

Map