metagRoot

F497066

General Info

Members	Datasets	Scaffolds	Average Seq Length
2800	580	2800	140

Family's Representative Sequence

Representative Sequence	3300025918\|Ga0207662_10409397\|Ga0207662_104093972
Length	165
Sequence	MAAAARAIENRQSKIGNKIMAEYKIPKRMKYRKQQRGRMSGVATRGAEISFGEYGLKALEPAWITGKQIEASRVAMTRFIKRGGKIWIRVCPDKPITKKPAETRMGKGKGAPEGWVAVVKPGRVLFEMEGVDEKTAIEAMRLAAQKLPIKTKFVSRKTQEGGGLV

Samples

	Sample ID	Description	Type	Environment
1	3300000546	Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled	Metagenome	Rhizosphere
2	3300002077	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3	Metagenome	Rhizosphere
3	3300002239	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2	Metagenome	Rhizosphere
4	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
5	3300003574	Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
6	3300003575	Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
7	3300004799	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
8	3300004801	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome)	Metatranscriptome	Unclassified
9	3300005288	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
10	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
11	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
12	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
13	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
14	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
15	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
16	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
17	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
18	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
19	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
20	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
21	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
22	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
23	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
24	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
25	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
26	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
27	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
28	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
29	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
30	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
31	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
32	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
33	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
34	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
35	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
36	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
37	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
38	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
39	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
40	3300005406	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG	Metagenome	Rhizosphere
41	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
42	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
43	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
44	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
45	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
46	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
47	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
48	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
49	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
50	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
51	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
52	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
53	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
54	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
55	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
56	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
57	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
58	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
59	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
60	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
61	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
62	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
63	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
64	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
65	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
66	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
67	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
68	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
69	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
70	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
71	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
72	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
73	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
74	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
75	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
76	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
77	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
78	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
79	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
80	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
81	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
82	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
83	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
84	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
85	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
86	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
87	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
88	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
89	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
90	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
91	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
92	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
93	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
94	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
95	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
96	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
97	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
98	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
99	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
100	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
101	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
102	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
103	3300006194	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1	Metagenome	Rhizosphere
104	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
105	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
106	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
107	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
108	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
109	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
110	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
111	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
112	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
113	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
114	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
115	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
116	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
117	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
118	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
119	3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Metagenome	Rhizosphere
120	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
121	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
122	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
123	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
124	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
125	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
126	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
127	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
128	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
129	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
130	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
131	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
132	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
133	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
134	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
135	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
136	3300012482	Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510	Metagenome	Rhizosphere
137	3300012485	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610	Metagenome	Rhizosphere
138	3300012495	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610	Metagenome	Rhizosphere
139	3300012497	Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510	Metagenome	Rhizosphere
140	3300012498	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410	Metagenome	Rhizosphere
141	3300012502	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610	Metagenome	Rhizosphere
142	3300012507	Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610	Metagenome	Rhizosphere
143	3300012510	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610	Metagenome	Rhizosphere
144	3300012512	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510	Metagenome	Rhizosphere
145	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
146	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
147	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
148	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
149	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
150	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
151	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
152	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
153	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
154	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
155	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
156	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
157	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
158	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
159	3300020070	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
160	3300021358	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3	Metagenome	Rhizosphere
161	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
162	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
163	3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Metagenome	Unclassified
164	3300021441	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1	Metagenome	Rhizosphere
165	3300022732	Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1	Metagenome	Rhizosphere
166	3300022734	Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3	Metagenome	Rhizosphere
167	3300023547	Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
168	3300024225	Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5	Metagenome	Rhizosphere
169	3300024227	Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4	Metagenome	Rhizosphere
170	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
171	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
172	3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
173	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
174	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
175	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
176	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
177	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
178	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
179	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
180	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
181	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
182	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
183	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
184	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
185	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
186	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
187	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
188	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
189	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
190	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
191	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
192	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
193	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
194	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
195	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
196	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
197	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
198	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
199	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
200	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
201	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
202	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
203	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
204	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
205	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
206	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
207	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
208	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
209	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
210	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
211	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
212	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
213	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
214	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
215	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
216	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
217	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
218	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
219	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
220	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
221	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
222	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
223	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
224	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
225	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
226	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
227	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
228	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
229	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
230	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
231	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
232	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
233	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
234	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
235	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
236	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
237	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
238	3300027424	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
239	3300027526	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
240	3300027543	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
241	3300027665	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
242	3300027671	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2)	Metagenome	Rhizosphere
243	3300027682	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
244	3300027695	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2)	Metagenome	Rhizosphere
245	3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
246	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
247	3300028017	Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4	Metagenome	Rhizosphere
248	3300028036	Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2	Metagenome	Rhizosphere
249	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
250	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
251	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
252	3300028556	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG	Metagenome	Rhizosphere
253	3300028558	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG	Metagenome	Rhizosphere
254	3300028563	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG	Metagenome	Rhizosphere
255	3300028573	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG	Metagenome	Rhizosphere
256	3300028577	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG	Metagenome	Rhizosphere
257	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
258	3300029957	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG	Metagenome	Rhizosphere
259	3300030745	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8	Metagenome	Rhizosphere
260	3300030760	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
261	3300030877	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
262	3300030878	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
263	3300030886	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
264	3300031010	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
265	3300031018	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
266	3300031090	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
267	3300031235	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG	Metagenome	Rhizosphere
268	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
269	3300031239	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG	Metagenome	Rhizosphere
270	3300031240	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG	Metagenome	Rhizosphere
271	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
272	3300031242	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG	Metagenome	Rhizosphere
273	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
274	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
275	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
276	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
277	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
278	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
279	3300031665	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3	Metagenome	Rhizosphere
280	3300031691	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA	Metagenome	Rhizosphere
281	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
282	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
283	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
284	3300031728	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC	Metagenome	Rhizosphere
285	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
286	3300031733	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1	Metagenome	Rhizosphere
287	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
288	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
289	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
290	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
291	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
292	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
293	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
294	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
295	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
296	3300032120	Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
297	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
298	3300032137	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC	Metagenome	Rhizosphere
299	3300032139	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB	Metagenome	Rhizosphere
300	3300032168	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
301	3300033541	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
302	3300034817	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1	Metagenome	Rhizosphere
303	3300034818	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3	Metagenome	Rhizosphere
304	3300034819	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1	Metagenome	Rhizosphere
305	3300034957	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2	Metagenome	Rhizosphere
306	3300035084	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1	Metagenome	Rhizosphere
307	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
308	3300035088	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4	Metagenome	Rhizosphere
309	3300035090	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2	Metagenome	Rhizosphere
310	3300035091	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4	Metagenome	Rhizosphere
311	3300035092	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11	Metagenome	Rhizosphere
312	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
313	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
314	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
315	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
316	3300035115	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11	Metagenome	Rhizosphere
317	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
318	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
319	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
320	3300035120	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5	Metagenome	Rhizosphere
321	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
322	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
323	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
324	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
325	3300035207	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16	Metagenome	Rhizosphere
326	3300035241	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4	Metagenome	Rhizosphere
327	3300035242	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11	Metagenome	Rhizosphere
328	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
329	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
330	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
331	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
332	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
333	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
334	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
335	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
336	3300036457	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
337	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
338	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
339	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
340	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
341	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
342	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
343	3300037588	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA	Metagenome	Rhizosphere
344	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
345	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
346	3300038996	Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19	Metagenome	Rhizosphere
347	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
348	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
349	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
350	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
351	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
352	3300041404	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272	Metagenome	Rhizosphere
353	3300041405	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414	Metagenome	Rhizosphere
354	3300041406	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284	Metagenome	Rhizosphere
355	3300041408	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195	Metagenome	Rhizosphere
356	3300041410	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596	Metagenome	Rhizosphere
357	3300041441	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG	Metagenome	Rhizoplane
358	3300041459	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG	Metagenome	Rhizoplane
359	3300041460	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG	Metagenome	Rhizoplane
360	3300041486	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG	Metagenome	Rhizoplane
361	3300041492	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG	Metagenome	Unclassified
362	3300041997	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607	Metagenome	Rhizosphere
363	3300041999	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297	Metagenome	Rhizosphere
364	3300042001	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542	Metagenome	Rhizosphere
365	3300042003	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551	Metagenome	Rhizosphere
366	3300042004	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619	Metagenome	Rhizosphere
367	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
368	3300042008	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219	Metagenome	Rhizosphere
369	3300042009	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348	Metagenome	Rhizosphere
370	3300042013	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339	Metagenome	Rhizosphere
371	3300042014	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275	Metagenome	Rhizosphere
372	3300042015	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287	Metagenome	Rhizosphere
373	3300042016	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357	Metagenome	Rhizosphere
374	3300042121	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398	Metagenome	Rhizosphere
375	3300042122	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496	Metagenome	Rhizosphere
376	3300042123	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228	Metagenome	Rhizosphere
377	3300042132	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133	Metagenome	Rhizosphere
378	3300042133	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134	Metagenome	Rhizosphere
379	3300042134	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126	Metagenome	Rhizosphere
380	3300042142	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610	Metagenome	Rhizosphere
381	3300042145	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581	Metagenome	Rhizosphere
382	3300042147	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618	Metagenome	Rhizosphere
383	3300042156	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593	Metagenome	Rhizosphere
384	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
385	3300042436	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520	Metagenome	Rhizosphere
386	3300042437	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554	Metagenome	Rhizosphere
387	3300042438	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533	Metagenome	Rhizosphere
388	3300042439	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363	Metagenome	Rhizosphere
389	3300042461	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366	Metagenome	Rhizosphere
390	3300042530	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047	Metagenome	Rhizosphere
391	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
392	3300042993	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372	Metagenome	Rhizosphere
393	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
394	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
395	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
396	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
397	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
398	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
399	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
400	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
401	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
402	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
403	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
404	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
405	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
406	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
407	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
408	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
409	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
410	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
411	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
412	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
413	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
414	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
415	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
416	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
417	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
418	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
419	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
420	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
421	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
422	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
423	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
424	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
425	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
426	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
427	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
428	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
429	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
430	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
431	3300046525	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere	Metagenome	Rhizosphere
432	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
433	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
434	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
435	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
436	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
437	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
438	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
439	3300046537	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere	Metagenome	Rhizosphere
440	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
441	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
442	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
443	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
444	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
445	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
446	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
447	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
448	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
449	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
450	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
451	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
452	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
453	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
454	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
455	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
456	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
457	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
458	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
459	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
460	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
461	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
462	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
463	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
464	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
465	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
466	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
467	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
468	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
469	3300047447	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere	Metagenome	Rhizosphere
470	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
471	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
472	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
473	3300048090	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere	Metagenome	Rhizosphere
474	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
475	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
476	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
477	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
478	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
479	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
480	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
481	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
482	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
483	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
484	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
485	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
486	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
487	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
488	3300049162	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
489	3300049513	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control	Metagenome	Rhizosphere
490	3300049514	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought	Metagenome	Rhizosphere
491	3300049521	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought	Metagenome	Rhizosphere
492	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
493	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
494	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
495	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
496	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
497	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
498	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
499	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
500	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
501	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
502	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
503	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
504	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
505	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
506	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
507	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
508	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
509	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
510	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
511	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
512	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
513	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
514	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
515	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
516	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
517	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
518	3300049653	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control	Metagenome	Rhizosphere
519	3300049655	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought	Metagenome	Rhizosphere
520	3300049657	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought	Metagenome	Rhizosphere
521	3300049661	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control	Metagenome	Rhizosphere
522	3300049665	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought	Metagenome	Rhizosphere
523	3300049669	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought	Metagenome	Rhizosphere
524	3300049679	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought	Metagenome	Rhizosphere
525	3300049686	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control	Metagenome	Rhizosphere
526	3300049705	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought	Metagenome	Rhizosphere
527	3300049707	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought	Metagenome	Rhizosphere
528	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
529	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
530	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
531	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
532	3300049769	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought	Metagenome	Rhizosphere
533	3300049770	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control	Metagenome	Rhizosphere
534	3300049774	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought	Metagenome	Rhizosphere
535	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
536	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
537	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
538	3300049851	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought	Metagenome	Rhizosphere
539	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
540	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
541	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
542	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
543	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
544	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
545	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
546	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
547	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
548	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
549	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
550	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
551	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
552	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
553	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
554	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
555	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
556	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
557	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
558	3300053104	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere	Metagenome	Endosphere
559	3300053129	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere	Metagenome	Endosphere
560	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
561	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
562	3300053158	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere	Metagenome	Endosphere
563	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
564	3300059421	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
565	3300059423	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
566	3300059424	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
567	3300059426	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
568	3300059490	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
569	3300059491	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
570	3300059506	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
571	3300059511	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
572	3300059513	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
573	3300059623	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
574	3300059625	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
575	3300059627	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
576	3300059640	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
577	3300059655	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
578	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
579	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
580	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	98.25
Metatranscriptomes	1.75
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	1.43
Nodule	0
Rhizoplane	2.21
Rhizosphere	94.14
Stem	0
Stem Tuber	0
Unclassified	2.21

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	LJNas_1001687	3300000546	Bacteria	2987
2	JGI24744J21845_10081047	3300002077	Bacteria	593
3	JGI24034J26672_10070390	3300002239	Bacteria	626
4	JGI25406J46586_10004601	3300003203	Bacteria	6420
5	JGI25406J46586_10077588	3300003203	Bacteria	1026
6	Ga0007410J51695_1071996	3300003574	Bacteria	677
7	Ga0007409J51694_1040163	3300003575	Bacteria	3389
8	Ga0058863_11724041	3300004799	Bacteria	1253
9	Ga0058860_10011966	3300004801	Bacteria	1019
10	Ga0058860_11893700	3300004801	Bacteria	660
11	Ga0065714_10158492	3300005288	Bacteria	1065
12	Ga0065714_10170390	3300005288	Bacteria	1007
13	Ga0065704_10033039	3300005289	Bacteria	996
14	Ga0065704_10135708	3300005289	Bacteria	1574
15	Ga0065712_10001248	3300005290	Bacteria	11167
16	Ga0065712_10001330	3300005290	Bacteria	7767
17	Ga0065712_10004633	3300005290	Bacteria	3547
18	Ga0065712_10007643	3300005290	Bacteria	2353
19	Ga0065712_10073977	3300005290	Bacteria	4220
20	Ga0065712_10087066	3300005290	Bacteria	2599
21	Ga0065712_10207534	3300005290	Bacteria	1085
22	Ga0065712_10408841	3300005290	Bacteria	723
23	Ga0065715_10001224	3300005293	Bacteria	10036
24	Ga0065715_10003690	3300005293	Bacteria	6152
25	Ga0065715_10013683	3300005293	Bacteria	2364
26	Ga0065715_10026741	3300005293	Bacteria	1582
27	Ga0065715_10230445	3300005293	Bacteria	1236
28	Ga0065715_10252487	3300005293	Bacteria	1163
29	Ga0065715_10307543	3300005293	Bacteria	1013
30	Ga0065715_10398204	3300005293	Bacteria	882
31	Ga0065715_10725569	3300005293	Bacteria	639
32	Ga0065715_10745601	3300005293	Bacteria	632
33	Ga0065715_11140061	3300005293	Bacteria	511
34	Ga0065707_10008221	3300005295	Bacteria	3499
35	Ga0065707_10013464	3300005295	Bacteria	3153
36	Ga0065707_10020108	3300005295	Bacteria	1943
37	Ga0065707_10085242	3300005295	Bacteria	6325
38	Ga0065707_10123082	3300005295	Bacteria	2073
39	Ga0065707_10140099	3300005295	Bacteria	1784
40	Ga0065707_10220891	3300005295	Bacteria	1225
41	Ga0065707_10416027	3300005295	Bacteria	836
42	Ga0070658_10015417	3300005327	Bacteria	6115
43	Ga0070658_10104987	3300005327	Bacteria	2337
44	Ga0070658_10724255	3300005327	Bacteria	864
45	Ga0070676_10014090	3300005328	Bacteria	4388
46	Ga0070676_10079279	3300005328	Bacteria	1988
47	Ga0070676_10130334	3300005328	Bacteria	1589
48	Ga0070676_10162744	3300005328	Bacteria	1437
49	Ga0070676_10251975	3300005328	Bacteria	1178
50	Ga0070683_100000726	3300005329	Bacteria	24102
51	Ga0070683_100045854	3300005329	Bacteria	4035
52	Ga0070683_101374839	3300005329	Bacteria	679
53	Ga0070683_101570657	3300005329	Bacteria	633
54	Ga0070690_100050578	3300005330	Bacteria	2651
55	Ga0070690_100155007	3300005330	Bacteria	1565
56	Ga0070690_100182062	3300005330	Bacteria	1452
57	Ga0070690_100213739	3300005330	Bacteria	1348
58	Ga0070690_101037043	3300005330	Bacteria	648
59	Ga0070670_100013308	3300005331	Bacteria	7047
60	Ga0070670_100018641	3300005331	Bacteria	5947
61	Ga0070670_100021447	3300005331	Bacteria	5557
62	Ga0070670_100039587	3300005331	Bacteria	4053
63	Ga0070670_100084186	3300005331	Bacteria	2732
64	Ga0070670_100254115	3300005331	Bacteria	1531
65	Ga0070670_100268411	3300005331	Bacteria	1488
66	Ga0070670_100344000	3300005331	Bacteria	1309
67	Ga0070670_100431031	3300005331	Bacteria	1167
68	Ga0070670_100504789	3300005331	Bacteria	1076
69	Ga0070670_100664284	3300005331	Bacteria	936
70	Ga0070670_100928731	3300005331	Bacteria	790
71	Ga0070677_10051828	3300005333	Bacteria	1663
72	Ga0070677_10245032	3300005333	Bacteria	887
73	Ga0070677_10434824	3300005333	Bacteria	699
74	Ga0070677_10552138	3300005333	Bacteria	632
75	Ga0070677_10804046	3300005333	Bacteria	537
76	Ga0068869_100103378	3300005334	Bacteria	2158
77	Ga0068869_100146086	3300005334	Bacteria	1830
78	Ga0068869_100150892	3300005334	Bacteria	1802
79	Ga0068869_100164987	3300005334	Bacteria	1727
80	Ga0068869_100255380	3300005334	Bacteria	1401
81	Ga0068869_100344912	3300005334	Bacteria	1213
82	Ga0068869_100368006	3300005334	Bacteria	1175
83	Ga0068869_100487269	3300005334	Bacteria	1027
84	Ga0068869_101143085	3300005334	Bacteria	682
85	Ga0068869_101220076	3300005334	Bacteria	661
86	Ga0070666_10019993	3300005335	Bacteria	4326
87	Ga0070666_10028665	3300005335	Bacteria	3654
88	Ga0070666_10050900	3300005335	Bacteria	2787
89	Ga0070666_10096045	3300005335	Bacteria	2040
90	Ga0070666_10177673	3300005335	Bacteria	1492
91	Ga0070680_100002147	3300005336	Bacteria	14571
92	Ga0070680_100017145	3300005336	Bacteria	5706
93	Ga0070680_100078049	3300005336	Bacteria	2728
94	Ga0070680_100090495	3300005336	Bacteria	2533
95	Ga0070680_100136118	3300005336	Bacteria	2058
96	Ga0070680_100211172	3300005336	Bacteria	1638
97	Ga0070680_100239648	3300005336	Bacteria	1533
98	Ga0070680_100670775	3300005336	Bacteria	892
99	Ga0070680_101073981	3300005336	Bacteria	696
100	Ga0070682_100244290	3300005337	Bacteria	1290
101	Ga0070682_100254169	3300005337	Bacteria	1268
102	Ga0070682_100340832	3300005337	Bacteria	1114
103	Ga0068868_100005009	3300005338	Bacteria	9304
104	Ga0068868_100034808	3300005338	Bacteria	3890
105	Ga0068868_100271206	3300005338	Bacteria	1433
106	Ga0068868_100757899	3300005338	Bacteria	873
107	Ga0068868_101316151	3300005338	Bacteria	671
108	Ga0070660_100141693	3300005339	Bacteria	1929
109	Ga0070660_101209127	3300005339	Bacteria	641
110	Ga0070689_100022608	3300005340	Bacteria	4697
111	Ga0070689_100033346	3300005340	Bacteria	3923
112	Ga0070689_100041808	3300005340	Bacteria	3518
113	Ga0070689_100063440	3300005340	Bacteria	2875
114	Ga0070689_100086181	3300005340	Bacteria	2470
115	Ga0070689_100115211	3300005340	Bacteria	2142
116	Ga0070689_100209522	3300005340	Bacteria	1595
117	Ga0070689_100315320	3300005340	Bacteria	1304
118	Ga0070689_100358443	3300005340	Bacteria	1225
119	Ga0070689_100540615	3300005340	Bacteria	1003
120	Ga0070689_100927457	3300005340	Bacteria	771
121	Ga0070691_10011131	3300005341	Bacteria	4106
122	Ga0070691_10025987	3300005341	Bacteria	2728
123	Ga0070691_10259158	3300005341	Bacteria	935
124	Ga0070687_100004670	3300005343	Bacteria	5477
125	Ga0070687_100072345	3300005343	Bacteria	1855
126	Ga0070687_100086599	3300005343	Bacteria	1722
127	Ga0070687_100389176	3300005343	Bacteria	911
128	Ga0070687_100390480	3300005343	Bacteria	909
129	Ga0070687_100740077	3300005343	Bacteria	691
130	Ga0070661_100052859	3300005344	Bacteria	2972
131	Ga0070661_100081951	3300005344	Bacteria	2383
132	Ga0070661_100142843	3300005344	Bacteria	1805
133	Ga0070661_100329049	3300005344	Bacteria	1195
134	Ga0070661_100561233	3300005344	Bacteria	920
135	Ga0070661_100737374	3300005344	Bacteria	805
136	Ga0070661_100985250	3300005344	Bacteria	699
137	Ga0070692_10019404	3300005345	Bacteria	3281
138	Ga0070692_10032375	3300005345	Bacteria	2628
139	Ga0070692_10036525	3300005345	Bacteria	2494
140	Ga0070692_10683548	3300005345	Bacteria	689
141	Ga0070692_11299744	3300005345	Bacteria	522
142	Ga0070668_100152202	3300005347	Bacteria	1872
143	Ga0070668_100228695	3300005347	Bacteria	1536
144	Ga0070668_100500800	3300005347	Bacteria	1051
145	Ga0070668_100515574	3300005347	Bacteria	1037
146	Ga0070668_100573269	3300005347	Bacteria	984
147	Ga0070668_101068291	3300005347	Bacteria	728
148	Ga0070669_100001695	3300005353	Bacteria	15953
149	Ga0070669_100004188	3300005353	Bacteria	10451
150	Ga0070669_100010881	3300005353	Bacteria	6458
151	Ga0070669_100071453	3300005353	Bacteria	2567
152	Ga0070669_100076899	3300005353	Bacteria	2478
153	Ga0070669_100094162	3300005353	Bacteria	2251
154	Ga0070669_100132419	3300005353	Bacteria	1914
155	Ga0070669_100135844	3300005353	Bacteria	1891
156	Ga0070669_100220461	3300005353	Bacteria	1499
157	Ga0070669_100276330	3300005353	Bacteria	1345
158	Ga0070669_100463819	3300005353	Bacteria	1046
159	Ga0070669_100604751	3300005353	Bacteria	919
160	Ga0070669_100905549	3300005353	Bacteria	753
161	Ga0070675_100004981	3300005354	Bacteria	10137
162	Ga0070675_100007191	3300005354	Bacteria	8578
163	Ga0070675_100014470	3300005354	Bacteria	6222
164	Ga0070675_100015584	3300005354	Bacteria	6014
165	Ga0070675_100025441	3300005354	Bacteria	4745
166	Ga0070675_100059893	3300005354	Bacteria	3142
167	Ga0070675_100068991	3300005354	Bacteria	2928
168	Ga0070675_100136564	3300005354	Bacteria	2093
169	Ga0070675_100138387	3300005354	Bacteria	2079
170	Ga0070675_100292812	3300005354	Bacteria	1433
171	Ga0070675_100294187	3300005354	Bacteria	1429
172	Ga0070675_100372698	3300005354	Bacteria	1269
173	Ga0070675_100537934	3300005354	Bacteria	1055
174	Ga0070675_100566339	3300005354	Bacteria	1028
175	Ga0070675_100582859	3300005354	Bacteria	1014
176	Ga0070675_100910863	3300005354	Bacteria	806
177	Ga0070675_101553508	3300005354	Bacteria	610
178	Ga0070671_100097474	3300005355	Bacteria	2466
179	Ga0070671_100118858	3300005355	Bacteria	2223
180	Ga0070671_100760368	3300005355	Bacteria	842
181	Ga0070671_101110137	3300005355	Bacteria	695
182	Ga0070671_101271503	3300005355	Bacteria	649
183	Ga0070674_100012403	3300005356	Bacteria	5234
184	Ga0070674_100015536	3300005356	Bacteria	4754
185	Ga0070674_100075244	3300005356	Bacteria	2397
186	Ga0070674_100084034	3300005356	Bacteria	2282
187	Ga0070674_100095772	3300005356	Bacteria	2152
188	Ga0070674_100176832	3300005356	Bacteria	1631
189	Ga0070674_100298926	3300005356	Bacteria	1282
190	Ga0070674_100476107	3300005356	Bacteria	1035
191	Ga0070674_100681839	3300005356	Bacteria	877
192	Ga0070674_100818159	3300005356	Bacteria	806
193	Ga0070674_100827223	3300005356	Bacteria	801
194	Ga0070673_100003685	3300005364	Bacteria	9600
195	Ga0070673_100004781	3300005364	Bacteria	8602
196	Ga0070673_100062278	3300005364	Bacteria	2963
197	Ga0070673_100098503	3300005364	Bacteria	2403
198	Ga0070673_100166539	3300005364	Bacteria	1878
199	Ga0070673_100210652	3300005364	Bacteria	1678
200	Ga0070673_100270783	3300005364	Bacteria	1486
201	Ga0070673_100286032	3300005364	Bacteria	1447
202	Ga0070673_100312532	3300005364	Bacteria	1386
203	Ga0070673_100464213	3300005364	Bacteria	1140
204	Ga0070673_100494573	3300005364	Bacteria	1105
205	Ga0070673_100541530	3300005364	Bacteria	1057
206	Ga0070673_100595888	3300005364	Bacteria	1008
207	Ga0070673_101200329	3300005364	Bacteria	711
208	Ga0070688_100003817	3300005365	Bacteria	7811
209	Ga0070688_100104043	3300005365	Bacteria	1877
210	Ga0070688_100123925	3300005365	Bacteria	1734
211	Ga0070688_100223754	3300005365	Bacteria	1327
212	Ga0070688_100271226	3300005365	Bacteria	1216
213	Ga0070688_100425783	3300005365	Bacteria	987
214	Ga0070688_100552336	3300005365	Bacteria	876
215	Ga0070688_100619000	3300005365	Bacteria	830
216	Ga0070659_100163155	3300005366	Bacteria	1823
217	Ga0070659_100293669	3300005366	Bacteria	1354
218	Ga0070659_101215863	3300005366	Bacteria	667
219	Ga0070659_101395704	3300005366	Bacteria	622
220	Ga0070659_101729487	3300005366	Bacteria	560
221	Ga0070659_102034408	3300005366	Bacteria	516
222	Ga0070667_100080432	3300005367	Bacteria	2787
223	Ga0070667_100137825	3300005367	Bacteria	2134
224	Ga0070667_100177440	3300005367	Bacteria	1883
225	Ga0070667_100346211	3300005367	Bacteria	1345
226	Ga0070667_100498973	3300005367	Bacteria	1115
227	Ga0070667_100819449	3300005367	Bacteria	864
228	Ga0070703_10002736	3300005406	Bacteria	5063
229	Ga0070709_10000098	3300005434	Bacteria	61823
230	Ga0070709_10001304	3300005434	Bacteria	13588
231	Ga0070709_10087532	3300005434	Bacteria	2047
232	Ga0070709_10105469	3300005434	Bacteria	1885
233	Ga0070709_10131419	3300005434	Bacteria	1709
234	Ga0070709_10315667	3300005434	Bacteria	1145
235	Ga0070709_10973490	3300005434	Bacteria	674
236	Ga0070709_11143934	3300005434	Bacteria	624
237	Ga0070714_100105831	3300005435	Bacteria	2484
238	Ga0070714_100116429	3300005435	Bacteria	2373
239	Ga0070714_100479264	3300005435	Bacteria	1184
240	Ga0070714_100610761	3300005435	Bacteria	1048
241	Ga0070714_101062460	3300005435	Bacteria	789
242	Ga0070714_101075338	3300005435	Bacteria	784
243	Ga0070714_101185717	3300005435	Bacteria	745
244	Ga0070713_100003189	3300005436	Bacteria	10795
245	Ga0070713_100004545	3300005436	Bacteria	9350
246	Ga0070713_100009214	3300005436	Bacteria	7047
247	Ga0070713_100107581	3300005436	Bacteria	2426
248	Ga0070713_100130441	3300005436	Bacteria	2216
249	Ga0070713_100173014	3300005436	Bacteria	1935
250	Ga0070713_100237985	3300005436	Bacteria	1657
251	Ga0070713_100958679	3300005436	Bacteria	824
252	Ga0070713_101324980	3300005436	Bacteria	698
253	Ga0070710_10007025	3300005437	Bacteria	5433
254	Ga0070710_10278323	3300005437	Bacteria	1085
255	Ga0070710_10525223	3300005437	Bacteria	814
256	Ga0070710_10687860	3300005437	Bacteria	721
257	Ga0070701_10002134	3300005438	Bacteria	7524
258	Ga0070701_10005353	3300005438	Bacteria	5289
259	Ga0070701_10052608	3300005438	Bacteria	2116
260	Ga0070701_10059153	3300005438	Bacteria	2013
261	Ga0070701_10062331	3300005438	Bacteria	1969
262	Ga0070701_10087038	3300005438	Bacteria	1704
263	Ga0070701_10133123	3300005438	Bacteria	1414
264	Ga0070701_10158647	3300005438	Bacteria	1309
265	Ga0070701_10265530	3300005438	Bacteria	1042
266	Ga0070701_10267569	3300005438	Bacteria	1038
267	Ga0070701_10642169	3300005438	Bacteria	708
268	Ga0070701_11149138	3300005438	Bacteria	549
269	Ga0070711_100000059	3300005439	Bacteria	65064
270	Ga0070711_100001361	3300005439	Bacteria	13347
271	Ga0070711_100011497	3300005439	Bacteria	5500
272	Ga0070711_100069416	3300005439	Bacteria	2479
273	Ga0070711_100485242	3300005439	Bacteria	1016
274	Ga0070711_100505780	3300005439	Bacteria	997
275	Ga0070705_100000175	3300005440	Bacteria	37567
276	Ga0070705_100000819	3300005440	Bacteria	17502
277	Ga0070705_100017087	3300005440	Bacteria	3781
278	Ga0070705_100111972	3300005440	Bacteria	1746
279	Ga0070705_100131563	3300005440	Bacteria	1633
280	Ga0070705_100189753	3300005440	Bacteria	1399
281	Ga0070705_100292718	3300005440	Bacteria	1163
282	Ga0070705_100443874	3300005440	Bacteria	972
283	Ga0070705_100937525	3300005440	Bacteria	699
284	Ga0070700_100050268	3300005441	Bacteria	2591
285	Ga0070700_100079899	3300005441	Bacteria	2109
286	Ga0070700_100103309	3300005441	Bacteria	1882
287	Ga0070700_100106484	3300005441	Bacteria	1856
288	Ga0070700_100292961	3300005441	Bacteria	1185
289	Ga0070700_100315382	3300005441	Bacteria	1147
290	Ga0070700_100354004	3300005441	Bacteria	1089
291	Ga0070700_100357647	3300005441	Bacteria	1084
292	Ga0070700_100385841	3300005441	Bacteria	1049
293	Ga0070700_100411383	3300005441	Bacteria	1020
294	Ga0070700_100548611	3300005441	Bacteria	897
295	Ga0070700_100775541	3300005441	Bacteria	770
296	Ga0070700_100961265	3300005441	Bacteria	700
297	Ga0070694_100076927	3300005444	Bacteria	2311
298	Ga0070694_100082310	3300005444	Bacteria	2241
299	Ga0070694_100237307	3300005444	Bacteria	1374
300	Ga0070694_100254644	3300005444	Bacteria	1329
301	Ga0070694_100303838	3300005444	Bacteria	1223
302	Ga0070694_100322218	3300005444	Bacteria	1190
303	Ga0070694_100376786	3300005444	Bacteria	1106
304	Ga0070694_100707660	3300005444	Bacteria	819
305	Ga0070694_100822918	3300005444	Bacteria	762
306	Ga0070694_100884481	3300005444	Bacteria	737
307	Ga0070708_100114080	3300005445	Bacteria	2486
308	Ga0070708_100182201	3300005445	Bacteria	1963
309	Ga0070708_100401355	3300005445	Bacteria	1293
310	Ga0070708_101751779	3300005445	Bacteria	577
311	Ga0070663_100006907	3300005455	Bacteria	6873
312	Ga0070663_100014660	3300005455	Bacteria	5036
313	Ga0070663_100016120	3300005455	Bacteria	4841
314	Ga0070678_100004485	3300005456	Bacteria	7921
315	Ga0070678_100092673	3300005456	Bacteria	2321
316	Ga0070678_100215478	3300005456	Bacteria	1593
317	Ga0070678_100302565	3300005456	Bacteria	1359
318	Ga0070678_100405896	3300005456	Bacteria	1185
319	Ga0070678_100454284	3300005456	Bacteria	1123
320	Ga0070678_101055623	3300005456	Bacteria	749
321	Ga0070662_100106420	3300005457	Bacteria	2130
322	Ga0070662_100122731	3300005457	Bacteria	1993
323	Ga0070662_100197971	3300005457	Bacteria	1592
324	Ga0070662_100450781	3300005457	Bacteria	1068
325	Ga0070662_100676966	3300005457	Bacteria	872
326	Ga0070681_10012326	3300005458	Bacteria	8476
327	Ga0070681_10029747	3300005458	Bacteria	5483
328	Ga0070681_10048010	3300005458	Bacteria	4267
329	Ga0070681_10065223	3300005458	Bacteria	3610
330	Ga0070681_10197421	3300005458	Bacteria	1931
331	Ga0070681_10367651	3300005458	Bacteria	1348
332	Ga0070681_10745861	3300005458	Bacteria	896
333	Ga0070681_10870718	3300005458	Bacteria	819
334	Ga0070681_10893788	3300005458	Bacteria	807
335	Ga0070681_10937401	3300005458	Bacteria	785
336	Ga0070681_11138352	3300005458	Bacteria	702
337	Ga0068867_100007115	3300005459	Bacteria	7904
338	Ga0068867_100008420	3300005459	Bacteria	7274
339	Ga0068867_100063207	3300005459	Bacteria	2751
340	Ga0068867_100153181	3300005459	Bacteria	1812
341	Ga0068867_100321290	3300005459	Bacteria	1282
342	Ga0068867_100432308	3300005459	Bacteria	1118
343	Ga0070685_10034211	3300005466	Bacteria	2861
344	Ga0070685_10119396	3300005466	Bacteria	1635
345	Ga0070685_10594422	3300005466	Bacteria	795
346	Ga0070685_10712589	3300005466	Bacteria	733
347	Ga0070706_100018325	3300005467	Bacteria	6460
348	Ga0070706_100074444	3300005467	Bacteria	3143
349	Ga0070706_100113508	3300005467	Bacteria	2523
350	Ga0070706_100154037	3300005467	Bacteria	2145
351	Ga0070706_100188506	3300005467	Bacteria	1927
352	Ga0070706_100243082	3300005467	Bacteria	1681
353	Ga0070706_100727191	3300005467	Bacteria	920
354	Ga0070706_101070506	3300005467	Bacteria	743
355	Ga0070706_101162304	3300005467	Bacteria	710
356	Ga0070706_101864446	3300005467	Bacteria	546
357	Ga0070707_100000221	3300005468	Bacteria	57035
358	Ga0070707_100028747	3300005468	Bacteria	5291
359	Ga0070707_100037632	3300005468	Bacteria	4618
360	Ga0070707_100143317	3300005468	Bacteria	2325
361	Ga0070707_100179164	3300005468	Bacteria	2066
362	Ga0070707_100396768	3300005468	Bacteria	1339
363	Ga0070707_100594968	3300005468	Bacteria	1068
364	Ga0070707_101363425	3300005468	Bacteria	676
365	Ga0070698_100010970	3300005471	Bacteria	9640
366	Ga0070698_100023916	3300005471	Bacteria	6378
367	Ga0070698_100036969	3300005471	Bacteria	5037
368	Ga0070698_100113085	3300005471	Bacteria	2680
369	Ga0070698_100147912	3300005471	Bacteria	2297
370	Ga0070698_100218332	3300005471	Bacteria	1841
371	Ga0070698_100338707	3300005471	Bacteria	1436
372	Ga0070698_100378004	3300005471	Bacteria	1349
373	Ga0070698_100416301	3300005471	Bacteria	1278
374	Ga0070698_100582784	3300005471	Bacteria	1059
375	Ga0070698_100927189	3300005471	Bacteria	817
376	Ga0070698_101077958	3300005471	Bacteria	752
377	Ga0070699_100000009	3300005518	Bacteria	272902
378	Ga0070699_100004496	3300005518	Bacteria	12337
379	Ga0070699_100029345	3300005518	Bacteria	4743
380	Ga0070699_100059675	3300005518	Bacteria	3304
381	Ga0070699_100149286	3300005518	Bacteria	2067
382	Ga0070699_100179427	3300005518	Bacteria	1879
383	Ga0070699_100253264	3300005518	Bacteria	1573
384	Ga0070699_100260953	3300005518	Bacteria	1549
385	Ga0070699_100299934	3300005518	Bacteria	1441
386	Ga0070699_100319677	3300005518	Bacteria	1395
387	Ga0070699_100554178	3300005518	Bacteria	1046
388	Ga0070699_100691717	3300005518	Bacteria	931
389	Ga0070699_100695578	3300005518	Bacteria	929
390	Ga0070699_100801484	3300005518	Bacteria	862
391	Ga0070699_101452480	3300005518	Bacteria	629
392	Ga0070679_100002074	3300005530	Bacteria	18031
393	Ga0070679_100039507	3300005530	Bacteria	4690
394	Ga0070679_100178886	3300005530	Bacteria	2094
395	Ga0070679_100200414	3300005530	Bacteria	1962
396	Ga0070679_100269282	3300005530	Bacteria	1658
397	Ga0070684_100000236	3300005535	Bacteria	38259
398	Ga0070684_100002839	3300005535	Bacteria	12871
399	Ga0070684_100010407	3300005535	Bacteria	7368
400	Ga0070684_100052381	3300005535	Bacteria	3550
401	Ga0070684_100575947	3300005535	Bacteria	1046
402	Ga0070684_100711488	3300005535	Bacteria	937
403	Ga0070684_100766927	3300005535	Bacteria	901
404	Ga0070697_100148214	3300005536	Bacteria	1977
405	Ga0070697_100161060	3300005536	Bacteria	1896
406	Ga0070697_100178610	3300005536	Bacteria	1799
407	Ga0070697_100208884	3300005536	Bacteria	1661
408	Ga0070697_100255520	3300005536	Bacteria	1499
409	Ga0070697_100284714	3300005536	Bacteria	1418
410	Ga0070697_100617459	3300005536	Bacteria	953
411	Ga0070697_100824633	3300005536	Bacteria	821
412	Ga0070697_100946470	3300005536	Bacteria	765
413	Ga0068853_100812635	3300005539	Bacteria	896
414	Ga0068853_101103149	3300005539	Bacteria	765
415	Ga0068853_101546104	3300005539	Bacteria	643
416	Ga0070672_100010895	3300005543	Bacteria	6323
417	Ga0070672_100017126	3300005543	Bacteria	5209
418	Ga0070672_100071248	3300005543	Bacteria	2764
419	Ga0070672_100076814	3300005543	Bacteria	2669
420	Ga0070672_100079352	3300005543	Bacteria	2627
421	Ga0070672_100111470	3300005543	Bacteria	2230
422	Ga0070672_100118563	3300005543	Bacteria	2164
423	Ga0070672_100159056	3300005543	Bacteria	1873
424	Ga0070672_100181803	3300005543	Bacteria	1752
425	Ga0070672_100211113	3300005543	Bacteria	1626
426	Ga0070672_100284329	3300005543	Bacteria	1399
427	Ga0070672_100304545	3300005543	Bacteria	1351
428	Ga0070672_100482402	3300005543	Unclassified	1071
429	Ga0070672_100732824	3300005543	Bacteria	867
430	Ga0070672_100746642	3300005543	Bacteria	859
431	Ga0070686_100002243	3300005544	Bacteria	10661
432	Ga0070686_100042575	3300005544	Bacteria	2845
433	Ga0070686_100061211	3300005544	Bacteria	2432
434	Ga0070686_100115364	3300005544	Bacteria	1836
435	Ga0070686_100122762	3300005544	Bacteria	1785
436	Ga0070686_100158136	3300005544	Bacteria	1593
437	Ga0070686_100191927	3300005544	Bacteria	1458
438	Ga0070686_100219637	3300005544	Bacteria	1373
439	Ga0070686_100512450	3300005544	Bacteria	933
440	Ga0070686_100649077	3300005544	Bacteria	836
441	Ga0070686_100700772	3300005544	Bacteria	808
442	Ga0070686_100706582	3300005544	Bacteria	804
443	Ga0070686_101170437	3300005544	Bacteria	638
444	Ga0070695_100004877	3300005545	Bacteria	7900
445	Ga0070695_100006901	3300005545	Bacteria	6724
446	Ga0070695_100076433	3300005545	Bacteria	2205
447	Ga0070695_100122205	3300005545	Bacteria	1783
448	Ga0070695_100464738	3300005545	Bacteria	972
449	Ga0070695_100645009	3300005545	Bacteria	836
450	Ga0070696_100006858	3300005546	Bacteria	7600
451	Ga0070696_100018915	3300005546	Bacteria	4663
452	Ga0070696_100026481	3300005546	Bacteria	3945
453	Ga0070696_100184495	3300005546	Bacteria	1549
454	Ga0070696_100337716	3300005546	Bacteria	1163
455	Ga0070696_100347694	3300005546	Bacteria	1148
456	Ga0070696_101169906	3300005546	Bacteria	649
457	Ga0070693_100003030	3300005547	Bacteria	7786
458	Ga0070693_100008359	3300005547	Bacteria	5098
459	Ga0070693_100301898	3300005547	Bacteria	1080
460	Ga0070693_100358657	3300005547	Bacteria	1000
461	Ga0070693_100702197	3300005547	Bacteria	741
462	Ga0070665_100029874	3300005548	Bacteria	5485
463	Ga0070665_100261265	3300005548	Bacteria	1733
464	Ga0070665_100459854	3300005548	Bacteria	1283
465	Ga0070665_100496293	3300005548	Bacteria	1232
466	Ga0070704_100000751	3300005549	Bacteria	15957
467	Ga0070704_100030754	3300005549	Bacteria	3601
468	Ga0070704_100034011	3300005549	Bacteria	3452
469	Ga0070704_100047708	3300005549	Bacteria	2995
470	Ga0070704_100208395	3300005549	Bacteria	1582
471	Ga0070704_100212720	3300005549	Bacteria	1567
472	Ga0070704_100521098	3300005549	Bacteria	1035
473	Ga0070704_100758035	3300005549	Bacteria	865
474	Ga0070704_101085418	3300005549	Bacteria	726
475	Ga0070704_101233829	3300005549	Bacteria	683
476	Ga0068855_100050186	3300005563	Bacteria	4918
477	Ga0068855_100066908	3300005563	Bacteria	4188
478	Ga0068855_100471757	3300005563	Bacteria	1367
479	Ga0068855_100527203	3300005563	Bacteria	1281
480	Ga0068855_101911150	3300005563	Bacteria	601
481	Ga0070664_100001147	3300005564	Bacteria	20989
482	Ga0070664_100006932	3300005564	Bacteria	9130
483	Ga0070664_100007621	3300005564	Bacteria	8741
484	Ga0070664_100014134	3300005564	Bacteria	6512
485	Ga0070664_100021515	3300005564	Bacteria	5316
486	Ga0070664_100120656	3300005564	Bacteria	2295
487	Ga0070664_100240838	3300005564	Bacteria	1624
488	Ga0070664_100421453	3300005564	Bacteria	1223
489	Ga0070664_100694720	3300005564	Bacteria	947
490	Ga0070664_100890053	3300005564	Bacteria	834
491	Ga0070664_101319850	3300005564	Bacteria	681
492	Ga0068857_100001770	3300005577	Bacteria	17362
493	Ga0068857_100046867	3300005577	Bacteria	3836
494	Ga0068857_100103260	3300005577	Bacteria	2559
495	Ga0068857_100141171	3300005577	Bacteria	2177
496	Ga0068857_100330068	3300005577	Bacteria	1410
497	Ga0068857_100383350	3300005577	Bacteria	1306
498	Ga0068857_100730820	3300005577	Bacteria	942
499	Ga0068857_100797489	3300005577	Bacteria	902
500	Ga0068857_101051465	3300005577	Bacteria	785
501	Ga0068857_101128921	3300005577	Bacteria	757
502	Ga0068857_101484046	3300005577	Bacteria	660
503	Ga0068854_100011828	3300005578	Bacteria	5698
504	Ga0068854_100084206	3300005578	Bacteria	2353
505	Ga0068854_100192971	3300005578	Bacteria	1597
506	Ga0068854_100356614	3300005578	Bacteria	1198
507	Ga0068854_100525838	3300005578	Bacteria	1000
508	Ga0068854_101121514	3300005578	Bacteria	702
509	Ga0068854_101320646	3300005578	Bacteria	650
510	Ga0068856_100012640	3300005614	Bacteria	8174
511	Ga0068856_100014911	3300005614	Bacteria	7502
512	Ga0068856_100021410	3300005614	Bacteria	6286
513	Ga0068856_100186927	3300005614	Bacteria	2085
514	Ga0068856_100438963	3300005614	Bacteria	1326
515	Ga0068856_100692332	3300005614	Bacteria	1040
516	Ga0068856_101145685	3300005614	Bacteria	794
517	Ga0068856_101325868	3300005614	Bacteria	735
518	Ga0070702_100023468	3300005615	Bacteria	3278
519	Ga0070702_100041855	3300005615	Bacteria	2572
520	Ga0070702_100526916	3300005615	Bacteria	872
521	Ga0070702_100699171	3300005615	Bacteria	772
522	Ga0070702_101351110	3300005615	Bacteria	581
523	Ga0068852_100007501	3300005616	Bacteria	7961
524	Ga0068852_100026423	3300005616	Bacteria	4718
525	Ga0068852_100244072	3300005616	Bacteria	1718
526	Ga0068852_100439411	3300005616	Bacteria	1290
527	Ga0068852_100836559	3300005616	Bacteria	936
528	Ga0068852_101434011	3300005616	Bacteria	713
529	Ga0068859_100030708	3300005617	Bacteria	5392
530	Ga0068859_100039359	3300005617	Bacteria	4743
531	Ga0068859_100070606	3300005617	Bacteria	3528
532	Ga0068859_100071027	3300005617	Bacteria	3517
533	Ga0068859_100139222	3300005617	Bacteria	2500
534	Ga0068859_100172586	3300005617	Bacteria	2244
535	Ga0068859_100195216	3300005617	Bacteria	2108
536	Ga0068859_100227698	3300005617	Bacteria	1952
537	Ga0068859_100308688	3300005617	Bacteria	1675
538	Ga0068859_100381515	3300005617	Bacteria	1505
539	Ga0068859_100390324	3300005617	Bacteria	1488
540	Ga0068859_100685577	3300005617	Bacteria	1116
541	Ga0068859_100733603	3300005617	Bacteria	1077
542	Ga0068859_100954411	3300005617	Bacteria	941
543	Ga0068859_101070329	3300005617	Bacteria	887
544	Ga0068859_101200021	3300005617	Bacteria	836
545	Ga0068859_101235569	3300005617	Bacteria	823
546	Ga0068859_101860317	3300005617	Bacteria	665
547	Ga0068864_100017656	3300005618	Bacteria	5950
548	Ga0068864_100083521	3300005618	Bacteria	2805
549	Ga0068864_100104627	3300005618	Bacteria	2515
550	Ga0068864_100222802	3300005618	Bacteria	1741
551	Ga0068864_100581868	3300005618	Bacteria	1085
552	Ga0068864_100594327	3300005618	Bacteria	1073
553	Ga0068866_10016782	3300005718	Bacteria	3280
554	Ga0068866_10102015	3300005718	Bacteria	1585
555	Ga0068861_100007625	3300005719	Bacteria	7426
556	Ga0068861_100012912	3300005719	Bacteria	5831
557	Ga0068861_100068173	3300005719	Bacteria	2749
558	Ga0068861_100068555	3300005719	Bacteria	2742
559	Ga0068861_100121690	3300005719	Bacteria	2106
560	Ga0068861_100285733	3300005719	Bacteria	1422
561	Ga0068861_100310619	3300005719	Bacteria	1369
562	Ga0068861_100376574	3300005719	Bacteria	1253
563	Ga0068861_100982573	3300005719	Bacteria	805
564	Ga0068851_10126664	3300005834	Bacteria	1377
565	Ga0068851_10270027	3300005834	Bacteria	970
566	Ga0068870_10000698	3300005840	Bacteria	12863
567	Ga0068870_10011864	3300005840	Bacteria	4055
568	Ga0068870_10018931	3300005840	Bacteria	3333
569	Ga0068870_10055278	3300005840	Bacteria	2115
570	Ga0068870_10138493	3300005840	Bacteria	1421
571	Ga0068870_10163239	3300005840	Bacteria	1323
572	Ga0068870_10164326	3300005840	Bacteria	1319
573	Ga0068870_10177626	3300005840	Bacteria	1275
574	Ga0068870_10349203	3300005840	Bacteria	949
575	Ga0068870_10767964	3300005840	Bacteria	671
576	Ga0068863_100026745	3300005841	Bacteria	5501
577	Ga0068863_100123429	3300005841	Bacteria	2471
578	Ga0068863_100607844	3300005841	Bacteria	1082
579	Ga0068863_100792845	3300005841	Bacteria	945
580	Ga0068863_101115750	3300005841	Bacteria	794
581	Ga0068863_101238108	3300005841	Bacteria	752
582	Ga0068863_101759381	3300005841	Bacteria	629
583	Ga0068858_100020935	3300005842	Bacteria	6111
584	Ga0068858_100098006	3300005842	Bacteria	2733
585	Ga0068858_100149733	3300005842	Bacteria	2193
586	Ga0068858_100182744	3300005842	Bacteria	1980
587	Ga0068858_100284992	3300005842	Bacteria	1573
588	Ga0068860_100023512	3300005843	Bacteria	5955
589	Ga0068860_100124992	3300005843	Bacteria	2465
590	Ga0068860_100152845	3300005843	Bacteria	2223
591	Ga0068860_100418677	3300005843	Bacteria	1327
592	Ga0068860_100886993	3300005843	Bacteria	908
593	Ga0068860_101200975	3300005843	Bacteria	779
594	Ga0068862_100005694	3300005844	Bacteria	10395
595	Ga0068862_100028432	3300005844	Bacteria	4708
596	Ga0068862_100040519	3300005844	Bacteria	3959
597	Ga0068862_100126523	3300005844	Bacteria	2256
598	Ga0068862_100174204	3300005844	Bacteria	1927
599	Ga0068862_100266012	3300005844	Bacteria	1567
600	Ga0068862_100285677	3300005844	Bacteria	1513
601	Ga0068862_100307596	3300005844	Bacteria	1460
602	Ga0068862_100373725	3300005844	Bacteria	1328
603	Ga0068862_100376849	3300005844	Bacteria	1322
604	Ga0068862_100405817	3300005844	Bacteria	1276
605	Ga0068862_100602739	3300005844	Bacteria	1055
606	Ga0068862_100708775	3300005844	Bacteria	975
607	Ga0068862_100786398	3300005844	Bacteria	928
608	Ga0068862_101000856	3300005844	Bacteria	827
609	Ga0068862_101263335	3300005844	Bacteria	739
610	Ga0068862_101677384	3300005844	Bacteria	643
611	Ga0068862_102140090	3300005844	Bacteria	571
612	Ga0081455_10187912	3300005937	Bacteria	1559
613	Ga0081538_10023137	3300005981	Bacteria	4476
614	Ga0081538_10100108	3300005981	Bacteria	1462
615	Ga0081538_10106236	3300005981	Bacteria	1394
616	Ga0081539_10000142	3300005985	Bacteria	165444
617	Ga0081539_10000215	3300005985	Bacteria	135054
618	Ga0081539_10008426	3300005985	Bacteria	8994
619	Ga0081539_10047557	3300005985	Bacteria	2448
620	Ga0081539_10087336	3300005985	Bacteria	1620
621	Ga0070717_10009206	3300006028	Bacteria	7421
622	Ga0070717_10014243	3300006028	Bacteria	6115
623	Ga0070717_10057068	3300006028	Bacteria	3227
624	Ga0070717_10196786	3300006028	Bacteria	1763
625	Ga0070717_10227353	3300006028	Bacteria	1642
626	Ga0070717_10870904	3300006028	Unclassified	820
627	Ga0070717_11069906	3300006028	Bacteria	735
628	Ga0070717_11143382	3300006028	Bacteria	709
629	Ga0070717_11393710	3300006028	Bacteria	637
630	Ga0075365_10061774	3300006038	Bacteria	2503
631	Ga0075365_10862343	3300006038	Bacteria	639
632	Ga0075368_10028530	3300006042	Bacteria	2156
633	Ga0075368_10048181	3300006042	Bacteria	1688
634	Ga0075363_100055304	3300006048	Bacteria	2126
635	Ga0075364_10011798	3300006051	Bacteria	5319
636	Ga0075364_10020392	3300006051	Bacteria	4168
637	Ga0070715_10002090	3300006163	Bacteria	6040
638	Ga0070715_10021656	3300006163	Bacteria	2496
639	Ga0070715_10080382	3300006163	Bacteria	1478
640	Ga0070715_10500960	3300006163	Bacteria	695
641	Ga0070716_100002371	3300006173	Bacteria	8670
642	Ga0070716_100041894	3300006173	Bacteria	2553
643	Ga0070716_100161948	3300006173	Bacteria	1451
644	Ga0070716_100202086	3300006173	Bacteria	1322
645	Ga0070716_100325494	3300006173	Bacteria	1079
646	Ga0070716_100426068	3300006173	Bacteria	961
647	Ga0070712_100003121	3300006175	Bacteria	10220
648	Ga0070712_100009424	3300006175	Bacteria	6154
649	Ga0070712_100010884	3300006175	Bacteria	5754
650	Ga0070712_100104418	3300006175	Bacteria	2103
651	Ga0070712_100125383	3300006175	Bacteria	1939
652	Ga0070712_100245876	3300006175	Bacteria	1427
653	Ga0070712_100528140	3300006175	Bacteria	992
654	Ga0075362_10000151	3300006177	Bacteria	18803
655	Ga0075362_10423391	3300006177	Bacteria	674
656	Ga0075367_10025104	3300006178	Bacteria	3367
657	Ga0075367_10037884	3300006178	Bacteria	2804
658	Ga0075367_10133790	3300006178	Bacteria	1533
659	Ga0075369_10261846	3300006186	Bacteria	804
660	Ga0075427_10009752	3300006194	Bacteria	1431
661	Ga0075366_10150177	3300006195	Bacteria	1410
662	Ga0075366_10203786	3300006195	Bacteria	1203
663	Ga0097621_100061607	3300006237	Bacteria	3077
664	Ga0097621_100334525	3300006237	Bacteria	1344
665	Ga0097621_100520622	3300006237	Bacteria	1079
666	Ga0075370_10002287	3300006353	Bacteria	8836
667	Ga0068871_100163247	3300006358	Bacteria	1906
668	Ga0068871_100304617	3300006358	Bacteria	1399
669	Ga0068871_100386034	3300006358	Bacteria	1245
670	Ga0068871_100775165	3300006358	Bacteria	883
671	Ga0075428_100000566	3300006844	Bacteria	37713
672	Ga0075428_100002605	3300006844	Bacteria	19618
673	Ga0075428_100007008	3300006844	Bacteria	12497
674	Ga0075428_100010737	3300006844	Bacteria	10180
675	Ga0075428_100027440	3300006844	Bacteria	6299
676	Ga0075428_100049170	3300006844	Bacteria	4627
677	Ga0075428_100064389	3300006844	Bacteria	4014
678	Ga0075428_100118854	3300006844	Bacteria	2878
679	Ga0075428_100173424	3300006844	Bacteria	2337
680	Ga0075428_100194308	3300006844	Bacteria	2195
681	Ga0075428_100403530	3300006844	Bacteria	1465
682	Ga0075428_100436107	3300006844	Bacteria	1403
683	Ga0075428_100452314	3300006844	Bacteria	1375
684	Ga0075428_100489074	3300006844	Bacteria	1317
685	Ga0075428_100513991	3300006844	Bacteria	1281
686	Ga0075428_100537023	3300006844	Bacteria	1250
687	Ga0075428_100699978	3300006844	Bacteria	1079
688	Ga0075430_100002725	3300006846	Bacteria	14742
689	Ga0075430_100003218	3300006846	Bacteria	13675
690	Ga0075430_100004914	3300006846	Bacteria	11243
691	Ga0075430_100006410	3300006846	Bacteria	9923
692	Ga0075430_100075305	3300006846	Bacteria	2830
693	Ga0075430_100099574	3300006846	Bacteria	2428
694	Ga0075430_100154218	3300006846	Bacteria	1912
695	Ga0075430_100155130	3300006846	Bacteria	1906
696	Ga0075430_100276334	3300006846	Bacteria	1390
697	Ga0075430_100343858	3300006846	Bacteria	1232
698	Ga0075430_100350642	3300006846	Bacteria	1219
699	Ga0075430_100520356	3300006846	Bacteria	982
700	Ga0075430_100813915	3300006846	Bacteria	770
701	Ga0075431_100002441	3300006847	Bacteria	17888
702	Ga0075431_100003301	3300006847	Bacteria	15626
703	Ga0075431_100004450	3300006847	Bacteria	13743
704	Ga0075431_100009893	3300006847	Bacteria	9575
705	Ga0075431_100012990	3300006847	Bacteria	8408
706	Ga0075431_100028175	3300006847	Bacteria	5768
707	Ga0075431_100153536	3300006847	Bacteria	2370
708	Ga0075431_100281612	3300006847	Bacteria	1683
709	Ga0075431_100428388	3300006847	Bacteria	1321
710	Ga0075431_100475015	3300006847	Bacteria	1244
711	Ga0075431_100672136	3300006847	Bacteria	1015
712	Ga0075433_10007511	3300006852	Bacteria	8653
713	Ga0075433_10013793	3300006852	Bacteria	6585
714	Ga0075433_10024037	3300006852	Bacteria	5138
715	Ga0075433_10024217	3300006852	Bacteria	5120
716	Ga0075433_10030541	3300006852	Bacteria	4598
717	Ga0075433_10091008	3300006852	Bacteria	2696
718	Ga0075433_10176190	3300006852	Bacteria	1903
719	Ga0075433_10204888	3300006852	Bacteria	1753
720	Ga0075433_10210789	3300006852	Bacteria	1726
721	Ga0075433_10213496	3300006852	Bacteria	1714
722	Ga0075433_10238467	3300006852	Bacteria	1614
723	Ga0075433_10306080	3300006852	Bacteria	1407
724	Ga0075433_10394217	3300006852	Bacteria	1222
725	Ga0075433_10514921	3300006852	Bacteria	1053
726	Ga0075433_10643640	3300006852	Bacteria	930
727	Ga0075433_11045139	3300006852	Bacteria	711
728	Ga0075433_11286271	3300006852	Bacteria	634
729	Ga0075434_100009524	3300006871	Bacteria	9062
730	Ga0075434_100016140	3300006871	Bacteria	7176
731	Ga0075434_100030809	3300006871	Bacteria	5285
732	Ga0075434_100033716	3300006871	Bacteria	5054
733	Ga0075434_100038827	3300006871	Bacteria	4718
734	Ga0075434_100067995	3300006871	Bacteria	3549
735	Ga0075434_100085770	3300006871	Bacteria	3148
736	Ga0075434_100232068	3300006871	Bacteria	1865
737	Ga0075434_100306797	3300006871	Bacteria	1607
738	Ga0075434_100349972	3300006871	Bacteria	1498
739	Ga0075434_100358465	3300006871	Bacteria	1479
740	Ga0075434_100396450	3300006871	Bacteria	1401
741	Ga0075434_100437207	3300006871	Bacteria	1329
742	Ga0075434_100452233	3300006871	Bacteria	1305
743	Ga0075434_100568330	3300006871	Bacteria	1153
744	Ga0075434_100589679	3300006871	Bacteria	1131
745	Ga0075434_100905825	3300006871	Bacteria	897
746	Ga0075434_102564037	3300006871	Bacteria	510
747	Ga0075429_100018802	3300006880	Bacteria	5985
748	Ga0075429_100054473	3300006880	Bacteria	3479
749	Ga0075429_100062865	3300006880	Bacteria	3235
750	Ga0075429_100093487	3300006880	Bacteria	2623
751	Ga0075429_100116433	3300006880	Bacteria	2336
752	Ga0075429_100144837	3300006880	Bacteria	2079
753	Ga0075429_100147076	3300006880	Bacteria	2062
754	Ga0075429_100365663	3300006880	Bacteria	1263
755	Ga0075429_100770859	3300006880	Bacteria	842
756	Ga0075429_101185903	3300006880	Bacteria	667
757	Ga0075429_101195734	3300006880	Bacteria	664
758	Ga0075429_101397282	3300006880	Bacteria	610
759	Ga0068865_100072643	3300006881	Bacteria	2444
760	Ga0068865_100096329	3300006881	Bacteria	2157
761	Ga0068865_100372500	3300006881	Bacteria	1162
762	Ga0068865_100506211	3300006881	Bacteria	1008
763	Ga0068865_100766760	3300006881	Bacteria	830
764	Ga0068865_101210459	3300006881	Bacteria	669
765	Ga0068865_101379911	3300006881	Bacteria	628
766	Ga0075436_100001836	3300006914	Bacteria	14551
767	Ga0075436_100007542	3300006914	Bacteria	7431
768	Ga0075436_100021672	3300006914	Bacteria	4409
769	Ga0075436_100123774	3300006914	Bacteria	1811
770	Ga0075436_100169094	3300006914	Bacteria	1543
771	Ga0075436_100197606	3300006914	Bacteria	1424
772	Ga0075436_100322150	3300006914	Bacteria	1110
773	Ga0075436_100439546	3300006914	Bacteria	949
774	Ga0075436_100629770	3300006914	Bacteria	791
775	Ga0075436_100655287	3300006914	Bacteria	776
776	Ga0075436_101070217	3300006914	Bacteria	607
777	Ga0097620_100030709	3300006931	Bacteria	5392
778	Ga0097620_100039358	3300006931	Bacteria	4743
779	Ga0097620_100070611	3300006931	Bacteria	3528
780	Ga0097620_100071027	3300006931	Bacteria	3517
781	Ga0097620_100139216	3300006931	Bacteria	2500
782	Ga0097620_100172589	3300006931	Bacteria	2244
783	Ga0097620_100195224	3300006931	Bacteria	2108
784	Ga0097620_100227692	3300006931	Bacteria	1952
785	Ga0097620_100308693	3300006931	Bacteria	1675
786	Ga0097620_100381560	3300006931	Bacteria	1505
787	Ga0097620_100390320	3300006931	Bacteria	1488
788	Ga0097620_100685649	3300006931	Bacteria	1116
789	Ga0097620_100733586	3300006931	Bacteria	1077
790	Ga0097620_100954339	3300006931	Bacteria	941
791	Ga0097620_101070432	3300006931	Bacteria	887
792	Ga0097620_101199910	3300006931	Bacteria	836
793	Ga0097620_101235574	3300006931	Bacteria	823
794	Ga0097620_101860020	3300006931	Bacteria	665
795	Ga0075435_100001248	3300007076	Bacteria	16274
796	Ga0075435_100038256	3300007076	Bacteria	3825
797	Ga0075435_100052049	3300007076	Bacteria	3299
798	Ga0075435_100061897	3300007076	Bacteria	3037
799	Ga0075435_100088000	3300007076	Bacteria	2560
800	Ga0075435_100232786	3300007076	Bacteria	1565
801	Ga0075435_100234216	3300007076	Bacteria	1560
802	Ga0075435_100262885	3300007076	Bacteria	1470
803	Ga0075435_100292354	3300007076	Bacteria	1392
804	Ga0075435_100432121	3300007076	Bacteria	1134
805	Ga0075435_100456868	3300007076	Bacteria	1102
806	Ga0099794_10047797	3300007265	Bacteria	2052
807	Ga0099794_10092648	3300007265	Bacteria	1501
808	Ga0099794_10373329	3300007265	Bacteria	743
809	Ga0099795_10019472	3300007788	Bacteria	2197
810	Ga0105251_10177393	3300009011	Bacteria	960
811	Ga0105244_10260690	3300009036	Bacteria	807
812	Ga0105240_10011307	3300009093	Bacteria	12434
813	Ga0105240_10026271	3300009093	Bacteria	7638
814	Ga0105240_10037897	3300009093	Bacteria	6191
815	Ga0105240_10178231	3300009093	Bacteria	2511
816	Ga0105240_10188536	3300009093	Bacteria	2427
817	Ga0105240_10217617	3300009093	Bacteria	2227
818	Ga0105240_10274195	3300009093	Bacteria	1941
819	Ga0105240_10386609	3300009093	Bacteria	1579
820	Ga0105240_10403321	3300009093	Bacteria	1539
821	Ga0105240_10427013	3300009093	Bacteria	1488
822	Ga0105240_10485348	3300009093	Bacteria	1377
823	Ga0105240_10683234	3300009093	Bacteria	1122
824	Ga0105240_10780130	3300009093	Bacteria	1037
825	Ga0111539_10000614	3300009094	Bacteria	46152
826	Ga0111539_10006016	3300009094	Bacteria	15679
827	Ga0111539_10011587	3300009094	Bacteria	11064
828	Ga0111539_10021054	3300009094	Bacteria	8031
829	Ga0111539_10076195	3300009094	Bacteria	3949
830	Ga0111539_10123506	3300009094	Bacteria	3034
831	Ga0111539_10259954	3300009094	Bacteria	2021
832	Ga0111539_10288238	3300009094	Bacteria	1911
833	Ga0111539_10313287	3300009094	Bacteria	1826
834	Ga0111539_10329806	3300009094	Bacteria	1776
835	Ga0111539_10575367	3300009094	Bacteria	1312
836	Ga0111539_10715130	3300009094	Bacteria	1166
837	Ga0111539_10975665	3300009094	Bacteria	985
838	Ga0111539_11095039	3300009094	Bacteria	926
839	Ga0111539_11247384	3300009094	Bacteria	863
840	Ga0111539_11534647	3300009094	Bacteria	772
841	Ga0111539_11819829	3300009094	Bacteria	706
842	Ga0111539_12021354	3300009094	Bacteria	668
843	Ga0105245_10237254	3300009098	Bacteria	1766
844	Ga0105245_10368669	3300009098	Bacteria	1427
845	Ga0105245_10660745	3300009098	Bacteria	1076
846	Ga0105245_11200888	3300009098	Bacteria	806
847	Ga0105245_11355940	3300009098	Bacteria	761
848	Ga0105247_10256343	3300009101	Bacteria	1198
849	Ga0105247_10520229	3300009101	Bacteria	870
850	Ga0105247_10564523	3300009101	Bacteria	839
851	Ga0114129_10003061	3300009147	Bacteria	23447
852	Ga0114129_10003419	3300009147	Bacteria	22319
853	Ga0114129_10005741	3300009147	Bacteria	17583
854	Ga0114129_10006820	3300009147	Bacteria	16221
855	Ga0114129_10030705	3300009147	Bacteria	7600
856	Ga0114129_10052031	3300009147	Bacteria	5748
857	Ga0114129_10060469	3300009147	Bacteria	5297
858	Ga0114129_10100800	3300009147	Bacteria	3996
859	Ga0114129_10132015	3300009147	Bacteria	3429
860	Ga0114129_10143266	3300009147	Bacteria	3275
861	Ga0114129_10222063	3300009147	Bacteria	2548
862	Ga0114129_10371994	3300009147	Bacteria	1888
863	Ga0114129_10423156	3300009147	Bacteria	1751
864	Ga0114129_10578807	3300009147	Bacteria	1457
865	Ga0114129_10939193	3300009147	Bacteria	1093
866	Ga0114129_11172131	3300009147	Bacteria	958
867	Ga0114129_11236120	3300009147	Bacteria	929
868	Ga0114129_11319173	3300009147	Bacteria	894
869	Ga0114129_11361528	3300009147	Bacteria	877
870	Ga0105243_10006180	3300009148	Bacteria	9262
871	Ga0105243_10234408	3300009148	Bacteria	1630
872	Ga0105243_10329934	3300009148	Bacteria	1393
873	Ga0105243_12412617	3300009148	Bacteria	564
874	Ga0105243_12765143	3300009148	Bacteria	531
875	Ga0105241_10052965	3300009174	Bacteria	3101
876	Ga0105241_10109507	3300009174	Bacteria	2209
877	Ga0105241_10271497	3300009174	Bacteria	1445
878	Ga0105241_10364923	3300009174	Bacteria	1257
879	Ga0105241_10562630	3300009174	Bacteria	1025
880	Ga0105242_10014946	3300009176	Bacteria	6017
881	Ga0105242_10029189	3300009176	Bacteria	4397
882	Ga0105242_10058432	3300009176	Bacteria	3162
883	Ga0105242_10762906	3300009176	Bacteria	954
884	Ga0105242_12588846	3300009176	Bacteria	556
885	Ga0105248_10065465	3300009177	Bacteria	4080
886	Ga0105248_10129099	3300009177	Bacteria	2852
887	Ga0105248_10143509	3300009177	Bacteria	2694
888	Ga0105248_10331624	3300009177	Bacteria	1714
889	Ga0105248_10344128	3300009177	Bacteria	1679
890	Ga0105248_10632415	3300009177	Bacteria	1207
891	Ga0105248_10653673	3300009177	Bacteria	1186
892	Ga0105248_10861921	3300009177	Bacteria	1022
893	Ga0105248_11254111	3300009177	Bacteria	838
894	Ga0105248_11897962	3300009177	Bacteria	676
895	Ga0105248_12078233	3300009177	Bacteria	646
896	Ga0105237_10011322	3300009545	Bacteria	9438
897	Ga0105237_10017171	3300009545	Bacteria	7506
898	Ga0105237_10438935	3300009545	Bacteria	1311
899	Ga0105237_11366120	3300009545	Bacteria	715
900	Ga0105238_10002481	3300009551	Bacteria	18468
901	Ga0105238_10053916	3300009551	Bacteria	4040
902	Ga0105238_10103389	3300009551	Bacteria	2830
903	Ga0105238_10629998	3300009551	Bacteria	1082
904	Ga0105238_10725634	3300009551	Bacteria	1007
905	Ga0105249_10000649	3300009553	Bacteria	31693
906	Ga0105249_10002497	3300009553	Bacteria	15920
907	Ga0105249_10025833	3300009553	Bacteria	5289
908	Ga0105249_10415926	3300009553	Bacteria	1377
909	Ga0105249_10569614	3300009553	Bacteria	1185
910	Ga0105249_10690255	3300009553	Bacteria	1080
911	Ga0105249_10733762	3300009553	Bacteria	1049
912	Ga0105239_10006176	3300010375	Bacteria	13938
913	Ga0105239_10079317	3300010375	Bacteria	3613
914	Ga0105239_10153814	3300010375	Bacteria	2568
915	Ga0105239_10913751	3300010375	Bacteria	1008
916	Ga0105246_10174956	3300011119	Bacteria	1647
917	Ga0105246_10614020	3300011119	Bacteria	941
918	Ga0105246_11006846	3300011119	Bacteria	755
919	Ga0105246_11092992	3300011119	Bacteria	728
920	Ga0105246_11208128	3300011119	Bacteria	696
921	Ga0105246_12037453	3300011119	Bacteria	555
922	Ga0157318_1012320	3300012482	Bacteria	659
923	Ga0157325_1014527	3300012485	Bacteria	633
924	Ga0157323_1030687	3300012495	Bacteria	569
925	Ga0157319_1035575	3300012497	Bacteria	560
926	Ga0157345_1012946	3300012498	Bacteria	761
927	Ga0157347_1053497	3300012502	Bacteria	562
928	Ga0157342_1081281	3300012507	Bacteria	510
929	Ga0157316_1058579	3300012510	Bacteria	552
930	Ga0157327_1053265	3300012512	Bacteria	582
931	Ga0157371_10050789	3300013102	Bacteria	2947
932	Ga0157371_10321212	3300013102	Bacteria	1123
933	Ga0157370_10023523	3300013104	Bacteria	6114
934	Ga0157370_10072430	3300013104	Bacteria	3251
935	Ga0157370_10299100	3300013104	Bacteria	1486
936	Ga0157370_10302698	3300013104	Bacteria	1476
937	Ga0157370_10335481	3300013104	Bacteria	1394
938	Ga0157370_10707729	3300013104	Bacteria	919
939	Ga0157370_10825657	3300013104	Bacteria	843
940	Ga0157370_11823087	3300013104	Bacteria	546
941	Ga0157369_10004249	3300013105	Bacteria	16965
942	Ga0157369_10099148	3300013105	Bacteria	3106
943	Ga0157369_10378043	3300013105	Bacteria	1470
944	Ga0157369_10460654	3300013105	Bacteria	1316
945	Ga0157369_10762224	3300013105	Bacteria	995
946	Ga0157369_10845608	3300013105	Bacteria	939
947	Ga0157369_10883094	3300013105	Bacteria	917
948	Ga0157369_10971173	3300013105	Bacteria	870
949	Ga0157369_12379243	3300013105	Bacteria	537
950	Ga0157374_10053425	3300013296	Bacteria	3767
951	Ga0157374_10134617	3300013296	Bacteria	2394
952	Ga0157374_10224972	3300013296	Bacteria	1842
953	Ga0157374_10240017	3300013296	Bacteria	1782
954	Ga0157374_10814654	3300013296	Bacteria	950
955	Ga0157378_10012390	3300013297	Bacteria	7466
956	Ga0157378_10025148	3300013297	Bacteria	5247
957	Ga0157378_10466873	3300013297	Bacteria	1255
958	Ga0157378_13240245	3300013297	Bacteria	506
959	Ga0163162_10007697	3300013306	Bacteria	10494
960	Ga0163162_10292861	3300013306	Bacteria	1759
961	Ga0163162_10498301	3300013306	Bacteria	1349
962	Ga0163162_10630461	3300013306	Bacteria	1197
963	Ga0163162_10751533	3300013306	Bacteria	1094
964	Ga0163162_10819894	3300013306	Bacteria	1047
965	Ga0163162_11040928	3300013306	Bacteria	926
966	Ga0157372_10003029	3300013307	Bacteria	18103
967	Ga0157372_10195048	3300013307	Bacteria	2346
968	Ga0157372_10225199	3300013307	Bacteria	2174
969	Ga0157372_12484135	3300013307	Bacteria	595
970	Ga0157375_10044727	3300013308	Bacteria	4305
971	Ga0157375_10045218	3300013308	Bacteria	4285
972	Ga0157375_10051620	3300013308	Bacteria	4039
973	Ga0157375_10107477	3300013308	Bacteria	2884
974	Ga0157375_10156849	3300013308	Bacteria	2415
975	Ga0157375_10276823	3300013308	Bacteria	1841
976	Ga0157375_11380368	3300013308	Bacteria	830
977	Ga0163163_10036710	3300014325	Bacteria	4762
978	Ga0163163_10061025	3300014325	Bacteria	3735
979	Ga0163163_10109877	3300014325	Bacteria	2785
980	Ga0163163_10177602	3300014325	Bacteria	2176
981	Ga0163163_10315689	3300014325	Bacteria	1616
982	Ga0163163_10434636	3300014325	Bacteria	1372
983	Ga0163163_10788662	3300014325	Bacteria	1013
984	Ga0163163_10883415	3300014325	Bacteria	957
985	Ga0163163_10914884	3300014325	Bacteria	940
986	Ga0163163_11993765	3300014325	Bacteria	640
987	Ga0157380_10002789	3300014326	Bacteria	11874
988	Ga0157380_10053387	3300014326	Bacteria	3204
989	Ga0157380_10112969	3300014326	Bacteria	2286
990	Ga0157380_10177040	3300014326	Bacteria	1870
991	Ga0157380_10444770	3300014326	Bacteria	1243
992	Ga0157380_10517016	3300014326	Bacteria	1163
993	Ga0157380_10787571	3300014326	Bacteria	966
994	Ga0157380_11113413	3300014326	Bacteria	829
995	Ga0157380_11864838	3300014326	Bacteria	661
996	Ga0157377_10039918	3300014745	Bacteria	2598
997	Ga0157377_10055085	3300014745	Bacteria	2254
998	Ga0157377_10207215	3300014745	Bacteria	1248
999	Ga0157377_10422401	3300014745	Bacteria	913
1000	Ga0157377_10870080	3300014745	Bacteria	671
1001	Ga0157379_11028974	3300014968	Bacteria	786
1002	Ga0157379_11239732	3300014968	Bacteria	718
1003	Ga0157376_10108272	3300014969	Bacteria	2441
1004	Ga0157376_10161410	3300014969	Bacteria	2032
1005	Ga0157376_10166834	3300014969	Bacteria	2001
1006	Ga0157376_10217700	3300014969	Bacteria	1767
1007	Ga0157376_10230233	3300014969	Bacteria	1721
1008	Ga0157376_10505455	3300014969	Bacteria	1188
1009	Ga0163161_10031310	3300017792	Bacteria	3789
1010	Ga0163161_10452575	3300017792	Bacteria	1038
1011	Ga0163161_10854725	3300017792	Bacteria	768
1012	Ga0206356_10914771	3300020070	Bacteria	1034
1013	Ga0206356_10939425	3300020070	Bacteria	2195
1014	Ga0213873_10179727	3300021358	Bacteria	649
1015	Ga0213872_10001460	3300021361	Bacteria	15372
1016	Ga0213876_10000941	3300021384	Bacteria	19201
1017	Ga0213876_10025160	3300021384	Bacteria	3142
1018	Ga0213876_10031839	3300021384	Bacteria	2782
1019	Ga0213876_10090144	3300021384	Bacteria	1624
1020	Ga0213876_10160465	3300021384	Bacteria	1196
1021	Ga0213876_10184345	3300021384	Bacteria	1110
1022	Ga0213876_10375449	3300021384	Bacteria	756
1023	Ga0213876_10478401	3300021384	Bacteria	663
1024	Ga0213875_10000015	3300021388	Bacteria	280499
1025	Ga0213875_10000208	3300021388	Bacteria	59796
1026	Ga0213875_10006316	3300021388	Bacteria	6237
1027	Ga0213875_10082696	3300021388	Bacteria	1498
1028	Ga0213875_10251359	3300021388	Bacteria	834
1029	Ga0213875_10287188	3300021388	Bacteria	777
1030	Ga0213875_10379479	3300021388	Bacteria	673
1031	Ga0213871_10017296	3300021441	Bacteria	1750
1032	Ga0224569_100332	3300022732	Bacteria	3997
1033	Ga0224571_100767	3300022734	Bacteria	1881
1034	Ga0247554_105199	3300023547	Bacteria	547
1035	Ga0224572_1007637	3300024225	Bacteria	1985
1036	Ga0224572_1029811	3300024225	Bacteria	1043
1037	Ga0228598_1000990	3300024227	Bacteria	6211
1038	Ga0228598_1001835	3300024227	Bacteria	4626
1039	Ga0228598_1003784	3300024227	Bacteria	3232
1040	Ga0228598_1011345	3300024227	Bacteria	1773
1041	Ga0228598_1116484	3300024227	Bacteria	542
1042	Ga0207697_10002633	3300025315	Bacteria	9219
1043	Ga0207697_10137265	3300025315	Bacteria	1059
1044	Ga0207697_10137639	3300025315	Bacteria	1058
1045	Ga0207697_10529731	3300025315	Bacteria	519
1046	Ga0207656_10443497	3300025321	Bacteria	655
1047	Ga0207653_10000020	3300025885	Bacteria	136681
1048	Ga0207653_10003065	3300025885	Bacteria	5303
1049	Ga0207653_10058910	3300025885	Bacteria	1291
1050	Ga0207682_10008298	3300025893	Bacteria	4112
1051	Ga0207682_10017127	3300025893	Bacteria	2829
1052	Ga0207682_10028142	3300025893	Bacteria	2242
1053	Ga0207682_10035982	3300025893	Bacteria	2002
1054	Ga0207682_10084994	3300025893	Bacteria	1363
1055	Ga0207682_10092952	3300025893	Bacteria	1310
1056	Ga0207682_10138084	3300025893	Bacteria	1092
1057	Ga0207682_10241721	3300025893	Bacteria	839
1058	Ga0207682_10558215	3300025893	Bacteria	541
1059	Ga0207692_10005572	3300025898	Bacteria	5054
1060	Ga0207692_10060899	3300025898	Bacteria	1954
1061	Ga0207692_10404427	3300025898	Bacteria	852
1062	Ga0207692_10592493	3300025898	Bacteria	712
1063	Ga0207642_10132105	3300025899	Bacteria	1304
1064	Ga0207642_10139870	3300025899	Bacteria	1275
1065	Ga0207710_10063272	3300025900	Bacteria	1683
1066	Ga0207710_10222924	3300025900	Bacteria	937
1067	Ga0207688_10046323	3300025901	Bacteria	2428
1068	Ga0207688_10061089	3300025901	Bacteria	2124
1069	Ga0207688_10169875	3300025901	Bacteria	1296
1070	Ga0207688_10253674	3300025901	Bacteria	1066
1071	Ga0207688_10380690	3300025901	Bacteria	873
1072	Ga0207688_10428788	3300025901	Bacteria	822
1073	Ga0207688_10713083	3300025901	Bacteria	634
1074	Ga0207680_10027842	3300025903	Bacteria	3154
1075	Ga0207680_10090511	3300025903	Bacteria	1945
1076	Ga0207680_10101925	3300025903	Bacteria	1846
1077	Ga0207680_10129180	3300025903	Bacteria	1663
1078	Ga0207680_10327868	3300025903	Bacteria	1072
1079	Ga0207680_10456743	3300025903	Bacteria	907
1080	Ga0207680_10669146	3300025903	Bacteria	744
1081	Ga0207680_11187289	3300025903	Bacteria	544
1082	Ga0207647_10266630	3300025904	Bacteria	980
1083	Ga0207685_10006052	3300025905	Bacteria	3259
1084	Ga0207685_10271077	3300025905	Bacteria	829
1085	Ga0207685_10298010	3300025905	Bacteria	797
1086	Ga0207685_10602150	3300025905	Bacteria	590
1087	Ga0207685_10793014	3300025905	Bacteria	521
1088	Ga0207699_10000005	3300025906	Bacteria	534560
1089	Ga0207699_10001057	3300025906	Bacteria	13000
1090	Ga0207699_10026977	3300025906	Bacteria	3174
1091	Ga0207699_10027213	3300025906	Bacteria	3163
1092	Ga0207699_10084460	3300025906	Bacteria	1977
1093	Ga0207699_10262871	3300025906	Bacteria	1193
1094	Ga0207699_10543871	3300025906	Bacteria	842
1095	Ga0207699_10904236	3300025906	Bacteria	651
1096	Ga0207645_10006334	3300025907	Bacteria	8508
1097	Ga0207645_10012143	3300025907	Bacteria	5851
1098	Ga0207645_10063739	3300025907	Bacteria	2355
1099	Ga0207645_10080833	3300025907	Bacteria	2083
1100	Ga0207645_10242480	3300025907	Bacteria	1191
1101	Ga0207645_10253266	3300025907	Bacteria	1165
1102	Ga0207645_10299319	3300025907	Bacteria	1071
1103	Ga0207645_10423609	3300025907	Bacteria	897
1104	Ga0207645_10782721	3300025907	Bacteria	649
1105	Ga0207643_10000779	3300025908	Bacteria	19421
1106	Ga0207643_10006374	3300025908	Bacteria	6319
1107	Ga0207643_10042159	3300025908	Bacteria	2572
1108	Ga0207643_10068954	3300025908	Bacteria	2032
1109	Ga0207643_10141311	3300025908	Bacteria	1438
1110	Ga0207643_10159542	3300025908	Bacteria	1356
1111	Ga0207643_10198150	3300025908	Bacteria	1222
1112	Ga0207643_10583022	3300025908	Bacteria	719
1113	Ga0207705_10036023	3300025909	Bacteria	3542
1114	Ga0207705_10077070	3300025909	Bacteria	2425
1115	Ga0207705_10169490	3300025909	Bacteria	1643
1116	Ga0207684_10002118	3300025910	Bacteria	20347
1117	Ga0207684_10134177	3300025910	Bacteria	2125
1118	Ga0207684_10143739	3300025910	Bacteria	2052
1119	Ga0207684_10161632	3300025910	Bacteria	1929
1120	Ga0207684_10335165	3300025910	Bacteria	1303
1121	Ga0207684_11151260	3300025910	Bacteria	644
1122	Ga0207654_10109702	3300025911	Bacteria	1715
1123	Ga0207707_10004150	3300025912	Bacteria	12833
1124	Ga0207707_10035593	3300025912	Bacteria	4353
1125	Ga0207707_10119584	3300025912	Bacteria	2303
1126	Ga0207707_10120094	3300025912	Bacteria	2298
1127	Ga0207707_10183733	3300025912	Bacteria	1825
1128	Ga0207707_10231749	3300025912	Bacteria	1607
1129	Ga0207707_10365260	3300025912	Bacteria	1242
1130	Ga0207707_10952796	3300025912	Bacteria	707
1131	Ga0207695_10004731	3300025913	Bacteria	18438
1132	Ga0207695_10033343	3300025913	Bacteria	5618
1133	Ga0207695_10040376	3300025913	Bacteria	5005
1134	Ga0207695_10042750	3300025913	Bacteria	4835
1135	Ga0207695_10123269	3300025913	Bacteria	2557
1136	Ga0207695_10210572	3300025913	Bacteria	1855
1137	Ga0207695_10503998	3300025913	Bacteria	1092
1138	Ga0207695_11221457	3300025913	Bacteria	632
1139	Ga0207695_11243412	3300025913	Bacteria	625
1140	Ga0207671_10000762	3300025914	Bacteria	40951
1141	Ga0207671_10016045	3300025914	Bacteria	5837
1142	Ga0207693_10000026	3300025915	Bacteria	122717
1143	Ga0207693_10001260	3300025915	Bacteria	22561
1144	Ga0207693_10004232	3300025915	Bacteria	12174
1145	Ga0207693_10069369	3300025915	Bacteria	2759
1146	Ga0207693_10193391	3300025915	Bacteria	1601
1147	Ga0207693_10260302	3300025915	Bacteria	1360
1148	Ga0207693_10292526	3300025915	Bacteria	1276
1149	Ga0207693_10518997	3300025915	Bacteria	929
1150	Ga0207693_10659380	3300025915	Bacteria	812
1151	Ga0207663_10000004	3300025916	Bacteria	294638
1152	Ga0207663_10003762	3300025916	Bacteria	7481
1153	Ga0207663_10009591	3300025916	Bacteria	5123
1154	Ga0207663_10074711	3300025916	Bacteria	2197
1155	Ga0207663_10112094	3300025916	Bacteria	1852
1156	Ga0207663_10184293	3300025916	Bacteria	1493
1157	Ga0207663_10375903	3300025916	Bacteria	1081
1158	Ga0207663_11669661	3300025916	Bacteria	513
1159	Ga0207660_10004571	3300025917	Bacteria	9014
1160	Ga0207660_10006183	3300025917	Bacteria	7778
1161	Ga0207660_10051923	3300025917	Bacteria	2917
1162	Ga0207660_10102981	3300025917	Bacteria	2135
1163	Ga0207660_10135373	3300025917	Bacteria	1879
1164	Ga0207660_10256799	3300025917	Bacteria	1381
1165	Ga0207660_10328546	3300025917	Bacteria	1222
1166	Ga0207660_10771626	3300025917	Bacteria	784
1167	Ga0207660_10897020	3300025917	Bacteria	723
1168	Ga0207660_10917798	3300025917	Bacteria	714
1169	Ga0207660_11009058	3300025917	Bacteria	679
1170	Ga0207660_11152441	3300025917	Bacteria	631
1171	Ga0207662_10000335	3300025918	Bacteria	21250
1172	Ga0207662_10009410	3300025918	Bacteria	5376
1173	Ga0207662_10065399	3300025918	Bacteria	2190
1174	Ga0207662_10069776	3300025918	Bacteria	2124
1175	Ga0207662_10294590	3300025918	Bacteria	1077
1176	Ga0207662_10312092	3300025918	Bacteria	1048
1177	Ga0207662_10353729	3300025918	Bacteria	987
1178	Ga0207662_10409397	3300025918	Bacteria	921
1179	Ga0207662_10562252	3300025918	Bacteria	791
1180	Ga0207662_10669911	3300025918	Bacteria	726
1181	Ga0207657_10051764	3300025919	Bacteria	3568
1182	Ga0207657_10183924	3300025919	Bacteria	1688
1183	Ga0207657_10198341	3300025919	Bacteria	1616
1184	Ga0207657_10418946	3300025919	Bacteria	1053
1185	Ga0207649_10028632	3300025920	Bacteria	3281
1186	Ga0207649_10039974	3300025920	Bacteria	2847
1187	Ga0207649_10179989	3300025920	Bacteria	1479
1188	Ga0207649_10185756	3300025920	Bacteria	1458
1189	Ga0207649_10196805	3300025920	Bacteria	1421
1190	Ga0207649_10228804	3300025920	Bacteria	1329
1191	Ga0207649_10604529	3300025920	Bacteria	844
1192	Ga0207649_11024424	3300025920	Bacteria	650
1193	Ga0207649_11038449	3300025920	Bacteria	645
1194	Ga0207649_11082517	3300025920	Bacteria	632
1195	Ga0207652_10002066	3300025921	Bacteria	17278
1196	Ga0207652_10160557	3300025921	Bacteria	2015
1197	Ga0207652_10485791	3300025921	Bacteria	1112
1198	Ga0207646_10000037	3300025922	Bacteria	196362
1199	Ga0207646_10000343	3300025922	Bacteria	62896
1200	Ga0207646_10072024	3300025922	Bacteria	3087
1201	Ga0207646_10132101	3300025922	Bacteria	2247
1202	Ga0207646_10147634	3300025922	Bacteria	2119
1203	Ga0207646_10174045	3300025922	Bacteria	1944
1204	Ga0207646_10492891	3300025922	Bacteria	1104
1205	Ga0207646_10495446	3300025922	Bacteria	1101
1206	Ga0207646_10757785	3300025922	Bacteria	866
1207	Ga0207681_10009786	3300025923	Bacteria	5864
1208	Ga0207681_10034313	3300025923	Bacteria	3335
1209	Ga0207681_10047830	3300025923	Bacteria	2884
1210	Ga0207681_10067799	3300025923	Bacteria	2475
1211	Ga0207681_10123765	3300025923	Bacteria	1900
1212	Ga0207681_10143052	3300025923	Bacteria	1783
1213	Ga0207681_10160800	3300025923	Bacteria	1693
1214	Ga0207681_10192437	3300025923	Bacteria	1561
1215	Ga0207681_10214659	3300025923	Bacteria	1485
1216	Ga0207681_10231770	3300025923	Bacteria	1433
1217	Ga0207681_10284469	3300025923	Bacteria	1303
1218	Ga0207681_10336160	3300025923	Bacteria	1205
1219	Ga0207681_10640869	3300025923	Bacteria	880
1220	Ga0207681_10791063	3300025923	Bacteria	792
1221	Ga0207694_10005630	3300025924	Bacteria	9606
1222	Ga0207694_10140080	3300025924	Bacteria	1945
1223	Ga0207694_10159080	3300025924	Bacteria	1824
1224	Ga0207650_10010669	3300025925	Bacteria	6310
1225	Ga0207650_10016401	3300025925	Bacteria	5177
1226	Ga0207650_10022979	3300025925	Bacteria	4418
1227	Ga0207650_10024938	3300025925	Bacteria	4257
1228	Ga0207650_10075717	3300025925	Bacteria	2541
1229	Ga0207650_10086165	3300025925	Bacteria	2391
1230	Ga0207650_10100318	3300025925	Bacteria	2227
1231	Ga0207650_10422818	3300025925	Bacteria	1106
1232	Ga0207650_10625721	3300025925	Bacteria	906
1233	Ga0207650_10815409	3300025925	Bacteria	791
1234	Ga0207659_10003579	3300025926	Bacteria	9354
1235	Ga0207659_10008566	3300025926	Bacteria	6358
1236	Ga0207659_10023137	3300025926	Bacteria	4144
1237	Ga0207659_10027677	3300025926	Bacteria	3842
1238	Ga0207659_10029153	3300025926	Bacteria	3758
1239	Ga0207659_10090843	3300025926	Bacteria	2280
1240	Ga0207659_10114608	3300025926	Bacteria	2055
1241	Ga0207659_10115175	3300025926	Bacteria	2050
1242	Ga0207659_10150800	3300025926	Bacteria	1815
1243	Ga0207659_10194635	3300025926	Bacteria	1615
1244	Ga0207659_10376511	3300025926	Bacteria	1183
1245	Ga0207659_10380934	3300025926	Bacteria	1176
1246	Ga0207659_10475327	3300025926	Bacteria	1055
1247	Ga0207659_10537761	3300025926	Bacteria	992
1248	Ga0207659_10544234	3300025926	Bacteria	986
1249	Ga0207659_10774895	3300025926	Bacteria	823
1250	Ga0207659_10923320	3300025926	Bacteria	751
1251	Ga0207659_10990134	3300025926	Bacteria	723
1252	Ga0207659_11146093	3300025926	Bacteria	669
1253	Ga0207659_11242311	3300025926	Bacteria	640
1254	Ga0207687_10126534	3300025927	Bacteria	1919
1255	Ga0207700_10004917	3300025928	Bacteria	7939
1256	Ga0207700_10008755	3300025928	Bacteria	6286
1257	Ga0207700_10037805	3300025928	Bacteria	3499
1258	Ga0207700_10056645	3300025928	Bacteria	2952
1259	Ga0207700_10072432	3300025928	Bacteria	2657
1260	Ga0207700_10142004	3300025928	Bacteria	1974
1261	Ga0207700_10210578	3300025928	Unclassified	1643
1262	Ga0207700_10320305	3300025928	Bacteria	1343
1263	Ga0207700_10355012	3300025928	Bacteria	1277
1264	Ga0207700_10675348	3300025928	Bacteria	921
1265	Ga0207700_11304747	3300025928	Bacteria	647
1266	Ga0207700_11436488	3300025928	Bacteria	613
1267	Ga0207664_10027001	3300025929	Bacteria	4348
1268	Ga0207664_10066125	3300025929	Bacteria	2897
1269	Ga0207664_10087127	3300025929	Bacteria	2552
1270	Ga0207664_10095778	3300025929	Bacteria	2442
1271	Ga0207664_10100654	3300025929	Bacteria	2387
1272	Ga0207664_10149059	3300025929	Bacteria	1986
1273	Ga0207664_10175750	3300025929	Bacteria	1836
1274	Ga0207664_10325900	3300025929	Bacteria	1356
1275	Ga0207664_10517984	3300025929	Bacteria	1069
1276	Ga0207664_11090757	3300025929	Bacteria	714
1277	Ga0207664_11653575	3300025929	Bacteria	562
1278	Ga0207664_11742109	3300025929	Bacteria	545
1279	Ga0207644_10007454	3300025931	Bacteria	7134
1280	Ga0207644_10072145	3300025931	Bacteria	2528
1281	Ga0207644_10284978	3300025931	Bacteria	1327
1282	Ga0207644_10341910	3300025931	Bacteria	1213
1283	Ga0207644_10430477	3300025931	Bacteria	1082
1284	Ga0207644_10483362	3300025931	Bacteria	1020
1285	Ga0207644_10737492	3300025931	Bacteria	822
1286	Ga0207690_10112581	3300025932	Bacteria	1963
1287	Ga0207690_10135978	3300025932	Bacteria	1805
1288	Ga0207690_10239893	3300025932	Bacteria	1396
1289	Ga0207690_10584907	3300025932	Bacteria	910
1290	Ga0207690_10964234	3300025932	Bacteria	709
1291	Ga0207690_11707456	3300025932	Bacteria	526
1292	Ga0207706_10003002	3300025933	Bacteria	16261
1293	Ga0207706_10037518	3300025933	Bacteria	4303
1294	Ga0207706_10064695	3300025933	Bacteria	3220
1295	Ga0207706_10482630	3300025933	Bacteria	1071
1296	Ga0207706_10651523	3300025933	Bacteria	902
1297	Ga0207706_10699068	3300025933	Bacteria	866
1298	Ga0207686_10010449	3300025934	Bacteria	5056
1299	Ga0207686_10026045	3300025934	Bacteria	3410
1300	Ga0207686_10027262	3300025934	Bacteria	3343
1301	Ga0207686_10159670	3300025934	Bacteria	1579
1302	Ga0207686_10173876	3300025934	Bacteria	1521
1303	Ga0207709_10327471	3300025935	Bacteria	1149
1304	Ga0207709_10789689	3300025935	Bacteria	766
1305	Ga0207670_10026265	3300025936	Bacteria	3667
1306	Ga0207670_10028280	3300025936	Bacteria	3557
1307	Ga0207670_10086373	3300025936	Bacteria	2207
1308	Ga0207670_10087202	3300025936	Bacteria	2198
1309	Ga0207670_10106205	3300025936	Bacteria	2014
1310	Ga0207670_10131652	3300025936	Bacteria	1833
1311	Ga0207670_10198665	3300025936	Bacteria	1522
1312	Ga0207670_10286127	3300025936	Bacteria	1286
1313	Ga0207670_10297732	3300025936	Bacteria	1262
1314	Ga0207670_10319200	3300025936	Bacteria	1222
1315	Ga0207670_10358215	3300025936	Bacteria	1157
1316	Ga0207670_10694258	3300025936	Bacteria	842
1317	Ga0207670_10911558	3300025936	Bacteria	736
1318	Ga0207670_11639169	3300025936	Bacteria	547
1319	Ga0207669_10003495	3300025937	Bacteria	6796
1320	Ga0207669_10048671	3300025937	Bacteria	2520
1321	Ga0207669_10133303	3300025937	Bacteria	1711
1322	Ga0207669_10179988	3300025937	Bacteria	1514
1323	Ga0207669_10237094	3300025937	Bacteria	1350
1324	Ga0207669_10274842	3300025937	Bacteria	1267
1325	Ga0207669_10348386	3300025937	Bacteria	1143
1326	Ga0207669_10513024	3300025937	Bacteria	961
1327	Ga0207669_10644678	3300025937	Bacteria	865
1328	Ga0207704_10001666	3300025938	Bacteria	9966
1329	Ga0207704_10107540	3300025938	Bacteria	1876
1330	Ga0207704_10384772	3300025938	Bacteria	1102
1331	Ga0207704_10498661	3300025938	Bacteria	981
1332	Ga0207704_10660017	3300025938	Bacteria	862
1333	Ga0207704_10775946	3300025938	Bacteria	799
1334	Ga0207704_10884045	3300025938	Bacteria	751
1335	Ga0207665_10002747	3300025939	Bacteria	11804
1336	Ga0207665_10040897	3300025939	Bacteria	3094
1337	Ga0207665_10046383	3300025939	Bacteria	2912
1338	Ga0207665_10048900	3300025939	Bacteria	2840
1339	Ga0207665_10136661	3300025939	Bacteria	1745
1340	Ga0207665_10152209	3300025939	Unclassified	1658
1341	Ga0207665_10825076	3300025939	Bacteria	733
1342	Ga0207691_10008380	3300025940	Bacteria	9933
1343	Ga0207691_10016722	3300025940	Bacteria	6964
1344	Ga0207691_10018907	3300025940	Bacteria	6526
1345	Ga0207691_10025426	3300025940	Bacteria	5560
1346	Ga0207691_10053434	3300025940	Bacteria	3688
1347	Ga0207691_10069317	3300025940	Bacteria	3186
1348	Ga0207691_10113744	3300025940	Bacteria	2405
1349	Ga0207691_10158771	3300025940	Bacteria	1985
1350	Ga0207691_10206001	3300025940	Bacteria	1710
1351	Ga0207691_10210746	3300025940	Bacteria	1688
1352	Ga0207691_10257099	3300025940	Bacteria	1506
1353	Ga0207691_10388411	3300025940	Bacteria	1191
1354	Ga0207691_10406402	3300025940	Bacteria	1161
1355	Ga0207691_10429646	3300025940	Bacteria	1125
1356	Ga0207691_10457143	3300025940	Bacteria	1086
1357	Ga0207711_10024917	3300025941	Bacteria	5018
1358	Ga0207711_10104634	3300025941	Bacteria	2509
1359	Ga0207711_10211221	3300025941	Bacteria	1772
1360	Ga0207711_10352669	3300025941	Bacteria	1362
1361	Ga0207711_10441063	3300025941	Bacteria	1212
1362	Ga0207711_10714152	3300025941	Bacteria	935
1363	Ga0207711_10869624	3300025941	Bacteria	838
1364	Ga0207711_10918938	3300025941	Bacteria	813
1365	Ga0207711_11194212	3300025941	Bacteria	702
1366	Ga0207689_10003297	3300025942	Bacteria	14779
1367	Ga0207689_10038286	3300025942	Bacteria	3973
1368	Ga0207689_10058878	3300025942	Bacteria	3160
1369	Ga0207689_10106439	3300025942	Bacteria	2304
1370	Ga0207689_10124470	3300025942	Bacteria	2121
1371	Ga0207689_10132836	3300025942	Bacteria	2049
1372	Ga0207689_10215724	3300025942	Bacteria	1586
1373	Ga0207689_10297295	3300025942	Bacteria	1338
1374	Ga0207689_10364038	3300025942	Bacteria	1203
1375	Ga0207689_10436867	3300025942	Bacteria	1093
1376	Ga0207661_10026560	3300025944	Bacteria	4413
1377	Ga0207661_10090383	3300025944	Bacteria	2549
1378	Ga0207661_10190576	3300025944	Bacteria	1797
1379	Ga0207661_10543483	3300025944	Bacteria	1064
1380	Ga0207661_11950275	3300025944	Bacteria	533
1381	Ga0207679_10001422	3300025945	Bacteria	15054
1382	Ga0207679_10011160	3300025945	Bacteria	5804
1383	Ga0207679_10074479	3300025945	Bacteria	2573
1384	Ga0207679_10112193	3300025945	Bacteria	2154
1385	Ga0207679_10133750	3300025945	Bacteria	1993
1386	Ga0207679_10193806	3300025945	Bacteria	1692
1387	Ga0207679_10206979	3300025945	Bacteria	1643
1388	Ga0207679_10929821	3300025945	Bacteria	796
1389	Ga0207679_10951141	3300025945	Bacteria	787
1390	Ga0207679_11003704	3300025945	Bacteria	765
1391	Ga0207667_10003860	3300025949	Bacteria	18438
1392	Ga0207667_10017864	3300025949	Bacteria	7972
1393	Ga0207667_10271172	3300025949	Bacteria	1735
1394	Ga0207667_10292278	3300025949	Bacteria	1665
1395	Ga0207667_10786065	3300025949	Bacteria	949
1396	Ga0207667_11474617	3300025949	Bacteria	652
1397	Ga0207651_10001161	3300025960	Bacteria	11777
1398	Ga0207651_10010012	3300025960	Bacteria	5227
1399	Ga0207651_10117040	3300025960	Bacteria	2013
1400	Ga0207651_10141863	3300025960	Bacteria	1857
1401	Ga0207651_10182359	3300025960	Bacteria	1666
1402	Ga0207651_10212138	3300025960	Bacteria	1559
1403	Ga0207651_10241356	3300025960	Bacteria	1473
1404	Ga0207651_10256471	3300025960	Bacteria	1433
1405	Ga0207651_10280614	3300025960	Bacteria	1376
1406	Ga0207651_10611967	3300025960	Bacteria	953
1407	Ga0207651_10750532	3300025960	Bacteria	862
1408	Ga0207651_10971078	3300025960	Bacteria	758
1409	Ga0207712_10018684	3300025961	Bacteria	4517
1410	Ga0207712_10099005	3300025961	Bacteria	2164
1411	Ga0207712_10104003	3300025961	Bacteria	2117
1412	Ga0207712_10224384	3300025961	Bacteria	1504
1413	Ga0207712_10273591	3300025961	Bacteria	1375
1414	Ga0207712_10351183	3300025961	Bacteria	1226
1415	Ga0207712_10372947	3300025961	Bacteria	1192
1416	Ga0207712_10426773	3300025961	Bacteria	1120
1417	Ga0207712_10658267	3300025961	Bacteria	911
1418	Ga0207668_10020156	3300025972	Bacteria	4231
1419	Ga0207668_10056063	3300025972	Bacteria	2743
1420	Ga0207668_10311920	3300025972	Bacteria	1302
1421	Ga0207668_10886424	3300025972	Bacteria	793
1422	Ga0207640_10058350	3300025981	Bacteria	2542
1423	Ga0207640_10469233	3300025981	Bacteria	1041
1424	Ga0207640_10524806	3300025981	Bacteria	990
1425	Ga0207640_10820481	3300025981	Bacteria	807
1426	Ga0207658_10113902	3300025986	Bacteria	2143
1427	Ga0207658_10266020	3300025986	Bacteria	1463
1428	Ga0207658_10746485	3300025986	Bacteria	886
1429	Ga0207658_11004558	3300025986	Bacteria	761
1430	Ga0207658_11089113	3300025986	Bacteria	730
1431	Ga0207658_11844382	3300025986	Bacteria	551
1432	Ga0207677_10272123	3300026023	Bacteria	1386
1433	Ga0207677_11016113	3300026023	Bacteria	752
1434	Ga0207677_11567352	3300026023	Bacteria	609
1435	Ga0207703_10033254	3300026035	Bacteria	4086
1436	Ga0207703_10084790	3300026035	Bacteria	2650
1437	Ga0207703_10258084	3300026035	Bacteria	1574
1438	Ga0207639_10058554	3300026041	Bacteria	2964
1439	Ga0207639_10153635	3300026041	Bacteria	1931
1440	Ga0207639_10987221	3300026041	Bacteria	788
1441	Ga0207678_10009839	3300026067	Bacteria	8402
1442	Ga0207678_10041831	3300026067	Bacteria	3972
1443	Ga0207678_10065410	3300026067	Bacteria	3122
1444	Ga0207678_10066708	3300026067	Bacteria	3090
1445	Ga0207678_10240913	3300026067	Bacteria	1549
1446	Ga0207678_10606993	3300026067	Bacteria	959
1447	Ga0207708_10033352	3300026075	Bacteria	3912
1448	Ga0207708_10050990	3300026075	Bacteria	3150
1449	Ga0207708_10097645	3300026075	Bacteria	2270
1450	Ga0207708_10122721	3300026075	Bacteria	2025
1451	Ga0207708_10131775	3300026075	Bacteria	1955
1452	Ga0207708_10140056	3300026075	Bacteria	1897
1453	Ga0207708_10170265	3300026075	Bacteria	1724
1454	Ga0207708_10218843	3300026075	Bacteria	1525
1455	Ga0207708_10255068	3300026075	Bacteria	1414
1456	Ga0207708_10335278	3300026075	Bacteria	1237
1457	Ga0207708_10550296	3300026075	Bacteria	973
1458	Ga0207708_10629106	3300026075	Bacteria	912
1459	Ga0207708_10684015	3300026075	Bacteria	876
1460	Ga0207708_10981533	3300026075	Bacteria	733
1461	Ga0207702_10002606	3300026078	Bacteria	16944
1462	Ga0207702_10003851	3300026078	Bacteria	13535
1463	Ga0207702_10026671	3300026078	Bacteria	4797
1464	Ga0207702_10653260	3300026078	Bacteria	1034
1465	Ga0207702_11057823	3300026078	Bacteria	805
1466	Ga0207641_10102102	3300026088	Bacteria	2528
1467	Ga0207641_10248486	3300026088	Bacteria	1660
1468	Ga0207641_10400237	3300026088	Bacteria	1318
1469	Ga0207641_10728585	3300026088	Bacteria	978
1470	Ga0207641_11135231	3300026088	Bacteria	780
1471	Ga0207641_11554030	3300026088	Bacteria	663
1472	Ga0207648_10003371	3300026089	Bacteria	16779
1473	Ga0207648_10013253	3300026089	Bacteria	7680
1474	Ga0207648_10046558	3300026089	Bacteria	3803
1475	Ga0207648_10239852	3300026089	Bacteria	1614
1476	Ga0207648_10489812	3300026089	Bacteria	1124
1477	Ga0207676_10009598	3300026095	Bacteria	6890
1478	Ga0207676_10057904	3300026095	Bacteria	3054
1479	Ga0207676_10081801	3300026095	Bacteria	2624
1480	Ga0207676_10106333	3300026095	Bacteria	2338
1481	Ga0207676_10133245	3300026095	Bacteria	2116
1482	Ga0207676_10138259	3300026095	Bacteria	2082
1483	Ga0207676_10339464	3300026095	Bacteria	1385
1484	Ga0207676_10368021	3300026095	Bacteria	1334
1485	Ga0207676_10498070	3300026095	Bacteria	1156
1486	Ga0207676_10530382	3300026095	Bacteria	1122
1487	Ga0207676_10631954	3300026095	Bacteria	1031
1488	Ga0207676_11909119	3300026095	Bacteria	592
1489	Ga0207676_12456531	3300026095	Bacteria	518
1490	Ga0207674_10003800	3300026116	Bacteria	18420
1491	Ga0207674_10025546	3300026116	Bacteria	6296
1492	Ga0207674_10043290	3300026116	Bacteria	4643
1493	Ga0207674_10046584	3300026116	Bacteria	4451
1494	Ga0207674_10057134	3300026116	Bacteria	3957
1495	Ga0207674_10066639	3300026116	Bacteria	3626
1496	Ga0207674_10074323	3300026116	Bacteria	3411
1497	Ga0207674_10124226	3300026116	Bacteria	2547
1498	Ga0207674_10248768	3300026116	Bacteria	1725
1499	Ga0207674_10381606	3300026116	Bacteria	1362
1500	Ga0207674_10490740	3300026116	Bacteria	1187
1501	Ga0207674_10545389	3300026116	Bacteria	1120
1502	Ga0207674_10867469	3300026116	Bacteria	870
1503	Ga0207674_11171937	3300026116	Bacteria	738
1504	Ga0207674_11193633	3300026116	Bacteria	730
1505	Ga0207674_11421277	3300026116	Bacteria	663
1506	Ga0207674_11444834	3300026116	Bacteria	657
1507	Ga0207674_12128406	3300026116	Bacteria	525
1508	Ga0207675_100022725	3300026118	Bacteria	5835
1509	Ga0207675_100023752	3300026118	Bacteria	5704
1510	Ga0207675_100052806	3300026118	Bacteria	3792
1511	Ga0207675_100081357	3300026118	Bacteria	3037
1512	Ga0207675_100093006	3300026118	Bacteria	2836
1513	Ga0207675_100094597	3300026118	Bacteria	2811
1514	Ga0207675_100151705	3300026118	Bacteria	2206
1515	Ga0207675_100213954	3300026118	Bacteria	1855
1516	Ga0207675_100249034	3300026118	Bacteria	1719
1517	Ga0207675_100268278	3300026118	Bacteria	1656
1518	Ga0207675_100437992	3300026118	Bacteria	1293
1519	Ga0207675_100623705	3300026118	Bacteria	1083
1520	Ga0207675_100959904	3300026118	Bacteria	872
1521	Ga0207675_101245419	3300026118	Bacteria	764
1522	Ga0207683_10015889	3300026121	Bacteria	6411
1523	Ga0207683_10016841	3300026121	Bacteria	6219
1524	Ga0207683_10021884	3300026121	Bacteria	5483
1525	Ga0207683_10054170	3300026121	Bacteria	3517
1526	Ga0207683_10222669	3300026121	Bacteria	1719
1527	Ga0207683_10248738	3300026121	Bacteria	1622
1528	Ga0207683_10341336	3300026121	Bacteria	1374
1529	Ga0207683_10446804	3300026121	Bacteria	1192
1530	Ga0207683_10473152	3300026121	Bacteria	1156
1531	Ga0207698_10068264	3300026142	Bacteria	2807
1532	Ga0207698_10105852	3300026142	Bacteria	2345
1533	Ga0207698_10186328	3300026142	Bacteria	1844
1534	Ga0207698_10202247	3300026142	Bacteria	1780
1535	Ga0207698_10670309	3300026142	Bacteria	1029
1536	Ga0207698_10844610	3300026142	Bacteria	920
1537	Ga0207698_11127904	3300026142	Bacteria	797
1538	Ga0207698_11343648	3300026142	Bacteria	729
1539	Ga0207698_11414019	3300026142	Bacteria	711
1540	Ga0209984_1052269	3300027424	Bacteria	599
1541	Ga0209968_1081948	3300027526	Bacteria	581
1542	Ga0209999_1050604	3300027543	Bacteria	785
1543	Ga0209983_1016113	3300027665	Bacteria	1542
1544	Ga0209983_1069529	3300027665	Bacteria	783
1545	Ga0209588_1028139	3300027671	Bacteria	1789
1546	Ga0209971_1025444	3300027682	Bacteria	1414
1547	Ga0209966_1026094	3300027695	Bacteria	1163
1548	Ga0209974_10017198	3300027876	Bacteria	2399
1549	Ga0209974_10127234	3300027876	Bacteria	906
1550	Ga0209974_10155246	3300027876	Bacteria	828
1551	Ga0209974_10360827	3300027876	Bacteria	565
1552	Ga0207428_10000487	3300027907	Bacteria	47438
1553	Ga0207428_10000570	3300027907	Bacteria	43701
1554	Ga0207428_10001541	3300027907	Bacteria	24114
1555	Ga0207428_10002655	3300027907	Bacteria	17812
1556	Ga0207428_10003291	3300027907	Bacteria	15710
1557	Ga0207428_10006979	3300027907	Bacteria	10347
1558	Ga0207428_10042714	3300027907	Bacteria	3665
1559	Ga0207428_10182453	3300027907	Bacteria	1585
1560	Ga0207428_10344821	3300027907	Bacteria	1097
1561	Ga0207428_10844667	3300027907	Bacteria	649
1562	Ga0265356_1007366	3300028017	Bacteria	1270
1563	Ga0265355_1003073	3300028036	Bacteria	1211
1564	Ga0268266_10006831	3300028379	Bacteria	10392
1565	Ga0268266_10053537	3300028379	Bacteria	3468
1566	Ga0268266_10458663	3300028379	Bacteria	1212
1567	Ga0268265_10000103	3300028380	Bacteria	106177
1568	Ga0268265_10021355	3300028380	Bacteria	4534
1569	Ga0268265_10048425	3300028380	Bacteria	3190
1570	Ga0268265_10285979	3300028380	Bacteria	1477
1571	Ga0268265_10306910	3300028380	Bacteria	1431
1572	Ga0268265_10313552	3300028380	Bacteria	1417
1573	Ga0268265_10447652	3300028380	Bacteria	1205
1574	Ga0268265_10664757	3300028380	Bacteria	1003
1575	Ga0268265_10726124	3300028380	Bacteria	962
1576	Ga0268265_11566245	3300028380	Bacteria	663
1577	Ga0268265_12086172	3300028380	Unclassified	574
1578	Ga0268264_10010645	3300028381	Bacteria	7600
1579	Ga0268264_10027905	3300028381	Bacteria	4615
1580	Ga0268264_10237700	3300028381	Bacteria	1686
1581	Ga0268264_10364592	3300028381	Bacteria	1379
1582	Ga0268264_10482506	3300028381	Bacteria	1206
1583	Ga0268264_10765843	3300028381	Bacteria	963
1584	Ga0268264_11007491	3300028381	Bacteria	840
1585	Ga0265337_1075517	3300028556	Bacteria	924
1586	Ga0265326_10155493	3300028558	Unclassified	653
1587	Ga0265319_1000426	3300028563	Bacteria	30400
1588	Ga0265319_1048413	3300028563	Bacteria	1411
1589	Ga0265319_1070993	3300028563	Bacteria	1116
1590	Ga0265319_1159626	3300028563	Bacteria	697
1591	Ga0265334_10084960	3300028573	Bacteria	1162
1592	Ga0265318_10000466	3300028577	Bacteria	30068
1593	Ga0265338_10002857	3300028800	Bacteria	25250
1594	Ga0265338_10017842	3300028800	Bacteria	7629
1595	Ga0265338_10066401	3300028800	Bacteria	3122
1596	Ga0265338_10066766	3300028800	Bacteria	3111
1597	Ga0265338_10087887	3300028800	Bacteria	2581
1598	Ga0265338_10094956	3300028800	Bacteria	2452
1599	Ga0265338_10133664	3300028800	Bacteria	1954
1600	Ga0265338_10218174	3300028800	Bacteria	1426
1601	Ga0265338_10272846	3300028800	Bacteria	1239
1602	Ga0265338_10342254	3300028800	Bacteria	1077
1603	Ga0265338_10441444	3300028800	Bacteria	922
1604	Ga0265324_10173337	3300029957	Unclassified	732
1605	Ga0316182_1309934	3300030745	Bacteria	632
1606	Ga0265762_1007058	3300030760	Bacteria	2006
1607	Ga0265762_1008735	3300030760	Bacteria	1803
1608	Ga0265762_1014812	3300030760	Bacteria	1409
1609	Ga0265762_1026261	3300030760	Bacteria	1089
1610	Ga0265762_1035631	3300030760	Bacteria	958
1611	Ga0265762_1132989	3300030760	Bacteria	579
1612	Ga0265762_1163547	3300030760	Bacteria	538
1613	Ga0265777_100033	3300030877	Bacteria	4295
1614	Ga0265770_1003601	3300030878	Bacteria	2107
1615	Ga0265770_1006606	3300030878	Bacteria	1615
1616	Ga0265770_1010532	3300030878	Bacteria	1343
1617	Ga0265770_1045233	3300030878	Bacteria	781
1618	Ga0265772_103393	3300030886	Bacteria	657
1619	Ga0265771_1011132	3300031010	Bacteria	670
1620	Ga0265773_1025439	3300031018	Bacteria	608
1621	Ga0265760_10019459	3300031090	Bacteria	1956
1622	Ga0265760_10020770	3300031090	Bacteria	1897
1623	Ga0265760_10020943	3300031090	Bacteria	1889
1624	Ga0265760_10040636	3300031090	Bacteria	1386
1625	Ga0265760_10057658	3300031090	Bacteria	1176
1626	Ga0265760_10118109	3300031090	Bacteria	849
1627	Ga0265760_10125617	3300031090	Bacteria	826
1628	Ga0265330_10006073	3300031235	Bacteria	5983
1629	Ga0265330_10348100	3300031235	Bacteria	626
1630	Ga0265332_10006554	3300031238	Bacteria	5279
1631	Ga0265332_10032292	3300031238	Bacteria	2282
1632	Ga0265332_10243435	3300031238	Bacteria	744
1633	Ga0265332_10391242	3300031238	Bacteria	574
1634	Ga0265328_10018083	3300031239	Bacteria	2723
1635	Ga0265320_10000126	3300031240	Bacteria	66933
1636	Ga0265320_10059921	3300031240	Bacteria	1819
1637	Ga0265320_10138400	3300031240	Bacteria	1103
1638	Ga0265325_10011206	3300031241	Bacteria	5158
1639	Ga0265325_10011719	3300031241	Bacteria	5032
1640	Ga0265325_10039203	3300031241	Bacteria	2496
1641	Ga0265325_10112208	3300031241	Bacteria	1323
1642	Ga0265329_10000274	3300031242	Bacteria	27297
1643	Ga0265329_10092146	3300031242	Bacteria	962
1644	Ga0265340_10002822	3300031247	Bacteria	9889
1645	Ga0265340_10040335	3300031247	Bacteria	2300
1646	Ga0265340_10185698	3300031247	Bacteria	939
1647	Ga0265340_10329041	3300031247	Bacteria	676
1648	Ga0265339_10001417	3300031249	Bacteria	17795
1649	Ga0265339_10032749	3300031249	Bacteria	2931
1650	Ga0265339_10048169	3300031249	Bacteria	2338
1651	Ga0265339_10119958	3300031249	Bacteria	1353
1652	Ga0265339_10303743	3300031249	Bacteria	760
1653	Ga0265331_10000025	3300031250	Bacteria	229346
1654	Ga0265331_10006433	3300031250	Bacteria	6938
1655	Ga0265331_10227300	3300031250	Bacteria	838
1656	Ga0265316_10000784	3300031344	Bacteria	35048
1657	Ga0265316_10016208	3300031344	Bacteria	6473
1658	Ga0265316_10017308	3300031344	Bacteria	6237
1659	Ga0265316_10027700	3300031344	Bacteria	4686
1660	Ga0265316_10040138	3300031344	Bacteria	3754
1661	Ga0265316_10065813	3300031344	Bacteria	2806
1662	Ga0265316_10189522	3300031344	Bacteria	1528
1663	Ga0265316_10280053	3300031344	Bacteria	1219
1664	Ga0265316_10322510	3300031344	Bacteria	1122
1665	Ga0307408_100010079	3300031548	Bacteria	6229
1666	Ga0307408_100057488	3300031548	Bacteria	2824
1667	Ga0307408_100081795	3300031548	Bacteria	2415
1668	Ga0307408_100160214	3300031548	Bacteria	1787
1669	Ga0307408_100357623	3300031548	Bacteria	1241
1670	Ga0307408_100724008	3300031548	Bacteria	896
1671	Ga0307408_102183095	3300031548	Bacteria	535
1672	Ga0265313_10001605	3300031595	Bacteria	21001
1673	Ga0265313_10014497	3300031595	Bacteria	4652
1674	Ga0265313_10244883	3300031595	Bacteria	733
1675	Ga0316575_10001707	3300031665	Bacteria	7199
1676	Ga0316575_10051697	3300031665	Bacteria	1636
1677	Ga0316579_10262051	3300031691	Bacteria	836
1678	Ga0316579_10335490	3300031691	Bacteria	731
1679	Ga0265314_10003075	3300031711	Bacteria	16448
1680	Ga0265314_10007579	3300031711	Bacteria	9400
1681	Ga0265314_10051681	3300031711	Bacteria	2861
1682	Ga0265314_10122093	3300031711	Bacteria	1638
1683	Ga0265342_10000362	3300031712	Bacteria	50260
1684	Ga0265342_10008579	3300031712	Bacteria	7308
1685	Ga0316576_10029952	3300031727	Bacteria	3850
1686	Ga0316576_10034426	3300031727	Bacteria	3610
1687	Ga0316576_10169271	3300031727	Bacteria	1649
1688	Ga0316576_10230232	3300031727	Bacteria	1393
1689	Ga0316576_11266770	3300031727	Bacteria	519
1690	Ga0316578_10005047	3300031728	Bacteria	6341
1691	Ga0316578_10486292	3300031728	Bacteria	728
1692	Ga0307405_10003705	3300031731	Bacteria	7092
1693	Ga0307405_10016138	3300031731	Bacteria	4065
1694	Ga0307405_10127804	3300031731	Bacteria	1751
1695	Ga0307405_10146129	3300031731	Bacteria	1656
1696	Ga0307405_10183848	3300031731	Bacteria	1503
1697	Ga0307405_10213570	3300031731	Bacteria	1410
1698	Ga0316577_10093016	3300031733	Bacteria	1688
1699	Ga0307413_10015504	3300031824	Bacteria	3908
1700	Ga0307413_10112221	3300031824	Bacteria	1827
1701	Ga0307413_10253804	3300031824	Bacteria	1306
1702	Ga0307413_10277933	3300031824	Bacteria	1258
1703	Ga0307413_10329299	3300031824	Bacteria	1170
1704	Ga0307413_10683530	3300031824	Bacteria	850
1705	Ga0307413_10973467	3300031824	Bacteria	725
1706	Ga0307413_11158912	3300031824	Bacteria	670
1707	Ga0307410_10061823	3300031852	Bacteria	2564
1708	Ga0307410_10089147	3300031852	Bacteria	2185
1709	Ga0307410_10589679	3300031852	Bacteria	926
1710	Ga0307410_10846115	3300031852	Bacteria	781
1711	Ga0307410_11507728	3300031852	Bacteria	592
1712	Ga0307406_10019528	3300031901	Bacteria	3978
1713	Ga0307406_10311688	3300031901	Bacteria	1213
1714	Ga0307406_10526991	3300031901	Bacteria	962
1715	Ga0307406_10808441	3300031901	Bacteria	792
1716	Ga0307406_11864599	3300031901	Bacteria	535
1717	Ga0307407_10002685	3300031903	Bacteria	7052
1718	Ga0307407_10225619	3300031903	Bacteria	1269
1719	Ga0307407_10721540	3300031903	Bacteria	752
1720	Ga0307412_10010747	3300031911	Bacteria	5280
1721	Ga0307412_10022653	3300031911	Bacteria	3855
1722	Ga0307412_10937903	3300031911	Bacteria	761
1723	Ga0307412_11264475	3300031911	Bacteria	663
1724	Ga0307412_12039794	3300031911	Bacteria	532
1725	Ga0307409_100008587	3300031995	Bacteria	6213
1726	Ga0307409_100009123	3300031995	Bacteria	6075
1727	Ga0307409_100010075	3300031995	Bacteria	5849
1728	Ga0307409_100145348	3300031995	Bacteria	2050
1729	Ga0307409_100489809	3300031995	Bacteria	1195
1730	Ga0307409_100577978	3300031995	Bacteria	1107
1731	Ga0307409_101169196	3300031995	Bacteria	792
1732	Ga0307416_100003624	3300032002	Bacteria	9121
1733	Ga0307416_100007895	3300032002	Bacteria	6811
1734	Ga0307416_100048189	3300032002	Bacteria	3378
1735	Ga0307416_100068883	3300032002	Bacteria	2925
1736	Ga0307416_100215862	3300032002	Bacteria	1835
1737	Ga0307416_100383634	3300032002	Bacteria	1436
1738	Ga0307416_100595139	3300032002	Bacteria	1185
1739	Ga0307416_100978009	3300032002	Bacteria	949
1740	Ga0307414_10014997	3300032004	Bacteria	4667
1741	Ga0307414_10288568	3300032004	Bacteria	1382
1742	Ga0307414_10342135	3300032004	Bacteria	1281
1743	Ga0307414_10650438	3300032004	Bacteria	950
1744	Ga0307414_10883431	3300032004	Bacteria	819
1745	Ga0307411_10016125	3300032005	Bacteria	4223
1746	Ga0307411_10072105	3300032005	Bacteria	2344
1747	Ga0307411_10124459	3300032005	Bacteria	1872
1748	Ga0307411_10284225	3300032005	Bacteria	1318
1749	Ga0307411_10365661	3300032005	Bacteria	1181
1750	Ga0307411_11317516	3300032005	Bacteria	658
1751	Ga0316053_109677	3300032120	Bacteria	664
1752	Ga0307415_100000625	3300032126	Bacteria	15495
1753	Ga0307415_100027708	3300032126	Bacteria	3593
1754	Ga0307415_100798279	3300032126	Bacteria	861
1755	Ga0316585_10001353	3300032137	Bacteria	6432
1756	Ga0316585_10092273	3300032137	Bacteria	990
1757	Ga0316580_10015398	3300032139	Bacteria	2339
1758	Ga0316593_10004142	3300032168	Bacteria	3686
1759	Ga0316593_10013084	3300032168	Bacteria	2449
1760	Ga0316596_1003008	3300033541	Bacteria	3660
1761	Ga0316596_1053656	3300033541	Bacteria	1069
1762	Ga0373948_0001632	3300034817	Bacteria	3162
1763	Ga0373950_0025540	3300034818	Bacteria	1067
1764	Ga0373958_0000045	3300034819	Bacteria	12165
1765	Ga0373938_0000418	3300034957	Bacteria	6847
1766	Ga0373928_0000984	3300035084	Bacteria	5581
1767	Ga0373928_0088542	3300035084	Bacteria	791
1768	Ga0373934_0039778	3300035086	Bacteria	1854
1769	Ga0373934_0125210	3300035086	Bacteria	1046
1770	Ga0373940_0000084	3300035088	Bacteria	11367
1771	Ga0373949_0000597	3300035090	Bacteria	11806
1772	Ga0373949_0136015	3300035090	Bacteria	701
1773	Ga0373951_0025379	3300035091	Bacteria	1376
1774	Ga0373951_0134710	3300035091	Bacteria	682
1775	Ga0373952_0030973	3300035092	Bacteria	1187
1776	Ga0373923_0065334	3300035111	Bacteria	1553
1777	Ga0373923_0098556	3300035111	Bacteria	1286
1778	Ga0373923_0162819	3300035111	Bacteria	1018
1779	Ga0373932_0001521	3300035112	Bacteria	6426
1780	Ga0373936_0024125	3300035113	Bacteria	2373
1781	Ga0373936_0516990	3300035113	Bacteria	556
1782	Ga0373939_0002335	3300035114	Bacteria	4487
1783	Ga0373939_0030175	3300035114	Bacteria	1557
1784	Ga0373939_0054583	3300035114	Bacteria	1252
1785	Ga0373941_0000161	3300035115	Bacteria	12224
1786	Ga0373945_0034528	3300035116	Bacteria	1803
1787	Ga0373954_0060048	3300035118	Bacteria	1793
1788	Ga0373954_0662541	3300035118	Bacteria	517
1789	Ga0373956_0002995	3300035119	Bacteria	6842
1790	Ga0373956_0511147	3300035119	Bacteria	573
1791	Ga0373957_0188454	3300035120	Bacteria	857
1792	Ga0373957_0196740	3300035120	Bacteria	839
1793	Ga0373957_0486439	3300035120	Bacteria	536
1794	Ga0373960_0001448	3300035121	Bacteria	5252
1795	Ga0373960_0019772	3300035121	Bacteria	1773
1796	Ga0373943_0126228	3300035170	Bacteria	1365
1797	Ga0373943_0160483	3300035170	Bacteria	1224
1798	Ga0373943_0235419	3300035170	Bacteria	1024
1799	Ga0373943_0298866	3300035170	Bacteria	914
1800	Ga0373943_0474431	3300035170	Bacteria	729
1801	Ga0373946_0036665	3300035171	Bacteria	1990
1802	Ga0373946_0063364	3300035171	Bacteria	1579
1803	Ga0373946_0122329	3300035171	Bacteria	1189
1804	Ga0373946_0308030	3300035171	Bacteria	784
1805	Ga0373955_0061523	3300035172	Bacteria	2074
1806	Ga0373955_0104192	3300035172	Bacteria	1632
1807	Ga0373955_0144108	3300035172	Bacteria	1398
1808	Ga0373955_0626120	3300035172	Bacteria	659
1809	Ga0373942_0001420	3300035207	Bacteria	6171
1810	Ga0373942_0216754	3300035207	Bacteria	640
1811	Ga0373961_0001591	3300035241	Bacteria	6457
1812	Ga0373961_0017893	3300035241	Bacteria	1844
1813	Ga0373961_0204075	3300035241	Bacteria	698
1814	Ga0373962_0000245	3300035242	Bacteria	11519
1815	Ga0373962_0008391	3300035242	Bacteria	2541
1816	Ga0373962_0260136	3300035242	Bacteria	605
1817	Ga0316574_0000232	3300035398	Bacteria	20051
1818	Ga0316574_0075698	3300035398	Bacteria	2132
1819	Ga0316574_0143004	3300035398	Bacteria	1541
1820	Ga0373924_0263969	3300035410	Bacteria	763
1821	Ga0373931_0002441	3300035691	Bacteria	8234
1822	Ga0373931_0013684	3300035691	Bacteria	3955
1823	Ga0373935_0011909	3300035692	Bacteria	5226
1824	Ga0373935_0030527	3300035692	Bacteria	3341
1825	Ga0373935_0042503	3300035692	Bacteria	2858
1826	Ga0373935_0221627	3300035692	Bacteria	1314
1827	Ga0373935_0462301	3300035692	Bacteria	918
1828	Ga0373935_0505529	3300035692	Bacteria	878
1829	Ga0373935_1190880	3300035692	Bacteria	568
1830	Ga0373935_1510541	3300035692	Bacteria	503
1831	Ga0373927_0093471	3300035695	Bacteria	1954
1832	Ga0373933_0002799	3300035724	Bacteria	9741
1833	Ga0373933_0045201	3300035724	Bacteria	2611
1834	Ga0373933_0136680	3300035724	Bacteria	1544
1835	Ga0373933_0204780	3300035724	Bacteria	1263
1836	Ga0373933_0309385	3300035724	Bacteria	1024
1837	Ga0373947_0043634	3300035725	Bacteria	2679
1838	Ga0373947_0353195	3300035725	Bacteria	987
1839	Ga0373947_0371340	3300035725	Bacteria	962
1840	Ga0373937_0000238	3300036401	Bacteria	53880
1841	Ga0373937_0014533	3300036401	Bacteria	6953
1842	Ga0373937_0033312	3300036401	Bacteria	4678
1843	Ga0373937_0053966	3300036401	Bacteria	3687
1844	Ga0373937_0092719	3300036401	Bacteria	2800
1845	Ga0373937_0131289	3300036401	Bacteria	2340
1846	Ga0373937_0397542	3300036401	Bacteria	1307
1847	Ga0373937_1303293	3300036401	Bacteria	674
1848	Ga0265778_000084	3300036457	Bacteria	5781
1849	Ga0265778_013163	3300036457	Bacteria	967
1850	Ga0316582_0107956	3300036647	Bacteria	1850
1851	Ga0316582_0351922	3300036647	Bacteria	1013
1852	Ga0316584_0028415	3300036712	Bacteria	4124
1853	Ga0316584_0070587	3300036712	Bacteria	2618
1854	Ga0316584_0568767	3300036712	Bacteria	789
1855	Ga0316584_0762688	3300036712	Bacteria	659
1856	Ga0316584_1015690	3300036712	Bacteria	553
1857	Ga0373925_0111916	3300037068	Bacteria	2110
1858	Ga0373925_0153738	3300037068	Bacteria	1808
1859	Ga0373925_0231223	3300037068	Bacteria	1478
1860	Ga0373925_0271625	3300037068	Bacteria	1364
1861	Ga0373925_0433749	3300037068	Bacteria	1075
1862	Ga0373925_0465916	3300037068	Bacteria	1036
1863	Ga0373925_0651424	3300037068	Bacteria	868
1864	Ga0373925_1146925	3300037068	Bacteria	639
1865	Ga0395900_0246523	3300037418	Bacteria	1790
1866	Ga0395900_0578520	3300037418	Bacteria	1065
1867	Ga0395898_0717426	3300037466	Bacteria	942
1868	Ga0395905_0197741	3300037471	Bacteria	1885
1869	Ga0395905_0229498	3300037471	Bacteria	1736
1870	Ga0395905_1529243	3300037471	Bacteria	572
1871	Ga0316581_0220815	3300037588	Bacteria	583
1872	Ga0436364_0071007	3300037853	Bacteria	1535
1873	Ga0436364_0100477	3300037853	Bacteria	1387
1874	Ga0436364_0202564	3300037853	Bacteria	2494
1875	Ga0436364_0240413	3300037853	Bacteria	9540
1876	Ga0436364_0336877	3300037853	Bacteria	1967
1877	Ga0436364_0637057	3300037853	Bacteria	692
1878	Ga0436364_0729405	3300037853	Bacteria	3249
1879	Ga0436364_1048251	3300037853	Bacteria	1079
1880	Ga0436364_1054367	3300037853	Bacteria	18076
1881	Ga0436364_1058247	3300037853	Bacteria	8845
1882	Ga0436364_1113127	3300037853	Bacteria	158393
1883	Ga0436364_1121262	3300037853	Bacteria	32436
1884	Ga0436364_1191769	3300037853	Bacteria	3412
1885	Ga0436364_1400193	3300037853	Bacteria	4067
1886	Ga0436364_1432674	3300037853	Bacteria	2013
1887	Ga0436364_1503533	3300037853	Bacteria	821
1888	Ga0395901_1322845	3300038443	Bacteria	682
1889	Ga0242420_064857	3300038996	Bacteria	734
1890	Ga0436365_0009652	3300039437	Bacteria	680
1891	Ga0436365_0196842	3300039437	Bacteria	2788
1892	Ga0436365_0446695	3300039437	Bacteria	741
1893	Ga0436365_0821682	3300039437	Bacteria	7072
1894	Ga0436365_0832523	3300039437	Bacteria	851
1895	Ga0436365_0890233	3300039437	Bacteria	9662
1896	Ga0436365_0933832	3300039437	Bacteria	1846
1897	Ga0436365_1141410	3300039437	Bacteria	715
1898	Ga0436365_1446940	3300039437	Bacteria	888
1899	Ga0436365_1496060	3300039437	Bacteria	599
1900	Ga0436365_1589353	3300039437	Bacteria	2261
1901	Ga0436365_1636383	3300039437	Bacteria	2851
1902	Ga0436365_1657880	3300039437	Bacteria	2371
1903	Ga0436365_1708300	3300039437	Bacteria	550
1904	Ga0436365_1875905	3300039437	Bacteria	993
1905	Ga0436360_0222243	3300039438	Bacteria	17184
1906	Ga0436360_0362444	3300039438	Bacteria	576
1907	Ga0436360_0599497	3300039438	Bacteria	1257
1908	Ga0436360_0639138	3300039438	Bacteria	1030
1909	Ga0436360_1041824	3300039438	Bacteria	3228
1910	Ga0436361_0420648	3300039447	Bacteria	1134
1911	Ga0436361_0754359	3300039447	Bacteria	78520
1912	Ga0436361_1030968	3300039447	Bacteria	5079
1913	Ga0436361_1065605	3300039447	Bacteria	903
1914	Ga0436363_0070828	3300039450	Bacteria	507
1915	Ga0436363_0325843	3300039450	Bacteria	778
1916	Ga0436363_0366011	3300039450	Bacteria	1052
1917	Ga0436363_0418035	3300039450	Bacteria	573
1918	Ga0436363_0703121	3300039450	Bacteria	545
1919	Ga0436363_1175577	3300039450	Bacteria	770
1920	Ga0436363_1241984	3300039450	Bacteria	611
1921	Ga0436363_1351619	3300039450	Bacteria	2929
1922	Ga0436363_1375689	3300039450	Bacteria	2135
1923	Ga0436363_1382919	3300039450	Unclassified	704
1924	Ga0436363_1464689	3300039450	Bacteria	1244
1925	Ga0436363_1502573	3300039450	Bacteria	905
1926	Ga0436363_1684757	3300039450	Bacteria	16063
1927	Ga0436362_0060795	3300039453	Bacteria	4399
1928	Ga0436362_0300827	3300039453	Bacteria	1000
1929	Ga0436362_0325756	3300039453	Bacteria	870
1930	Ga0436362_0336800	3300039453	Bacteria	6278
1931	Ga0436362_0378468	3300039453	Bacteria	3668
1932	Ga0436362_0678590	3300039453	Bacteria	3258
1933	Ga0436362_0803568	3300039453	Bacteria	1619
1934	Ga0436362_1240431	3300039453	Bacteria	3489
1935	Ga0436362_1287607	3300039453	Bacteria	1786
1936	Ga0436362_1302949	3300039453	Bacteria	1280
1937	Ga0439436_0100431	3300041404	Bacteria	807
1938	Ga0439438_051557	3300041405	Bacteria	1045
1939	Ga0439439_0072645	3300041406	Bacteria	923
1940	Ga0439439_0145571	3300041406	Bacteria	671
1941	Ga0439453_0004794	3300041408	Bacteria	2029
1942	Ga0439453_0016605	3300041408	Bacteria	1286
1943	Ga0439453_0025935	3300041408	Bacteria	1084
1944	Ga0439453_0029411	3300041408	Bacteria	1034
1945	Ga0439461_0078944	3300041410	Bacteria	774
1946	Ga0439461_0203114	3300041410	Bacteria	533
1947	Ga0451787_185390	3300041441	Bacteria	564
1948	Ga0451800_0915318	3300041459	Bacteria	602
1949	Ga0451802_1895611	3300041460	Bacteria	590
1950	Ga0451807_1303676	3300041486	Bacteria	864
1951	Ga0451835_1259139	3300041492	Bacteria	629
1952	Ga0439431_0023903	3300041997	Bacteria	1483
1953	Ga0439431_0035041	3300041997	Bacteria	1260
1954	Ga0439431_0059821	3300041997	Bacteria	1001
1955	Ga0439433_0003305	3300041999	Bacteria	3456
1956	Ga0439433_0019476	3300041999	Bacteria	1512
1957	Ga0439433_0053899	3300041999	Bacteria	951
1958	Ga0439441_085985	3300042001	Bacteria	690
1959	Ga0439443_027889	3300042003	Bacteria	919
1960	Ga0439443_078359	3300042003	Bacteria	611
1961	Ga0439445_0035897	3300042004	Bacteria	1303
1962	Ga0439445_0094755	3300042004	Bacteria	843
1963	Ga0439445_0122373	3300042004	Bacteria	747
1964	Ga0439445_0131261	3300042004	Bacteria	723
1965	Ga0439449_0030857	3300042007	Bacteria	1998
1966	Ga0439449_0271896	3300042007	Bacteria	638
1967	Ga0439450_001122	3300042008	Bacteria	3796
1968	Ga0439450_006649	3300042008	Bacteria	2090
1969	Ga0439451_024249	3300042009	Bacteria	1222
1970	Ga0439456_050819	3300042013	Bacteria	906
1971	Ga0439457_058728	3300042014	Bacteria	870
1972	Ga0439462_0015273	3300042015	Bacteria	1978
1973	Ga0439463_193666	3300042016	Bacteria	528
1974	Ga0450919_020895	3300042121	Bacteria	739
1975	Ga0450920_017831	3300042122	Bacteria	1358
1976	Ga0450920_032321	3300042122	Bacteria	1033
1977	Ga0450921_013421	3300042123	Bacteria	720
1978	Ga0450895_002671	3300042132	Bacteria	1340
1979	Ga0450896_000755	3300042133	Bacteria	3627
1980	Ga0450896_018419	3300042133	Bacteria	1012
1981	Ga0450896_028446	3300042133	Bacteria	839
1982	Ga0450898_051989	3300042134	Bacteria	793
1983	Ga0450905_088931	3300042142	Bacteria	544
1984	Ga0450906_034703	3300042145	Bacteria	891
1985	Ga0450910_043211	3300042147	Bacteria	732
1986	Ga0439446_0015322	3300042156	Bacteria	2126
1987	Ga0439446_0027668	3300042156	Bacteria	1628
1988	Ga0439446_0056617	3300042156	Bacteria	1178
1989	Ga0439446_0081098	3300042156	Bacteria	1005
1990	Ga0439446_0172593	3300042156	Bacteria	720
1991	Ga0439446_0244988	3300042156	Bacteria	617
1992	Ga0439434_0014052	3300042435	Bacteria	2381
1993	Ga0439434_0039654	3300042435	Bacteria	1445
1994	Ga0439434_0070200	3300042435	Bacteria	1102
1995	Ga0439434_0155331	3300042435	Bacteria	759
1996	Ga0439434_0175087	3300042435	Bacteria	717
1997	Ga0439435_0007633	3300042436	Bacteria	2483
1998	Ga0439435_0013274	3300042436	Bacteria	2011
1999	Ga0439435_0013307	3300042436	Bacteria	2010
2000	Ga0439435_0015414	3300042436	Bacteria	1902
2001	Ga0439435_0065818	3300042436	Bacteria	1064
2002	Ga0439435_0109210	3300042436	Bacteria	857
2003	Ga0439435_0137376	3300042436	Bacteria	776
2004	Ga0439435_0165231	3300042436	Bacteria	716
2005	Ga0439444_0128155	3300042437	Bacteria	598
2006	Ga0439444_0147824	3300042437	Bacteria	566
2007	Ga0439459_0029533	3300042438	Bacteria	1107
2008	Ga0439464_0019492	3300042439	Bacteria	1852
2009	Ga0439464_0061233	3300042439	Bacteria	1102
2010	Ga0439464_0140549	3300042439	Bacteria	752
2011	Ga0439460_0030589	3300042461	Bacteria	1531
2012	Ga0439460_0107664	3300042461	Bacteria	901
2013	Ga0450916_029311	3300042530	Bacteria	795
2014	Ga0451577_0010501	3300042876	Bacteria	8843
2015	Ga0451577_0011517	3300042876	Bacteria	8358
2016	Ga0451577_0015343	3300042876	Bacteria	7130
2017	Ga0451577_0053226	3300042876	Bacteria	3614
2018	Ga0451577_0226955	3300042876	Bacteria	1688
2019	Ga0451577_0285939	3300042876	Bacteria	1494
2020	Ga0451577_0389714	3300042876	Bacteria	1264
2021	Ga0451577_0552691	3300042876	Bacteria	1045
2022	Ga0451577_1170952	3300042876	Bacteria	686
2023	Ga0451577_1211359	3300042876	Bacteria	673
2024	Ga0439440_0036941	3300042993	Bacteria	1177
2025	Ga0439440_0055198	3300042993	Bacteria	1002
2026	Ga0439440_0079013	3300042993	Bacteria	867
2027	Ga0453683_0004189	3300044673	Bacteria	10317
2028	Ga0453683_0006843	3300044673	Bacteria	7785
2029	Ga0453683_0008784	3300044673	Bacteria	6768
2030	Ga0453683_0012952	3300044673	Bacteria	5452
2031	Ga0453683_0284632	3300044673	Bacteria	1056
2032	Ga0453683_0464429	3300044673	Bacteria	819
2033	Ga0453683_0480755	3300044673	Bacteria	805
2034	Ga0466966_0097377	3300044684	Bacteria	1822
2035	Ga0466966_0348609	3300044684	Bacteria	890
2036	Ga0466961_0066545	3300044693	Bacteria	2289
2037	Ga0466963_0034085	3300044694	Bacteria	3311
2038	Ga0466963_0370629	3300044694	Bacteria	1009
2039	Ga0466963_0449609	3300044694	Bacteria	909
2040	Ga0466963_0908171	3300044694	Bacteria	621
2041	Ga0466964_0038031	3300044706	Bacteria	1934
2042	Ga0466964_0661092	3300044706	Bacteria	579
2043	Ga0453684_0008349	3300044712	Bacteria	18610
2044	Ga0453684_0010446	3300044712	Bacteria	15876
2045	Ga0453684_0060757	3300044712	Bacteria	4857
2046	Ga0453684_0070322	3300044712	Bacteria	4432
2047	Ga0453684_0103316	3300044712	Bacteria	3483
2048	Ga0453684_0366242	3300044712	Bacteria	1622
2049	Ga0453684_1007707	3300044712	Bacteria	885
2050	Ga0453684_1564433	3300044712	Bacteria	678
2051	Ga0466968_0073577	3300044735	Bacteria	1491
2052	Ga0466970_0296093	3300044765	Bacteria	912
2053	Ga0466970_0465988	3300044765	Bacteria	725
2054	Ga0466957_0241364	3300044842	Bacteria	1199
2055	Ga0466960_0086709	3300044901	Bacteria	1588
2056	Ga0451576_0018296	3300045051	Bacteria	7684
2057	Ga0451576_0055541	3300045051	Bacteria	4142
2058	Ga0451576_0066389	3300045051	Bacteria	3756
2059	Ga0451576_0084364	3300045051	Bacteria	3304
2060	Ga0451576_0093519	3300045051	Bacteria	3126
2061	Ga0451576_0132682	3300045051	Bacteria	2596
2062	Ga0451576_0224852	3300045051	Bacteria	1960
2063	Ga0451576_0317050	3300045051	Bacteria	1631
2064	Ga0451576_0385399	3300045051	Bacteria	1469
2065	Ga0451576_0714922	3300045051	Bacteria	1052
2066	Ga0451576_0877597	3300045051	Bacteria	941
2067	Ga0451576_1268048	3300045051	Bacteria	769
2068	Ga0451576_1378020	3300045051	Bacteria	734
2069	Ga0466958_0078521	3300045836	Bacteria	2029
2070	Ga0466958_0168574	3300045836	Bacteria	1386
2071	Ga0466958_0467981	3300045836	Bacteria	817
2072	Ga0466958_0488459	3300045836	Bacteria	799
2073	Ga0466967_0011957	3300045976	Bacteria	6613
2074	Ga0466967_0041111	3300045976	Bacteria	3983
2075	Ga0466967_0057235	3300045976	Bacteria	3441
2076	Ga0466967_1391242	3300045976	Bacteria	699
2077	Ga0495592_0002866	3300046454	Bacteria	12261
2078	Ga0495603_0163063	3300046455	Bacteria	1293
2079	Ga0495603_0174783	3300046455	Bacteria	1243
2080	Ga0495590_0052166	3300046457	Bacteria	1429
2081	Ga0495629_0005673	3300046459	Bacteria	9321
2082	Ga0495629_0039073	3300046459	Bacteria	3341
2083	Ga0495638_0029541	3300046460	Bacteria	3535
2084	Ga0495651_0000269	3300046462	Bacteria	40351
2085	Ga0495651_0002930	3300046462	Bacteria	13203
2086	Ga0495651_0056300	3300046462	Bacteria	3021
2087	Ga0495653_0008279	3300046463	Bacteria	8527
2088	Ga0495653_0774795	3300046463	Bacteria	578
2089	Ga0495580_0001845	3300046472	Bacteria	18638
2090	Ga0495580_0006027	3300046472	Bacteria	9927
2091	Ga0495580_0019875	3300046472	Bacteria	4980
2092	Ga0495580_0095127	3300046472	Bacteria	2072
2093	Ga0495580_0263915	3300046472	Bacteria	1177
2094	Ga0495580_0467656	3300046472	Bacteria	845
2095	Ga0495580_0597561	3300046472	Bacteria	729
2096	Ga0495580_0745946	3300046472	Bacteria	638
2097	Ga0495582_0004179	3300046473	Bacteria	8118
2098	Ga0495582_0017687	3300046473	Bacteria	3900
2099	Ga0495582_0194031	3300046473	Bacteria	1159
2100	Ga0495582_0903152	3300046473	Bacteria	511
2101	Ga0495639_0119857	3300046475	Bacteria	1255
2102	Ga0495662_0607831	3300046476	Bacteria	534
2103	Ga0495664_0055549	3300046477	Bacteria	2356
2104	Ga0495664_0095937	3300046477	Bacteria	1785
2105	Ga0495584_0036251	3300046491	Bacteria	2491
2106	Ga0495584_0041619	3300046491	Bacteria	2319
2107	Ga0495584_0237246	3300046491	Bacteria	927
2108	Ga0495584_0328437	3300046491	Bacteria	777
2109	Ga0495584_0372898	3300046491	Bacteria	725
2110	Ga0495584_0660100	3300046491	Bacteria	533
2111	Ga0495585_0148659	3300046492	Bacteria	1223
2112	Ga0495585_0243046	3300046492	Bacteria	901
2113	Ga0495594_0013061	3300046499	Bacteria	4331
2114	Ga0495594_0018438	3300046499	Bacteria	3696
2115	Ga0495594_0103100	3300046499	Bacteria	1605
2116	Ga0495596_0286596	3300046500	Bacteria	640
2117	Ga0495583_0426913	3300046506	Bacteria	520
2118	Ga0495608_0300403	3300046511	Bacteria	994
2119	Ga0495608_0437160	3300046511	Bacteria	797
2120	Ga0495616_0083494	3300046513	Bacteria	1524
2121	Ga0495618_0008519	3300046514	Bacteria	6201
2122	Ga0495620_0264072	3300046515	Bacteria	656
2123	Ga0495628_0007627	3300046516	Bacteria	9350
2124	Ga0495628_0691306	3300046516	Bacteria	721
2125	Ga0495630_0003394	3300046517	Bacteria	11094
2126	Ga0495630_0339591	3300046517	Bacteria	1149
2127	Ga0495630_0421005	3300046517	Bacteria	1023
2128	Ga0495643_0008784	3300046522	Bacteria	6366
2129	Ga0495644_0070816	3300046523	Bacteria	1310
2130	Ga0495644_0191789	3300046523	Bacteria	787
2131	Ga0495663_0022782	3300046525	Bacteria	1811
2132	Ga0495666_0152073	3300046526	Bacteria	1076
2133	Ga0495666_0284504	3300046526	Bacteria	749
2134	Ga0495642_0004633	3300046528	Bacteria	5329
2135	Ga0495642_0324427	3300046528	Bacteria	676
2136	Ga0495652_0006579	3300046529	Bacteria	10798
2137	Ga0495652_0023062	3300046529	Bacteria	5519
2138	Ga0495665_0175153	3300046531	Bacteria	1116
2139	Ga0495640_0012136	3300046533	Bacteria	6596
2140	Ga0495640_0029374	3300046533	Bacteria	3948
2141	Ga0495640_0222183	3300046533	Bacteria	1191
2142	Ga0495640_0921274	3300046533	Bacteria	517
2143	Ga0495586_0025989	3300046535	Bacteria	3133
2144	Ga0495586_0447198	3300046535	Bacteria	745
2145	Ga0495587_0000383	3300046536	Bacteria	31535
2146	Ga0495587_0001208	3300046536	Bacteria	17086
2147	Ga0495598_0009276	3300046537	Bacteria	2321
2148	Ga0495598_0027246	3300046537	Bacteria	1574
2149	Ga0495609_0019662	3300046538	Bacteria	3122
2150	Ga0495609_0099809	3300046538	Bacteria	1258
2151	Ga0495621_0003023	3300046539	Bacteria	4590
2152	Ga0495621_0019246	3300046539	Bacteria	2228
2153	Ga0495621_0039960	3300046539	Bacteria	1642
2154	Ga0495621_0080708	3300046539	Bacteria	1212
2155	Ga0495621_0117878	3300046539	Bacteria	1023
2156	Ga0495621_0120941	3300046539	Bacteria	1012
2157	Ga0495621_0157502	3300046539	Bacteria	896
2158	Ga0495622_0287203	3300046557	Bacteria	718
2159	Ga0495667_0005671	3300046559	Bacteria	8448
2160	Ga0495667_0006456	3300046559	Bacteria	7961
2161	Ga0495667_0217474	3300046559	Bacteria	1220
2162	Ga0495656_0013358	3300046615	Bacteria	3054
2163	Ga0495656_0120246	3300046615	Bacteria	1239
2164	Ga0495656_0220352	3300046615	Bacteria	948
2165	Ga0495656_0664219	3300046615	Bacteria	560
2166	Ga0495656_0700114	3300046615	Bacteria	545
2167	Ga0495634_0225797	3300046642	Bacteria	1154
2168	Ga0495634_0246877	3300046642	Bacteria	1093
2169	Ga0495635_0173793	3300046663	Bacteria	1465
2170	Ga0495635_0310528	3300046663	Bacteria	1056
2171	Ga0495659_0002901	3300046664	Bacteria	5502
2172	Ga0495659_0057748	3300046664	Bacteria	1426
2173	Ga0495661_0257617	3300046665	Bacteria	888
2174	Ga0495588_0004710	3300046674	Bacteria	6030
2175	Ga0495588_0507407	3300046674	Bacteria	632
2176	Ga0495657_0028345	3300046675	Bacteria	3941
2177	Ga0495657_0139699	3300046675	Bacteria	1511
2178	Ga0495657_0388225	3300046675	Bacteria	823
2179	Ga0495657_0550148	3300046675	Bacteria	670
2180	Ga0495599_0004201	3300046678	Bacteria	8505
2181	Ga0495599_0055135	3300046678	Bacteria	2490
2182	Ga0495623_0021172	3300046679	Bacteria	4201
2183	Ga0495623_0244355	3300046679	Bacteria	1012
2184	Ga0495623_0512503	3300046679	Bacteria	632
2185	Ga0495646_0287236	3300046680	Bacteria	873
2186	Ga0495658_0069813	3300046683	Bacteria	2037
2187	Ga0495658_0101506	3300046683	Bacteria	1718
2188	Ga0495658_0166193	3300046683	Bacteria	1363
2189	Ga0495658_0185792	3300046683	Bacteria	1290
2190	Ga0495658_0217515	3300046683	Bacteria	1195
2191	Ga0495658_0266532	3300046683	Bacteria	1079
2192	Ga0495669_0009094	3300046684	Bacteria	4187
2193	Ga0495669_0082230	3300046684	Bacteria	1479
2194	Ga0495669_0160426	3300046684	Bacteria	1067
2195	Ga0495669_0246262	3300046684	Bacteria	858
2196	Ga0495669_0369727	3300046684	Bacteria	694
2197	Ga0495669_0451705	3300046684	Bacteria	624
2198	Ga0495613_0035909	3300046689	Bacteria	3676
2199	Ga0495613_0162852	3300046689	Bacteria	1586
2200	Ga0495613_0210387	3300046689	Bacteria	1368
2201	Ga0495613_0217414	3300046689	Bacteria	1342
2202	Ga0495613_0564243	3300046689	Bacteria	761
2203	Ga0495670_0054060	3300046691	Bacteria	2011
2204	Ga0495670_0067328	3300046691	Bacteria	1808
2205	Ga0495670_0176012	3300046691	Bacteria	1128
2206	Ga0495649_0270283	3300046694	Bacteria	870
2207	Ga0495649_0587980	3300046694	Bacteria	550
2208	Ga0495600_0006881	3300046809	Bacteria	6935
2209	Ga0495600_0058659	3300046809	Bacteria	2514
2210	Ga0495581_0128728	3300047315	Bacteria	1475
2211	Ga0495581_0138688	3300047315	Bacteria	1418
2212	Ga0495581_0207563	3300047315	Bacteria	1146
2213	Ga0495581_0325976	3300047315	Bacteria	897
2214	Ga0495604_0000736	3300047317	Bacteria	27505
2215	Ga0495604_0270113	3300047317	Bacteria	1152
2216	Ga0495636_0002384	3300047318	Bacteria	7217
2217	Ga0495636_0502741	3300047318	Bacteria	586
2218	Ga0495674_0006002	3300047319	Bacteria	11662
2219	Ga0495674_0099749	3300047319	Bacteria	2472
2220	Ga0495674_0119365	3300047319	Bacteria	2229
2221	Ga0495674_0161377	3300047319	Bacteria	1875
2222	Ga0495674_0297662	3300047319	Bacteria	1318
2223	Ga0495672_0013301	3300047320	Bacteria	5685
2224	Ga0495672_0157563	3300047320	Bacteria	1171
2225	Ga0495676_0078221	3300047321	Bacteria	2519
2226	Ga0495676_0089697	3300047321	Bacteria	2303
2227	Ga0495676_0693823	3300047321	Bacteria	659
2228	Ga0495680_0000041	3300047322	Bacteria	99386
2229	Ga0495680_0015439	3300047322	Bacteria	6589
2230	Ga0495680_0030107	3300047322	Bacteria	4436
2231	Ga0495675_0000349	3300047444	Bacteria	32511
2232	Ga0495675_0036213	3300047444	Bacteria	3148
2233	Ga0495675_0594303	3300047444	Bacteria	628
2234	Ga0495677_0130869	3300047445	Bacteria	960
2235	Ga0495677_0169345	3300047445	Bacteria	845
2236	Ga0495685_051797	3300047447	Bacteria	1391
2237	Ga0495684_0005536	3300047471	Bacteria	9841
2238	Ga0495593_0191818	3300047673	Bacteria	1028
2239	Ga0495602_0008800	3300048088	Bacteria	10531
2240	Ga0495602_0036335	3300048088	Bacteria	4586
2241	Ga0495602_0183162	3300048088	Bacteria	1613
2242	Ga0495602_0362643	3300048088	Bacteria	1043
2243	Ga0495602_0670068	3300048088	Bacteria	707
2244	Ga0495602_0764584	3300048088	Bacteria	651
2245	Ga0495615_0028899	3300048090	Bacteria	1312
2246	Ga0496100_0167363	3300048903	Bacteria	1580
2247	Ga0496100_0206131	3300048903	Bacteria	1436
2248	Ga0496100_0359163	3300048903	Bacteria	1102
2249	Ga0496101_0029477	3300048904	Bacteria	3838
2250	Ga0496101_0485553	3300048904	Bacteria	976
2251	Ga0496101_1291302	3300048904	Bacteria	571
2252	Ga0496101_1307997	3300048904	Bacteria	567
2253	Ga0496104_0002699	3300048907	Bacteria	15275
2254	Ga0496104_0122124	3300048907	Bacteria	2501
2255	Ga0496104_0184501	3300048907	Bacteria	1997
2256	Ga0496104_0218896	3300048907	Bacteria	1816
2257	Ga0496105_0071869	3300048908	Bacteria	2860
2258	Ga0496105_0411538	3300048908	Bacteria	1072
2259	Ga0496105_0517149	3300048908	Bacteria	935
2260	Ga0496106_0036122	3300048909	Bacteria	3696
2261	Ga0496106_0396984	3300048909	Bacteria	1108
2262	Ga0496106_0397359	3300048909	Bacteria	1108
2263	Ga0496106_0458223	3300048909	Bacteria	1024
2264	Ga0496106_0459365	3300048909	Bacteria	1023
2265	Ga0496106_0783276	3300048909	Bacteria	757
2266	Ga0496106_0838717	3300048909	Bacteria	728
2267	Ga0496107_0190874	3300048910	Bacteria	1522
2268	Ga0496107_0758680	3300048910	Bacteria	712
2269	Ga0496108_0036505	3300048911	Bacteria	4089
2270	Ga0496108_0039080	3300048911	Bacteria	3955
2271	Ga0496108_0713255	3300048911	Bacteria	869
2272	Ga0496108_0876937	3300048911	Bacteria	771
2273	Ga0496109_0001514	3300048912	Bacteria	19323
2274	Ga0496109_0014351	3300048912	Bacteria	6893
2275	Ga0496109_0170040	3300048912	Bacteria	2044
2276	Ga0496109_0284335	3300048912	Bacteria	1559
2277	Ga0496109_0319686	3300048912	Bacteria	1465
2278	Ga0496109_0396245	3300048912	Bacteria	1304
2279	Ga0496110_0015263	3300048913	Bacteria	6388
2280	Ga0496110_0119072	3300048913	Bacteria	2378
2281	Ga0496110_0136241	3300048913	Bacteria	2219
2282	Ga0496110_0346138	3300048913	Bacteria	1354
2283	Ga0496111_0027389	3300048914	Bacteria	4032
2284	Ga0496111_0220854	3300048914	Bacteria	1408
2285	Ga0496111_0483717	3300048914	Bacteria	912
2286	Ga0496112_0002153	3300048915	Bacteria	15650
2287	Ga0496112_0048479	3300048915	Bacteria	4164
2288	Ga0496112_0137285	3300048915	Bacteria	2415
2289	Ga0496112_0485975	3300048915	Bacteria	1171
2290	Ga0496112_0571013	3300048915	Bacteria	1064
2291	Ga0496112_0798311	3300048915	Bacteria	869
2292	Ga0496112_0902587	3300048915	Bacteria	806
2293	Ga0496112_0979726	3300048915	Bacteria	766
2294	Ga0496112_1029677	3300048915	Bacteria	743
2295	Ga0496113_0006726	3300048916	Bacteria	7324
2296	Ga0496113_0012466	3300048916	Bacteria	5713
2297	Ga0496113_0145507	3300048916	Bacteria	1867
2298	Ga0496113_0382769	3300048916	Bacteria	1129
2299	Ga0496114_0117000	3300048917	Bacteria	2289
2300	Ga0496114_0332047	3300048917	Bacteria	1344
2301	Ga0496114_0793241	3300048917	Bacteria	826
2302	Ga0496114_1653436	3300048917	Bacteria	528
2303	Ga0496115_0088120	3300048918	Bacteria	2533
2304	Ga0501307_067577	3300049162	Bacteria	565
2305	Ga0501290_008610	3300049513	Bacteria	1293
2306	Ga0501291_009519	3300049514	Bacteria	1364
2307	Ga0501298_038020	3300049521	Bacteria	968
2308	Ga0501031_0093564	3300049568	Bacteria	1961
2309	Ga0501031_0095535	3300049568	Bacteria	1939
2310	Ga0501031_0279645	3300049568	Bacteria	1083
2311	Ga0501031_0291892	3300049568	Bacteria	1057
2312	Ga0501031_0330445	3300049568	Bacteria	987
2313	Ga0501031_0393588	3300049568	Bacteria	896
2314	Ga0501031_0445375	3300049568	Bacteria	837
2315	Ga0501031_0659752	3300049568	Bacteria	672
2316	Ga0501031_0979802	3300049568	Bacteria	541
2317	Ga0501031_0980217	3300049568	Bacteria	540
2318	Ga0501032_0009972	3300049569	Bacteria	6860
2319	Ga0501032_0692086	3300049569	Bacteria	646
2320	Ga0501033_0009806	3300049570	Bacteria	7354
2321	Ga0501033_0060787	3300049570	Bacteria	2786
2322	Ga0501033_0113559	3300049570	Bacteria	1970
2323	Ga0501033_0126412	3300049570	Bacteria	1854
2324	Ga0501033_0413416	3300049570	Bacteria	940
2325	Ga0501033_1089396	3300049570	Bacteria	532
2326	Ga0501034_0002859	3300049571	Bacteria	20118
2327	Ga0501034_0027734	3300049571	Bacteria	5758
2328	Ga0501034_0828072	3300049571	Bacteria	817
2329	Ga0501036_0022396	3300049572	Bacteria	5314
2330	Ga0501036_0025075	3300049572	Bacteria	5029
2331	Ga0501036_0030598	3300049572	Bacteria	4546
2332	Ga0501036_0041477	3300049572	Bacteria	3894
2333	Ga0501036_0261933	3300049572	Bacteria	1448
2334	Ga0501036_0550007	3300049572	Bacteria	959
2335	Ga0501036_0781508	3300049572	Bacteria	787
2336	Ga0501036_0815483	3300049572	Bacteria	768
2337	Ga0501037_0340236	3300049573	Bacteria	1036
2338	Ga0501037_0450494	3300049573	Bacteria	878
2339	Ga0501037_0617426	3300049573	Bacteria	727
2340	Ga0501038_0006023	3300049574	Bacteria	11222
2341	Ga0501038_0619306	3300049574	Bacteria	817
2342	Ga0501038_0805151	3300049574	Bacteria	698
2343	Ga0501038_1279176	3300049574	Bacteria	530
2344	Ga0501039_0038801	3300049575	Bacteria	3678
2345	Ga0501039_0061806	3300049575	Bacteria	2901
2346	Ga0501039_0181447	3300049575	Bacteria	1655
2347	Ga0501039_0242600	3300049575	Bacteria	1417
2348	Ga0501040_0033398	3300049576	Bacteria	3486
2349	Ga0501040_0085634	3300049576	Bacteria	2187
2350	Ga0501040_0122475	3300049576	Bacteria	1825
2351	Ga0501040_0144838	3300049576	Bacteria	1674
2352	Ga0501040_0353542	3300049576	Bacteria	1053
2353	Ga0501040_0389614	3300049576	Bacteria	1000
2354	Ga0501040_0611734	3300049576	Bacteria	787
2355	Ga0501040_0640735	3300049576	Bacteria	768
2356	Ga0501040_0732536	3300049576	Bacteria	715
2357	Ga0501040_0772894	3300049576	Bacteria	695
2358	Ga0501040_0931619	3300049576	Bacteria	629
2359	Ga0501040_1035797	3300049576	Bacteria	595
2360	Ga0501040_1255284	3300049576	Bacteria	538
2361	Ga0501041_0020185	3300049577	Bacteria	3981
2362	Ga0501041_0035058	3300049577	Bacteria	3040
2363	Ga0501041_0083554	3300049577	Bacteria	1968
2364	Ga0501041_0093312	3300049577	Bacteria	1859
2365	Ga0501041_0105774	3300049577	Bacteria	1744
2366	Ga0501041_0482244	3300049577	Bacteria	788
2367	Ga0501041_0703078	3300049577	Bacteria	647
2368	Ga0501041_0779815	3300049577	Bacteria	613
2369	Ga0501042_0014342	3300049578	Bacteria	5408
2370	Ga0501042_0032497	3300049578	Bacteria	3696
2371	Ga0501042_0049023	3300049578	Bacteria	3012
2372	Ga0501042_0307305	3300049578	Bacteria	1146
2373	Ga0501042_1456506	3300049578	Bacteria	500
2374	Ga0501043_0017963	3300049579	Bacteria	5546
2375	Ga0501043_0244315	3300049579	Bacteria	1384
2376	Ga0501046_0037734	3300049580	Bacteria	3882
2377	Ga0501046_0097864	3300049580	Bacteria	2253
2378	Ga0501046_0148187	3300049580	Bacteria	1771
2379	Ga0501046_0153859	3300049580	Bacteria	1734
2380	Ga0501046_0187146	3300049580	Bacteria	1546
2381	Ga0501046_0258405	3300049580	Bacteria	1280
2382	Ga0501046_0689183	3300049580	Bacteria	720
2383	Ga0501047_0033605	3300049581	Bacteria	4950
2384	Ga0501047_0038476	3300049581	Bacteria	4628
2385	Ga0501047_0062299	3300049581	Bacteria	3598
2386	Ga0501047_0106831	3300049581	Bacteria	2680
2387	Ga0501048_0013721	3300049582	Bacteria	6012
2388	Ga0501048_0071770	3300049582	Bacteria	2444
2389	Ga0501048_0078759	3300049582	Bacteria	2326
2390	Ga0501048_0095047	3300049582	Bacteria	2102
2391	Ga0501048_0125270	3300049582	Bacteria	1816
2392	Ga0501048_0267495	3300049582	Bacteria	1215
2393	Ga0501048_0351785	3300049582	Bacteria	1051
2394	Ga0501048_0492771	3300049582	Bacteria	879
2395	Ga0501048_0851631	3300049582	Bacteria	655
2396	Ga0501048_0941381	3300049582	Bacteria	621
2397	Ga0501067_0132288	3300049583	Bacteria	1389
2398	Ga0501067_0322911	3300049583	Bacteria	860
2399	Ga0501068_0079249	3300049584	Bacteria	2014
2400	Ga0501068_0233074	3300049584	Bacteria	1171
2401	Ga0501068_0536363	3300049584	Bacteria	760
2402	Ga0501069_0132204	3300049585	Bacteria	1429
2403	Ga0501069_0451729	3300049585	Bacteria	764
2404	Ga0501069_0606974	3300049585	Bacteria	657
2405	Ga0501070_0018074	3300049586	Bacteria	5916
2406	Ga0501070_0257666	3300049586	Bacteria	1426
2407	Ga0501070_0626441	3300049586	Bacteria	856
2408	Ga0501070_1176813	3300049586	Bacteria	589
2409	Ga0501071_0147227	3300049587	Bacteria	1756
2410	Ga0501071_0229710	3300049587	Bacteria	1397
2411	Ga0501071_0235095	3300049587	Bacteria	1381
2412	Ga0501071_0259486	3300049587	Bacteria	1312
2413	Ga0501071_0951699	3300049587	Bacteria	663
2414	Ga0501071_0980702	3300049587	Bacteria	653
2415	Ga0501071_1363385	3300049587	Bacteria	548
2416	Ga0501072_0012080	3300049588	Bacteria	6597
2417	Ga0501072_0018529	3300049588	Bacteria	5364
2418	Ga0501072_0060525	3300049588	Bacteria	2986
2419	Ga0501072_0067976	3300049588	Bacteria	2812
2420	Ga0501072_0289484	3300049588	Bacteria	1302
2421	Ga0501072_0551271	3300049588	Bacteria	910
2422	Ga0501072_0852379	3300049588	Bacteria	712
2423	Ga0501072_1092152	3300049588	Bacteria	621
2424	Ga0501072_1357009	3300049588	Bacteria	550
2425	Ga0501072_1398234	3300049588	Bacteria	541
2426	Ga0501073_0029956	3300049589	Bacteria	3887
2427	Ga0501073_0335358	3300049589	Bacteria	1044
2428	Ga0501073_0341782	3300049589	Bacteria	1033
2429	Ga0501073_0453433	3300049589	Bacteria	886
2430	Ga0501073_0512904	3300049589	Bacteria	829
2431	Ga0501074_0032023	3300049590	Bacteria	3811
2432	Ga0501074_0043689	3300049590	Bacteria	3244
2433	Ga0501074_0069510	3300049590	Bacteria	2532
2434	Ga0501074_0073675	3300049590	Bacteria	2453
2435	Ga0501074_0088859	3300049590	Bacteria	2213
2436	Ga0501074_0206565	3300049590	Bacteria	1399
2437	Ga0501074_0337002	3300049590	Bacteria	1071
2438	Ga0501074_0445698	3300049590	Bacteria	918
2439	Ga0501074_0468065	3300049590	Bacteria	893
2440	Ga0501074_0552690	3300049590	Bacteria	815
2441	Ga0501075_0014965	3300049591	Bacteria	5565
2442	Ga0501075_0022977	3300049591	Bacteria	4561
2443	Ga0501075_0032571	3300049591	Bacteria	3873
2444	Ga0501075_0036489	3300049591	Bacteria	3669
2445	Ga0501075_0054431	3300049591	Bacteria	3010
2446	Ga0501075_0056171	3300049591	Bacteria	2964
2447	Ga0501075_0082026	3300049591	Bacteria	2442
2448	Ga0501075_0133814	3300049591	Bacteria	1888
2449	Ga0501075_0181695	3300049591	Bacteria	1605
2450	Ga0501075_0256528	3300049591	Bacteria	1333
2451	Ga0501075_0449152	3300049591	Bacteria	983
2452	Ga0501075_0897609	3300049591	Bacteria	674
2453	Ga0501075_0958487	3300049591	Bacteria	650
2454	Ga0501075_1019633	3300049591	Bacteria	629
2455	Ga0501075_1284664	3300049591	Bacteria	555
2456	Ga0501076_0006741	3300049592	Bacteria	8331
2457	Ga0501076_0016605	3300049592	Bacteria	5582
2458	Ga0501076_0066363	3300049592	Bacteria	2880
2459	Ga0501076_0072166	3300049592	Bacteria	2762
2460	Ga0501076_0128722	3300049592	Bacteria	2052
2461	Ga0501076_0192768	3300049592	Bacteria	1663
2462	Ga0501076_0412416	3300049592	Bacteria	1111
2463	Ga0501076_0854671	3300049592	Bacteria	750
2464	Ga0501076_1698357	3300049592	Bacteria	518
2465	Ga0501077_0029542	3300049593	Bacteria	3485
2466	Ga0501077_0054477	3300049593	Bacteria	2540
2467	Ga0501077_0059188	3300049593	Bacteria	2432
2468	Ga0501077_0123526	3300049593	Bacteria	1641
2469	Ga0501077_0229859	3300049593	Bacteria	1179
2470	Ga0501077_0236191	3300049593	Bacteria	1162
2471	Ga0501077_0236575	3300049593	Bacteria	1161
2472	Ga0501077_0265779	3300049593	Bacteria	1091
2473	Ga0501077_0334887	3300049593	Bacteria	965
2474	Ga0501206_050384	3300049653	Bacteria	662
2475	Ga0501208_090993	3300049655	Bacteria	641
2476	Ga0501210_016797	3300049657	Bacteria	655
2477	Ga0501217_086667	3300049661	Bacteria	874
2478	Ga0501227_091495	3300049665	Bacteria	803
2479	Ga0501235_027375	3300049669	Bacteria	1279
2480	Ga0501249_018373	3300049679	Bacteria	1512
2481	Ga0501257_038868	3300049686	Bacteria	1164
2482	Ga0501257_158765	3300049686	Bacteria	628
2483	Ga0501225_0368319	3300049705	Bacteria	500
2484	Ga0501234_052759	3300049707	Bacteria	679
2485	Ga0501079_0012691	3300049741	Bacteria	6435
2486	Ga0501079_0018519	3300049741	Bacteria	5320
2487	Ga0501079_0177276	3300049741	Bacteria	1662
2488	Ga0501079_0439943	3300049741	Bacteria	1024
2489	Ga0501079_0511394	3300049741	Bacteria	944
2490	Ga0501079_0647913	3300049741	Bacteria	832
2491	Ga0501079_0758571	3300049741	Bacteria	764
2492	Ga0501079_1247117	3300049741	Bacteria	585
2493	Ga0501080_0156447	3300049742	Bacteria	2105
2494	Ga0501080_0173258	3300049742	Bacteria	1989
2495	Ga0501080_0210625	3300049742	Bacteria	1781
2496	Ga0501080_0275098	3300049742	Bacteria	1532
2497	Ga0501080_0365091	3300049742	Bacteria	1302
2498	Ga0501080_0463336	3300049742	Bacteria	1135
2499	Ga0501080_0616412	3300049742	Bacteria	962
2500	Ga0501080_1105616	3300049742	Bacteria	684
2501	Ga0501080_1476498	3300049742	Bacteria	578
2502	Ga0501081_0019645	3300049743	Bacteria	4501
2503	Ga0501081_0020963	3300049743	Bacteria	4361
2504	Ga0501081_0032194	3300049743	Bacteria	3556
2505	Ga0501081_0048503	3300049743	Bacteria	2923
2506	Ga0501081_0050237	3300049743	Bacteria	2873
2507	Ga0501081_0078473	3300049743	Bacteria	2308
2508	Ga0501081_0106766	3300049743	Bacteria	1985
2509	Ga0501081_0218879	3300049743	Bacteria	1384
2510	Ga0501081_0224277	3300049743	Bacteria	1367
2511	Ga0501081_0310001	3300049743	Bacteria	1159
2512	Ga0501081_0320536	3300049743	Bacteria	1139
2513	Ga0501081_0359397	3300049743	Bacteria	1074
2514	Ga0501081_0509077	3300049743	Bacteria	898
2515	Ga0501083_0083580	3300049744	Bacteria	2115
2516	Ga0501083_0104824	3300049744	Bacteria	1863
2517	Ga0501083_0469635	3300049744	Bacteria	819
2518	Ga0501083_1075986	3300049744	Bacteria	523
2519	Ga0501272_037387	3300049769	Bacteria	638
2520	Ga0501273_006923	3300049770	Bacteria	1325
2521	Ga0501278_011701	3300049774	Bacteria	716
2522	Ga0501035_0102841	3300049822	Bacteria	2506
2523	Ga0501035_0176934	3300049822	Bacteria	1840
2524	Ga0501035_0186754	3300049822	Bacteria	1784
2525	Ga0501035_0318236	3300049822	Bacteria	1308
2526	Ga0501035_0400779	3300049822	Bacteria	1141
2527	Ga0501035_0486003	3300049822	Bacteria	1018
2528	Ga0501035_0535866	3300049822	Bacteria	960
2529	Ga0501035_0550229	3300049822	Bacteria	945
2530	Ga0501044_0002703	3300049823	Bacteria	20155
2531	Ga0501044_0003143	3300049823	Bacteria	18681
2532	Ga0501044_0010929	3300049823	Bacteria	9853
2533	Ga0501044_0246715	3300049823	Bacteria	1728
2534	Ga0501044_0737767	3300049823	Bacteria	868
2535	Ga0501045_0004175	3300049824	Bacteria	9980
2536	Ga0501045_0008437	3300049824	Bacteria	7183
2537	Ga0501045_0031277	3300049824	Bacteria	3855
2538	Ga0501045_0051561	3300049824	Bacteria	3003
2539	Ga0501045_0053686	3300049824	Bacteria	2945
2540	Ga0501045_0054873	3300049824	Bacteria	2914
2541	Ga0501045_0069093	3300049824	Bacteria	2596
2542	Ga0501045_0083823	3300049824	Bacteria	2352
2543	Ga0501045_0096356	3300049824	Bacteria	2189
2544	Ga0501045_0937225	3300049824	Bacteria	636
2545	Ga0501045_1275385	3300049824	Bacteria	535
2546	Ga0501212_007829	3300049851	Bacteria	1474
2547	nmdc:mga03683_830_c1	3300050489	Bacteria	8880
2548	nmdc:mga03n38_66871_c1	3300050490	Bacteria	1652
2549	nmdc:mga00v17_127345_c1	3300050491	Bacteria	1626
2550	nmdc:mga00v17_1497_c1	3300050491	Bacteria	12197
2551	nmdc:mga00v17_3322_c1	3300050491	Bacteria	8294
2552	nmdc:mga00v17_796932_c1	3300050491	Bacteria	602
2553	nmdc:mga0yw44_3081_c1	3300050492	Bacteria	7303
2554	nmdc:mga0k408_23995_c1	3300050493	Bacteria	3445
2555	nmdc:mga0k408_262749_c1	3300050493	Bacteria	1031
2556	nmdc:mga0k408_29187_c2	3300050493	Bacteria	2345
2557	nmdc:mga06z11_75398_c1	3300050494	Bacteria	1796
2558	nmdc:mga06z11_9437_c1	3300050494	Bacteria	4111
2559	nmdc:mga06z11_9765_c1	3300050494	Bacteria	4056
2560	nmdc:mga04h51_19918_c2	3300050495	Bacteria	1617
2561	nmdc:mga04h51_44017_c1	3300050495	Bacteria	1470
2562	nmdc:mga07m45_5892_c1	3300050496	Bacteria	1730
2563	nmdc:mga05p37_11036_c1	3300050507	Bacteria	10734
2564	nmdc:mga05p37_115407_c2	3300050507	Bacteria	1773
2565	nmdc:mga05p37_118577_c1	3300050507	Bacteria	3252
2566	nmdc:mga05p37_131138_c1	3300050507	Bacteria	3075
2567	nmdc:mga05p37_158310_c1	3300050507	Bacteria	2767
2568	nmdc:mga05p37_16973_c1	3300050507	Bacteria	8780
2569	nmdc:mga05p37_17293_c1	3300050507	Bacteria	8698
2570	nmdc:mga05p37_17386_c1	3300050507	Bacteria	8676
2571	nmdc:mga05p37_270637_c1	3300050507	Bacteria	2030
2572	nmdc:mga05p37_27725_c1	3300050507	Bacteria	6901
2573	nmdc:mga05p37_29448_c1	3300050507	Bacteria	6700
2574	nmdc:mga05p37_326511_c1	3300050507	Bacteria	1814
2575	nmdc:mga05p37_356099_c1	3300050507	Bacteria	1722
2576	nmdc:mga05p37_4213_c1	3300050507	Bacteria	16803
2577	nmdc:mga05p37_46174_c1	3300050507	Bacteria	5356
2578	nmdc:mga05p37_553931_c1	3300050507	Bacteria	1308
2579	nmdc:mga05p37_580266_c1	3300050507	Bacteria	1270
2580	nmdc:mga05p37_58588_c1	3300050507	Bacteria	4743
2581	nmdc:mga05p37_6327_c1	3300050507	Bacteria	13947
2582	nmdc:mga05p37_65_c1	3300050507	Bacteria	48888
2583	nmdc:mga05p37_787443_c1	3300050507	Bacteria	1042
2584	nmdc:mga05p37_828736_c1	3300050507	Bacteria	1008
2585	nmdc:mga05p37_83124_c1	3300050507	Bacteria	3944
2586	nmdc:mga05p37_857133_c1	3300050507	Bacteria	986
2587	nmdc:mga09592_12543_c1	3300050508	Bacteria	6906
2588	nmdc:mga09592_140646_c1	3300050508	Bacteria	2080
2589	nmdc:mga09592_193438_c1	3300050508	Bacteria	1761
2590	nmdc:mga09592_20919_c1	3300050508	Bacteria	5388
2591	nmdc:mga09592_26106_c1	3300050508	Bacteria	4838
2592	nmdc:mga09592_413295_c1	3300050508	Bacteria	1166
2593	nmdc:mga09592_43557_c1	3300050508	Bacteria	3777
2594	nmdc:mga09592_53079_c1	3300050508	Bacteria	3422
2595	nmdc:mga09592_712424_c1	3300050508	Bacteria	853
2596	nmdc:mga09592_81897_c1	3300050508	Bacteria	2750
2597	nmdc:mga09592_97790_c1	3300050508	Bacteria	2512
2598	nmdc:mga0qj67_13764_c1	3300050509	Bacteria	6106
2599	nmdc:mga0qj67_172206_c1	3300050509	Bacteria	1758
2600	nmdc:mga0qj67_17403_c1	3300050509	Bacteria	5464
2601	nmdc:mga0qj67_217542_c2	3300050509	Bacteria	1097
2602	nmdc:mga0qj67_22250_c1	3300050509	Bacteria	4869
2603	nmdc:mga0qj67_2372_c1	3300050509	Bacteria	13411
2604	nmdc:mga0qj67_301103_c1	3300050509	Bacteria	1299
2605	nmdc:mga0qj67_309110_c1	3300050509	Bacteria	1280
2606	nmdc:mga0qj67_379729_c1	3300050509	Bacteria	1141
2607	nmdc:mga0qj67_39259_c1	3300050509	Bacteria	3717
2608	nmdc:mga0qj67_39738_c1	3300050509	Bacteria	3696
2609	nmdc:mga0qj67_410538_c1	3300050509	Bacteria	1092
2610	nmdc:mga0qj67_416183_c1	3300050509	Bacteria	1084
2611	nmdc:mga0qj67_43083_c1	3300050509	Bacteria	3554
2612	nmdc:mga0qj67_63444_c1	3300050509	Bacteria	2938
2613	nmdc:mga0qj67_71314_c1	3300050509	Bacteria	2773
2614	nmdc:mga0qj67_869406_c1	3300050509	Bacteria	711
2615	nmdc:mga06r32_101221_c1	3300050510	Bacteria	2827
2616	nmdc:mga06r32_121583_c1	3300050510	Bacteria	2576
2617	nmdc:mga06r32_122428_c1	3300050510	Bacteria	2567
2618	nmdc:mga06r32_174692_c1	3300050510	Bacteria	2133
2619	nmdc:mga06r32_2097_c1	3300050510	Bacteria	17859
2620	nmdc:mga06r32_25316_c1	3300050510	Bacteria	5520
2621	nmdc:mga06r32_270738_c1	3300050510	Bacteria	1686
2622	nmdc:mga06r32_286086_c1	3300050510	Bacteria	1635
2623	nmdc:mga06r32_332554_c1	3300050510	Bacteria	1504
2624	nmdc:mga06r32_46809_c1	3300050510	Bacteria	4128
2625	nmdc:mga06r32_687531_c1	3300050510	Bacteria	989
2626	nmdc:mga06r32_7117_c1	3300050510	Bacteria	10077
2627	nmdc:mga06r32_734962_c1	3300050510	Bacteria	951
2628	nmdc:mga06r32_81958_c1	3300050510	Bacteria	3142
2629	nmdc:mga06r32_847603_c1	3300050510	Bacteria	873
2630	nmdc:mga06r32_88206_c1	3300050510	Bacteria	3028
2631	nmdc:mga06r32_9166_c1	3300050510	Bacteria	8919
2632	nmdc:mga08y16_1002702_c1	3300050511	Bacteria	815
2633	nmdc:mga08y16_1017032_c1	3300050511	Bacteria	808
2634	nmdc:mga08y16_1036024_c1	3300050511	Bacteria	799
2635	nmdc:mga08y16_1116467_c1	3300050511	Bacteria	763
2636	nmdc:mga08y16_1209440_c1	3300050511	Bacteria	726
2637	nmdc:mga08y16_131088_c1	3300050511	Bacteria	2607
2638	nmdc:mga08y16_143634_c1	3300050511	Bacteria	2481
2639	nmdc:mga08y16_144030_c1	3300050511	Bacteria	2477
2640	nmdc:mga08y16_15360_c1	3300050511	Bacteria	8052
2641	nmdc:mga08y16_155_c1	3300050511	Bacteria	31746
2642	nmdc:mga08y16_176628_c1	3300050511	Bacteria	2218
2643	nmdc:mga08y16_1804_c1	3300050511	Bacteria	21719
2644	nmdc:mga08y16_2707_c1	3300050511	Bacteria	18190
2645	nmdc:mga08y16_291394_c1	3300050511	Bacteria	1683
2646	nmdc:mga08y16_40599_c1	3300050511	Bacteria	4876
2647	nmdc:mga08y16_463123_c1	3300050511	Bacteria	1292
2648	nmdc:mga08y16_59755_c1	3300050511	Bacteria	3982
2649	nmdc:mga08y16_61945_c1	3300050511	Bacteria	3907
2650	nmdc:mga08y16_722837_c1	3300050511	Bacteria	994
2651	nmdc:mga08y16_83813_c1	3300050511	Bacteria	3323
2652	nmdc:mga08y16_87753_c1	3300050511	Bacteria	3241
2653	nmdc:mga08y16_92485_c1	3300050511	Bacteria	3152
2654	nmdc:mga0n895_1020598_c1	3300050512	Bacteria	808
2655	nmdc:mga0n895_1640069_c1	3300050512	Bacteria	607
2656	nmdc:mga0n895_17556_c1	3300050512	Bacteria	6598
2657	nmdc:mga0n895_187035_c1	3300050512	Bacteria	2102
2658	nmdc:mga0n895_199000_c1	3300050512	Unclassified	2035
2659	nmdc:mga0n895_22365_c1	3300050512	Bacteria	5928
2660	nmdc:mga0n895_24421_c1	3300050512	Bacteria	5697
2661	nmdc:mga0n895_24941_c1	3300050512	Bacteria	5643
2662	nmdc:mga0n895_255644_c1	3300050512	Bacteria	1778
2663	nmdc:mga0n895_25766_c1	3300050512	Bacteria	5561
2664	nmdc:mga0n895_267349_c1	3300050512	Bacteria	1735
2665	nmdc:mga0n895_26927_c1	3300050512	Bacteria	5454
2666	nmdc:mga0n895_283875_c1	3300050512	Bacteria	1679
2667	nmdc:mga0n895_29459_c1	3300050512	Bacteria	5237
2668	nmdc:mga0n895_309431_c1	3300050512	Bacteria	1601
2669	nmdc:mga0n895_320295_c1	3300050512	Bacteria	1571
2670	nmdc:mga0n895_32578_c1	3300050512	Bacteria	5003
2671	nmdc:mga0n895_36985_c1	3300050512	Bacteria	4719
2672	nmdc:mga0n895_392235_c1	3300050512	Bacteria	1404
2673	nmdc:mga0n895_717531_c1	3300050512	Bacteria	995
2674	nmdc:mga0n895_91417_c1	3300050512	Bacteria	3046
2675	nmdc:mga0n895_977671_c1	3300050512	Bacteria	829
2676	nmdc:mga0rr50_134663_c1	3300050513	Bacteria	1982
2677	nmdc:mga0rr50_1773_c1	3300050513	Bacteria	11923
2678	nmdc:mga0rr50_2263_c1	3300050513	Bacteria	10796
2679	nmdc:mga0rr50_240651_c1	3300050513	Bacteria	1500
2680	nmdc:mga0rr50_276564_c1	3300050513	Bacteria	1400
2681	nmdc:mga0rr50_37105_c1	3300050513	Bacteria	3515
2682	nmdc:mga0rr50_373_c1	3300050513	Bacteria	24506
2683	nmdc:mga0rr50_37885_c1	3300050513	Bacteria	3484
2684	nmdc:mga0rr50_43434_c1	3300050513	Bacteria	3290
2685	nmdc:mga0rr50_48198_c1	3300050513	Bacteria	3148
2686	nmdc:mga0rr50_619231_c1	3300050513	Bacteria	923
2687	nmdc:mga0rr50_652911_c1	3300050513	Bacteria	898
2688	nmdc:mga0rr50_678669_c1	3300050513	Bacteria	879
2689	nmdc:mga0rr50_74213_c1	3300050513	Bacteria	2603
2690	nmdc:mga0rr50_832684_c1	3300050513	Unclassified	787
2691	nmdc:mga0rr50_84011_c1	3300050513	Bacteria	2464
2692	nmdc:mga0rr50_919623_c1	3300050513	Bacteria	746
2693	nmdc:mga08x19_10007_c1	3300050514	Bacteria	5684
2694	nmdc:mga08x19_1121760_c1	3300050514	Bacteria	558
2695	nmdc:mga08x19_14095_c1	3300050514	Bacteria	4844
2696	nmdc:mga08x19_175218_c1	3300050514	Bacteria	1462
2697	nmdc:mga08x19_17_c1	3300050514	Bacteria	313678
2698	nmdc:mga08x19_220624_c1	3300050514	Bacteria	1303
2699	nmdc:mga08x19_277610_c1	3300050514	Bacteria	1161
2700	nmdc:mga08x19_308589_c1	3300050514	Bacteria	1100
2701	nmdc:mga08x19_441370_c1	3300050514	Bacteria	915
2702	nmdc:mga08x19_57439_c1	3300050514	Bacteria	2515
2703	nmdc:mga08x19_606480_c1	3300050514	Bacteria	776
2704	nmdc:mga0a205_10695_c1	3300050515	Bacteria	8436
2705	nmdc:mga0a205_1287823_c1	3300050515	Bacteria	579
2706	nmdc:mga0a205_1418121_c1	3300050515	Bacteria	542
2707	nmdc:mga0a205_1574712_c1	3300050515	Bacteria	505
2708	nmdc:mga0a205_203776_c1	3300050515	Bacteria	1868
2709	nmdc:mga0a205_228133_c1	3300050515	Bacteria	1746
2710	nmdc:mga0a205_232843_c1	3300050515	Bacteria	1725
2711	nmdc:mga0a205_24132_c1	3300050515	Bacteria	5776
2712	nmdc:mga0a205_249769_c1	3300050515	Bacteria	1654
2713	nmdc:mga0a205_26068_c1	3300050515	Bacteria	5570
2714	nmdc:mga0a205_267551_c1	3300050515	Bacteria	1587
2715	nmdc:mga0a205_3001_c1	3300050515	Bacteria	14958
2716	nmdc:mga0a205_3048_c1	3300050515	Bacteria	14858
2717	nmdc:mga0a205_30905_c1	3300050515	Bacteria	5130
2718	nmdc:mga0a205_317090_c2	3300050515	Bacteria	876
2719	nmdc:mga0a205_354900_c1	3300050515	Bacteria	1333
2720	nmdc:mga0a205_379993_c1	3300050515	Bacteria	1278
2721	nmdc:mga0a205_600537_c1	3300050515	Bacteria	954
2722	nmdc:mga0a205_6280_c1	3300050515	Bacteria	10723
2723	nmdc:mga0a205_74220_c1	3300050515	Bacteria	3287
2724	nmdc:mga0a205_7607_c1	3300050515	Bacteria	9821
2725	nmdc:mga0a205_7753_c2	3300050515	Bacteria	5583
2726	nmdc:mga0a205_818402_c1	3300050515	Bacteria	779
2727	nmdc:mga0a205_832780_c1	3300050515	Bacteria	770
2728	Ga0495619_0119959	3300053085	Bacteria	1803
2729	Ga0495619_0569128	3300053085	Bacteria	776
2730	Ga0500641_0005245	3300053096	Bacteria	4592
2731	Ga0500556_0112794	3300053104	Bacteria	1055
2732	Ga0500628_021149	3300053129	Bacteria	1316
2733	Ga0500628_116926	3300053129	Bacteria	721
2734	Ga0500628_235749	3300053129	Bacteria	535
2735	Ga0500658_0169562	3300053134	Bacteria	991
2736	Ga0500568_0002524	3300053139	Bacteria	10698
2737	Ga0500627_0323977	3300053158	Bacteria	669
2738	Ga0501084_0029531	3300054114	Bacteria	4586
2739	Ga0501084_0031787	3300054114	Bacteria	4413
2740	Ga0501084_0032147	3300054114	Bacteria	4389
2741	Ga0501084_0032922	3300054114	Bacteria	4337
2742	Ga0501084_0139760	3300054114	Bacteria	2039
2743	Ga0501084_0146768	3300054114	Bacteria	1987
2744	Ga0501084_0148992	3300054114	Bacteria	1972
2745	Ga0590071_000185	3300059421	Bacteria	18146
2746	Ga0590071_002230	3300059421	Bacteria	4915
2747	Ga0590071_002630	3300059421	Bacteria	4512
2748	Ga0590071_014932	3300059421	Bacteria	1822
2749	Ga0590071_065848	3300059421	Bacteria	889
2750	Ga0590071_113679	3300059421	Bacteria	688
2751	Ga0590071_120580	3300059421	Bacteria	669
2752	Ga0590071_129332	3300059421	Bacteria	648
2753	Ga0590071_199301	3300059421	Bacteria	527
2754	Ga0590074_000624	3300059423	Bacteria	5338
2755	Ga0590074_001499	3300059423	Bacteria	3772
2756	Ga0590074_085454	3300059423	Bacteria	606
2757	Ga0590075_000204	3300059424	Bacteria	16569
2758	Ga0590075_001831	3300059424	Bacteria	5174
2759	Ga0590075_011111	3300059424	Bacteria	2173
2760	Ga0590075_037586	3300059424	Bacteria	1234
2761	Ga0590075_067606	3300059424	Bacteria	922
2762	Ga0590077_001004	3300059426	Bacteria	7115
2763	Ga0590077_017613	3300059426	Bacteria	1503
2764	Ga0590077_038028	3300059426	Bacteria	1064
2765	Ga0587066_092639	3300059490	Bacteria	673
2766	Ga0587070_068133	3300059491	Bacteria	753
2767	Ga0587085_120968	3300059506	Bacteria	575
2768	Ga0587085_131632	3300059506	Bacteria	560
2769	Ga0587091_215394	3300059511	Bacteria	523
2770	Ga0587094_063288	3300059513	Bacteria	652
2771	Ga0587101_124978	3300059623	Bacteria	536
2772	Ga0587113_011289	3300059625	Bacteria	834
2773	Ga0587117_066425	3300059627	Bacteria	631
2774	Ga0587067_056166	3300059640	Bacteria	811
2775	Ga0587114_014789	3300059655	Bacteria	1023
2776	Ga0501082_0004163	3300060353	Bacteria	12644
2777	Ga0501082_0016570	3300060353	Bacteria	6345
2778	Ga0501082_0025650	3300060353	Bacteria	5079
2779	Ga0501082_0063820	3300060353	Bacteria	3171
2780	Ga0501082_0246947	3300060353	Bacteria	1553
2781	Ga0501082_0372611	3300060353	Bacteria	1245
2782	Ga0501082_0490967	3300060353	Bacteria	1073
2783	Ga0501082_0625274	3300060353	Bacteria	942
2784	Ga0501082_0978599	3300060353	Bacteria	740
2785	Ga0501082_1534311	3300060353	Bacteria	582
2786	Ga0466962_0029520	3300061719	Bacteria	2625
2787	Ga0466962_0197036	3300061719	Bacteria	984
2788	Ga0530510_0004587	3300061734	Bacteria	9554
2789	Ga0530510_0006572	3300061734	Bacteria	8104
2790	Ga0530510_0006698	3300061734	Bacteria	8032
2791	Ga0530510_0176519	3300061734	Bacteria	1583
2792	Ga0530510_0229520	3300061734	Bacteria	1381
2793	Ga0530510_0267037	3300061734	Bacteria	1277
2794	Ga0530510_0323333	3300061734	Bacteria	1157
2795	Ga0530510_0368464	3300061734	Bacteria	1080
2796	Ga0530510_0381627	3300061734	Bacteria	1061
2797	Ga0530510_0602086	3300061734	Bacteria	836
2798	Ga0530510_0728425	3300061734	Bacteria	756
2799	Ga0530510_0777776	3300061734	Bacteria	730
2800	Ga0530510_1158270	3300061734	Bacteria	593

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300009098	Ga0105245_10237254	Ga0105245_102372544	130
2	3300048088	Ga0495602_0670068	Ga0495602_0670068_11_409	130
3	3300049593	Ga0501077_0236575	Ga0501077_0236575_525_938	131
4	3300050512	nmdc:mga0n895_199000_c1	nmdc:mga0n895_199000_c1_20_433	131
5	3300007265	Ga0099794_10047797	Ga0099794_100477973	134
6	3300009093	Ga0105240_10217617	Ga0105240_102176172	134
7	3300009093	Ga0105240_10386609	Ga0105240_103866092	134
8	3300009093	Ga0105240_10485348	Ga0105240_104853482	134
9	3300012482	Ga0157318_1012320	Ga0157318_10123202	134
10	3300013296	Ga0157374_10053425	Ga0157374_100534256	134
11	3300013297	Ga0157378_10012390	Ga0157378_1001239014	134
12	3300014968	Ga0157379_11028974	Ga0157379_110289742	134
13	3300014969	Ga0157376_10166834	Ga0157376_101668343	134
14	3300026088	Ga0207641_10248486	Ga0207641_102484863	134
15	3300030878	Ga0265770_1045233	Ga0265770_10452332	134
16	3300031090	Ga0265760_10020943	Ga0265760_100209435	134
17	3300035172	Ga0373955_0061523	Ga0373955_0061523_1447_1857	134
18	3300035172	Ga0373955_0626120	Ga0373955_0626120_165_575	134
19	3300036401	Ga0373937_0092719	Ga0373937_0092719_964_1374	134
20	3300037068	Ga0373925_1146925	Ga0373925_1146925_131_541	134
21	3300046454	Ga0495592_0002866	Ga0495592_0002866_7743_8153	134
22	3300046462	Ga0495651_0002930	Ga0495651_0002930_4706_5116	134
23	3300046463	Ga0495653_0008279	Ga0495653_0008279_1103_1513	134
24	3300046472	Ga0495580_0095127	Ga0495580_0095127_408_818	134
25	3300046477	Ga0495664_0055549	Ga0495664_0055549_1074_1484	134
26	3300046514	Ga0495618_0008519	Ga0495618_0008519_2509_2919	134
27	3300046516	Ga0495628_0007627	Ga0495628_0007627_5376_5786	134
28	3300046517	Ga0495630_0003394	Ga0495630_0003394_8052_8462	134
29	3300046517	Ga0495630_0421005	Ga0495630_0421005_209_619	134
30	3300046526	Ga0495666_0152073	Ga0495666_0152073_151_561	134
31	3300046529	Ga0495652_0006579	Ga0495652_0006579_5335_5745	134
32	3300046533	Ga0495640_0012136	Ga0495640_0012136_1818_2228	134
33	3300046533	Ga0495640_0029374	Ga0495640_0029374_2989_3399	134
34	3300046535	Ga0495586_0025989	Ga0495586_0025989_2454_2864	134
35	3300046536	Ga0495587_0001208	Ga0495587_0001208_4367_4777	134
36	3300046557	Ga0495622_0287203	Ga0495622_0287203_162_572	134
37	3300046559	Ga0495667_0006456	Ga0495667_0006456_5638_6048	134
38	3300046663	Ga0495635_0310528	Ga0495635_0310528_350_760	134
39	3300046675	Ga0495657_0028345	Ga0495657_0028345_1577_1987	134
40	3300046675	Ga0495657_0388225	Ga0495657_0388225_196_606	134
41	3300046678	Ga0495599_0004201	Ga0495599_0004201_6705_7115	134
42	3300046680	Ga0495646_0287236	Ga0495646_0287236_183_593	134
43	3300046689	Ga0495613_0217414	Ga0495613_0217414_724_1134	134
44	3300046809	Ga0495600_0006881	Ga0495600_0006881_1144_1554	134
45	3300047317	Ga0495604_0000736	Ga0495604_0000736_4139_4549	134
46	3300047319	Ga0495674_0006002	Ga0495674_0006002_1887_2297	134
47	3300047319	Ga0495674_0161377	Ga0495674_0161377_257_667	134
48	3300047322	Ga0495680_0015439	Ga0495680_0015439_5434_5844	134
49	3300047444	Ga0495675_0000349	Ga0495675_0000349_5389_5799	134
50	3300047471	Ga0495684_0005536	Ga0495684_0005536_3316_3726	134
51	3300048088	Ga0495602_0008800	Ga0495602_0008800_3920_4330	134
52	3300048915	Ga0496112_0902587	Ga0496112_0902587_326_736	134
53	3300005435	Ga0070714_100116429	Ga0070714_1001164294	135
54	3300005518	Ga0070699_100695578	Ga0070699_1006955782	135
55	3300006914	Ga0075436_100021672	Ga0075436_1000216725	135
56	3300009094	Ga0111539_10329806	Ga0111539_103298062	135
57	3300009174	Ga0105241_10109507	Ga0105241_101095075	135
58	3300014325	Ga0163163_11993765	Ga0163163_119937651	135
59	3300021388	Ga0213875_10379479	Ga0213875_103794792	135
60	3300025929	Ga0207664_10149059	Ga0207664_101490593	135
61	3300030877	Ga0265777_100033	Ga0265777_1000335	135
62	3300031235	Ga0265330_10348100	Ga0265330_103481002	135
63	3300031247	Ga0265340_10329041	Ga0265340_103290412	135
64	3300031344	Ga0265316_10017308	Ga0265316_100173087	135
65	3300031711	Ga0265314_10003075	Ga0265314_1000307518	135
66	3300037853	Ga0436364_1432674	Ga0436364_1432674_921_1349	135
67	3300039450	Ga0436363_1382919	Ga0436363_1382919_172_579	135
68	3300041410	Ga0439461_0078944	Ga0439461_0078944_185_604	135
69	3300042008	Ga0439450_006649	Ga0439450_006649_1321_1740	135
70	3300042156	Ga0439446_0172593	Ga0439446_0172593_44_463	135
71	3300042435	Ga0439434_0039654	Ga0439434_0039654_223_642	135
72	3300042436	Ga0439435_0013307	Ga0439435_0013307_692_1111	135
73	3300042461	Ga0439460_0030589	Ga0439460_0030589_150_569	135
74	3300046476	Ga0495662_0607831	Ga0495662_0607831_89_508	135
75	3300048916	Ga0496113_0006726	Ga0496113_0006726_2752_3171	135
76	3300049576	Ga0501040_1255284	Ga0501040_1255284_65_484	135
77	3300049653	Ga0501206_050384	Ga0501206_050384_38_457	135
78	3300049669	Ga0501235_027375	Ga0501235_027375_509_928	135
79	3300049743	Ga0501081_0320536	Ga0501081_0320536_48_467	135
80	3300049823	Ga0501044_0737767	Ga0501044_0737767_17_424	135
81	3300050507	nmdc:mga05p37_131138_c1	nmdc:mga05p37_131138_c1_2296_2715	135
82	3300050508	nmdc:mga09592_12543_c1	nmdc:mga09592_12543_c1_4840_5259	135
83	3300050509	nmdc:mga0qj67_13764_c1	nmdc:mga0qj67_13764_c1_5496_5915	135
84	3300050509	nmdc:mga0qj67_309110_c1	nmdc:mga0qj67_309110_c1_498_917	135
85	3300050509	nmdc:mga0qj67_39259_c1	nmdc:mga0qj67_39259_c1_3076_3495	135
86	3300050509	nmdc:mga0qj67_43083_c1	nmdc:mga0qj67_43083_c1_2384_2803	135
87	3300050510	nmdc:mga06r32_46809_c1	nmdc:mga06r32_46809_c1_224_643	135
88	3300050510	nmdc:mga06r32_88206_c1	nmdc:mga06r32_88206_c1_1415_1834	135
89	3300050512	nmdc:mga0n895_309431_c1	nmdc:mga0n895_309431_c1_207_626	135
90	3300050514	nmdc:mga08x19_441370_c1	nmdc:mga08x19_441370_c1_441_860	135
91	3300053129	Ga0500628_235749	Ga0500628_235749_56_475	135
92	3300005434	Ga0070709_10131419	Ga0070709_101314193	136
93	3300005435	Ga0070714_100105831	Ga0070714_1001058312	136
94	3300005435	Ga0070714_101185717	Ga0070714_1011857171	136
95	3300005436	Ga0070713_100009214	Ga0070713_1000092143	136
96	3300005436	Ga0070713_100173014	Ga0070713_1001730145	136
97	3300005436	Ga0070713_100958679	Ga0070713_1009586792	136
98	3300005437	Ga0070710_10525223	Ga0070710_105252231	136
99	3300005438	Ga0070701_11149138	Ga0070701_111491381	136
100	3300005467	Ga0070706_100074444	Ga0070706_1000744445	136
101	3300005467	Ga0070706_100727191	Ga0070706_1007271912	136
102	3300005468	Ga0070707_100000221	Ga0070707_10000022145	136
103	3300005468	Ga0070707_100028747	Ga0070707_10002874713	136
104	3300005468	Ga0070707_101363425	Ga0070707_1013634252	136
105	3300005471	Ga0070698_100023916	Ga0070698_1000239166	136
106	3300005518	Ga0070699_100004496	Ga0070699_10000449619	136
107	3300005518	Ga0070699_100149286	Ga0070699_1001492861	136
108	3300005518	Ga0070699_100179427	Ga0070699_1001794271	136
109	3300005535	Ga0070684_100575947	Ga0070684_1005759471	136
110	3300005536	Ga0070697_100161060	Ga0070697_1001610602	136
111	3300005536	Ga0070697_100178610	Ga0070697_1001786103	136
112	3300005545	Ga0070695_100122205	Ga0070695_1001222054	136
113	3300005614	Ga0068856_101325868	Ga0068856_1013258682	136
114	3300005617	Ga0068859_101235569	Ga0068859_1012355691	136
115	3300006028	Ga0070717_10009206	Ga0070717_100092063	136
116	3300006028	Ga0070717_10870904	Ga0070717_108709042	136
117	3300006028	Ga0070717_11393710	Ga0070717_113937101	136
118	3300006173	Ga0070716_100426068	Ga0070716_1004260682	136
119	3300006175	Ga0070712_100104418	Ga0070712_1001044182	136
120	3300006931	Ga0097620_101235574	Ga0097620_1012355742	136
121	3300007076	Ga0075435_100456868	Ga0075435_1004568682	136
122	3300007265	Ga0099794_10092648	Ga0099794_100926482	136
123	3300009093	Ga0105240_10188536	Ga0105240_101885364	136
124	3300013104	Ga0157370_10299100	Ga0157370_102991004	136
125	3300013104	Ga0157370_10335481	Ga0157370_103354813	136
126	3300013104	Ga0157370_10707729	Ga0157370_107077291	136
127	3300013104	Ga0157370_10825657	Ga0157370_108256571	136
128	3300022732	Ga0224569_100332	Ga0224569_1003327	136
129	3300024225	Ga0224572_1029811	Ga0224572_10298112	136
130	3300024227	Ga0228598_1000990	Ga0228598_10009907	136
131	3300024227	Ga0228598_1001835	Ga0228598_10018353	136
132	3300024227	Ga0228598_1011345	Ga0228598_10113453	136
133	3300024227	Ga0228598_1116484	Ga0228598_11164841	136
134	3300025315	Ga0207697_10529731	Ga0207697_105297311	136
135	3300025898	Ga0207692_10592493	Ga0207692_105924932	136
136	3300025906	Ga0207699_10027213	Ga0207699_100272131	136
137	3300025906	Ga0207699_10084460	Ga0207699_100844605	136
138	3300025910	Ga0207684_10134177	Ga0207684_101341775	136
139	3300025910	Ga0207684_10335165	Ga0207684_103351652	136
140	3300025913	Ga0207695_10123269	Ga0207695_101232691	136
141	3300025915	Ga0207693_10193391	Ga0207693_101933911	136
142	3300025915	Ga0207693_10292526	Ga0207693_102925262	136
143	3300025916	Ga0207663_10112094	Ga0207663_101120945	136
144	3300025922	Ga0207646_10000037	Ga0207646_10000037169	136
145	3300025922	Ga0207646_10000343	Ga0207646_1000034311	136
146	3300025928	Ga0207700_10210578	Ga0207700_102105784	136
147	3300025928	Ga0207700_10320305	Ga0207700_103203052	136
148	3300025928	Ga0207700_11304747	Ga0207700_113047472	136
149	3300025929	Ga0207664_10027001	Ga0207664_100270016	136
150	3300025939	Ga0207665_10825076	Ga0207665_108250761	136
151	3300027671	Ga0209588_1028139	Ga0209588_10281392	136
152	3300028563	Ga0265319_1000426	Ga0265319_10004268	136
153	3300028563	Ga0265319_1048413	Ga0265319_10484134	136
154	3300028563	Ga0265319_1159626	Ga0265319_11596261	136
155	3300028573	Ga0265334_10084960	Ga0265334_100849603	136
156	3300028577	Ga0265318_10000466	Ga0265318_1000046629	136
157	3300028800	Ga0265338_10017842	Ga0265338_100178428	136
158	3300028800	Ga0265338_10066401	Ga0265338_100664016	136
159	3300028800	Ga0265338_10066766	Ga0265338_100667668	136
160	3300028800	Ga0265338_10094956	Ga0265338_100949565	136
161	3300028800	Ga0265338_10133664	Ga0265338_101336643	136
162	3300028800	Ga0265338_10218174	Ga0265338_102181742	136
163	3300028800	Ga0265338_10272846	Ga0265338_102728462	136
164	3300028800	Ga0265338_10342254	Ga0265338_103422543	136
165	3300028800	Ga0265338_10441444	Ga0265338_104414443	136
166	3300030760	Ga0265762_1007058	Ga0265762_10070583	136
167	3300030760	Ga0265762_1035631	Ga0265762_10356312	136
168	3300030760	Ga0265762_1132989	Ga0265762_11329891	136
169	3300030878	Ga0265770_1003601	Ga0265770_10036012	136
170	3300030878	Ga0265770_1010532	Ga0265770_10105322	136
171	3300031010	Ga0265771_1011132	Ga0265771_10111322	136
172	3300031090	Ga0265760_10020770	Ga0265760_100207702	136
173	3300031090	Ga0265760_10057658	Ga0265760_100576584	136
174	3300031090	Ga0265760_10118109	Ga0265760_101181091	136
175	3300031090	Ga0265760_10125617	Ga0265760_101256171	136
176	3300031238	Ga0265332_10006554	Ga0265332_100065546	136
177	3300031238	Ga0265332_10391242	Ga0265332_103912421	136
178	3300031239	Ga0265328_10018083	Ga0265328_100180833	136
179	3300031240	Ga0265320_10000126	Ga0265320_100001267	136
180	3300031240	Ga0265320_10059921	Ga0265320_100599214	136
181	3300031241	Ga0265325_10011206	Ga0265325_1001120610	136
182	3300031241	Ga0265325_10039203	Ga0265325_100392035	136
183	3300031241	Ga0265325_10112208	Ga0265325_101122083	136
184	3300031242	Ga0265329_10000274	Ga0265329_1000027411	136
185	3300031242	Ga0265329_10092146	Ga0265329_100921462	136
186	3300031247	Ga0265340_10002822	Ga0265340_1000282214	136
187	3300031249	Ga0265339_10001417	Ga0265339_1000141711	136
188	3300031249	Ga0265339_10048169	Ga0265339_100481695	136
189	3300031250	Ga0265331_10000025	Ga0265331_10000025151	136
190	3300031250	Ga0265331_10006433	Ga0265331_1000643312	136
191	3300031250	Ga0265331_10227300	Ga0265331_102273002	136
192	3300031344	Ga0265316_10000784	Ga0265316_1000078426	136
193	3300031344	Ga0265316_10016208	Ga0265316_100162088	136
194	3300031344	Ga0265316_10040138	Ga0265316_100401384	136
195	3300031344	Ga0265316_10065813	Ga0265316_100658135	136
196	3300031344	Ga0265316_10189522	Ga0265316_101895222	136
197	3300031595	Ga0265313_10001605	Ga0265313_1000160519	136
198	3300031595	Ga0265313_10014497	Ga0265313_100144975	136
199	3300031712	Ga0265342_10000362	Ga0265342_1000036221	136
200	3300031824	Ga0307413_10277933	Ga0307413_102779332	136
201	3300035118	Ga0373954_0060048	Ga0373954_0060048_33_449	136
202	3300035119	Ga0373956_0002995	Ga0373956_0002995_4211_4627	136
203	3300035120	Ga0373957_0196740	Ga0373957_0196740_329_745	136
204	3300035410	Ga0373924_0263969	Ga0373924_0263969_127_543	136
205	3300035724	Ga0373933_0002799	Ga0373933_0002799_5621_6037	136
206	3300035724	Ga0373933_0204780	Ga0373933_0204780_690_1106	136
207	3300036401	Ga0373937_0000238	Ga0373937_0000238_48364_48780	136
208	3300036401	Ga0373937_0014533	Ga0373937_0014533_1907_2323	136
209	3300036457	Ga0265778_013163	Ga0265778_013163_190_603	136
210	3300037853	Ga0436364_1054367	Ga0436364_1054367_15714_16142	136
211	3300039450	Ga0436363_0366011	Ga0436363_0366011_107_520	136
212	3300039450	Ga0436363_1175577	Ga0436363_1175577_320_748	136
213	3300042876	Ga0451577_0015343	Ga0451577_0015343_2842_3258	136
214	3300042876	Ga0451577_0226955	Ga0451577_0226955_506_922	136
215	3300042876	Ga0451577_0389714	Ga0451577_0389714_619_1035	136
216	3300044673	Ga0453683_0006843	Ga0453683_0006843_1033_1449	136
217	3300044673	Ga0453683_0008784	Ga0453683_0008784_4704_5120	136
218	3300044673	Ga0453683_0012952	Ga0453683_0012952_4404_4820	136
219	3300044673	Ga0453683_0464429	Ga0453683_0464429_47_463	136
220	3300044712	Ga0453684_0008349	Ga0453684_0008349_13108_13524	136
221	3300044712	Ga0453684_0070322	Ga0453684_0070322_3936_4352	136
222	3300045051	Ga0451576_0093519	Ga0451576_0093519_1291_1707	136
223	3300045051	Ga0451576_1378020	Ga0451576_1378020_274_690	136
224	3300046462	Ga0495651_0000269	Ga0495651_0000269_30650_31066	136
225	3300046462	Ga0495651_0056300	Ga0495651_0056300_1427_1843	136
226	3300046473	Ga0495582_0017687	Ga0495582_0017687_544_960	136
227	3300046477	Ga0495664_0095937	Ga0495664_0095937_109_525	136
228	3300046511	Ga0495608_0437160	Ga0495608_0437160_47_463	136
229	3300046526	Ga0495666_0284504	Ga0495666_0284504_64_480	136
230	3300046529	Ga0495652_0023062	Ga0495652_0023062_25_441	136
231	3300046536	Ga0495587_0000383	Ga0495587_0000383_3422_3838	136
232	3300046559	Ga0495667_0005671	Ga0495667_0005671_4376_4792	136
233	3300046679	Ga0495623_0021172	Ga0495623_0021172_757_1173	136
234	3300046689	Ga0495613_0035909	Ga0495613_0035909_1308_1724	136
235	3300046689	Ga0495613_0564243	Ga0495613_0564243_278_688	136
236	3300046809	Ga0495600_0058659	Ga0495600_0058659_1441_1857	136
237	3300047315	Ga0495581_0138688	Ga0495581_0138688_743_1159	136
238	3300047317	Ga0495604_0270113	Ga0495604_0270113_154_570	136
239	3300047319	Ga0495674_0297662	Ga0495674_0297662_618_1034	136
240	3300047321	Ga0495676_0089697	Ga0495676_0089697_1238_1654	136
241	3300047322	Ga0495680_0000041	Ga0495680_0000041_41628_42044	136
242	3300047322	Ga0495680_0030107	Ga0495680_0030107_1263_1679	136
243	3300047444	Ga0495675_0036213	Ga0495675_0036213_829_1245	136
244	3300048088	Ga0495602_0036335	Ga0495602_0036335_2285_2701	136
245	3300048912	Ga0496109_0396245	Ga0496109_0396245_683_1093	136
246	3300048915	Ga0496112_0137285	Ga0496112_0137285_1323_1739	136
247	3300048915	Ga0496112_0798311	Ga0496112_0798311_440_853	136
248	3300049589	Ga0501073_0029956	Ga0501073_0029956_3231_3644	136
249	3300049590	Ga0501074_0206565	Ga0501074_0206565_700_1113	136
250	3300049593	Ga0501077_0265779	Ga0501077_0265779_593_1006	136
251	3300049744	Ga0501083_0083580	Ga0501083_0083580_58_471	136
252	3300050509	nmdc:mga0qj67_217542_c2	nmdc:mga0qj67_217542_c2_64_474	136
253	3300050513	nmdc:mga0rr50_619231_c1	nmdc:mga0rr50_619231_c1_195_632	136
254	3300054114	Ga0501084_0032147	Ga0501084_0032147_399_812	136
255	3300061719	Ga0466962_0029520	Ga0466962_0029520_295_705	136
256	3300002077	JGI24744J21845_10081047	JGI24744J21845_100810471	137
257	3300002239	JGI24034J26672_10070390	JGI24034J26672_100703902	137
258	3300003203	JGI25406J46586_10004601	JGI25406J46586_1000460110	137
259	3300003203	JGI25406J46586_10077588	JGI25406J46586_100775882	137
260	3300003574	Ga0007410J51695_1071996	Ga0007410J51695_10719961	137
261	3300003575	Ga0007409J51694_1040163	Ga0007409J51694_10401632	137
262	3300004799	Ga0058863_11724041	Ga0058863_117240413	137
263	3300004801	Ga0058860_10011966	Ga0058860_100119661	137
264	3300004801	Ga0058860_11893700	Ga0058860_118937001	137
265	3300005288	Ga0065714_10158492	Ga0065714_101584921	137
266	3300005288	Ga0065714_10170390	Ga0065714_101703903	137
267	3300005289	Ga0065704_10033039	Ga0065704_100330392	137
268	3300005289	Ga0065704_10135708	Ga0065704_101357085	137
269	3300005290	Ga0065712_10001248	Ga0065712_1000124814	137
270	3300005290	Ga0065712_10001330	Ga0065712_100013306	137
271	3300005290	Ga0065712_10004633	Ga0065712_100046339	137
272	3300005290	Ga0065712_10007643	Ga0065712_100076432	137
273	3300005290	Ga0065712_10073977	Ga0065712_100739773	137
274	3300005290	Ga0065712_10087066	Ga0065712_100870666	137
275	3300005290	Ga0065712_10207534	Ga0065712_102075342	137
276	3300005290	Ga0065712_10408841	Ga0065712_104088411	137
277	3300005293	Ga0065715_10001224	Ga0065715_100012241	137
278	3300005293	Ga0065715_10003690	Ga0065715_100036902	137
279	3300005293	Ga0065715_10013683	Ga0065715_100136833	137
280	3300005293	Ga0065715_10026741	Ga0065715_100267413	137
281	3300005293	Ga0065715_10230445	Ga0065715_102304454	137
282	3300005293	Ga0065715_10252487	Ga0065715_102524871	137
283	3300005293	Ga0065715_10307543	Ga0065715_103075432	137
284	3300005293	Ga0065715_10398204	Ga0065715_103982042	137
285	3300005293	Ga0065715_10725569	Ga0065715_107255692	137
286	3300005293	Ga0065715_10745601	Ga0065715_107456012	137
287	3300005293	Ga0065715_11140061	Ga0065715_111400611	137
288	3300005295	Ga0065707_10008221	Ga0065707_100082213	137
289	3300005295	Ga0065707_10013464	Ga0065707_100134648	137
290	3300005295	Ga0065707_10020108	Ga0065707_100201082	137
291	3300005295	Ga0065707_10085242	Ga0065707_100852426	137
292	3300005295	Ga0065707_10123082	Ga0065707_101230826	137
293	3300005295	Ga0065707_10140099	Ga0065707_101400993	137
294	3300005295	Ga0065707_10220891	Ga0065707_102208912	137
295	3300005295	Ga0065707_10416027	Ga0065707_104160271	137
296	3300005327	Ga0070658_10015417	Ga0070658_100154175	137
297	3300005327	Ga0070658_10104987	Ga0070658_101049873	137
298	3300005328	Ga0070676_10014090	Ga0070676_100140909	137
299	3300005328	Ga0070676_10079279	Ga0070676_100792792	137
300	3300005328	Ga0070676_10130334	Ga0070676_101303342	137
301	3300005328	Ga0070676_10162744	Ga0070676_101627442	137
302	3300005328	Ga0070676_10251975	Ga0070676_102519752	137
303	3300005329	Ga0070683_100000726	Ga0070683_10000072616	137
304	3300005329	Ga0070683_100045854	Ga0070683_1000458543	137
305	3300005329	Ga0070683_101374839	Ga0070683_1013748392	137
306	3300005329	Ga0070683_101570657	Ga0070683_1015706571	137
307	3300005330	Ga0070690_100050578	Ga0070690_1000505785	137
308	3300005330	Ga0070690_100155007	Ga0070690_1001550072	137
309	3300005330	Ga0070690_100182062	Ga0070690_1001820621	137
310	3300005330	Ga0070690_100213739	Ga0070690_1002137394	137
311	3300005330	Ga0070690_101037043	Ga0070690_1010370431	137
312	3300005331	Ga0070670_100013308	Ga0070670_1000133086	137
313	3300005331	Ga0070670_100018641	Ga0070670_1000186414	137
314	3300005331	Ga0070670_100021447	Ga0070670_1000214473	137
315	3300005331	Ga0070670_100039587	Ga0070670_1000395875	137
316	3300005331	Ga0070670_100084186	Ga0070670_1000841865	137
317	3300005331	Ga0070670_100254115	Ga0070670_1002541151	137
318	3300005331	Ga0070670_100344000	Ga0070670_1003440004	137
319	3300005331	Ga0070670_100431031	Ga0070670_1004310311	137
320	3300005331	Ga0070670_100504789	Ga0070670_1005047893	137
321	3300005331	Ga0070670_100664284	Ga0070670_1006642841	137
322	3300005331	Ga0070670_100928731	Ga0070670_1009287312	137
323	3300005333	Ga0070677_10245032	Ga0070677_102450322	137
324	3300005333	Ga0070677_10434824	Ga0070677_104348242	137
325	3300005333	Ga0070677_10552138	Ga0070677_105521382	137
326	3300005334	Ga0068869_100103378	Ga0068869_1001033785	137
327	3300005334	Ga0068869_100146086	Ga0068869_1001460862	137
328	3300005334	Ga0068869_100150892	Ga0068869_1001508924	137
329	3300005334	Ga0068869_100164987	Ga0068869_1001649874	137
330	3300005334	Ga0068869_100255380	Ga0068869_1002553801	137
331	3300005334	Ga0068869_100344912	Ga0068869_1003449122	137
332	3300005334	Ga0068869_100487269	Ga0068869_1004872692	137
333	3300005334	Ga0068869_101143085	Ga0068869_1011430851	137
334	3300005334	Ga0068869_101220076	Ga0068869_1012200762	137
335	3300005335	Ga0070666_10019993	Ga0070666_100199931	137
336	3300005335	Ga0070666_10028665	Ga0070666_100286652	137
337	3300005335	Ga0070666_10050900	Ga0070666_100509004	137
338	3300005335	Ga0070666_10096045	Ga0070666_100960453	137
339	3300005335	Ga0070666_10177673	Ga0070666_101776733	137
340	3300005336	Ga0070680_100017145	Ga0070680_10001714510	137
341	3300005336	Ga0070680_100078049	Ga0070680_1000780494	137
342	3300005336	Ga0070680_100090495	Ga0070680_1000904956	137
343	3300005336	Ga0070680_100136118	Ga0070680_1001361183	137
344	3300005336	Ga0070680_100239648	Ga0070680_1002396483	137
345	3300005336	Ga0070680_100670775	Ga0070680_1006707752	137
346	3300005336	Ga0070680_101073981	Ga0070680_1010739812	137
347	3300005337	Ga0070682_100254169	Ga0070682_1002541694	137
348	3300005338	Ga0068868_100005009	Ga0068868_10000500918	137
349	3300005338	Ga0068868_100034808	Ga0068868_1000348086	137
350	3300005338	Ga0068868_100271206	Ga0068868_1002712065	137
351	3300005338	Ga0068868_100757899	Ga0068868_1007578992	137
352	3300005339	Ga0070660_101209127	Ga0070660_1012091271	137
353	3300005340	Ga0070689_100022608	Ga0070689_1000226089	137
354	3300005340	Ga0070689_100033346	Ga0070689_1000333467	137
355	3300005340	Ga0070689_100063440	Ga0070689_1000634405	137
356	3300005340	Ga0070689_100086181	Ga0070689_1000861814	137
357	3300005340	Ga0070689_100209522	Ga0070689_1002095225	137
358	3300005340	Ga0070689_100315320	Ga0070689_1003153202	137
359	3300005340	Ga0070689_100358443	Ga0070689_1003584432	137
360	3300005340	Ga0070689_100540615	Ga0070689_1005406153	137
361	3300005340	Ga0070689_100927457	Ga0070689_1009274572	137
362	3300005341	Ga0070691_10025987	Ga0070691_100259873	137
363	3300005341	Ga0070691_10259158	Ga0070691_102591582	137
364	3300005343	Ga0070687_100004670	Ga0070687_1000046705	137
365	3300005343	Ga0070687_100072345	Ga0070687_1000723451	137
366	3300005343	Ga0070687_100086599	Ga0070687_1000865993	137
367	3300005343	Ga0070687_100389176	Ga0070687_1003891762	137
368	3300005343	Ga0070687_100390480	Ga0070687_1003904802	137
369	3300005343	Ga0070687_100740077	Ga0070687_1007400772	137
370	3300005344	Ga0070661_100052859	Ga0070661_1000528596	137
371	3300005344	Ga0070661_100081951	Ga0070661_1000819512	137
372	3300005344	Ga0070661_100142843	Ga0070661_1001428432	137
373	3300005344	Ga0070661_100329049	Ga0070661_1003290492	137
374	3300005344	Ga0070661_100561233	Ga0070661_1005612332	137
375	3300005344	Ga0070661_100737374	Ga0070661_1007373742	137
376	3300005344	Ga0070661_100985250	Ga0070661_1009852501	137
377	3300005345	Ga0070692_10019404	Ga0070692_100194044	137
378	3300005345	Ga0070692_10032375	Ga0070692_100323754	137
379	3300005345	Ga0070692_10036525	Ga0070692_100365256	137
380	3300005345	Ga0070692_11299744	Ga0070692_112997441	137
381	3300005347	Ga0070668_100152202	Ga0070668_1001522025	137
382	3300005347	Ga0070668_100228695	Ga0070668_1002286954	137
383	3300005347	Ga0070668_100500800	Ga0070668_1005008003	137
384	3300005347	Ga0070668_100515574	Ga0070668_1005155742	137
385	3300005347	Ga0070668_100573269	Ga0070668_1005732692	137
386	3300005347	Ga0070668_101068291	Ga0070668_1010682911	137
387	3300005353	Ga0070669_100001695	Ga0070669_10000169511	137
388	3300005353	Ga0070669_100004188	Ga0070669_10000418814	137
389	3300005353	Ga0070669_100010881	Ga0070669_1000108815	137
390	3300005353	Ga0070669_100071453	Ga0070669_1000714534	137
391	3300005353	Ga0070669_100076899	Ga0070669_1000768996	137
392	3300005353	Ga0070669_100132419	Ga0070669_1001324192	137
393	3300005353	Ga0070669_100135844	Ga0070669_1001358441	137
394	3300005353	Ga0070669_100220461	Ga0070669_1002204612	137
395	3300005353	Ga0070669_100276330	Ga0070669_1002763302	137
396	3300005353	Ga0070669_100463819	Ga0070669_1004638192	137
397	3300005353	Ga0070669_100604751	Ga0070669_1006047513	137
398	3300005353	Ga0070669_100905549	Ga0070669_1009055491	137
399	3300005354	Ga0070675_100004981	Ga0070675_1000049812	137
400	3300005354	Ga0070675_100007191	Ga0070675_10000719114	137
401	3300005354	Ga0070675_100014470	Ga0070675_1000144703	137
402	3300005354	Ga0070675_100015584	Ga0070675_1000155848	137
403	3300005354	Ga0070675_100025441	Ga0070675_1000254417	137
404	3300005354	Ga0070675_100059893	Ga0070675_1000598938	137
405	3300005354	Ga0070675_100068991	Ga0070675_1000689913	137
406	3300005354	Ga0070675_100136564	Ga0070675_1001365645	137
407	3300005354	Ga0070675_100138387	Ga0070675_1001383875	137
408	3300005354	Ga0070675_100292812	Ga0070675_1002928123	137
409	3300005354	Ga0070675_100372698	Ga0070675_1003726982	137
410	3300005354	Ga0070675_100537934	Ga0070675_1005379342	137
411	3300005354	Ga0070675_100566339	Ga0070675_1005663392	137
412	3300005354	Ga0070675_100582859	Ga0070675_1005828592	137
413	3300005354	Ga0070675_101553508	Ga0070675_1015535081	137
414	3300005355	Ga0070671_100097474	Ga0070671_1000974742	137
415	3300005355	Ga0070671_100118858	Ga0070671_1001188586	137
416	3300005355	Ga0070671_100760368	Ga0070671_1007603682	137
417	3300005355	Ga0070671_101271503	Ga0070671_1012715032	137
418	3300005356	Ga0070674_100012403	Ga0070674_1000124038	137
419	3300005356	Ga0070674_100015536	Ga0070674_1000155369	137
420	3300005356	Ga0070674_100075244	Ga0070674_1000752444	137
421	3300005356	Ga0070674_100084034	Ga0070674_1000840345	137
422	3300005356	Ga0070674_100095772	Ga0070674_1000957721	137
423	3300005356	Ga0070674_100176832	Ga0070674_1001768324	137
424	3300005356	Ga0070674_100298926	Ga0070674_1002989262	137
425	3300005356	Ga0070674_100476107	Ga0070674_1004761072	137
426	3300005356	Ga0070674_100681839	Ga0070674_1006818392	137
427	3300005356	Ga0070674_100818159	Ga0070674_1008181592	137
428	3300005356	Ga0070674_100827223	Ga0070674_1008272232	137
429	3300005364	Ga0070673_100003685	Ga0070673_1000036855	137
430	3300005364	Ga0070673_100004781	Ga0070673_10000478111	137
431	3300005364	Ga0070673_100062278	Ga0070673_1000622783	137
432	3300005364	Ga0070673_100098503	Ga0070673_1000985035	137
433	3300005364	Ga0070673_100166539	Ga0070673_1001665393	137
434	3300005364	Ga0070673_100210652	Ga0070673_1002106522	137
435	3300005364	Ga0070673_100270783	Ga0070673_1002707831	137
436	3300005364	Ga0070673_100286032	Ga0070673_1002860322	137
437	3300005364	Ga0070673_100464213	Ga0070673_1004642133	137
438	3300005364	Ga0070673_100494573	Ga0070673_1004945732	137
439	3300005364	Ga0070673_100541530	Ga0070673_1005415303	137
440	3300005364	Ga0070673_100595888	Ga0070673_1005958883	137
441	3300005364	Ga0070673_101200329	Ga0070673_1012003291	137
442	3300005365	Ga0070688_100003817	Ga0070688_1000038179	137
443	3300005365	Ga0070688_100104043	Ga0070688_1001040431	137
444	3300005365	Ga0070688_100123925	Ga0070688_1001239252	137
445	3300005365	Ga0070688_100223754	Ga0070688_1002237544	137
446	3300005365	Ga0070688_100271226	Ga0070688_1002712263	137
447	3300005365	Ga0070688_100425783	Ga0070688_1004257832	137
448	3300005365	Ga0070688_100552336	Ga0070688_1005523362	137
449	3300005365	Ga0070688_100619000	Ga0070688_1006190001	137
450	3300005366	Ga0070659_100163155	Ga0070659_1001631553	137
451	3300005366	Ga0070659_100293669	Ga0070659_1002936694	137
452	3300005366	Ga0070659_101215863	Ga0070659_1012158631	137
453	3300005366	Ga0070659_101395704	Ga0070659_1013957041	137
454	3300005366	Ga0070659_101729487	Ga0070659_1017294871	137
455	3300005366	Ga0070659_102034408	Ga0070659_1020344081	137
456	3300005367	Ga0070667_100080432	Ga0070667_1000804325	137
457	3300005367	Ga0070667_100137825	Ga0070667_1001378254	137
458	3300005367	Ga0070667_100177440	Ga0070667_1001774401	137
459	3300005367	Ga0070667_100346211	Ga0070667_1003462112	137
460	3300005367	Ga0070667_100498973	Ga0070667_1004989732	137
461	3300005367	Ga0070667_100819449	Ga0070667_1008194492	137
462	3300005406	Ga0070703_10002736	Ga0070703_100027363	137
463	3300005434	Ga0070709_10000098	Ga0070709_1000009810	137
464	3300005438	Ga0070701_10002134	Ga0070701_1000213411	137
465	3300005438	Ga0070701_10005353	Ga0070701_100053539	137
466	3300005438	Ga0070701_10052608	Ga0070701_100526086	137
467	3300005438	Ga0070701_10059153	Ga0070701_100591534	137
468	3300005438	Ga0070701_10062331	Ga0070701_100623311	137
469	3300005438	Ga0070701_10087038	Ga0070701_100870385	137
470	3300005438	Ga0070701_10133123	Ga0070701_101331234	137
471	3300005438	Ga0070701_10158647	Ga0070701_101586472	137
472	3300005438	Ga0070701_10265530	Ga0070701_102655303	137
473	3300005438	Ga0070701_10267569	Ga0070701_102675691	137
474	3300005438	Ga0070701_10642169	Ga0070701_106421691	137
475	3300005439	Ga0070711_100000059	Ga0070711_10000005910	137
476	3300005439	Ga0070711_100485242	Ga0070711_1004852423	137
477	3300005439	Ga0070711_100505780	Ga0070711_1005057802	137
478	3300005440	Ga0070705_100000175	Ga0070705_1000001758	137
479	3300005440	Ga0070705_100000819	Ga0070705_10000081922	137
480	3300005440	Ga0070705_100017087	Ga0070705_1000170874	137
481	3300005440	Ga0070705_100111972	Ga0070705_1001119725	137
482	3300005440	Ga0070705_100189753	Ga0070705_1001897532	137
483	3300005440	Ga0070705_100292718	Ga0070705_1002927181	137
484	3300005440	Ga0070705_100443874	Ga0070705_1004438741	137
485	3300005440	Ga0070705_100937525	Ga0070705_1009375251	137
486	3300005441	Ga0070700_100050268	Ga0070700_1000502681	137
487	3300005441	Ga0070700_100079899	Ga0070700_1000798994	137
488	3300005441	Ga0070700_100103309	Ga0070700_1001033094	137
489	3300005441	Ga0070700_100106484	Ga0070700_1001064842	137
490	3300005441	Ga0070700_100292961	Ga0070700_1002929614	137
491	3300005441	Ga0070700_100315382	Ga0070700_1003153822	137
492	3300005441	Ga0070700_100354004	Ga0070700_1003540042	137
493	3300005441	Ga0070700_100357647	Ga0070700_1003576471	137
494	3300005441	Ga0070700_100385841	Ga0070700_1003858412	137
495	3300005441	Ga0070700_100411383	Ga0070700_1004113832	137
496	3300005441	Ga0070700_100775541	Ga0070700_1007755412	137
497	3300005441	Ga0070700_100961265	Ga0070700_1009612651	137
498	3300005444	Ga0070694_100076927	Ga0070694_1000769276	137
499	3300005444	Ga0070694_100082310	Ga0070694_1000823103	137
500	3300005444	Ga0070694_100237307	Ga0070694_1002373073	137
501	3300005444	Ga0070694_100254644	Ga0070694_1002546443	137
502	3300005444	Ga0070694_100303838	Ga0070694_1003038382	137
503	3300005444	Ga0070694_100322218	Ga0070694_1003222182	137
504	3300005444	Ga0070694_100376786	Ga0070694_1003767862	137
505	3300005444	Ga0070694_100707660	Ga0070694_1007076603	137
506	3300005444	Ga0070694_100822918	Ga0070694_1008229182	137
507	3300005444	Ga0070694_100884481	Ga0070694_1008844812	137
508	3300005445	Ga0070708_100114080	Ga0070708_1001140801	137
509	3300005445	Ga0070708_100182201	Ga0070708_1001822011	137
510	3300005445	Ga0070708_100401355	Ga0070708_1004013552	137
511	3300005445	Ga0070708_101751779	Ga0070708_1017517791	137
512	3300005455	Ga0070663_100014660	Ga0070663_1000146605	137
513	3300005455	Ga0070663_100016120	Ga0070663_1000161202	137
514	3300005456	Ga0070678_100004485	Ga0070678_1000044859	137
515	3300005456	Ga0070678_100092673	Ga0070678_1000926737	137
516	3300005456	Ga0070678_100215478	Ga0070678_1002154782	137
517	3300005456	Ga0070678_100302565	Ga0070678_1003025654	137
518	3300005456	Ga0070678_100405896	Ga0070678_1004058962	137
519	3300005456	Ga0070678_100454284	Ga0070678_1004542841	137
520	3300005456	Ga0070678_101055623	Ga0070678_1010556232	137
521	3300005457	Ga0070662_100106420	Ga0070662_1001064204	137
522	3300005457	Ga0070662_100122731	Ga0070662_1001227312	137
523	3300005457	Ga0070662_100197971	Ga0070662_1001979712	137
524	3300005457	Ga0070662_100676966	Ga0070662_1006769662	137
525	3300005458	Ga0070681_10029747	Ga0070681_100297479	137
526	3300005458	Ga0070681_10065223	Ga0070681_100652235	137
527	3300005458	Ga0070681_10367651	Ga0070681_103676514	137
528	3300005458	Ga0070681_10745861	Ga0070681_107458611	137
529	3300005458	Ga0070681_10893788	Ga0070681_108937881	137
530	3300005458	Ga0070681_11138352	Ga0070681_111383521	137
531	3300005459	Ga0068867_100007115	Ga0068867_10000711510	137
532	3300005459	Ga0068867_100008420	Ga0068867_10000842015	137
533	3300005459	Ga0068867_100063207	Ga0068867_1000632074	137
534	3300005459	Ga0068867_100321290	Ga0068867_1003212904	137
535	3300005459	Ga0068867_100432308	Ga0068867_1004323082	137
536	3300005466	Ga0070685_10034211	Ga0070685_100342113	137
537	3300005466	Ga0070685_10119396	Ga0070685_101193963	137
538	3300005466	Ga0070685_10712589	Ga0070685_107125891	137
539	3300005467	Ga0070706_100018325	Ga0070706_1000183255	137
540	3300005467	Ga0070706_100243082	Ga0070706_1002430823	137
541	3300005467	Ga0070706_101162304	Ga0070706_1011623042	137
542	3300005467	Ga0070706_101864446	Ga0070706_1018644461	137
543	3300005468	Ga0070707_100037632	Ga0070707_10003763212	137
544	3300005468	Ga0070707_100143317	Ga0070707_1001433175	137
545	3300005468	Ga0070707_100396768	Ga0070707_1003967683	137
546	3300005468	Ga0070707_100594968	Ga0070707_1005949681	137
547	3300005471	Ga0070698_100010970	Ga0070698_10001097018	137
548	3300005471	Ga0070698_100113085	Ga0070698_1001130852	137
549	3300005471	Ga0070698_100147912	Ga0070698_1001479121	137
550	3300005471	Ga0070698_100218332	Ga0070698_1002183325	137
551	3300005471	Ga0070698_100338707	Ga0070698_1003387072	137
552	3300005471	Ga0070698_100416301	Ga0070698_1004163012	137
553	3300005471	Ga0070698_100582784	Ga0070698_1005827842	137
554	3300005471	Ga0070698_100927189	Ga0070698_1009271892	137
555	3300005471	Ga0070698_101077958	Ga0070698_1010779581	137
556	3300005518	Ga0070699_100000009	Ga0070699_100000009249	137
557	3300005518	Ga0070699_100029345	Ga0070699_1000293455	137
558	3300005518	Ga0070699_100059675	Ga0070699_1000596756	137
559	3300005518	Ga0070699_100253264	Ga0070699_1002532642	137
560	3300005518	Ga0070699_100260953	Ga0070699_1002609532	137
561	3300005518	Ga0070699_100299934	Ga0070699_1002999341	137
562	3300005518	Ga0070699_100319677	Ga0070699_1003196772	137
563	3300005518	Ga0070699_100554178	Ga0070699_1005541782	137
564	3300005518	Ga0070699_100691717	Ga0070699_1006917171	137
565	3300005518	Ga0070699_100801484	Ga0070699_1008014842	137
566	3300005530	Ga0070679_100039507	Ga0070679_10003950711	137
567	3300005530	Ga0070679_100269282	Ga0070679_1002692822	137
568	3300005535	Ga0070684_100000236	Ga0070684_10000023614	137
569	3300005535	Ga0070684_100010407	Ga0070684_10001040714	137
570	3300005535	Ga0070684_100052381	Ga0070684_1000523817	137
571	3300005535	Ga0070684_100711488	Ga0070684_1007114882	137
572	3300005536	Ga0070697_100148214	Ga0070697_1001482145	137
573	3300005536	Ga0070697_100284714	Ga0070697_1002847143	137
574	3300005536	Ga0070697_100617459	Ga0070697_1006174592	137
575	3300005539	Ga0068853_100812635	Ga0068853_1008126353	137
576	3300005539	Ga0068853_101546104	Ga0068853_1015461041	137
577	3300005543	Ga0070672_100010895	Ga0070672_1000108955	137
578	3300005543	Ga0070672_100017126	Ga0070672_1000171264	137
579	3300005543	Ga0070672_100071248	Ga0070672_1000712488	137
580	3300005543	Ga0070672_100076814	Ga0070672_1000768142	137
581	3300005543	Ga0070672_100079352	Ga0070672_1000793526	137
582	3300005543	Ga0070672_100111470	Ga0070672_1001114702	137
583	3300005543	Ga0070672_100118563	Ga0070672_1001185632	137
584	3300005543	Ga0070672_100159056	Ga0070672_1001590564	137
585	3300005543	Ga0070672_100181803	Ga0070672_1001818034	137
586	3300005543	Ga0070672_100211113	Ga0070672_1002111131	137
587	3300005543	Ga0070672_100284329	Ga0070672_1002843294	137
588	3300005543	Ga0070672_100304545	Ga0070672_1003045453	137
589	3300005543	Ga0070672_100732824	Ga0070672_1007328242	137
590	3300005543	Ga0070672_100746642	Ga0070672_1007466422	137
591	3300005544	Ga0070686_100002243	Ga0070686_10000224316	137
592	3300005544	Ga0070686_100042575	Ga0070686_1000425752	137
593	3300005544	Ga0070686_100061211	Ga0070686_1000612114	137
594	3300005544	Ga0070686_100115364	Ga0070686_1001153642	137
595	3300005544	Ga0070686_100122762	Ga0070686_1001227623	137
596	3300005544	Ga0070686_100158136	Ga0070686_1001581362	137
597	3300005544	Ga0070686_100191927	Ga0070686_1001919274	137
598	3300005544	Ga0070686_100219637	Ga0070686_1002196372	137
599	3300005544	Ga0070686_100512450	Ga0070686_1005124502	137
600	3300005544	Ga0070686_100649077	Ga0070686_1006490772	137
601	3300005544	Ga0070686_100700772	Ga0070686_1007007722	137
602	3300005544	Ga0070686_101170437	Ga0070686_1011704371	137
603	3300005545	Ga0070695_100004877	Ga0070695_10000487714	137
604	3300005545	Ga0070695_100006901	Ga0070695_1000069015	137
605	3300005545	Ga0070695_100076433	Ga0070695_1000764335	137
606	3300005545	Ga0070695_100464738	Ga0070695_1004647381	137
607	3300005545	Ga0070695_100645009	Ga0070695_1006450092	137
608	3300005546	Ga0070696_100006858	Ga0070696_1000068585	137
609	3300005546	Ga0070696_100018915	Ga0070696_1000189159	137
610	3300005546	Ga0070696_100026481	Ga0070696_1000264819	137
611	3300005546	Ga0070696_100184495	Ga0070696_1001844953	137
612	3300005546	Ga0070696_100337716	Ga0070696_1003377162	137
613	3300005546	Ga0070696_100347694	Ga0070696_1003476943	137
614	3300005546	Ga0070696_101169906	Ga0070696_1011699061	137
615	3300005547	Ga0070693_100003030	Ga0070693_10000303010	137
616	3300005547	Ga0070693_100008359	Ga0070693_1000083592	137
617	3300005547	Ga0070693_100301898	Ga0070693_1003018982	137
618	3300005547	Ga0070693_100358657	Ga0070693_1003586571	137
619	3300005547	Ga0070693_100702197	Ga0070693_1007021971	137
620	3300005548	Ga0070665_100029874	Ga0070665_1000298742	137
621	3300005548	Ga0070665_100261265	Ga0070665_1002612653	137
622	3300005548	Ga0070665_100459854	Ga0070665_1004598544	137
623	3300005549	Ga0070704_100000751	Ga0070704_10000075124	137
624	3300005549	Ga0070704_100030754	Ga0070704_1000307549	137
625	3300005549	Ga0070704_100034011	Ga0070704_1000340112	137
626	3300005549	Ga0070704_100047708	Ga0070704_1000477083	137
627	3300005549	Ga0070704_100208395	Ga0070704_1002083952	137
628	3300005549	Ga0070704_100212720	Ga0070704_1002127202	137
629	3300005549	Ga0070704_100758035	Ga0070704_1007580351	137
630	3300005549	Ga0070704_101085418	Ga0070704_1010854182	137
631	3300005549	Ga0070704_101233829	Ga0070704_1012338292	137
632	3300005563	Ga0068855_100066908	Ga0068855_1000669082	137
633	3300005563	Ga0068855_100527203	Ga0068855_1005272032	137
634	3300005564	Ga0070664_100001147	Ga0070664_1000011479	137
635	3300005564	Ga0070664_100006932	Ga0070664_10000693214	137
636	3300005564	Ga0070664_100007621	Ga0070664_10000762116	137
637	3300005564	Ga0070664_100014134	Ga0070664_1000141345	137
638	3300005564	Ga0070664_100021515	Ga0070664_1000215158	137
639	3300005564	Ga0070664_100120656	Ga0070664_1001206562	137
640	3300005564	Ga0070664_100240838	Ga0070664_1002408384	137
641	3300005564	Ga0070664_100421453	Ga0070664_1004214532	137
642	3300005564	Ga0070664_100694720	Ga0070664_1006947202	137
643	3300005564	Ga0070664_100890053	Ga0070664_1008900531	137
644	3300005564	Ga0070664_101319850	Ga0070664_1013198502	137
645	3300005577	Ga0068857_100046867	Ga0068857_1000468679	137
646	3300005577	Ga0068857_100103260	Ga0068857_1001032605	137
647	3300005577	Ga0068857_100141171	Ga0068857_1001411712	137
648	3300005577	Ga0068857_100383350	Ga0068857_1003833502	137
649	3300005577	Ga0068857_100797489	Ga0068857_1007974891	137
650	3300005577	Ga0068857_101051465	Ga0068857_1010514652	137
651	3300005577	Ga0068857_101128921	Ga0068857_1011289212	137
652	3300005577	Ga0068857_101484046	Ga0068857_1014840461	137
653	3300005578	Ga0068854_100011828	Ga0068854_1000118287	137
654	3300005578	Ga0068854_100084206	Ga0068854_1000842062	137
655	3300005578	Ga0068854_100192971	Ga0068854_1001929712	137
656	3300005578	Ga0068854_100356614	Ga0068854_1003566142	137
657	3300005578	Ga0068854_100525838	Ga0068854_1005258383	137
658	3300005578	Ga0068854_101121514	Ga0068854_1011215142	137
659	3300005578	Ga0068854_101320646	Ga0068854_1013206462	137
660	3300005614	Ga0068856_100438963	Ga0068856_1004389632	137
661	3300005614	Ga0068856_100692332	Ga0068856_1006923322	137
662	3300005615	Ga0070702_100023468	Ga0070702_1000234681	137
663	3300005615	Ga0070702_100041855	Ga0070702_1000418552	137
664	3300005615	Ga0070702_100526916	Ga0070702_1005269162	137
665	3300005615	Ga0070702_100699171	Ga0070702_1006991712	137
666	3300005615	Ga0070702_101351110	Ga0070702_1013511101	137
667	3300005616	Ga0068852_100026423	Ga0068852_10002642311	137
668	3300005616	Ga0068852_100244072	Ga0068852_1002440724	137
669	3300005616	Ga0068852_100439411	Ga0068852_1004394112	137
670	3300005616	Ga0068852_100836559	Ga0068852_1008365592	137
671	3300005616	Ga0068852_101434011	Ga0068852_1014340112	137
672	3300005617	Ga0068859_100030708	Ga0068859_1000307089	137
673	3300005617	Ga0068859_100039359	Ga0068859_1000393597	137
674	3300005617	Ga0068859_100070606	Ga0068859_1000706063	137
675	3300005617	Ga0068859_100071027	Ga0068859_1000710279	137
676	3300005617	Ga0068859_100139222	Ga0068859_1001392226	137
677	3300005617	Ga0068859_100172586	Ga0068859_1001725862	137
678	3300005617	Ga0068859_100195216	Ga0068859_1001952166	137
679	3300005617	Ga0068859_100227698	Ga0068859_1002276981	137
680	3300005617	Ga0068859_100308688	Ga0068859_1003086884	137
681	3300005617	Ga0068859_100381515	Ga0068859_1003815152	137
682	3300005617	Ga0068859_100390324	Ga0068859_1003903244	137
683	3300005617	Ga0068859_100685577	Ga0068859_1006855772	137
684	3300005617	Ga0068859_100733603	Ga0068859_1007336031	137
685	3300005617	Ga0068859_100954411	Ga0068859_1009544112	137
686	3300005617	Ga0068859_101070329	Ga0068859_1010703292	137
687	3300005617	Ga0068859_101200021	Ga0068859_1012000212	137
688	3300005617	Ga0068859_101860317	Ga0068859_1018603171	137
689	3300005618	Ga0068864_100017656	Ga0068864_10001765610	137
690	3300005618	Ga0068864_100083521	Ga0068864_1000835215	137
691	3300005618	Ga0068864_100104627	Ga0068864_1001046273	137
692	3300005618	Ga0068864_100222802	Ga0068864_1002228024	137
693	3300005618	Ga0068864_100581868	Ga0068864_1005818682	137
694	3300005618	Ga0068864_100594327	Ga0068864_1005943272	137
695	3300005718	Ga0068866_10016782	Ga0068866_100167822	137
696	3300005718	Ga0068866_10102015	Ga0068866_101020152	137
697	3300005719	Ga0068861_100007625	Ga0068861_10000762510	137
698	3300005719	Ga0068861_100012912	Ga0068861_1000129125	137
699	3300005719	Ga0068861_100068173	Ga0068861_1000681732	137
700	3300005719	Ga0068861_100068555	Ga0068861_1000685553	137
701	3300005719	Ga0068861_100121690	Ga0068861_1001216905	137
702	3300005719	Ga0068861_100285733	Ga0068861_1002857333	137
703	3300005719	Ga0068861_100310619	Ga0068861_1003106192	137
704	3300005719	Ga0068861_100376574	Ga0068861_1003765742	137
705	3300005719	Ga0068861_100982573	Ga0068861_1009825732	137
706	3300005834	Ga0068851_10270027	Ga0068851_102700273	137
707	3300005840	Ga0068870_10000698	Ga0068870_100006985	137
708	3300005840	Ga0068870_10011864	Ga0068870_100118647	137
709	3300005840	Ga0068870_10018931	Ga0068870_100189314	137
710	3300005840	Ga0068870_10055278	Ga0068870_100552783	137
711	3300005840	Ga0068870_10138493	Ga0068870_101384934	137
712	3300005840	Ga0068870_10163239	Ga0068870_101632394	137
713	3300005840	Ga0068870_10177626	Ga0068870_101776262	137
714	3300005840	Ga0068870_10349203	Ga0068870_103492031	137
715	3300005840	Ga0068870_10767964	Ga0068870_107679641	137
716	3300005841	Ga0068863_100026745	Ga0068863_10002674513	137
717	3300005841	Ga0068863_100123429	Ga0068863_1001234296	137
718	3300005841	Ga0068863_100607844	Ga0068863_1006078442	137
719	3300005841	Ga0068863_100792845	Ga0068863_1007928452	137
720	3300005841	Ga0068863_101115750	Ga0068863_1011157503	137
721	3300005841	Ga0068863_101238108	Ga0068863_1012381081	137
722	3300005841	Ga0068863_101759381	Ga0068863_1017593811	137
723	3300005842	Ga0068858_100020935	Ga0068858_10002093513	137
724	3300005842	Ga0068858_100098006	Ga0068858_1000980064	137
725	3300005842	Ga0068858_100149733	Ga0068858_1001497336	137
726	3300005842	Ga0068858_100284992	Ga0068858_1002849923	137
727	3300005843	Ga0068860_100023512	Ga0068860_1000235123	137
728	3300005843	Ga0068860_100124992	Ga0068860_1001249923	137
729	3300005843	Ga0068860_100152845	Ga0068860_1001528453	137
730	3300005843	Ga0068860_100418677	Ga0068860_1004186773	137
731	3300005843	Ga0068860_101200975	Ga0068860_1012009752	137
732	3300005844	Ga0068862_100005694	Ga0068862_10000569414	137
733	3300005844	Ga0068862_100028432	Ga0068862_1000284328	137
734	3300005844	Ga0068862_100040519	Ga0068862_1000405198	137
735	3300005844	Ga0068862_100126523	Ga0068862_1001265234	137
736	3300005844	Ga0068862_100174204	Ga0068862_1001742045	137
737	3300005844	Ga0068862_100266012	Ga0068862_1002660122	137
738	3300005844	Ga0068862_100285677	Ga0068862_1002856773	137
739	3300005844	Ga0068862_100307596	Ga0068862_1003075963	137
740	3300005844	Ga0068862_100373725	Ga0068862_1003737253	137
741	3300005844	Ga0068862_100376849	Ga0068862_1003768493	137
742	3300005844	Ga0068862_100602739	Ga0068862_1006027392	137
743	3300005844	Ga0068862_100708775	Ga0068862_1007087751	137
744	3300005844	Ga0068862_100786398	Ga0068862_1007863983	137
745	3300005844	Ga0068862_101000856	Ga0068862_1010008562	137
746	3300005844	Ga0068862_101263335	Ga0068862_1012633352	137
747	3300005844	Ga0068862_101677384	Ga0068862_1016773841	137
748	3300005844	Ga0068862_102140090	Ga0068862_1021400902	137
749	3300005937	Ga0081455_10187912	Ga0081455_101879124	137
750	3300005981	Ga0081538_10023137	Ga0081538_100231374	137
751	3300005981	Ga0081538_10100108	Ga0081538_101001083	137
752	3300005981	Ga0081538_10106236	Ga0081538_101062363	137
753	3300005985	Ga0081539_10000142	Ga0081539_10000142100	137
754	3300005985	Ga0081539_10000215	Ga0081539_10000215147	137
755	3300005985	Ga0081539_10008426	Ga0081539_100084269	137
756	3300005985	Ga0081539_10087336	Ga0081539_100873364	137
757	3300006038	Ga0075365_10061774	Ga0075365_100617747	137
758	3300006038	Ga0075365_10862343	Ga0075365_108623432	137
759	3300006042	Ga0075368_10028530	Ga0075368_100285302	137
760	3300006042	Ga0075368_10048181	Ga0075368_100481813	137
761	3300006048	Ga0075363_100055304	Ga0075363_1000553044	137
762	3300006051	Ga0075364_10011798	Ga0075364_1001179813	137
763	3300006051	Ga0075364_10020392	Ga0075364_1002039211	137
764	3300006163	Ga0070715_10021656	Ga0070715_100216565	137
765	3300006173	Ga0070716_100161948	Ga0070716_1001619482	137
766	3300006173	Ga0070716_100202086	Ga0070716_1002020862	137
767	3300006175	Ga0070712_100125383	Ga0070712_1001253834	137
768	3300006177	Ga0075362_10000151	Ga0075362_1000015123	137
769	3300006177	Ga0075362_10423391	Ga0075362_104233912	137
770	3300006178	Ga0075367_10025104	Ga0075367_100251048	137
771	3300006178	Ga0075367_10037884	Ga0075367_100378848	137
772	3300006178	Ga0075367_10133790	Ga0075367_101337902	137
773	3300006186	Ga0075369_10261846	Ga0075369_102618462	137
774	3300006194	Ga0075427_10009752	Ga0075427_100097523	137
775	3300006195	Ga0075366_10150177	Ga0075366_101501772	137
776	3300006195	Ga0075366_10203786	Ga0075366_102037862	137
777	3300006237	Ga0097621_100061607	Ga0097621_1000616078	137
778	3300006237	Ga0097621_100334525	Ga0097621_1003345252	137
779	3300006237	Ga0097621_100520622	Ga0097621_1005206221	137
780	3300006353	Ga0075370_10002287	Ga0075370_1000228714	137
781	3300006358	Ga0068871_100163247	Ga0068871_1001632475	137
782	3300006358	Ga0068871_100304617	Ga0068871_1003046175	137
783	3300006358	Ga0068871_100386034	Ga0068871_1003860344	137
784	3300006358	Ga0068871_100775165	Ga0068871_1007751652	137
785	3300006844	Ga0075428_100000566	Ga0075428_10000056610	137
786	3300006844	Ga0075428_100002605	Ga0075428_1000026055	137
787	3300006844	Ga0075428_100007008	Ga0075428_10000700810	137
788	3300006844	Ga0075428_100010737	Ga0075428_10001073710	137
789	3300006844	Ga0075428_100027440	Ga0075428_1000274404	137
790	3300006844	Ga0075428_100049170	Ga0075428_10004917013	137
791	3300006844	Ga0075428_100064389	Ga0075428_1000643893	137
792	3300006844	Ga0075428_100118854	Ga0075428_1001188545	137
793	3300006844	Ga0075428_100173424	Ga0075428_1001734246	137
794	3300006844	Ga0075428_100194308	Ga0075428_1001943084	137
795	3300006844	Ga0075428_100403530	Ga0075428_1004035302	137
796	3300006844	Ga0075428_100436107	Ga0075428_1004361072	137
797	3300006844	Ga0075428_100452314	Ga0075428_1004523141	137
798	3300006844	Ga0075428_100489074	Ga0075428_1004890742	137
799	3300006844	Ga0075428_100513991	Ga0075428_1005139911	137
800	3300006844	Ga0075428_100537023	Ga0075428_1005370233	137
801	3300006844	Ga0075428_100699978	Ga0075428_1006999782	137
802	3300006846	Ga0075430_100002725	Ga0075430_10000272522	137
803	3300006846	Ga0075430_100003218	Ga0075430_10000321816	137
804	3300006846	Ga0075430_100004914	Ga0075430_10000491415	137
805	3300006846	Ga0075430_100006410	Ga0075430_10000641010	137
806	3300006846	Ga0075430_100075305	Ga0075430_1000753054	137
807	3300006846	Ga0075430_100099574	Ga0075430_1000995748	137
808	3300006846	Ga0075430_100154218	Ga0075430_1001542182	137
809	3300006846	Ga0075430_100155130	Ga0075430_1001551301	137
810	3300006846	Ga0075430_100276334	Ga0075430_1002763342	137
811	3300006846	Ga0075430_100343858	Ga0075430_1003438582	137
812	3300006846	Ga0075430_100350642	Ga0075430_1003506423	137
813	3300006846	Ga0075430_100520356	Ga0075430_1005203562	137
814	3300006846	Ga0075430_100813915	Ga0075430_1008139152	137
815	3300006847	Ga0075431_100002441	Ga0075431_10000244126	137
816	3300006847	Ga0075431_100003301	Ga0075431_10000330111	137
817	3300006847	Ga0075431_100004450	Ga0075431_1000044507	137
818	3300006847	Ga0075431_100009893	Ga0075431_10000989315	137
819	3300006847	Ga0075431_100012990	Ga0075431_10001299010	137
820	3300006847	Ga0075431_100028175	Ga0075431_1000281753	137
821	3300006847	Ga0075431_100153536	Ga0075431_1001535366	137
822	3300006847	Ga0075431_100281612	Ga0075431_1002816122	137
823	3300006847	Ga0075431_100428388	Ga0075431_1004283884	137
824	3300006847	Ga0075431_100475015	Ga0075431_1004750152	137
825	3300006847	Ga0075431_100672136	Ga0075431_1006721362	137
826	3300006852	Ga0075433_10007511	Ga0075433_1000751113	137
827	3300006852	Ga0075433_10013793	Ga0075433_1001379311	137
828	3300006852	Ga0075433_10024037	Ga0075433_1002403710	137
829	3300006852	Ga0075433_10024217	Ga0075433_100242175	137
830	3300006852	Ga0075433_10030541	Ga0075433_100305413	137
831	3300006852	Ga0075433_10091008	Ga0075433_100910085	137
832	3300006852	Ga0075433_10176190	Ga0075433_101761903	137
833	3300006852	Ga0075433_10204888	Ga0075433_102048884	137
834	3300006852	Ga0075433_10210789	Ga0075433_102107892	137
835	3300006852	Ga0075433_10213496	Ga0075433_102134963	137
836	3300006852	Ga0075433_10238467	Ga0075433_102384672	137
837	3300006852	Ga0075433_10306080	Ga0075433_103060802	137
838	3300006852	Ga0075433_10394217	Ga0075433_103942172	137
839	3300006852	Ga0075433_10514921	Ga0075433_105149213	137
840	3300006852	Ga0075433_10643640	Ga0075433_106436403	137
841	3300006852	Ga0075433_11045139	Ga0075433_110451392	137
842	3300006852	Ga0075433_11286271	Ga0075433_112862711	137
843	3300006871	Ga0075434_100009524	Ga0075434_10000952410	137
844	3300006871	Ga0075434_100016140	Ga0075434_1000161406	137
845	3300006871	Ga0075434_100030809	Ga0075434_1000308093	137
846	3300006871	Ga0075434_100033716	Ga0075434_1000337162	137
847	3300006871	Ga0075434_100038827	Ga0075434_1000388275	137
848	3300006871	Ga0075434_100067995	Ga0075434_1000679955	137
849	3300006871	Ga0075434_100085770	Ga0075434_1000857703	137
850	3300006871	Ga0075434_100306797	Ga0075434_1003067974	137
851	3300006871	Ga0075434_100349972	Ga0075434_1003499722	137
852	3300006871	Ga0075434_100358465	Ga0075434_1003584652	137
853	3300006871	Ga0075434_100396450	Ga0075434_1003964502	137
854	3300006871	Ga0075434_100437207	Ga0075434_1004372073	137
855	3300006871	Ga0075434_100452233	Ga0075434_1004522333	137
856	3300006871	Ga0075434_100568330	Ga0075434_1005683302	137
857	3300006871	Ga0075434_100589679	Ga0075434_1005896792	137
858	3300006871	Ga0075434_100905825	Ga0075434_1009058252	137
859	3300006871	Ga0075434_102564037	Ga0075434_1025640371	137
860	3300006880	Ga0075429_100018802	Ga0075429_10001880214	137
861	3300006880	Ga0075429_100054473	Ga0075429_1000544736	137
862	3300006880	Ga0075429_100062865	Ga0075429_1000628656	137
863	3300006880	Ga0075429_100093487	Ga0075429_1000934873	137
864	3300006880	Ga0075429_100116433	Ga0075429_1001164334	137
865	3300006880	Ga0075429_100144837	Ga0075429_1001448373	137
866	3300006880	Ga0075429_100147076	Ga0075429_1001470762	137
867	3300006880	Ga0075429_100365663	Ga0075429_1003656631	137
868	3300006880	Ga0075429_100770859	Ga0075429_1007708592	137
869	3300006880	Ga0075429_101185903	Ga0075429_1011859032	137
870	3300006880	Ga0075429_101195734	Ga0075429_1011957342	137
871	3300006880	Ga0075429_101397282	Ga0075429_1013972822	137
872	3300006881	Ga0068865_100072643	Ga0068865_1000726432	137
873	3300006881	Ga0068865_100096329	Ga0068865_1000963292	137
874	3300006881	Ga0068865_100372500	Ga0068865_1003725004	137
875	3300006881	Ga0068865_100506211	Ga0068865_1005062111	137
876	3300006881	Ga0068865_100766760	Ga0068865_1007667601	137
877	3300006881	Ga0068865_101210459	Ga0068865_1012104592	137
878	3300006881	Ga0068865_101379911	Ga0068865_1013799111	137
879	3300006914	Ga0075436_100007542	Ga0075436_1000075427	137
880	3300006914	Ga0075436_100123774	Ga0075436_1001237745	137
881	3300006914	Ga0075436_100169094	Ga0075436_1001690942	137
882	3300006914	Ga0075436_100197606	Ga0075436_1001976061	137
883	3300006914	Ga0075436_100322150	Ga0075436_1003221502	137
884	3300006914	Ga0075436_100439546	Ga0075436_1004395462	137
885	3300006914	Ga0075436_100629770	Ga0075436_1006297702	137
886	3300006914	Ga0075436_100655287	Ga0075436_1006552872	137
887	3300006914	Ga0075436_101070217	Ga0075436_1010702171	137
888	3300006931	Ga0097620_100030709	Ga0097620_1000307099	137
889	3300006931	Ga0097620_100039358	Ga0097620_1000393587	137
890	3300006931	Ga0097620_100070611	Ga0097620_1000706113	137
891	3300006931	Ga0097620_100071027	Ga0097620_1000710279	137
892	3300006931	Ga0097620_100139216	Ga0097620_1001392166	137
893	3300006931	Ga0097620_100172589	Ga0097620_1001725892	137
894	3300006931	Ga0097620_100195224	Ga0097620_1001952246	137
895	3300006931	Ga0097620_100227692	Ga0097620_1002276921	137
896	3300006931	Ga0097620_100308693	Ga0097620_1003086932	137
897	3300006931	Ga0097620_100381560	Ga0097620_1003815602	137
898	3300006931	Ga0097620_100390320	Ga0097620_1003903204	137
899	3300006931	Ga0097620_100685649	Ga0097620_1006856492	137
900	3300006931	Ga0097620_100733586	Ga0097620_1007335861	137
901	3300006931	Ga0097620_100954339	Ga0097620_1009543392	137
902	3300006931	Ga0097620_101070432	Ga0097620_1010704322	137
903	3300006931	Ga0097620_101199910	Ga0097620_1011999102	137
904	3300006931	Ga0097620_101860020	Ga0097620_1018600201	137
905	3300007076	Ga0075435_100001248	Ga0075435_10000124822	137
906	3300007076	Ga0075435_100038256	Ga0075435_1000382564	137
907	3300007076	Ga0075435_100052049	Ga0075435_1000520497	137
908	3300007076	Ga0075435_100061897	Ga0075435_1000618975	137
909	3300007076	Ga0075435_100088000	Ga0075435_1000880003	137
910	3300007076	Ga0075435_100232786	Ga0075435_1002327863	137
911	3300007076	Ga0075435_100234216	Ga0075435_1002342164	137
912	3300007076	Ga0075435_100262885	Ga0075435_1002628854	137
913	3300007076	Ga0075435_100292354	Ga0075435_1002923544	137
914	3300007076	Ga0075435_100432121	Ga0075435_1004321214	137
915	3300009011	Ga0105251_10177393	Ga0105251_101773932	137
916	3300009036	Ga0105244_10260690	Ga0105244_102606902	137
917	3300009093	Ga0105240_10178231	Ga0105240_101782313	137
918	3300009093	Ga0105240_10683234	Ga0105240_106832342	137
919	3300009093	Ga0105240_10780130	Ga0105240_107801302	137
920	3300009094	Ga0111539_10000614	Ga0111539_100006143	137
921	3300009094	Ga0111539_10006016	Ga0111539_1000601622	137
922	3300009094	Ga0111539_10011587	Ga0111539_1001158710	137
923	3300009094	Ga0111539_10021054	Ga0111539_1002105410	137
924	3300009094	Ga0111539_10076195	Ga0111539_100761952	137
925	3300009094	Ga0111539_10123506	Ga0111539_101235064	137
926	3300009094	Ga0111539_10259954	Ga0111539_102599543	137
927	3300009094	Ga0111539_10288238	Ga0111539_102882382	137
928	3300009094	Ga0111539_10313287	Ga0111539_103132872	137
929	3300009094	Ga0111539_10575367	Ga0111539_105753672	137
930	3300009094	Ga0111539_10715130	Ga0111539_107151302	137
931	3300009094	Ga0111539_10975665	Ga0111539_109756653	137
932	3300009094	Ga0111539_11095039	Ga0111539_110950393	137
933	3300009094	Ga0111539_11247384	Ga0111539_112473842	137
934	3300009094	Ga0111539_11534647	Ga0111539_115346472	137
935	3300009094	Ga0111539_11819829	Ga0111539_118198291	137
936	3300009094	Ga0111539_12021354	Ga0111539_120213542	137
937	3300009098	Ga0105245_10368669	Ga0105245_103686693	137
938	3300009098	Ga0105245_10660745	Ga0105245_106607451	137
939	3300009098	Ga0105245_11200888	Ga0105245_112008882	137
940	3300009101	Ga0105247_10256343	Ga0105247_102563433	137
941	3300009101	Ga0105247_10520229	Ga0105247_105202292	137
942	3300009101	Ga0105247_10564523	Ga0105247_105645231	137
943	3300009147	Ga0114129_10003061	Ga0114129_1000306129	137
944	3300009147	Ga0114129_10003419	Ga0114129_1000341916	137
945	3300009147	Ga0114129_10005741	Ga0114129_100057414	137
946	3300009147	Ga0114129_10006820	Ga0114129_1000682011	137
947	3300009147	Ga0114129_10030705	Ga0114129_100307057	137
948	3300009147	Ga0114129_10052031	Ga0114129_1005203110	137
949	3300009147	Ga0114129_10060469	Ga0114129_100604693	137
950	3300009147	Ga0114129_10100800	Ga0114129_101008004	137
951	3300009147	Ga0114129_10132015	Ga0114129_101320153	137
952	3300009147	Ga0114129_10143266	Ga0114129_101432665	137
953	3300009147	Ga0114129_10222063	Ga0114129_102220637	137
954	3300009147	Ga0114129_10371994	Ga0114129_103719945	137
955	3300009147	Ga0114129_10423156	Ga0114129_104231563	137
956	3300009147	Ga0114129_10578807	Ga0114129_105788074	137
957	3300009147	Ga0114129_10939193	Ga0114129_109391932	137
958	3300009147	Ga0114129_11172131	Ga0114129_111721313	137
959	3300009147	Ga0114129_11236120	Ga0114129_112361201	137
960	3300009147	Ga0114129_11319173	Ga0114129_113191731	137
961	3300009147	Ga0114129_11361528	Ga0114129_113615281	137
962	3300009148	Ga0105243_10006180	Ga0105243_1000618019	137
963	3300009148	Ga0105243_10234408	Ga0105243_102344085	137
964	3300009148	Ga0105243_10329934	Ga0105243_103299342	137
965	3300009148	Ga0105243_12412617	Ga0105243_124126171	137
966	3300009148	Ga0105243_12765143	Ga0105243_127651431	137
967	3300009174	Ga0105241_10271497	Ga0105241_102714974	137
968	3300009176	Ga0105242_10014946	Ga0105242_100149465	137
969	3300009176	Ga0105242_10029189	Ga0105242_100291894	137
970	3300009176	Ga0105242_10058432	Ga0105242_100584325	137
971	3300009176	Ga0105242_10762906	Ga0105242_107629062	137
972	3300009176	Ga0105242_12588846	Ga0105242_125888462	137
973	3300009177	Ga0105248_10065465	Ga0105248_100654654	137
974	3300009177	Ga0105248_10143509	Ga0105248_101435092	137
975	3300009177	Ga0105248_10331624	Ga0105248_103316241	137
976	3300009177	Ga0105248_10344128	Ga0105248_103441284	137
977	3300009177	Ga0105248_10653673	Ga0105248_106536732	137
978	3300009177	Ga0105248_10861921	Ga0105248_108619212	137
979	3300009177	Ga0105248_11254111	Ga0105248_112541112	137
980	3300009177	Ga0105248_11897962	Ga0105248_118979621	137
981	3300009177	Ga0105248_12078233	Ga0105248_120782331	137
982	3300009551	Ga0105238_10053916	Ga0105238_100539165	137
983	3300009551	Ga0105238_10103389	Ga0105238_101033896	137
984	3300009551	Ga0105238_10725634	Ga0105238_107256343	137
985	3300009553	Ga0105249_10000649	Ga0105249_1000064935	137
986	3300009553	Ga0105249_10002497	Ga0105249_100024977	137
987	3300009553	Ga0105249_10025833	Ga0105249_1002583313	137
988	3300009553	Ga0105249_10569614	Ga0105249_105696144	137
989	3300009553	Ga0105249_10690255	Ga0105249_106902554	137
990	3300009553	Ga0105249_10733762	Ga0105249_107337623	137
991	3300010375	Ga0105239_10079317	Ga0105239_100793172	137
992	3300010375	Ga0105239_10153814	Ga0105239_101538145	137
993	3300011119	Ga0105246_10174956	Ga0105246_101749562	137
994	3300011119	Ga0105246_10614020	Ga0105246_106140202	137
995	3300011119	Ga0105246_11006846	Ga0105246_110068461	137
996	3300011119	Ga0105246_11092992	Ga0105246_110929921	137
997	3300011119	Ga0105246_11208128	Ga0105246_112081282	137
998	3300011119	Ga0105246_12037453	Ga0105246_120374531	137
999	3300012485	Ga0157325_1014527	Ga0157325_10145271	137
1000	3300012495	Ga0157323_1030687	Ga0157323_10306871	137
1001	3300012497	Ga0157319_1035575	Ga0157319_10355751	137
1002	3300012498	Ga0157345_1012946	Ga0157345_10129462	137
1003	3300012502	Ga0157347_1053497	Ga0157347_10534972	137
1004	3300012507	Ga0157342_1081281	Ga0157342_10812811	137
1005	3300012510	Ga0157316_1058579	Ga0157316_10585792	137
1006	3300012512	Ga0157327_1053265	Ga0157327_10532651	137
1007	3300013102	Ga0157371_10050789	Ga0157371_100507891	137
1008	3300013102	Ga0157371_10321212	Ga0157371_103212121	137
1009	3300013104	Ga0157370_10302698	Ga0157370_103026981	137
1010	3300013296	Ga0157374_10134617	Ga0157374_101346175	137
1011	3300013296	Ga0157374_10224972	Ga0157374_102249722	137
1012	3300013296	Ga0157374_10814654	Ga0157374_108146542	137
1013	3300013297	Ga0157378_10025148	Ga0157378_100251483	137
1014	3300013297	Ga0157378_10466873	Ga0157378_104668732	137
1015	3300013306	Ga0163162_10007697	Ga0163162_1000769710	137
1016	3300013306	Ga0163162_10292861	Ga0163162_102928611	137
1017	3300013306	Ga0163162_10498301	Ga0163162_104983014	137
1018	3300013306	Ga0163162_10630461	Ga0163162_106304612	137
1019	3300013306	Ga0163162_10751533	Ga0163162_107515333	137
1020	3300013306	Ga0163162_10819894	Ga0163162_108198942	137
1021	3300013306	Ga0163162_11040928	Ga0163162_110409283	137
1022	3300013307	Ga0157372_10225199	Ga0157372_102251993	137
1023	3300013307	Ga0157372_12484135	Ga0157372_124841352	137
1024	3300013308	Ga0157375_10044727	Ga0157375_100447272	137
1025	3300013308	Ga0157375_10045218	Ga0157375_100452188	137
1026	3300013308	Ga0157375_10051620	Ga0157375_100516202	137
1027	3300013308	Ga0157375_10107477	Ga0157375_101074774	137
1028	3300013308	Ga0157375_10156849	Ga0157375_101568494	137
1029	3300013308	Ga0157375_10276823	Ga0157375_102768233	137
1030	3300013308	Ga0157375_11380368	Ga0157375_113803682	137
1031	3300014325	Ga0163163_10036710	Ga0163163_100367107	137
1032	3300014325	Ga0163163_10061025	Ga0163163_100610259	137
1033	3300014325	Ga0163163_10109877	Ga0163163_101098773	137
1034	3300014325	Ga0163163_10177602	Ga0163163_101776026	137
1035	3300014325	Ga0163163_10315689	Ga0163163_103156893	137
1036	3300014325	Ga0163163_10434636	Ga0163163_104346361	137
1037	3300014325	Ga0163163_10788662	Ga0163163_107886622	137
1038	3300014325	Ga0163163_10883415	Ga0163163_108834152	137
1039	3300014325	Ga0163163_10914884	Ga0163163_109148842	137
1040	3300014326	Ga0157380_10002789	Ga0157380_1000278917	137
1041	3300014326	Ga0157380_10053387	Ga0157380_100533878	137
1042	3300014326	Ga0157380_10112969	Ga0157380_101129693	137
1043	3300014326	Ga0157380_10177040	Ga0157380_101770402	137
1044	3300014326	Ga0157380_10444770	Ga0157380_104447704	137
1045	3300014326	Ga0157380_10517016	Ga0157380_105170162	137
1046	3300014326	Ga0157380_10787571	Ga0157380_107875712	137
1047	3300014326	Ga0157380_11113413	Ga0157380_111134131	137
1048	3300014326	Ga0157380_11864838	Ga0157380_118648382	137
1049	3300014745	Ga0157377_10039918	Ga0157377_100399184	137
1050	3300014745	Ga0157377_10055085	Ga0157377_100550852	137
1051	3300014745	Ga0157377_10207215	Ga0157377_102072153	137
1052	3300014745	Ga0157377_10422401	Ga0157377_104224012	137
1053	3300014745	Ga0157377_10870080	Ga0157377_108700801	137
1054	3300014968	Ga0157379_11239732	Ga0157379_112397322	137
1055	3300014969	Ga0157376_10161410	Ga0157376_101614102	137
1056	3300014969	Ga0157376_10217700	Ga0157376_102177002	137
1057	3300014969	Ga0157376_10230233	Ga0157376_102302332	137
1058	3300014969	Ga0157376_10505455	Ga0157376_105054552	137
1059	3300017792	Ga0163161_10031310	Ga0163161_100313102	137
1060	3300017792	Ga0163161_10452575	Ga0163161_104525751	137
1061	3300017792	Ga0163161_10854725	Ga0163161_108547251	137
1062	3300020070	Ga0206356_10914771	Ga0206356_109147713	137
1063	3300020070	Ga0206356_10939425	Ga0206356_109394255	137
1064	3300021358	Ga0213873_10179727	Ga0213873_101797272	137
1065	3300021384	Ga0213876_10160465	Ga0213876_101604652	137
1066	3300024227	Ga0228598_1003784	Ga0228598_10037846	137
1067	3300025315	Ga0207697_10002633	Ga0207697_1000263314	137
1068	3300025315	Ga0207697_10137265	Ga0207697_101372652	137
1069	3300025321	Ga0207656_10443497	Ga0207656_104434971	137
1070	3300025885	Ga0207653_10000020	Ga0207653_1000002010	137
1071	3300025885	Ga0207653_10003065	Ga0207653_1000306511	137
1072	3300025885	Ga0207653_10058910	Ga0207653_100589103	137
1073	3300025893	Ga0207682_10008298	Ga0207682_100082984	137
1074	3300025893	Ga0207682_10017127	Ga0207682_100171273	137
1075	3300025893	Ga0207682_10028142	Ga0207682_100281423	137
1076	3300025893	Ga0207682_10084994	Ga0207682_100849945	137
1077	3300025893	Ga0207682_10092952	Ga0207682_100929522	137
1078	3300025893	Ga0207682_10138084	Ga0207682_101380844	137
1079	3300025893	Ga0207682_10558215	Ga0207682_105582151	137
1080	3300025899	Ga0207642_10132105	Ga0207642_101321052	137
1081	3300025899	Ga0207642_10139870	Ga0207642_101398704	137
1082	3300025900	Ga0207710_10063272	Ga0207710_100632725	137
1083	3300025901	Ga0207688_10046323	Ga0207688_100463233	137
1084	3300025901	Ga0207688_10061089	Ga0207688_100610895	137
1085	3300025901	Ga0207688_10169875	Ga0207688_101698753	137
1086	3300025901	Ga0207688_10253674	Ga0207688_102536742	137
1087	3300025901	Ga0207688_10380690	Ga0207688_103806901	137
1088	3300025901	Ga0207688_10428788	Ga0207688_104287882	137
1089	3300025901	Ga0207688_10713083	Ga0207688_107130832	137
1090	3300025903	Ga0207680_10027842	Ga0207680_100278425	137
1091	3300025903	Ga0207680_10090511	Ga0207680_100905111	137
1092	3300025903	Ga0207680_10101925	Ga0207680_101019253	137
1093	3300025903	Ga0207680_10129180	Ga0207680_101291802	137
1094	3300025903	Ga0207680_10327868	Ga0207680_103278682	137
1095	3300025903	Ga0207680_10456743	Ga0207680_104567432	137
1096	3300025903	Ga0207680_10669146	Ga0207680_106691461	137
1097	3300025903	Ga0207680_11187289	Ga0207680_111872891	137
1098	3300025904	Ga0207647_10266630	Ga0207647_102666302	137
1099	3300025905	Ga0207685_10793014	Ga0207685_107930141	137
1100	3300025906	Ga0207699_10000005	Ga0207699_1000000510	137
1101	3300025906	Ga0207699_10904236	Ga0207699_109042361	137
1102	3300025907	Ga0207645_10006334	Ga0207645_1000633414	137
1103	3300025907	Ga0207645_10012143	Ga0207645_100121433	137
1104	3300025907	Ga0207645_10063739	Ga0207645_100637397	137
1105	3300025907	Ga0207645_10080833	Ga0207645_100808332	137
1106	3300025907	Ga0207645_10242480	Ga0207645_102424804	137
1107	3300025907	Ga0207645_10253266	Ga0207645_102532661	137
1108	3300025907	Ga0207645_10299319	Ga0207645_102993192	137
1109	3300025907	Ga0207645_10423609	Ga0207645_104236092	137
1110	3300025907	Ga0207645_10782721	Ga0207645_107827212	137
1111	3300025908	Ga0207643_10000779	Ga0207643_1000077924	137
1112	3300025908	Ga0207643_10006374	Ga0207643_100063745	137
1113	3300025908	Ga0207643_10042159	Ga0207643_100421595	137
1114	3300025908	Ga0207643_10068954	Ga0207643_100689542	137
1115	3300025908	Ga0207643_10141311	Ga0207643_101413112	137
1116	3300025908	Ga0207643_10198150	Ga0207643_101981501	137
1117	3300025908	Ga0207643_10583022	Ga0207643_105830222	137
1118	3300025909	Ga0207705_10077070	Ga0207705_100770704	137
1119	3300025909	Ga0207705_10169490	Ga0207705_101694902	137
1120	3300025910	Ga0207684_10002118	Ga0207684_1000211810	137
1121	3300025912	Ga0207707_10119584	Ga0207707_101195843	137
1122	3300025912	Ga0207707_10120094	Ga0207707_101200945	137
1123	3300025912	Ga0207707_10183733	Ga0207707_101837332	137
1124	3300025912	Ga0207707_10365260	Ga0207707_103652602	137
1125	3300025913	Ga0207695_10040376	Ga0207695_100403765	137
1126	3300025913	Ga0207695_10210572	Ga0207695_102105725	137
1127	3300025913	Ga0207695_10503998	Ga0207695_105039982	137
1128	3300025913	Ga0207695_11221457	Ga0207695_112214572	137
1129	3300025915	Ga0207693_10069369	Ga0207693_100693696	137
1130	3300025915	Ga0207693_10518997	Ga0207693_105189972	137
1131	3300025916	Ga0207663_10000004	Ga0207663_10000004107	137
1132	3300025916	Ga0207663_10184293	Ga0207663_101842932	137
1133	3300025916	Ga0207663_10375903	Ga0207663_103759032	137
1134	3300025917	Ga0207660_10004571	Ga0207660_1000457112	137
1135	3300025917	Ga0207660_10102981	Ga0207660_101029814	137
1136	3300025917	Ga0207660_10135373	Ga0207660_101353734	137
1137	3300025917	Ga0207660_10256799	Ga0207660_102567993	137
1138	3300025917	Ga0207660_10328546	Ga0207660_103285463	137
1139	3300025917	Ga0207660_10771626	Ga0207660_107716262	137
1140	3300025917	Ga0207660_10897020	Ga0207660_108970201	137
1141	3300025917	Ga0207660_10917798	Ga0207660_109177981	137
1142	3300025917	Ga0207660_11009058	Ga0207660_110090582	137
1143	3300025917	Ga0207660_11152441	Ga0207660_111524411	137
1144	3300025918	Ga0207662_10000335	Ga0207662_1000033525	137
1145	3300025918	Ga0207662_10009410	Ga0207662_1000941010	137
1146	3300025918	Ga0207662_10065399	Ga0207662_100653992	137
1147	3300025918	Ga0207662_10294590	Ga0207662_102945902	137
1148	3300025918	Ga0207662_10312092	Ga0207662_103120924	137
1149	3300025918	Ga0207662_10353729	Ga0207662_103537293	137
1150	3300025918	Ga0207662_10409397	Ga0207662_104093972	137
1151	3300025918	Ga0207662_10562252	Ga0207662_105622523	137
1152	3300025918	Ga0207662_10669911	Ga0207662_106699111	137
1153	3300025919	Ga0207657_10183924	Ga0207657_101839242	137
1154	3300025919	Ga0207657_10198341	Ga0207657_101983414	137
1155	3300025919	Ga0207657_10418946	Ga0207657_104189462	137
1156	3300025920	Ga0207649_10028632	Ga0207649_100286321	137
1157	3300025920	Ga0207649_10039974	Ga0207649_100399742	137
1158	3300025920	Ga0207649_10179989	Ga0207649_101799893	137
1159	3300025920	Ga0207649_10185756	Ga0207649_101857561	137
1160	3300025920	Ga0207649_10196805	Ga0207649_101968052	137
1161	3300025920	Ga0207649_10228804	Ga0207649_102288042	137
1162	3300025920	Ga0207649_10604529	Ga0207649_106045293	137
1163	3300025920	Ga0207649_11024424	Ga0207649_110244241	137
1164	3300025920	Ga0207649_11038449	Ga0207649_110384492	137
1165	3300025920	Ga0207649_11082517	Ga0207649_110825171	137
1166	3300025921	Ga0207652_10160557	Ga0207652_101605572	137
1167	3300025921	Ga0207652_10485791	Ga0207652_104857913	137
1168	3300025922	Ga0207646_10132101	Ga0207646_101321014	137
1169	3300025922	Ga0207646_10147634	Ga0207646_101476345	137
1170	3300025922	Ga0207646_10174045	Ga0207646_101740452	137
1171	3300025922	Ga0207646_10492891	Ga0207646_104928912	137
1172	3300025922	Ga0207646_10495446	Ga0207646_104954462	137
1173	3300025922	Ga0207646_10757785	Ga0207646_107577851	137
1174	3300025923	Ga0207681_10009786	Ga0207681_100097867	137
1175	3300025923	Ga0207681_10034313	Ga0207681_100343134	137
1176	3300025923	Ga0207681_10047830	Ga0207681_100478306	137
1177	3300025923	Ga0207681_10067799	Ga0207681_100677994	137
1178	3300025923	Ga0207681_10123765	Ga0207681_101237652	137
1179	3300025923	Ga0207681_10143052	Ga0207681_101430523	137
1180	3300025923	Ga0207681_10192437	Ga0207681_101924372	137
1181	3300025923	Ga0207681_10214659	Ga0207681_102146591	137
1182	3300025923	Ga0207681_10231770	Ga0207681_102317703	137
1183	3300025923	Ga0207681_10284469	Ga0207681_102844694	137
1184	3300025923	Ga0207681_10336160	Ga0207681_103361603	137
1185	3300025923	Ga0207681_10640869	Ga0207681_106408691	137
1186	3300025923	Ga0207681_10791063	Ga0207681_107910632	137
1187	3300025924	Ga0207694_10140080	Ga0207694_101400803	137
1188	3300025924	Ga0207694_10159080	Ga0207694_101590801	137
1189	3300025925	Ga0207650_10010669	Ga0207650_100106695	137
1190	3300025925	Ga0207650_10016401	Ga0207650_100164012	137
1191	3300025925	Ga0207650_10022979	Ga0207650_100229796	137
1192	3300025925	Ga0207650_10024938	Ga0207650_100249385	137
1193	3300025925	Ga0207650_10075717	Ga0207650_100757174	137
1194	3300025925	Ga0207650_10086165	Ga0207650_100861652	137
1195	3300025925	Ga0207650_10100318	Ga0207650_101003186	137
1196	3300025925	Ga0207650_10422818	Ga0207650_104228183	137
1197	3300025925	Ga0207650_10815409	Ga0207650_108154091	137
1198	3300025926	Ga0207659_10003579	Ga0207659_100035793	137
1199	3300025926	Ga0207659_10008566	Ga0207659_1000856610	137
1200	3300025926	Ga0207659_10023137	Ga0207659_100231373	137
1201	3300025926	Ga0207659_10027677	Ga0207659_100276772	137
1202	3300025926	Ga0207659_10029153	Ga0207659_1002915310	137
1203	3300025926	Ga0207659_10090843	Ga0207659_100908434	137
1204	3300025926	Ga0207659_10114608	Ga0207659_101146083	137
1205	3300025926	Ga0207659_10115175	Ga0207659_101151756	137
1206	3300025926	Ga0207659_10150800	Ga0207659_101508003	137
1207	3300025926	Ga0207659_10376511	Ga0207659_103765111	137
1208	3300025926	Ga0207659_10380934	Ga0207659_103809341	137
1209	3300025926	Ga0207659_10475327	Ga0207659_104753271	137
1210	3300025926	Ga0207659_10537761	Ga0207659_105377612	137
1211	3300025926	Ga0207659_10544234	Ga0207659_105442343	137
1212	3300025926	Ga0207659_10774895	Ga0207659_107748951	137
1213	3300025926	Ga0207659_10923320	Ga0207659_109233202	137
1214	3300025926	Ga0207659_10990134	Ga0207659_109901342	137
1215	3300025926	Ga0207659_11146093	Ga0207659_111460931	137
1216	3300025927	Ga0207687_10126534	Ga0207687_101265344	137
1217	3300025928	Ga0207700_10037805	Ga0207700_100378055	137
1218	3300025928	Ga0207700_10675348	Ga0207700_106753482	137
1219	3300025928	Ga0207700_11436488	Ga0207700_114364881	137
1220	3300025929	Ga0207664_10066125	Ga0207664_100661257	137
1221	3300025929	Ga0207664_10100654	Ga0207664_101006542	137
1222	3300025929	Ga0207664_10175750	Ga0207664_101757501	137
1223	3300025929	Ga0207664_10325900	Ga0207664_103259003	137
1224	3300025929	Ga0207664_11653575	Ga0207664_116535751	137
1225	3300025931	Ga0207644_10007454	Ga0207644_100074549	137
1226	3300025931	Ga0207644_10072145	Ga0207644_100721456	137
1227	3300025931	Ga0207644_10284978	Ga0207644_102849782	137
1228	3300025931	Ga0207644_10341910	Ga0207644_103419102	137
1229	3300025931	Ga0207644_10430477	Ga0207644_104304772	137
1230	3300025931	Ga0207644_10483362	Ga0207644_104833622	137
1231	3300025931	Ga0207644_10737492	Ga0207644_107374921	137
1232	3300025932	Ga0207690_10112581	Ga0207690_101125814	137
1233	3300025932	Ga0207690_10135978	Ga0207690_101359785	137
1234	3300025932	Ga0207690_10239893	Ga0207690_102398931	137
1235	3300025932	Ga0207690_10584907	Ga0207690_105849072	137
1236	3300025932	Ga0207690_10964234	Ga0207690_109642341	137
1237	3300025932	Ga0207690_11707456	Ga0207690_117074561	137
1238	3300025933	Ga0207706_10003002	Ga0207706_100030024	137
1239	3300025933	Ga0207706_10037518	Ga0207706_1003751810	137
1240	3300025933	Ga0207706_10064695	Ga0207706_100646957	137
1241	3300025933	Ga0207706_10482630	Ga0207706_104826303	137
1242	3300025933	Ga0207706_10651523	Ga0207706_106515233	137
1243	3300025933	Ga0207706_10699068	Ga0207706_106990682	137
1244	3300025934	Ga0207686_10010449	Ga0207686_100104496	137
1245	3300025934	Ga0207686_10026045	Ga0207686_100260452	137
1246	3300025934	Ga0207686_10027262	Ga0207686_100272624	137
1247	3300025934	Ga0207686_10159670	Ga0207686_101596705	137
1248	3300025935	Ga0207709_10327471	Ga0207709_103274712	137
1249	3300025935	Ga0207709_10789689	Ga0207709_107896892	137
1250	3300025936	Ga0207670_10026265	Ga0207670_100262651	137
1251	3300025936	Ga0207670_10028280	Ga0207670_100282807	137
1252	3300025936	Ga0207670_10086373	Ga0207670_100863732	137
1253	3300025936	Ga0207670_10087202	Ga0207670_100872024	137
1254	3300025936	Ga0207670_10106205	Ga0207670_101062054	137
1255	3300025936	Ga0207670_10198665	Ga0207670_101986652	137
1256	3300025936	Ga0207670_10286127	Ga0207670_102861274	137
1257	3300025936	Ga0207670_10319200	Ga0207670_103192002	137
1258	3300025936	Ga0207670_10358215	Ga0207670_103582151	137
1259	3300025936	Ga0207670_10694258	Ga0207670_106942582	137
1260	3300025936	Ga0207670_10911558	Ga0207670_109115582	137
1261	3300025936	Ga0207670_11639169	Ga0207670_116391692	137
1262	3300025937	Ga0207669_10003495	Ga0207669_100034957	137
1263	3300025937	Ga0207669_10048671	Ga0207669_100486716	137
1264	3300025937	Ga0207669_10133303	Ga0207669_101333034	137
1265	3300025937	Ga0207669_10179988	Ga0207669_101799882	137
1266	3300025937	Ga0207669_10237094	Ga0207669_102370944	137
1267	3300025937	Ga0207669_10274842	Ga0207669_102748422	137
1268	3300025937	Ga0207669_10348386	Ga0207669_103483862	137
1269	3300025937	Ga0207669_10513024	Ga0207669_105130241	137
1270	3300025937	Ga0207669_10644678	Ga0207669_106446781	137
1271	3300025938	Ga0207704_10001666	Ga0207704_100016668	137
1272	3300025938	Ga0207704_10107540	Ga0207704_101075403	137
1273	3300025938	Ga0207704_10498661	Ga0207704_104986613	137
1274	3300025938	Ga0207704_10660017	Ga0207704_106600172	137
1275	3300025938	Ga0207704_10775946	Ga0207704_107759461	137
1276	3300025938	Ga0207704_10884045	Ga0207704_108840452	137
1277	3300025939	Ga0207665_10040897	Ga0207665_100408975	137
1278	3300025939	Ga0207665_10046383	Ga0207665_100463832	137
1279	3300025939	Ga0207665_10152209	Ga0207665_101522092	137
1280	3300025940	Ga0207691_10008380	Ga0207691_1000838014	137
1281	3300025940	Ga0207691_10016722	Ga0207691_1001672214	137
1282	3300025940	Ga0207691_10018907	Ga0207691_1001890714	137
1283	3300025940	Ga0207691_10025426	Ga0207691_100254269	137
1284	3300025940	Ga0207691_10053434	Ga0207691_100534348	137
1285	3300025940	Ga0207691_10069317	Ga0207691_100693172	137
1286	3300025940	Ga0207691_10158771	Ga0207691_101587711	137
1287	3300025940	Ga0207691_10210746	Ga0207691_102107462	137
1288	3300025940	Ga0207691_10257099	Ga0207691_102570993	137
1289	3300025940	Ga0207691_10406402	Ga0207691_104064022	137
1290	3300025940	Ga0207691_10429646	Ga0207691_104296463	137
1291	3300025940	Ga0207691_10457143	Ga0207691_104571433	137
1292	3300025941	Ga0207711_10024917	Ga0207711_1002491713	137
1293	3300025941	Ga0207711_10211221	Ga0207711_102112212	137
1294	3300025941	Ga0207711_10352669	Ga0207711_103526694	137
1295	3300025941	Ga0207711_10714152	Ga0207711_107141523	137
1296	3300025941	Ga0207711_10869624	Ga0207711_108696242	137
1297	3300025941	Ga0207711_10918938	Ga0207711_109189381	137
1298	3300025941	Ga0207711_11194212	Ga0207711_111942121	137
1299	3300025942	Ga0207689_10003297	Ga0207689_1000329721	137
1300	3300025942	Ga0207689_10038286	Ga0207689_100382861	137
1301	3300025942	Ga0207689_10058878	Ga0207689_100588786	137
1302	3300025942	Ga0207689_10106439	Ga0207689_101064394	137
1303	3300025942	Ga0207689_10124470	Ga0207689_101244704	137
1304	3300025942	Ga0207689_10132836	Ga0207689_101328362	137
1305	3300025942	Ga0207689_10215724	Ga0207689_102157244	137
1306	3300025942	Ga0207689_10297295	Ga0207689_102972954	137
1307	3300025942	Ga0207689_10364038	Ga0207689_103640382	137
1308	3300025942	Ga0207689_10436867	Ga0207689_104368674	137
1309	3300025944	Ga0207661_10090383	Ga0207661_100903836	137
1310	3300025944	Ga0207661_10190576	Ga0207661_101905763	137
1311	3300025944	Ga0207661_11950275	Ga0207661_119502751	137
1312	3300025945	Ga0207679_10001422	Ga0207679_1000142210	137
1313	3300025945	Ga0207679_10011160	Ga0207679_1001116010	137
1314	3300025945	Ga0207679_10074479	Ga0207679_100744795	137
1315	3300025945	Ga0207679_10112193	Ga0207679_101121934	137
1316	3300025945	Ga0207679_10133750	Ga0207679_101337505	137
1317	3300025945	Ga0207679_10193806	Ga0207679_101938061	137
1318	3300025945	Ga0207679_10206979	Ga0207679_102069792	137
1319	3300025945	Ga0207679_10929821	Ga0207679_109298211	137
1320	3300025945	Ga0207679_10951141	Ga0207679_109511412	137
1321	3300025945	Ga0207679_11003704	Ga0207679_110037041	137
1322	3300025949	Ga0207667_10017864	Ga0207667_100178647	137
1323	3300025949	Ga0207667_10271172	Ga0207667_102711722	137
1324	3300025949	Ga0207667_10292278	Ga0207667_102922782	137
1325	3300025949	Ga0207667_10786065	Ga0207667_107860651	137
1326	3300025960	Ga0207651_10001161	Ga0207651_1000116123	137
1327	3300025960	Ga0207651_10010012	Ga0207651_100100126	137
1328	3300025960	Ga0207651_10117040	Ga0207651_101170402	137
1329	3300025960	Ga0207651_10141863	Ga0207651_101418631	137
1330	3300025960	Ga0207651_10182359	Ga0207651_101823592	137
1331	3300025960	Ga0207651_10212138	Ga0207651_102121383	137
1332	3300025960	Ga0207651_10241356	Ga0207651_102413562	137
1333	3300025960	Ga0207651_10256471	Ga0207651_102564711	137
1334	3300025960	Ga0207651_10280614	Ga0207651_102806142	137
1335	3300025960	Ga0207651_10611967	Ga0207651_106119673	137
1336	3300025960	Ga0207651_10750532	Ga0207651_107505322	137
1337	3300025960	Ga0207651_10971078	Ga0207651_109710783	137
1338	3300025961	Ga0207712_10018684	Ga0207712_100186845	137
1339	3300025961	Ga0207712_10099005	Ga0207712_100990054	137
1340	3300025961	Ga0207712_10104003	Ga0207712_101040031	137
1341	3300025961	Ga0207712_10224384	Ga0207712_102243843	137
1342	3300025961	Ga0207712_10351183	Ga0207712_103511833	137
1343	3300025961	Ga0207712_10372947	Ga0207712_103729471	137
1344	3300025972	Ga0207668_10020156	Ga0207668_100201564	137
1345	3300025972	Ga0207668_10056063	Ga0207668_100560631	137
1346	3300025972	Ga0207668_10311920	Ga0207668_103119204	137
1347	3300025972	Ga0207668_10886424	Ga0207668_108864242	137
1348	3300025981	Ga0207640_10058350	Ga0207640_100583505	137
1349	3300025981	Ga0207640_10469233	Ga0207640_104692333	137
1350	3300025981	Ga0207640_10524806	Ga0207640_105248063	137
1351	3300025981	Ga0207640_10820481	Ga0207640_108204812	137
1352	3300025986	Ga0207658_10113902	Ga0207658_101139022	137
1353	3300025986	Ga0207658_10266020	Ga0207658_102660204	137
1354	3300025986	Ga0207658_10746485	Ga0207658_107464852	137
1355	3300025986	Ga0207658_11004558	Ga0207658_110045582	137
1356	3300025986	Ga0207658_11844382	Ga0207658_118443821	137
1357	3300026023	Ga0207677_11016113	Ga0207677_110161132	137
1358	3300026023	Ga0207677_11567352	Ga0207677_115673521	137
1359	3300026035	Ga0207703_10033254	Ga0207703_100332548	137
1360	3300026035	Ga0207703_10084790	Ga0207703_100847907	137
1361	3300026035	Ga0207703_10258084	Ga0207703_102580842	137
1362	3300026041	Ga0207639_10153635	Ga0207639_101536352	137
1363	3300026041	Ga0207639_10987221	Ga0207639_109872211	137
1364	3300026067	Ga0207678_10041831	Ga0207678_100418315	137
1365	3300026067	Ga0207678_10065410	Ga0207678_100654108	137
1366	3300026067	Ga0207678_10066708	Ga0207678_100667084	137
1367	3300026067	Ga0207678_10240913	Ga0207678_102409134	137
1368	3300026067	Ga0207678_10606993	Ga0207678_106069933	137
1369	3300026075	Ga0207708_10033352	Ga0207708_100333526	137
1370	3300026075	Ga0207708_10050990	Ga0207708_100509903	137
1371	3300026075	Ga0207708_10097645	Ga0207708_100976455	137
1372	3300026075	Ga0207708_10122721	Ga0207708_101227212	137
1373	3300026075	Ga0207708_10131775	Ga0207708_101317752	137
1374	3300026075	Ga0207708_10140056	Ga0207708_101400564	137
1375	3300026075	Ga0207708_10170265	Ga0207708_101702652	137
1376	3300026075	Ga0207708_10218843	Ga0207708_102188434	137
1377	3300026075	Ga0207708_10255068	Ga0207708_102550682	137
1378	3300026075	Ga0207708_10335278	Ga0207708_103352784	137
1379	3300026075	Ga0207708_10550296	Ga0207708_105502962	137
1380	3300026075	Ga0207708_10629106	Ga0207708_106291062	137
1381	3300026075	Ga0207708_10684015	Ga0207708_106840152	137
1382	3300026075	Ga0207708_10981533	Ga0207708_109815332	137
1383	3300026078	Ga0207702_10653260	Ga0207702_106532601	137
1384	3300026078	Ga0207702_11057823	Ga0207702_110578232	137
1385	3300026088	Ga0207641_10102102	Ga0207641_101021026	137
1386	3300026088	Ga0207641_10400237	Ga0207641_104002372	137
1387	3300026088	Ga0207641_10728585	Ga0207641_107285853	137
1388	3300026088	Ga0207641_11135231	Ga0207641_111352312	137
1389	3300026088	Ga0207641_11554030	Ga0207641_115540302	137
1390	3300026089	Ga0207648_10003371	Ga0207648_100033712	137
1391	3300026089	Ga0207648_10013253	Ga0207648_100132539	137
1392	3300026089	Ga0207648_10046558	Ga0207648_1004655810	137
1393	3300026089	Ga0207648_10239852	Ga0207648_102398524	137
1394	3300026089	Ga0207648_10489812	Ga0207648_104898123	137
1395	3300026095	Ga0207676_10009598	Ga0207676_100095988	137
1396	3300026095	Ga0207676_10057904	Ga0207676_100579043	137
1397	3300026095	Ga0207676_10081801	Ga0207676_100818014	137
1398	3300026095	Ga0207676_10106333	Ga0207676_101063334	137
1399	3300026095	Ga0207676_10133245	Ga0207676_101332454	137
1400	3300026095	Ga0207676_10339464	Ga0207676_103394642	137
1401	3300026095	Ga0207676_10368021	Ga0207676_103680212	137
1402	3300026095	Ga0207676_10498070	Ga0207676_104980703	137
1403	3300026095	Ga0207676_10530382	Ga0207676_105303824	137
1404	3300026095	Ga0207676_10631954	Ga0207676_106319543	137
1405	3300026116	Ga0207674_10043290	Ga0207674_100432901	137
1406	3300026116	Ga0207674_10046584	Ga0207674_1004658410	137
1407	3300026116	Ga0207674_10057134	Ga0207674_100571349	137
1408	3300026116	Ga0207674_10066639	Ga0207674_100666396	137
1409	3300026116	Ga0207674_10074323	Ga0207674_100743236	137
1410	3300026116	Ga0207674_10124226	Ga0207674_101242263	137
1411	3300026116	Ga0207674_10248768	Ga0207674_102487681	137
1412	3300026116	Ga0207674_10381606	Ga0207674_103816062	137
1413	3300026116	Ga0207674_10490740	Ga0207674_104907404	137
1414	3300026116	Ga0207674_10867469	Ga0207674_108674692	137
1415	3300026116	Ga0207674_11171937	Ga0207674_111719371	137
1416	3300026116	Ga0207674_11193633	Ga0207674_111936332	137
1417	3300026116	Ga0207674_11421277	Ga0207674_114212771	137
1418	3300026116	Ga0207674_12128406	Ga0207674_121284061	137
1419	3300026118	Ga0207675_100022725	Ga0207675_10002272511	137
1420	3300026118	Ga0207675_100052806	Ga0207675_1000528068	137
1421	3300026118	Ga0207675_100081357	Ga0207675_1000813575	137
1422	3300026118	Ga0207675_100093006	Ga0207675_1000930062	137
1423	3300026118	Ga0207675_100094597	Ga0207675_1000945978	137
1424	3300026118	Ga0207675_100151705	Ga0207675_1001517052	137
1425	3300026118	Ga0207675_100213954	Ga0207675_1002139544	137
1426	3300026118	Ga0207675_100249034	Ga0207675_1002490345	137
1427	3300026118	Ga0207675_100268278	Ga0207675_1002682782	137
1428	3300026118	Ga0207675_100437992	Ga0207675_1004379922	137
1429	3300026118	Ga0207675_100623705	Ga0207675_1006237052	137
1430	3300026118	Ga0207675_100959904	Ga0207675_1009599042	137
1431	3300026118	Ga0207675_101245419	Ga0207675_1012454192	137
1432	3300026121	Ga0207683_10016841	Ga0207683_100168416	137
1433	3300026121	Ga0207683_10021884	Ga0207683_1002188413	137
1434	3300026121	Ga0207683_10054170	Ga0207683_100541703	137
1435	3300026121	Ga0207683_10222669	Ga0207683_102226695	137
1436	3300026121	Ga0207683_10248738	Ga0207683_102487384	137
1437	3300026121	Ga0207683_10341336	Ga0207683_103413362	137
1438	3300026121	Ga0207683_10446804	Ga0207683_104468044	137
1439	3300026121	Ga0207683_10473152	Ga0207683_104731524	137
1440	3300026142	Ga0207698_10105852	Ga0207698_101058522	137
1441	3300026142	Ga0207698_10186328	Ga0207698_101863285	137
1442	3300026142	Ga0207698_10202247	Ga0207698_102022473	137
1443	3300026142	Ga0207698_11127904	Ga0207698_111279042	137
1444	3300026142	Ga0207698_11343648	Ga0207698_113436482	137
1445	3300026142	Ga0207698_11414019	Ga0207698_114140191	137
1446	3300027424	Ga0209984_1052269	Ga0209984_10522692	137
1447	3300027526	Ga0209968_1081948	Ga0209968_10819482	137
1448	3300027543	Ga0209999_1050604	Ga0209999_10506041	137
1449	3300027665	Ga0209983_1016113	Ga0209983_10161133	137
1450	3300027665	Ga0209983_1069529	Ga0209983_10695292	137
1451	3300027682	Ga0209971_1025444	Ga0209971_10254442	137
1452	3300027695	Ga0209966_1026094	Ga0209966_10260943	137
1453	3300027876	Ga0209974_10017198	Ga0209974_100171985	137
1454	3300027876	Ga0209974_10127234	Ga0209974_101272342	137
1455	3300027876	Ga0209974_10155246	Ga0209974_101552463	137
1456	3300027876	Ga0209974_10360827	Ga0209974_103608271	137
1457	3300027907	Ga0207428_10000487	Ga0207428_1000048750	137
1458	3300027907	Ga0207428_10000570	Ga0207428_100005709	137
1459	3300027907	Ga0207428_10001541	Ga0207428_1000154128	137
1460	3300027907	Ga0207428_10002655	Ga0207428_1000265523	137
1461	3300027907	Ga0207428_10003291	Ga0207428_1000329123	137
1462	3300027907	Ga0207428_10006979	Ga0207428_1000697914	137
1463	3300027907	Ga0207428_10042714	Ga0207428_100427144	137
1464	3300027907	Ga0207428_10182453	Ga0207428_101824533	137
1465	3300027907	Ga0207428_10344821	Ga0207428_103448211	137
1466	3300027907	Ga0207428_10844667	Ga0207428_108446671	137
1467	3300028379	Ga0268266_10053537	Ga0268266_100535376	137
1468	3300028380	Ga0268265_10000103	Ga0268265_1000010313	137
1469	3300028380	Ga0268265_10021355	Ga0268265_100213557	137
1470	3300028380	Ga0268265_10048425	Ga0268265_100484253	137
1471	3300028380	Ga0268265_10285979	Ga0268265_102859792	137
1472	3300028380	Ga0268265_10306910	Ga0268265_103069103	137
1473	3300028380	Ga0268265_10313552	Ga0268265_103135522	137
1474	3300028380	Ga0268265_10447652	Ga0268265_104476523	137
1475	3300028380	Ga0268265_10664757	Ga0268265_106647573	137
1476	3300028380	Ga0268265_10726124	Ga0268265_107261241	137
1477	3300028380	Ga0268265_11566245	Ga0268265_115662452	137
1478	3300028381	Ga0268264_10010645	Ga0268264_1001064514	137
1479	3300028381	Ga0268264_10027905	Ga0268264_100279059	137
1480	3300028381	Ga0268264_10237700	Ga0268264_102377002	137
1481	3300028381	Ga0268264_10482506	Ga0268264_104825062	137
1482	3300028381	Ga0268264_10765843	Ga0268264_107658432	137
1483	3300028381	Ga0268264_11007491	Ga0268264_110074912	137
1484	3300028800	Ga0265338_10087887	Ga0265338_100878872	137
1485	3300030745	Ga0316182_1309934	Ga0316182_13099342	137
1486	3300031235	Ga0265330_10006073	Ga0265330_1000607311	137
1487	3300031238	Ga0265332_10032292	Ga0265332_100322922	137
1488	3300031247	Ga0265340_10040335	Ga0265340_100403356	137
1489	3300031247	Ga0265340_10185698	Ga0265340_101856981	137
1490	3300031249	Ga0265339_10303743	Ga0265339_103037432	137
1491	3300031344	Ga0265316_10322510	Ga0265316_103225103	137
1492	3300031548	Ga0307408_100010079	Ga0307408_1000100799	137
1493	3300031548	Ga0307408_100057488	Ga0307408_1000574882	137
1494	3300031548	Ga0307408_100081795	Ga0307408_1000817951	137
1495	3300031548	Ga0307408_100160214	Ga0307408_1001602145	137
1496	3300031548	Ga0307408_100357623	Ga0307408_1003576232	137
1497	3300031548	Ga0307408_100724008	Ga0307408_1007240083	137
1498	3300031548	Ga0307408_102183095	Ga0307408_1021830951	137
1499	3300031665	Ga0316575_10001707	Ga0316575_100017077	137
1500	3300031665	Ga0316575_10051697	Ga0316575_100516973	137
1501	3300031691	Ga0316579_10262051	Ga0316579_102620511	137
1502	3300031691	Ga0316579_10335490	Ga0316579_103354902	137
1503	3300031711	Ga0265314_10007579	Ga0265314_1000757915	137
1504	3300031711	Ga0265314_10051681	Ga0265314_100516813	137
1505	3300031727	Ga0316576_10029952	Ga0316576_100299527	137
1506	3300031727	Ga0316576_10034426	Ga0316576_100344266	137
1507	3300031727	Ga0316576_10169271	Ga0316576_101692712	137
1508	3300031727	Ga0316576_10230232	Ga0316576_102302323	137
1509	3300031727	Ga0316576_11266770	Ga0316576_112667701	137
1510	3300031728	Ga0316578_10005047	Ga0316578_100050478	137
1511	3300031728	Ga0316578_10486292	Ga0316578_104862922	137
1512	3300031731	Ga0307405_10003705	Ga0307405_1000370510	137
1513	3300031731	Ga0307405_10016138	Ga0307405_1001613810	137
1514	3300031731	Ga0307405_10127804	Ga0307405_101278046	137
1515	3300031731	Ga0307405_10146129	Ga0307405_101461294	137
1516	3300031731	Ga0307405_10183848	Ga0307405_101838481	137
1517	3300031731	Ga0307405_10213570	Ga0307405_102135704	137
1518	3300031733	Ga0316577_10093016	Ga0316577_100930162	137
1519	3300031824	Ga0307413_10015504	Ga0307413_100155045	137
1520	3300031824	Ga0307413_10112221	Ga0307413_101122213	137
1521	3300031824	Ga0307413_10253804	Ga0307413_102538043	137
1522	3300031824	Ga0307413_10329299	Ga0307413_103292993	137
1523	3300031824	Ga0307413_10683530	Ga0307413_106835302	137
1524	3300031824	Ga0307413_10973467	Ga0307413_109734671	137
1525	3300031824	Ga0307413_11158912	Ga0307413_111589122	137
1526	3300031852	Ga0307410_10061823	Ga0307410_100618232	137
1527	3300031852	Ga0307410_10089147	Ga0307410_100891471	137
1528	3300031852	Ga0307410_10589679	Ga0307410_105896793	137
1529	3300031852	Ga0307410_10846115	Ga0307410_108461152	137
1530	3300031852	Ga0307410_11507728	Ga0307410_115077282	137
1531	3300031901	Ga0307406_10019528	Ga0307406_100195286	137
1532	3300031901	Ga0307406_10311688	Ga0307406_103116882	137
1533	3300031901	Ga0307406_10526991	Ga0307406_105269913	137
1534	3300031901	Ga0307406_10808441	Ga0307406_108084413	137
1535	3300031901	Ga0307406_11864599	Ga0307406_118645992	137
1536	3300031903	Ga0307407_10002685	Ga0307407_100026858	137
1537	3300031903	Ga0307407_10225619	Ga0307407_102256194	137
1538	3300031903	Ga0307407_10721540	Ga0307407_107215401	137
1539	3300031911	Ga0307412_10010747	Ga0307412_100107475	137
1540	3300031911	Ga0307412_10022653	Ga0307412_100226535	137
1541	3300031911	Ga0307412_10937903	Ga0307412_109379031	137
1542	3300031911	Ga0307412_11264475	Ga0307412_112644752	137
1543	3300031911	Ga0307412_12039794	Ga0307412_120397941	137
1544	3300031995	Ga0307409_100008587	Ga0307409_10000858710	137
1545	3300031995	Ga0307409_100009123	Ga0307409_1000091235	137
1546	3300031995	Ga0307409_100010075	Ga0307409_1000100755	137
1547	3300031995	Ga0307409_100145348	Ga0307409_1001453485	137
1548	3300031995	Ga0307409_100489809	Ga0307409_1004898092	137
1549	3300031995	Ga0307409_100577978	Ga0307409_1005779784	137
1550	3300031995	Ga0307409_101169196	Ga0307409_1011691961	137
1551	3300032002	Ga0307416_100003624	Ga0307416_1000036242	137
1552	3300032002	Ga0307416_100007895	Ga0307416_1000078958	137
1553	3300032002	Ga0307416_100048189	Ga0307416_1000481898	137
1554	3300032002	Ga0307416_100068883	Ga0307416_1000688834	137
1555	3300032002	Ga0307416_100215862	Ga0307416_1002158623	137
1556	3300032002	Ga0307416_100383634	Ga0307416_1003836342	137
1557	3300032002	Ga0307416_100595139	Ga0307416_1005951393	137
1558	3300032002	Ga0307416_100978009	Ga0307416_1009780091	137
1559	3300032004	Ga0307414_10014997	Ga0307414_1001499711	137
1560	3300032004	Ga0307414_10288568	Ga0307414_102885681	137
1561	3300032004	Ga0307414_10342135	Ga0307414_103421352	137
1562	3300032004	Ga0307414_10650438	Ga0307414_106504382	137
1563	3300032004	Ga0307414_10883431	Ga0307414_108834312	137
1564	3300032005	Ga0307411_10016125	Ga0307411_100161254	137
1565	3300032005	Ga0307411_10072105	Ga0307411_100721055	137
1566	3300032005	Ga0307411_10124459	Ga0307411_101244592	137
1567	3300032005	Ga0307411_10284225	Ga0307411_102842252	137
1568	3300032005	Ga0307411_10365661	Ga0307411_103656611	137
1569	3300032005	Ga0307411_11317516	Ga0307411_113175161	137
1570	3300032120	Ga0316053_109677	Ga0316053_1096772	137
1571	3300032126	Ga0307415_100000625	Ga0307415_10000062517	137
1572	3300032126	Ga0307415_100027708	Ga0307415_1000277084	137
1573	3300032126	Ga0307415_100798279	Ga0307415_1007982791	137
1574	3300032137	Ga0316585_10001353	Ga0316585_100013539	137
1575	3300032137	Ga0316585_10092273	Ga0316585_100922733	137
1576	3300032139	Ga0316580_10015398	Ga0316580_100153983	137
1577	3300034817	Ga0373948_0001632	Ga0373948_0001632_1398_1823	137
1578	3300034818	Ga0373950_0025540	Ga0373950_0025540_236_661	137
1579	3300034819	Ga0373958_0000045	Ga0373958_0000045_5665_6090	137
1580	3300034957	Ga0373938_0000418	Ga0373938_0000418_5000_5425	137
1581	3300035084	Ga0373928_0000984	Ga0373928_0000984_215_640	137
1582	3300035084	Ga0373928_0088542	Ga0373928_0088542_32_457	137
1583	3300035086	Ga0373934_0125210	Ga0373934_0125210_186_611	137
1584	3300035088	Ga0373940_0000084	Ga0373940_0000084_1870_2295	137
1585	3300035090	Ga0373949_0000597	Ga0373949_0000597_4832_5257	137
1586	3300035090	Ga0373949_0136015	Ga0373949_0136015_14_439	137
1587	3300035091	Ga0373951_0025379	Ga0373951_0025379_625_1050	137
1588	3300035091	Ga0373951_0134710	Ga0373951_0134710_81_506	137
1589	3300035092	Ga0373952_0030973	Ga0373952_0030973_648_1073	137
1590	3300035111	Ga0373923_0162819	Ga0373923_0162819_321_734	137
1591	3300035112	Ga0373932_0001521	Ga0373932_0001521_4553_4978	137
1592	3300035113	Ga0373936_0516990	Ga0373936_0516990_97_522	137
1593	3300035114	Ga0373939_0002335	Ga0373939_0002335_2984_3409	137
1594	3300035114	Ga0373939_0030175	Ga0373939_0030175_547_972	137
1595	3300035114	Ga0373939_0054583	Ga0373939_0054583_200_625	137
1596	3300035115	Ga0373941_0000161	Ga0373941_0000161_3049_3474	137
1597	3300035119	Ga0373956_0511147	Ga0373956_0511147_13_438	137
1598	3300035120	Ga0373957_0486439	Ga0373957_0486439_92_517	137
1599	3300035121	Ga0373960_0001448	Ga0373960_0001448_676_1101	137
1600	3300035121	Ga0373960_0019772	Ga0373960_0019772_1173_1598	137
1601	3300035170	Ga0373943_0160483	Ga0373943_0160483_241_654	137
1602	3300035170	Ga0373943_0298866	Ga0373943_0298866_20_445	137
1603	3300035171	Ga0373946_0063364	Ga0373946_0063364_345_770	137
1604	3300035171	Ga0373946_0308030	Ga0373946_0308030_324_749	137
1605	3300035207	Ga0373942_0001420	Ga0373942_0001420_2467_2892	137
1606	3300035207	Ga0373942_0216754	Ga0373942_0216754_82_507	137
1607	3300035241	Ga0373961_0001591	Ga0373961_0001591_212_637	137
1608	3300035241	Ga0373961_0017893	Ga0373961_0017893_1004_1429	137
1609	3300035241	Ga0373961_0204075	Ga0373961_0204075_111_536	137
1610	3300035242	Ga0373962_0000245	Ga0373962_0000245_7827_8252	137
1611	3300035242	Ga0373962_0008391	Ga0373962_0008391_1476_1901	137
1612	3300035242	Ga0373962_0260136	Ga0373962_0260136_65_490	137
1613	3300035398	Ga0316574_0000232	Ga0316574_0000232_15502_15918	137
1614	3300035398	Ga0316574_0075698	Ga0316574_0075698_53_469	137
1615	3300035398	Ga0316574_0143004	Ga0316574_0143004_52_468	137
1616	3300035691	Ga0373931_0002441	Ga0373931_0002441_5343_5768	137
1617	3300035691	Ga0373931_0013684	Ga0373931_0013684_517_942	137
1618	3300035692	Ga0373935_0030527	Ga0373935_0030527_396_809	137
1619	3300035692	Ga0373935_0221627	Ga0373935_0221627_582_1007	137
1620	3300035692	Ga0373935_1190880	Ga0373935_1190880_48_473	137
1621	3300035724	Ga0373933_0045201	Ga0373933_0045201_557_982	137
1622	3300035725	Ga0373947_0371340	Ga0373947_0371340_302_727	137
1623	3300036401	Ga0373937_0053966	Ga0373937_0053966_1966_2379	137
1624	3300036401	Ga0373937_0397542	Ga0373937_0397542_249_674	137
1625	3300036401	Ga0373937_1303293	Ga0373937_1303293_177_602	137
1626	3300036647	Ga0316582_0107956	Ga0316582_0107956_237_653	137
1627	3300036647	Ga0316582_0351922	Ga0316582_0351922_59_475	137
1628	3300036712	Ga0316584_0028415	Ga0316584_0028415_3325_3741	137
1629	3300036712	Ga0316584_0070587	Ga0316584_0070587_1740_2156	137
1630	3300036712	Ga0316584_0762688	Ga0316584_0762688_223_642	137
1631	3300036712	Ga0316584_1015690	Ga0316584_1015690_53_469	137
1632	3300037068	Ga0373925_0231223	Ga0373925_0231223_879_1304	137
1633	3300037068	Ga0373925_0271625	Ga0373925_0271625_37_450	137
1634	3300037068	Ga0373925_0433749	Ga0373925_0433749_404_829	137
1635	3300037068	Ga0373925_0651424	Ga0373925_0651424_115_528	137
1636	3300037418	Ga0395900_0578520	Ga0395900_0578520_292_714	137
1637	3300037471	Ga0395905_0197741	Ga0395905_0197741_172_597	137
1638	3300037471	Ga0395905_0229498	Ga0395905_0229498_971_1393	137
1639	3300037471	Ga0395905_1529243	Ga0395905_1529243_21_446	137
1640	3300037588	Ga0316581_0220815	Ga0316581_0220815_139_558	137
1641	3300038996	Ga0242420_064857	Ga0242420_064857_161_586	137
1642	3300039437	Ga0436365_0009652	Ga0436365_0009652_41_472	137
1643	3300039437	Ga0436365_0832523	Ga0436365_0832523_165_590	137
1644	3300039437	Ga0436365_0933832	Ga0436365_0933832_400_813	137
1645	3300039437	Ga0436365_1141410	Ga0436365_1141410_53_478	137
1646	3300039437	Ga0436365_1708300	Ga0436365_1708300_19_432	137
1647	3300039437	Ga0436365_1875905	Ga0436365_1875905_465_890	137
1648	3300039438	Ga0436360_0362444	Ga0436360_0362444_145_558	137
1649	3300039438	Ga0436360_0639138	Ga0436360_0639138_202_615	137
1650	3300039450	Ga0436363_0070828	Ga0436363_0070828_15_440	137
1651	3300039450	Ga0436363_0703121	Ga0436363_0703121_60_473	137
1652	3300039450	Ga0436363_1241984	Ga0436363_1241984_166_579	137
1653	3300039450	Ga0436363_1502573	Ga0436363_1502573_431_844	137
1654	3300039453	Ga0436362_1287607	Ga0436362_1287607_891_1316	137
1655	3300041404	Ga0439436_0100431	Ga0439436_0100431_256_681	137
1656	3300041405	Ga0439438_051557	Ga0439438_051557_526_951	137
1657	3300041406	Ga0439439_0072645	Ga0439439_0072645_83_508	137
1658	3300041406	Ga0439439_0145571	Ga0439439_0145571_80_505	137
1659	3300041408	Ga0439453_0004794	Ga0439453_0004794_693_1118	137
1660	3300041408	Ga0439453_0016605	Ga0439453_0016605_828_1253	137
1661	3300041408	Ga0439453_0025935	Ga0439453_0025935_74_499	137
1662	3300041408	Ga0439453_0029411	Ga0439453_0029411_338_763	137
1663	3300041410	Ga0439461_0203114	Ga0439461_0203114_40_462	137
1664	3300041441	Ga0451787_185390	Ga0451787_185390_34_459	137
1665	3300041459	Ga0451800_0915318	Ga0451800_0915318_12_434	137
1666	3300041460	Ga0451802_1895611	Ga0451802_1895611_141_563	137
1667	3300041486	Ga0451807_1303676	Ga0451807_1303676_267_689	137
1668	3300041492	Ga0451835_1259139	Ga0451835_1259139_171_596	137
1669	3300041997	Ga0439431_0023903	Ga0439431_0023903_839_1261	137
1670	3300041997	Ga0439431_0035041	Ga0439431_0035041_421_843	137
1671	3300041997	Ga0439431_0059821	Ga0439431_0059821_245_658	137
1672	3300041999	Ga0439433_0003305	Ga0439433_0003305_2699_3124	137
1673	3300041999	Ga0439433_0019476	Ga0439433_0019476_603_1028	137
1674	3300041999	Ga0439433_0053899	Ga0439433_0053899_180_602	137
1675	3300042001	Ga0439441_085985	Ga0439441_085985_96_518	137
1676	3300042003	Ga0439443_027889	Ga0439443_027889_44_469	137
1677	3300042003	Ga0439443_078359	Ga0439443_078359_94_519	137
1678	3300042004	Ga0439445_0035897	Ga0439445_0035897_412_834	137
1679	3300042004	Ga0439445_0094755	Ga0439445_0094755_257_682	137
1680	3300042004	Ga0439445_0122373	Ga0439445_0122373_104_529	137
1681	3300042004	Ga0439445_0131261	Ga0439445_0131261_271_693	137
1682	3300042007	Ga0439449_0030857	Ga0439449_0030857_1539_1964	137
1683	3300042007	Ga0439449_0271896	Ga0439449_0271896_168_593	137
1684	3300042008	Ga0439450_001122	Ga0439450_001122_3070_3495	137
1685	3300042009	Ga0439451_024249	Ga0439451_024249_148_573	137
1686	3300042013	Ga0439456_050819	Ga0439456_050819_22_447	137
1687	3300042014	Ga0439457_058728	Ga0439457_058728_396_821	137
1688	3300042015	Ga0439462_0015273	Ga0439462_0015273_206_631	137
1689	3300042016	Ga0439463_193666	Ga0439463_193666_67_492	137
1690	3300042121	Ga0450919_020895	Ga0450919_020895_27_443	137
1691	3300042122	Ga0450920_017831	Ga0450920_017831_547_969	137
1692	3300042122	Ga0450920_032321	Ga0450920_032321_393_815	137
1693	3300042132	Ga0450895_002671	Ga0450895_002671_873_1295	137
1694	3300042133	Ga0450896_000755	Ga0450896_000755_480_902	137
1695	3300042133	Ga0450896_018419	Ga0450896_018419_442_864	137
1696	3300042133	Ga0450896_028446	Ga0450896_028446_369_794	137
1697	3300042134	Ga0450898_051989	Ga0450898_051989_343_765	137
1698	3300042142	Ga0450905_088931	Ga0450905_088931_64_489	137
1699	3300042145	Ga0450906_034703	Ga0450906_034703_212_637	137
1700	3300042147	Ga0450910_043211	Ga0450910_043211_148_570	137
1701	3300042156	Ga0439446_0015322	Ga0439446_0015322_1243_1668	137
1702	3300042156	Ga0439446_0027668	Ga0439446_0027668_657_1082	137
1703	3300042156	Ga0439446_0056617	Ga0439446_0056617_270_695	137
1704	3300042156	Ga0439446_0081098	Ga0439446_0081098_557_982	137
1705	3300042156	Ga0439446_0244988	Ga0439446_0244988_176_601	137
1706	3300042435	Ga0439434_0014052	Ga0439434_0014052_503_925	137
1707	3300042435	Ga0439434_0070200	Ga0439434_0070200_404_829	137
1708	3300042435	Ga0439434_0155331	Ga0439434_0155331_225_647	137
1709	3300042435	Ga0439434_0175087	Ga0439434_0175087_114_539	137
1710	3300042436	Ga0439435_0007633	Ga0439435_0007633_1541_1966	137
1711	3300042436	Ga0439435_0013274	Ga0439435_0013274_560_985	137
1712	3300042436	Ga0439435_0015414	Ga0439435_0015414_1366_1791	137
1713	3300042436	Ga0439435_0065818	Ga0439435_0065818_377_802	137
1714	3300042436	Ga0439435_0109210	Ga0439435_0109210_312_737	137
1715	3300042436	Ga0439435_0137376	Ga0439435_0137376_45_470	137
1716	3300042436	Ga0439435_0165231	Ga0439435_0165231_39_464	137
1717	3300042437	Ga0439444_0128155	Ga0439444_0128155_13_438	137
1718	3300042437	Ga0439444_0147824	Ga0439444_0147824_26_451	137
1719	3300042438	Ga0439459_0029533	Ga0439459_0029533_243_668	137
1720	3300042439	Ga0439464_0019492	Ga0439464_0019492_174_596	137
1721	3300042439	Ga0439464_0061233	Ga0439464_0061233_37_462	137
1722	3300042439	Ga0439464_0140549	Ga0439464_0140549_74_499	137
1723	3300042461	Ga0439460_0107664	Ga0439460_0107664_421_843	137
1724	3300042530	Ga0450916_029311	Ga0450916_029311_184_609	137
1725	3300042876	Ga0451577_0010501	Ga0451577_0010501_3109_3525	137
1726	3300042876	Ga0451577_0011517	Ga0451577_0011517_2317_2742	137
1727	3300042876	Ga0451577_0053226	Ga0451577_0053226_947_1372	137
1728	3300042876	Ga0451577_0285939	Ga0451577_0285939_988_1413	137
1729	3300042876	Ga0451577_0552691	Ga0451577_0552691_368_793	137
1730	3300042876	Ga0451577_1211359	Ga0451577_1211359_160_573	137
1731	3300042993	Ga0439440_0036941	Ga0439440_0036941_623_1048	137
1732	3300042993	Ga0439440_0055198	Ga0439440_0055198_121_543	137
1733	3300042993	Ga0439440_0079013	Ga0439440_0079013_189_614	137
1734	3300044673	Ga0453683_0004189	Ga0453683_0004189_2881_3297	137
1735	3300044673	Ga0453683_0284632	Ga0453683_0284632_179_604	137
1736	3300044673	Ga0453683_0480755	Ga0453683_0480755_120_545	137
1737	3300044693	Ga0466961_0066545	Ga0466961_0066545_1416_1829	137
1738	3300044712	Ga0453684_0010446	Ga0453684_0010446_10751_11167	137
1739	3300044712	Ga0453684_0103316	Ga0453684_0103316_1829_2254	137
1740	3300044712	Ga0453684_1007707	Ga0453684_1007707_256_675	137
1741	3300044712	Ga0453684_1564433	Ga0453684_1564433_96_515	137
1742	3300044735	Ga0466968_0073577	Ga0466968_0073577_86_499	137
1743	3300045051	Ga0451576_0018296	Ga0451576_0018296_2652_3077	137
1744	3300045051	Ga0451576_0055541	Ga0451576_0055541_2391_2816	137
1745	3300045051	Ga0451576_0066389	Ga0451576_0066389_1263_1688	137
1746	3300045051	Ga0451576_0084364	Ga0451576_0084364_2571_2996	137
1747	3300045051	Ga0451576_0132682	Ga0451576_0132682_1694_2110	137
1748	3300045051	Ga0451576_0224852	Ga0451576_0224852_1031_1456	137
1749	3300045051	Ga0451576_0317050	Ga0451576_0317050_396_821	137
1750	3300045051	Ga0451576_0385399	Ga0451576_0385399_580_1005	137
1751	3300045051	Ga0451576_0714922	Ga0451576_0714922_222_644	137
1752	3300045051	Ga0451576_0877597	Ga0451576_0877597_165_587	137
1753	3300045051	Ga0451576_1268048	Ga0451576_1268048_131_556	137
1754	3300045836	Ga0466958_0488459	Ga0466958_0488459_255_680	137
1755	3300045976	Ga0466967_0057235	Ga0466967_0057235_2356_2781	137
1756	3300045976	Ga0466967_1391242	Ga0466967_1391242_260_685	137
1757	3300046455	Ga0495603_0163063	Ga0495603_0163063_342_767	137
1758	3300046455	Ga0495603_0174783	Ga0495603_0174783_239_664	137
1759	3300046457	Ga0495590_0052166	Ga0495590_0052166_83_496	137
1760	3300046459	Ga0495629_0005673	Ga0495629_0005673_5592_6017	137
1761	3300046460	Ga0495638_0029541	Ga0495638_0029541_2277_2699	137
1762	3300046472	Ga0495580_0019875	Ga0495580_0019875_1608_2021	137
1763	3300046472	Ga0495580_0263915	Ga0495580_0263915_138_563	137
1764	3300046472	Ga0495580_0597561	Ga0495580_0597561_292_717	137
1765	3300046472	Ga0495580_0745946	Ga0495580_0745946_56_469	137
1766	3300046473	Ga0495582_0194031	Ga0495582_0194031_590_1015	137
1767	3300046473	Ga0495582_0903152	Ga0495582_0903152_12_437	137
1768	3300046475	Ga0495639_0119857	Ga0495639_0119857_341_766	137
1769	3300046491	Ga0495584_0036251	Ga0495584_0036251_753_1178	137
1770	3300046491	Ga0495584_0041619	Ga0495584_0041619_344_769	137
1771	3300046491	Ga0495584_0237246	Ga0495584_0237246_81_506	137
1772	3300046491	Ga0495584_0328437	Ga0495584_0328437_59_484	137
1773	3300046491	Ga0495584_0372898	Ga0495584_0372898_181_606	137
1774	3300046491	Ga0495584_0660100	Ga0495584_0660100_50_466	137
1775	3300046492	Ga0495585_0148659	Ga0495585_0148659_105_530	137
1776	3300046499	Ga0495594_0013061	Ga0495594_0013061_133_558	137
1777	3300046499	Ga0495594_0018438	Ga0495594_0018438_54_479	137
1778	3300046499	Ga0495594_0103100	Ga0495594_0103100_448_873	137
1779	3300046500	Ga0495596_0286596	Ga0495596_0286596_26_451	137
1780	3300046506	Ga0495583_0426913	Ga0495583_0426913_25_450	137
1781	3300046511	Ga0495608_0300403	Ga0495608_0300403_443_868	137
1782	3300046513	Ga0495616_0083494	Ga0495616_0083494_558_983	137
1783	3300046515	Ga0495620_0264072	Ga0495620_0264072_167_592	137
1784	3300046522	Ga0495643_0008784	Ga0495643_0008784_5355_5780	137
1785	3300046523	Ga0495644_0070816	Ga0495644_0070816_185_607	137
1786	3300046523	Ga0495644_0191789	Ga0495644_0191789_188_613	137
1787	3300046525	Ga0495663_0022782	Ga0495663_0022782_1227_1652	137
1788	3300046528	Ga0495642_0004633	Ga0495642_0004633_800_1225	137
1789	3300046528	Ga0495642_0324427	Ga0495642_0324427_90_515	137
1790	3300046531	Ga0495665_0175153	Ga0495665_0175153_86_511	137
1791	3300046533	Ga0495640_0921274	Ga0495640_0921274_60_485	137
1792	3300046535	Ga0495586_0447198	Ga0495586_0447198_226_651	137
1793	3300046537	Ga0495598_0009276	Ga0495598_0009276_771_1196	137
1794	3300046537	Ga0495598_0027246	Ga0495598_0027246_516_941	137
1795	3300046538	Ga0495609_0019662	Ga0495609_0019662_136_561	137
1796	3300046538	Ga0495609_0099809	Ga0495609_0099809_415_840	137
1797	3300046539	Ga0495621_0003023	Ga0495621_0003023_2530_2955	137
1798	3300046539	Ga0495621_0019246	Ga0495621_0019246_1659_2081	137
1799	3300046539	Ga0495621_0039960	Ga0495621_0039960_955_1380	137
1800	3300046539	Ga0495621_0080708	Ga0495621_0080708_213_638	137
1801	3300046539	Ga0495621_0117878	Ga0495621_0117878_339_764	137
1802	3300046539	Ga0495621_0120941	Ga0495621_0120941_422_847	137
1803	3300046539	Ga0495621_0157502	Ga0495621_0157502_259_684	137
1804	3300046559	Ga0495667_0217474	Ga0495667_0217474_544_969	137
1805	3300046615	Ga0495656_0013358	Ga0495656_0013358_2428_2853	137
1806	3300046615	Ga0495656_0120246	Ga0495656_0120246_76_501	137
1807	3300046615	Ga0495656_0220352	Ga0495656_0220352_224_649	137
1808	3300046615	Ga0495656_0664219	Ga0495656_0664219_10_435	137
1809	3300046615	Ga0495656_0700114	Ga0495656_0700114_43_468	137
1810	3300046642	Ga0495634_0225797	Ga0495634_0225797_205_630	137
1811	3300046642	Ga0495634_0246877	Ga0495634_0246877_346_771	137
1812	3300046663	Ga0495635_0173793	Ga0495635_0173793_414_839	137
1813	3300046664	Ga0495659_0002901	Ga0495659_0002901_4998_5423	137
1814	3300046664	Ga0495659_0057748	Ga0495659_0057748_473_898	137
1815	3300046665	Ga0495661_0257617	Ga0495661_0257617_78_503	137
1816	3300046674	Ga0495588_0004710	Ga0495588_0004710_5389_5814	137
1817	3300046674	Ga0495588_0507407	Ga0495588_0507407_60_500	137
1818	3300046679	Ga0495623_0244355	Ga0495623_0244355_126_551	137
1819	3300046679	Ga0495623_0512503	Ga0495623_0512503_21_434	137
1820	3300046683	Ga0495658_0101506	Ga0495658_0101506_137_562	137
1821	3300046683	Ga0495658_0166193	Ga0495658_0166193_768_1193	137
1822	3300046683	Ga0495658_0185792	Ga0495658_0185792_75_500	137
1823	3300046683	Ga0495658_0217515	Ga0495658_0217515_581_1006	137
1824	3300046683	Ga0495658_0266532	Ga0495658_0266532_36_461	137
1825	3300046684	Ga0495669_0009094	Ga0495669_0009094_2256_2678	137
1826	3300046684	Ga0495669_0082230	Ga0495669_0082230_500_925	137
1827	3300046684	Ga0495669_0160426	Ga0495669_0160426_443_868	137
1828	3300046684	Ga0495669_0246262	Ga0495669_0246262_410_835	137
1829	3300046684	Ga0495669_0369727	Ga0495669_0369727_165_590	137
1830	3300046689	Ga0495613_0162852	Ga0495613_0162852_556_981	137
1831	3300046691	Ga0495670_0054060	Ga0495670_0054060_67_489	137
1832	3300046691	Ga0495670_0067328	Ga0495670_0067328_1163_1588	137
1833	3300046691	Ga0495670_0176012	Ga0495670_0176012_322_747	137
1834	3300046694	Ga0495649_0270283	Ga0495649_0270283_346_759	137
1835	3300046694	Ga0495649_0587980	Ga0495649_0587980_53_478	137
1836	3300047315	Ga0495581_0325976	Ga0495581_0325976_211_636	137
1837	3300047318	Ga0495636_0002384	Ga0495636_0002384_2865_3290	137
1838	3300047318	Ga0495636_0502741	Ga0495636_0502741_23_448	137
1839	3300047319	Ga0495674_0119365	Ga0495674_0119365_1072_1497	137
1840	3300047320	Ga0495672_0013301	Ga0495672_0013301_2718_3140	137
1841	3300047320	Ga0495672_0157563	Ga0495672_0157563_724_1149	137
1842	3300047321	Ga0495676_0078221	Ga0495676_0078221_1553_1978	137
1843	3300047321	Ga0495676_0693823	Ga0495676_0693823_205_630	137
1844	3300047445	Ga0495677_0130869	Ga0495677_0130869_372_797	137
1845	3300047445	Ga0495677_0169345	Ga0495677_0169345_143_568	137
1846	3300047447	Ga0495685_051797	Ga0495685_051797_275_700	137
1847	3300048088	Ga0495602_0183162	Ga0495602_0183162_1165_1578	137
1848	3300048088	Ga0495602_0764584	Ga0495602_0764584_117_530	137
1849	3300048090	Ga0495615_0028899	Ga0495615_0028899_858_1283	137
1850	3300048903	Ga0496100_0167363	Ga0496100_0167363_502_924	137
1851	3300048903	Ga0496100_0206131	Ga0496100_0206131_654_1079	137
1852	3300048903	Ga0496100_0359163	Ga0496100_0359163_472_897	137
1853	3300048904	Ga0496101_0029477	Ga0496101_0029477_525_950	137
1854	3300048904	Ga0496101_0485553	Ga0496101_0485553_200_625	137
1855	3300048904	Ga0496101_1307997	Ga0496101_1307997_76_501	137
1856	3300048907	Ga0496104_0002699	Ga0496104_0002699_11361_11786	137
1857	3300048907	Ga0496104_0184501	Ga0496104_0184501_1342_1764	137
1858	3300048907	Ga0496104_0218896	Ga0496104_0218896_220_645	137
1859	3300048908	Ga0496105_0071869	Ga0496105_0071869_1764_2189	137
1860	3300048908	Ga0496105_0411538	Ga0496105_0411538_168_593	137
1861	3300048908	Ga0496105_0517149	Ga0496105_0517149_435_860	137
1862	3300048909	Ga0496106_0036122	Ga0496106_0036122_215_637	137
1863	3300048909	Ga0496106_0396984	Ga0496106_0396984_112_537	137
1864	3300048909	Ga0496106_0397359	Ga0496106_0397359_601_1026	137
1865	3300048909	Ga0496106_0458223	Ga0496106_0458223_44_469	137
1866	3300048909	Ga0496106_0459365	Ga0496106_0459365_68_493	137
1867	3300048909	Ga0496106_0783276	Ga0496106_0783276_35_460	137
1868	3300048909	Ga0496106_0838717	Ga0496106_0838717_147_572	137
1869	3300048910	Ga0496107_0190874	Ga0496107_0190874_180_602	137
1870	3300048910	Ga0496107_0758680	Ga0496107_0758680_257_682	137
1871	3300048911	Ga0496108_0036505	Ga0496108_0036505_3547_3969	137
1872	3300048911	Ga0496108_0039080	Ga0496108_0039080_1906_2331	137
1873	3300048911	Ga0496108_0713255	Ga0496108_0713255_394_819	137
1874	3300048911	Ga0496108_0876937	Ga0496108_0876937_318_743	137
1875	3300048912	Ga0496109_0001514	Ga0496109_0001514_8787_9212	137
1876	3300048912	Ga0496109_0014351	Ga0496109_0014351_4031_4453	137
1877	3300048912	Ga0496109_0170040	Ga0496109_0170040_1342_1767	137
1878	3300048912	Ga0496109_0284335	Ga0496109_0284335_607_1032	137
1879	3300048912	Ga0496109_0319686	Ga0496109_0319686_369_794	137
1880	3300048913	Ga0496110_0015263	Ga0496110_0015263_3671_4096	137
1881	3300048913	Ga0496110_0119072	Ga0496110_0119072_687_1109	137
1882	3300048913	Ga0496110_0136241	Ga0496110_0136241_789_1214	137
1883	3300048913	Ga0496110_0346138	Ga0496110_0346138_336_761	137
1884	3300048914	Ga0496111_0027389	Ga0496111_0027389_1710_2135	137
1885	3300048914	Ga0496111_0220854	Ga0496111_0220854_328_753	137
1886	3300048914	Ga0496111_0483717	Ga0496111_0483717_455_880	137
1887	3300048915	Ga0496112_0002153	Ga0496112_0002153_6418_6843	137
1888	3300048915	Ga0496112_0048479	Ga0496112_0048479_3079_3501	137
1889	3300048915	Ga0496112_0485975	Ga0496112_0485975_30_455	137
1890	3300048915	Ga0496112_0979726	Ga0496112_0979726_176_601	137
1891	3300048915	Ga0496112_1029677	Ga0496112_1029677_280_705	137
1892	3300048916	Ga0496113_0012466	Ga0496113_0012466_913_1335	137
1893	3300048916	Ga0496113_0145507	Ga0496113_0145507_973_1398	137
1894	3300048916	Ga0496113_0382769	Ga0496113_0382769_107_532	137
1895	3300048917	Ga0496114_0332047	Ga0496114_0332047_871_1293	137
1896	3300048917	Ga0496114_0793241	Ga0496114_0793241_94_519	137
1897	3300048917	Ga0496114_1653436	Ga0496114_1653436_92_517	137
1898	3300049162	Ga0501307_067577	Ga0501307_067577_57_482	137
1899	3300049513	Ga0501290_008610	Ga0501290_008610_416_841	137
1900	3300049514	Ga0501291_009519	Ga0501291_009519_505_930	137
1901	3300049521	Ga0501298_038020	Ga0501298_038020_55_477	137
1902	3300049568	Ga0501031_0093564	Ga0501031_0093564_399_815	137
1903	3300049568	Ga0501031_0095535	Ga0501031_0095535_1342_1767	137
1904	3300049568	Ga0501031_0279645	Ga0501031_0279645_103_525	137
1905	3300049568	Ga0501031_0330445	Ga0501031_0330445_398_823	137
1906	3300049568	Ga0501031_0393588	Ga0501031_0393588_73_513	137
1907	3300049568	Ga0501031_0445375	Ga0501031_0445375_231_656	137
1908	3300049568	Ga0501031_0659752	Ga0501031_0659752_195_620	137
1909	3300049568	Ga0501031_0979802	Ga0501031_0979802_67_492	137
1910	3300049568	Ga0501031_0980217	Ga0501031_0980217_87_512	137
1911	3300049569	Ga0501032_0692086	Ga0501032_0692086_113_538	137
1912	3300049570	Ga0501033_0060787	Ga0501033_0060787_1647_2072	137
1913	3300049570	Ga0501033_0113559	Ga0501033_0113559_491_916	137
1914	3300049570	Ga0501033_0126412	Ga0501033_0126412_519_935	137
1915	3300049570	Ga0501033_1089396	Ga0501033_1089396_97_522	137
1916	3300049571	Ga0501034_0002859	Ga0501034_0002859_8259_8684	137
1917	3300049572	Ga0501036_0022396	Ga0501036_0022396_4738_5154	137
1918	3300049572	Ga0501036_0025075	Ga0501036_0025075_3211_3636	137
1919	3300049572	Ga0501036_0030598	Ga0501036_0030598_155_580	137
1920	3300049572	Ga0501036_0041477	Ga0501036_0041477_2105_2545	137
1921	3300049572	Ga0501036_0261933	Ga0501036_0261933_336_749	137
1922	3300049572	Ga0501036_0550007	Ga0501036_0550007_28_453	137
1923	3300049572	Ga0501036_0781508	Ga0501036_0781508_80_502	137
1924	3300049572	Ga0501036_0815483	Ga0501036_0815483_13_438	137
1925	3300049573	Ga0501037_0340236	Ga0501037_0340236_35_451	137
1926	3300049573	Ga0501037_0617426	Ga0501037_0617426_251_676	137
1927	3300049574	Ga0501038_0619306	Ga0501038_0619306_363_779	137
1928	3300049574	Ga0501038_0805151	Ga0501038_0805151_263_688	137
1929	3300049574	Ga0501038_1279176	Ga0501038_1279176_83_508	137
1930	3300049575	Ga0501039_0038801	Ga0501039_0038801_862_1287	137
1931	3300049575	Ga0501039_0061806	Ga0501039_0061806_1676_2101	137
1932	3300049575	Ga0501039_0181447	Ga0501039_0181447_579_992	137
1933	3300049575	Ga0501039_0242600	Ga0501039_0242600_462_878	137
1934	3300049576	Ga0501040_0033398	Ga0501040_0033398_2840_3265	137
1935	3300049576	Ga0501040_0085634	Ga0501040_0085634_506_931	137
1936	3300049576	Ga0501040_0122475	Ga0501040_0122475_859_1275	137
1937	3300049576	Ga0501040_0144838	Ga0501040_0144838_1018_1431	137
1938	3300049576	Ga0501040_0353542	Ga0501040_0353542_35_460	137
1939	3300049576	Ga0501040_0389614	Ga0501040_0389614_406_822	137
1940	3300049576	Ga0501040_0611734	Ga0501040_0611734_301_726	137
1941	3300049576	Ga0501040_0640735	Ga0501040_0640735_181_621	137
1942	3300049576	Ga0501040_0732536	Ga0501040_0732536_221_643	137
1943	3300049576	Ga0501040_0772894	Ga0501040_0772894_62_487	137
1944	3300049576	Ga0501040_0931619	Ga0501040_0931619_183_608	137
1945	3300049576	Ga0501040_1035797	Ga0501040_1035797_67_492	137
1946	3300049577	Ga0501041_0020185	Ga0501041_0020185_2725_3138	137
1947	3300049577	Ga0501041_0035058	Ga0501041_0035058_2039_2464	137
1948	3300049577	Ga0501041_0083554	Ga0501041_0083554_611_1036	137
1949	3300049577	Ga0501041_0093312	Ga0501041_0093312_239_679	137
1950	3300049577	Ga0501041_0105774	Ga0501041_0105774_623_1039	137
1951	3300049577	Ga0501041_0482244	Ga0501041_0482244_325_750	137
1952	3300049577	Ga0501041_0703078	Ga0501041_0703078_27_452	137
1953	3300049577	Ga0501041_0779815	Ga0501041_0779815_13_438	137
1954	3300049578	Ga0501042_0014342	Ga0501042_0014342_3976_4401	137
1955	3300049578	Ga0501042_0032497	Ga0501042_0032497_1878_2318	137
1956	3300049578	Ga0501042_0049023	Ga0501042_0049023_842_1255	137
1957	3300049578	Ga0501042_0307305	Ga0501042_0307305_693_1118	137
1958	3300049578	Ga0501042_1456506	Ga0501042_1456506_41_466	137
1959	3300049580	Ga0501046_0037734	Ga0501046_0037734_2259_2699	137
1960	3300049580	Ga0501046_0097864	Ga0501046_0097864_1429_1854	137
1961	3300049580	Ga0501046_0148187	Ga0501046_0148187_1000_1425	137
1962	3300049580	Ga0501046_0187146	Ga0501046_0187146_573_986	137
1963	3300049580	Ga0501046_0258405	Ga0501046_0258405_723_1148	137
1964	3300049580	Ga0501046_0689183	Ga0501046_0689183_197_622	137
1965	3300049581	Ga0501047_0033605	Ga0501047_0033605_745_1170	137
1966	3300049582	Ga0501048_0013721	Ga0501048_0013721_2627_3067	137
1967	3300049582	Ga0501048_0071770	Ga0501048_0071770_1014_1439	137
1968	3300049582	Ga0501048_0078759	Ga0501048_0078759_617_1033	137
1969	3300049582	Ga0501048_0095047	Ga0501048_0095047_529_954	137
1970	3300049582	Ga0501048_0125270	Ga0501048_0125270_1295_1720	137
1971	3300049582	Ga0501048_0267495	Ga0501048_0267495_225_650	137
1972	3300049582	Ga0501048_0351785	Ga0501048_0351785_527_952	137
1973	3300049582	Ga0501048_0492771	Ga0501048_0492771_269_691	137
1974	3300049582	Ga0501048_0851631	Ga0501048_0851631_91_504	137
1975	3300049583	Ga0501067_0322911	Ga0501067_0322911_245_670	137
1976	3300049584	Ga0501068_0079249	Ga0501068_0079249_573_1037	137
1977	3300049584	Ga0501068_0233074	Ga0501068_0233074_26_451	137
1978	3300049584	Ga0501068_0536363	Ga0501068_0536363_320_745	137
1979	3300049585	Ga0501069_0451729	Ga0501069_0451729_266_691	137
1980	3300049585	Ga0501069_0606974	Ga0501069_0606974_159_584	137
1981	3300049586	Ga0501070_0626441	Ga0501070_0626441_378_803	137
1982	3300049586	Ga0501070_1176813	Ga0501070_1176813_49_474	137
1983	3300049587	Ga0501071_0147227	Ga0501071_0147227_29_454	137
1984	3300049587	Ga0501071_0229710	Ga0501071_0229710_428_853	137
1985	3300049587	Ga0501071_0235095	Ga0501071_0235095_837_1262	137
1986	3300049587	Ga0501071_0259486	Ga0501071_0259486_463_903	137
1987	3300049587	Ga0501071_0951699	Ga0501071_0951699_50_475	137
1988	3300049587	Ga0501071_0980702	Ga0501071_0980702_121_546	137
1989	3300049587	Ga0501071_1363385	Ga0501071_1363385_25_450	137
1990	3300049588	Ga0501072_0012080	Ga0501072_0012080_1924_2349	137
1991	3300049588	Ga0501072_0018529	Ga0501072_0018529_1711_2136	137
1992	3300049588	Ga0501072_0060525	Ga0501072_0060525_42_455	137
1993	3300049588	Ga0501072_0067976	Ga0501072_0067976_851_1276	137
1994	3300049588	Ga0501072_0289484	Ga0501072_0289484_112_528	137
1995	3300049588	Ga0501072_0551271	Ga0501072_0551271_474_899	137
1996	3300049588	Ga0501072_0852379	Ga0501072_0852379_238_678	137
1997	3300049588	Ga0501072_1092152	Ga0501072_1092152_172_597	137
1998	3300049588	Ga0501072_1357009	Ga0501072_1357009_112_537	137
1999	3300049588	Ga0501072_1398234	Ga0501072_1398234_17_442	137
2000	3300049589	Ga0501073_0335358	Ga0501073_0335358_130_594	137
2001	3300049589	Ga0501073_0453433	Ga0501073_0453433_216_641	137
2002	3300049589	Ga0501073_0512904	Ga0501073_0512904_333_758	137
2003	3300049590	Ga0501074_0032023	Ga0501074_0032023_815_1240	137
2004	3300049590	Ga0501074_0069510	Ga0501074_0069510_615_1031	137
2005	3300049590	Ga0501074_0073675	Ga0501074_0073675_1295_1720	137
2006	3300049590	Ga0501074_0088859	Ga0501074_0088859_1590_2015	137
2007	3300049590	Ga0501074_0337002	Ga0501074_0337002_72_512	137
2008	3300049590	Ga0501074_0445698	Ga0501074_0445698_120_533	137
2009	3300049590	Ga0501074_0468065	Ga0501074_0468065_45_470	137
2010	3300049590	Ga0501074_0552690	Ga0501074_0552690_360_785	137
2011	3300049591	Ga0501075_0014965	Ga0501075_0014965_1343_1756	137
2012	3300049591	Ga0501075_0022977	Ga0501075_0022977_1530_1955	137
2013	3300049591	Ga0501075_0032571	Ga0501075_0032571_2735_3175	137
2014	3300049591	Ga0501075_0036489	Ga0501075_0036489_2928_3344	137
2015	3300049591	Ga0501075_0054431	Ga0501075_0054431_2381_2806	137
2016	3300049591	Ga0501075_0056171	Ga0501075_0056171_1556_1981	137
2017	3300049591	Ga0501075_0082026	Ga0501075_0082026_125_550	137
2018	3300049591	Ga0501075_0133814	Ga0501075_0133814_670_1095	137
2019	3300049591	Ga0501075_0181695	Ga0501075_0181695_1059_1484	137
2020	3300049591	Ga0501075_0256528	Ga0501075_0256528_655_1080	137
2021	3300049591	Ga0501075_0449152	Ga0501075_0449152_401_826	137
2022	3300049591	Ga0501075_0897609	Ga0501075_0897609_96_521	137
2023	3300049591	Ga0501075_0958487	Ga0501075_0958487_78_494	137
2024	3300049591	Ga0501075_1019633	Ga0501075_1019633_169_609	137
2025	3300049591	Ga0501075_1284664	Ga0501075_1284664_113_538	137
2026	3300049592	Ga0501076_0006741	Ga0501076_0006741_5036_5449	137
2027	3300049592	Ga0501076_0016605	Ga0501076_0016605_3794_4219	137
2028	3300049592	Ga0501076_0066363	Ga0501076_0066363_1107_1532	137
2029	3300049592	Ga0501076_0072166	Ga0501076_0072166_2220_2645	137
2030	3300049592	Ga0501076_0128722	Ga0501076_0128722_70_495	137
2031	3300049592	Ga0501076_0192768	Ga0501076_0192768_75_491	137
2032	3300049592	Ga0501076_0412416	Ga0501076_0412416_244_669	137
2033	3300049592	Ga0501076_0854671	Ga0501076_0854671_213_629	137
2034	3300049592	Ga0501076_1698357	Ga0501076_1698357_48_473	137
2035	3300049593	Ga0501077_0029542	Ga0501077_0029542_2326_2739	137
2036	3300049593	Ga0501077_0054477	Ga0501077_0054477_1883_2308	137
2037	3300049593	Ga0501077_0059188	Ga0501077_0059188_1121_1546	137
2038	3300049593	Ga0501077_0123526	Ga0501077_0123526_277_702	137
2039	3300049593	Ga0501077_0229859	Ga0501077_0229859_572_997	137
2040	3300049593	Ga0501077_0236191	Ga0501077_0236191_361_777	137
2041	3300049593	Ga0501077_0334887	Ga0501077_0334887_442_867	137
2042	3300049655	Ga0501208_090993	Ga0501208_090993_71_496	137
2043	3300049657	Ga0501210_016797	Ga0501210_016797_56_481	137
2044	3300049661	Ga0501217_086667	Ga0501217_086667_220_645	137
2045	3300049665	Ga0501227_091495	Ga0501227_091495_207_629	137
2046	3300049679	Ga0501249_018373	Ga0501249_018373_466_888	137
2047	3300049686	Ga0501257_038868	Ga0501257_038868_626_1051	137
2048	3300049686	Ga0501257_158765	Ga0501257_158765_157_579	137
2049	3300049705	Ga0501225_0368319	Ga0501225_0368319_18_458	137
2050	3300049707	Ga0501234_052759	Ga0501234_052759_108_533	137
2051	3300049741	Ga0501079_0012691	Ga0501079_0012691_5747_6163	137
2052	3300049741	Ga0501079_0018519	Ga0501079_0018519_3877_4302	137
2053	3300049741	Ga0501079_0177276	Ga0501079_0177276_596_1009	137
2054	3300049741	Ga0501079_0439943	Ga0501079_0439943_515_940	137
2055	3300049741	Ga0501079_0511394	Ga0501079_0511394_474_899	137
2056	3300049741	Ga0501079_0647913	Ga0501079_0647913_376_801	137
2057	3300049741	Ga0501079_0758571	Ga0501079_0758571_137_550	137
2058	3300049741	Ga0501079_1247117	Ga0501079_1247117_49_474	137
2059	3300049742	Ga0501080_0156447	Ga0501080_0156447_1129_1545	137
2060	3300049742	Ga0501080_0173258	Ga0501080_0173258_1250_1675	137
2061	3300049742	Ga0501080_0210625	Ga0501080_0210625_939_1364	137
2062	3300049742	Ga0501080_0275098	Ga0501080_0275098_479_904	137
2063	3300049742	Ga0501080_0365091	Ga0501080_0365091_285_710	137
2064	3300049742	Ga0501080_0463336	Ga0501080_0463336_264_686	137
2065	3300049742	Ga0501080_1105616	Ga0501080_1105616_24_440	137
2066	3300049742	Ga0501080_1476498	Ga0501080_1476498_10_435	137
2067	3300049743	Ga0501081_0019645	Ga0501081_0019645_455_871	137
2068	3300049743	Ga0501081_0020963	Ga0501081_0020963_1924_2349	137
2069	3300049743	Ga0501081_0032194	Ga0501081_0032194_166_582	137
2070	3300049743	Ga0501081_0048503	Ga0501081_0048503_62_487	137
2071	3300049743	Ga0501081_0050237	Ga0501081_0050237_1373_1813	137
2072	3300049743	Ga0501081_0078473	Ga0501081_0078473_1821_2246	137
2073	3300049743	Ga0501081_0106766	Ga0501081_0106766_1034_1450	137
2074	3300049743	Ga0501081_0218879	Ga0501081_0218879_664_1089	137
2075	3300049743	Ga0501081_0224277	Ga0501081_0224277_467_892	137
2076	3300049743	Ga0501081_0310001	Ga0501081_0310001_699_1139	137
2077	3300049743	Ga0501081_0359397	Ga0501081_0359397_60_485	137
2078	3300049743	Ga0501081_0509077	Ga0501081_0509077_34_447	137
2079	3300049744	Ga0501083_0104824	Ga0501083_0104824_138_563	137
2080	3300049744	Ga0501083_0469635	Ga0501083_0469635_60_485	137
2081	3300049769	Ga0501272_037387	Ga0501272_037387_192_617	137
2082	3300049770	Ga0501273_006923	Ga0501273_006923_384_809	137
2083	3300049774	Ga0501278_011701	Ga0501278_011701_146_571	137
2084	3300049822	Ga0501035_0176934	Ga0501035_0176934_928_1344	137
2085	3300049822	Ga0501035_0186754	Ga0501035_0186754_1334_1759	137
2086	3300049822	Ga0501035_0318236	Ga0501035_0318236_771_1196	137
2087	3300049822	Ga0501035_0486003	Ga0501035_0486003_170_610	137
2088	3300049822	Ga0501035_0535866	Ga0501035_0535866_137_562	137
2089	3300049822	Ga0501035_0550229	Ga0501035_0550229_34_459	137
2090	3300049824	Ga0501045_0004175	Ga0501045_0004175_2612_3028	137
2091	3300049824	Ga0501045_0008437	Ga0501045_0008437_1659_2099	137
2092	3300049824	Ga0501045_0031277	Ga0501045_0031277_2717_3142	137
2093	3300049824	Ga0501045_0051561	Ga0501045_0051561_50_475	137
2094	3300049824	Ga0501045_0053686	Ga0501045_0053686_2419_2844	137
2095	3300049824	Ga0501045_0054873	Ga0501045_0054873_1647_2072	137
2096	3300049824	Ga0501045_0069093	Ga0501045_0069093_957_1382	137
2097	3300049824	Ga0501045_0083823	Ga0501045_0083823_578_1003	137
2098	3300049824	Ga0501045_0096356	Ga0501045_0096356_428_841	137
2099	3300049824	Ga0501045_0937225	Ga0501045_0937225_51_467	137
2100	3300049824	Ga0501045_1275385	Ga0501045_1275385_21_446	137
2101	3300049851	Ga0501212_007829	Ga0501212_007829_102_527	137
2102	3300050489	nmdc:mga03683_830_c1	nmdc:mga03683_830_c1_6413_6838	137
2103	3300050490	nmdc:mga03n38_66871_c1	nmdc:mga03n38_66871_c1_901_1326	137
2104	3300050491	nmdc:mga00v17_127345_c1	nmdc:mga00v17_127345_c1_522_947	137
2105	3300050491	nmdc:mga00v17_1497_c1	nmdc:mga00v17_1497_c1_941_1366	137
2106	3300050491	nmdc:mga00v17_3322_c1	nmdc:mga00v17_3322_c1_730_1155	137
2107	3300050491	nmdc:mga00v17_796932_c1	nmdc:mga00v17_796932_c1_10_435	137
2108	3300050492	nmdc:mga0yw44_3081_c1	nmdc:mga0yw44_3081_c1_3148_3573	137
2109	3300050493	nmdc:mga0k408_23995_c1	nmdc:mga0k408_23995_c1_2052_2477	137
2110	3300050493	nmdc:mga0k408_262749_c1	nmdc:mga0k408_262749_c1_229_651	137
2111	3300050493	nmdc:mga0k408_29187_c2	nmdc:mga0k408_29187_c2_1451_1873	137
2112	3300050494	nmdc:mga06z11_75398_c1	nmdc:mga06z11_75398_c1_753_1175	137
2113	3300050494	nmdc:mga06z11_9437_c1	nmdc:mga06z11_9437_c1_2169_2594	137
2114	3300050494	nmdc:mga06z11_9765_c1	nmdc:mga06z11_9765_c1_2126_2551	137
2115	3300050495	nmdc:mga04h51_19918_c2	nmdc:mga04h51_19918_c2_74_499	137
2116	3300050495	nmdc:mga04h51_44017_c1	nmdc:mga04h51_44017_c1_462_884	137
2117	3300050496	nmdc:mga07m45_5892_c1	nmdc:mga07m45_5892_c1_1045_1470	137
2118	3300050507	nmdc:mga05p37_11036_c1	nmdc:mga05p37_11036_c1_2964_3389	137
2119	3300050507	nmdc:mga05p37_115407_c2	nmdc:mga05p37_115407_c2_737_1162	137
2120	3300050507	nmdc:mga05p37_118577_c1	nmdc:mga05p37_118577_c1_1929_2345	137
2121	3300050507	nmdc:mga05p37_158310_c1	nmdc:mga05p37_158310_c1_198_623	137
2122	3300050507	nmdc:mga05p37_16973_c1	nmdc:mga05p37_16973_c1_65_478	137
2123	3300050507	nmdc:mga05p37_17293_c1	nmdc:mga05p37_17293_c1_6570_6995	137
2124	3300050507	nmdc:mga05p37_17386_c1	nmdc:mga05p37_17386_c1_4382_4807	137
2125	3300050507	nmdc:mga05p37_270637_c1	nmdc:mga05p37_270637_c1_1387_1812	137
2126	3300050507	nmdc:mga05p37_27725_c1	nmdc:mga05p37_27725_c1_5533_5955	137
2127	3300050507	nmdc:mga05p37_29448_c1	nmdc:mga05p37_29448_c1_380_805	137
2128	3300050507	nmdc:mga05p37_326511_c1	nmdc:mga05p37_326511_c1_314_730	137
2129	3300050507	nmdc:mga05p37_356099_c1	nmdc:mga05p37_356099_c1_1133_1558	137
2130	3300050507	nmdc:mga05p37_4213_c1	nmdc:mga05p37_4213_c1_11725_12141	137
2131	3300050507	nmdc:mga05p37_46174_c1	nmdc:mga05p37_46174_c1_440_865	137
2132	3300050507	nmdc:mga05p37_553931_c1	nmdc:mga05p37_553931_c1_256_696	137
2133	3300050507	nmdc:mga05p37_580266_c1	nmdc:mga05p37_580266_c1_535_960	137
2134	3300050507	nmdc:mga05p37_58588_c1	nmdc:mga05p37_58588_c1_569_994	137
2135	3300050507	nmdc:mga05p37_6327_c1	nmdc:mga05p37_6327_c1_8784_9224	137
2136	3300050507	nmdc:mga05p37_65_c1	nmdc:mga05p37_65_c1_21714_22139	137
2137	3300050507	nmdc:mga05p37_787443_c1	nmdc:mga05p37_787443_c1_260_676	137
2138	3300050507	nmdc:mga05p37_828736_c1	nmdc:mga05p37_828736_c1_327_752	137
2139	3300050507	nmdc:mga05p37_83124_c1	nmdc:mga05p37_83124_c1_626_1066	137
2140	3300050507	nmdc:mga05p37_857133_c1	nmdc:mga05p37_857133_c1_422_847	137
2141	3300050508	nmdc:mga09592_140646_c1	nmdc:mga09592_140646_c1_884_1300	137
2142	3300050508	nmdc:mga09592_193438_c1	nmdc:mga09592_193438_c1_1010_1435	137
2143	3300050508	nmdc:mga09592_20919_c1	nmdc:mga09592_20919_c1_432_857	137
2144	3300050508	nmdc:mga09592_26106_c1	nmdc:mga09592_26106_c1_1423_1845	137
2145	3300050508	nmdc:mga09592_413295_c1	nmdc:mga09592_413295_c1_586_1011	137
2146	3300050508	nmdc:mga09592_43557_c1	nmdc:mga09592_43557_c1_656_1081	137
2147	3300050508	nmdc:mga09592_53079_c1	nmdc:mga09592_53079_c1_553_978	137
2148	3300050508	nmdc:mga09592_712424_c1	nmdc:mga09592_712424_c1_66_491	137
2149	3300050508	nmdc:mga09592_81897_c1	nmdc:mga09592_81897_c1_1052_1492	137
2150	3300050508	nmdc:mga09592_97790_c1	nmdc:mga09592_97790_c1_135_560	137
2151	3300050509	nmdc:mga0qj67_172206_c1	nmdc:mga0qj67_172206_c1_48_464	137
2152	3300050509	nmdc:mga0qj67_17403_c1	nmdc:mga0qj67_17403_c1_558_983	137
2153	3300050509	nmdc:mga0qj67_22250_c1	nmdc:mga0qj67_22250_c1_4013_4438	137
2154	3300050509	nmdc:mga0qj67_2372_c1	nmdc:mga0qj67_2372_c1_7231_7656	137
2155	3300050509	nmdc:mga0qj67_301103_c1	nmdc:mga0qj67_301103_c1_715_1137	137
2156	3300050509	nmdc:mga0qj67_379729_c1	nmdc:mga0qj67_379729_c1_13_438	137
2157	3300050509	nmdc:mga0qj67_39738_c1	nmdc:mga0qj67_39738_c1_812_1237	137
2158	3300050509	nmdc:mga0qj67_410538_c1	nmdc:mga0qj67_410538_c1_270_695	137
2159	3300050509	nmdc:mga0qj67_416183_c1	nmdc:mga0qj67_416183_c1_489_926	137
2160	3300050509	nmdc:mga0qj67_63444_c1	nmdc:mga0qj67_63444_c1_37_462	137
2161	3300050509	nmdc:mga0qj67_71314_c1	nmdc:mga0qj67_71314_c1_1665_2087	137
2162	3300050509	nmdc:mga0qj67_869406_c1	nmdc:mga0qj67_869406_c1_122_547	137
2163	3300050510	nmdc:mga06r32_101221_c1	nmdc:mga06r32_101221_c1_1349_1774	137
2164	3300050510	nmdc:mga06r32_121583_c1	nmdc:mga06r32_121583_c1_520_945	137
2165	3300050510	nmdc:mga06r32_122428_c1	nmdc:mga06r32_122428_c1_603_1028	137
2166	3300050510	nmdc:mga06r32_174692_c1	nmdc:mga06r32_174692_c1_1153_1575	137
2167	3300050510	nmdc:mga06r32_2097_c1	nmdc:mga06r32_2097_c1_13245_13661	137
2168	3300050510	nmdc:mga06r32_25316_c1	nmdc:mga06r32_25316_c1_521_946	137
2169	3300050510	nmdc:mga06r32_270738_c1	nmdc:mga06r32_270738_c1_764_1180	137
2170	3300050510	nmdc:mga06r32_286086_c1	nmdc:mga06r32_286086_c1_82_498	137
2171	3300050510	nmdc:mga06r32_332554_c1	nmdc:mga06r32_332554_c1_319_744	137
2172	3300050510	nmdc:mga06r32_687531_c1	nmdc:mga06r32_687531_c1_308_730	137
2173	3300050510	nmdc:mga06r32_7117_c1	nmdc:mga06r32_7117_c1_6975_7400	137
2174	3300050510	nmdc:mga06r32_734962_c1	nmdc:mga06r32_734962_c1_497_922	137
2175	3300050510	nmdc:mga06r32_81958_c1	nmdc:mga06r32_81958_c1_931_1347	137
2176	3300050510	nmdc:mga06r32_847603_c1	nmdc:mga06r32_847603_c1_295_720	137
2177	3300050510	nmdc:mga06r32_9166_c1	nmdc:mga06r32_9166_c1_8318_8743	137
2178	3300050511	nmdc:mga08y16_1002702_c1	nmdc:mga08y16_1002702_c1_353_778	137
2179	3300050511	nmdc:mga08y16_1017032_c1	nmdc:mga08y16_1017032_c1_30_455	137
2180	3300050511	nmdc:mga08y16_1036024_c1	nmdc:mga08y16_1036024_c1_280_705	137
2181	3300050511	nmdc:mga08y16_1116467_c1	nmdc:mga08y16_1116467_c1_238_663	137
2182	3300050511	nmdc:mga08y16_1209440_c1	nmdc:mga08y16_1209440_c1_28_453	137
2183	3300050511	nmdc:mga08y16_131088_c1	nmdc:mga08y16_131088_c1_1102_1527	137
2184	3300050511	nmdc:mga08y16_143634_c1	nmdc:mga08y16_143634_c1_1474_1899	137
2185	3300050511	nmdc:mga08y16_144030_c1	nmdc:mga08y16_144030_c1_1738_2163	137
2186	3300050511	nmdc:mga08y16_15360_c1	nmdc:mga08y16_15360_c1_7057_7482	137
2187	3300050511	nmdc:mga08y16_155_c1	nmdc:mga08y16_155_c1_5793_6218	137
2188	3300050511	nmdc:mga08y16_176628_c1	nmdc:mga08y16_176628_c1_1757_2182	137
2189	3300050511	nmdc:mga08y16_1804_c1	nmdc:mga08y16_1804_c1_5085_5501	137
2190	3300050511	nmdc:mga08y16_2707_c1	nmdc:mga08y16_2707_c1_5800_6216	137
2191	3300050511	nmdc:mga08y16_291394_c1	nmdc:mga08y16_291394_c1_329_754	137
2192	3300050511	nmdc:mga08y16_40599_c1	nmdc:mga08y16_40599_c1_2549_2971	137
2193	3300050511	nmdc:mga08y16_463123_c1	nmdc:mga08y16_463123_c1_120_536	137
2194	3300050511	nmdc:mga08y16_59755_c1	nmdc:mga08y16_59755_c1_1204_1629	137
2195	3300050511	nmdc:mga08y16_61945_c1	nmdc:mga08y16_61945_c1_1086_1526	137
2196	3300050511	nmdc:mga08y16_722837_c1	nmdc:mga08y16_722837_c1_185_610	137
2197	3300050511	nmdc:mga08y16_83813_c1	nmdc:mga08y16_83813_c1_2589_3011	137
2198	3300050511	nmdc:mga08y16_87753_c1	nmdc:mga08y16_87753_c1_2761_3186	137
2199	3300050511	nmdc:mga08y16_92485_c1	nmdc:mga08y16_92485_c1_2199_2621	137
2200	3300050512	nmdc:mga0n895_1020598_c1	nmdc:mga0n895_1020598_c1_204_629	137
2201	3300050512	nmdc:mga0n895_1640069_c1	nmdc:mga0n895_1640069_c1_111_551	137
2202	3300050512	nmdc:mga0n895_17556_c1	nmdc:mga0n895_17556_c1_1949_2374	137
2203	3300050512	nmdc:mga0n895_187035_c1	nmdc:mga0n895_187035_c1_238_663	137
2204	3300050512	nmdc:mga0n895_22365_c1	nmdc:mga0n895_22365_c1_3725_4150	137
2205	3300050512	nmdc:mga0n895_24421_c1	nmdc:mga0n895_24421_c1_4874_5299	137
2206	3300050512	nmdc:mga0n895_24941_c1	nmdc:mga0n895_24941_c1_815_1240	137
2207	3300050512	nmdc:mga0n895_255644_c1	nmdc:mga0n895_255644_c1_1031_1447	137
2208	3300050512	nmdc:mga0n895_25766_c1	nmdc:mga0n895_25766_c1_3439_3864	137
2209	3300050512	nmdc:mga0n895_267349_c1	nmdc:mga0n895_267349_c1_698_1114	137
2210	3300050512	nmdc:mga0n895_26927_c1	nmdc:mga0n895_26927_c1_558_983	137
2211	3300050512	nmdc:mga0n895_283875_c1	nmdc:mga0n895_283875_c1_578_1003	137
2212	3300050512	nmdc:mga0n895_29459_c1	nmdc:mga0n895_29459_c1_1146_1571	137
2213	3300050512	nmdc:mga0n895_320295_c1	nmdc:mga0n895_320295_c1_677_1090	137
2214	3300050512	nmdc:mga0n895_32578_c1	nmdc:mga0n895_32578_c1_1584_2024	137
2215	3300050512	nmdc:mga0n895_36985_c1	nmdc:mga0n895_36985_c1_248_673	137
2216	3300050512	nmdc:mga0n895_392235_c1	nmdc:mga0n895_392235_c1_79_504	137
2217	3300050512	nmdc:mga0n895_717531_c1	nmdc:mga0n895_717531_c1_522_947	137
2218	3300050512	nmdc:mga0n895_91417_c1	nmdc:mga0n895_91417_c1_1616_2041	137
2219	3300050512	nmdc:mga0n895_977671_c1	nmdc:mga0n895_977671_c1_332_757	137
2220	3300050513	nmdc:mga0rr50_134663_c1	nmdc:mga0rr50_134663_c1_894_1334	137
2221	3300050513	nmdc:mga0rr50_1773_c1	nmdc:mga0rr50_1773_c1_6584_7009	137
2222	3300050513	nmdc:mga0rr50_2263_c1	nmdc:mga0rr50_2263_c1_3938_4363	137
2223	3300050513	nmdc:mga0rr50_240651_c1	nmdc:mga0rr50_240651_c1_508_933	137
2224	3300050513	nmdc:mga0rr50_37105_c1	nmdc:mga0rr50_37105_c1_583_1008	137
2225	3300050513	nmdc:mga0rr50_373_c1	nmdc:mga0rr50_373_c1_22693_23118	137
2226	3300050513	nmdc:mga0rr50_37885_c1	nmdc:mga0rr50_37885_c1_902_1318	137
2227	3300050513	nmdc:mga0rr50_43434_c1	nmdc:mga0rr50_43434_c1_259_684	137
2228	3300050513	nmdc:mga0rr50_48198_c1	nmdc:mga0rr50_48198_c1_1912_2337	137
2229	3300050513	nmdc:mga0rr50_652911_c1	nmdc:mga0rr50_652911_c1_293_718	137
2230	3300050513	nmdc:mga0rr50_678669_c1	nmdc:mga0rr50_678669_c1_83_514	137
2231	3300050513	nmdc:mga0rr50_74213_c1	nmdc:mga0rr50_74213_c1_1832_2257	137
2232	3300050513	nmdc:mga0rr50_832684_c1	nmdc:mga0rr50_832684_c1_210_650	137
2233	3300050513	nmdc:mga0rr50_84011_c1	nmdc:mga0rr50_84011_c1_558_983	137
2234	3300050513	nmdc:mga0rr50_919623_c1	nmdc:mga0rr50_919623_c1_191_616	137
2235	3300050514	nmdc:mga08x19_10007_c1	nmdc:mga08x19_10007_c1_4758_5183	137
2236	3300050514	nmdc:mga08x19_1121760_c1	nmdc:mga08x19_1121760_c1_54_467	137
2237	3300050514	nmdc:mga08x19_14095_c1	nmdc:mga08x19_14095_c1_2361_2774	137
2238	3300050514	nmdc:mga08x19_175218_c1	nmdc:mga08x19_175218_c1_120_533	137
2239	3300050514	nmdc:mga08x19_17_c1	nmdc:mga08x19_17_c1_33962_34402	137
2240	3300050514	nmdc:mga08x19_220624_c1	nmdc:mga08x19_220624_c1_15_440	137
2241	3300050514	nmdc:mga08x19_277610_c1	nmdc:mga08x19_277610_c1_423_848	137
2242	3300050514	nmdc:mga08x19_308589_c1	nmdc:mga08x19_308589_c1_479_904	137
2243	3300050514	nmdc:mga08x19_57439_c1	nmdc:mga08x19_57439_c1_1700_2140	137
2244	3300050514	nmdc:mga08x19_606480_c1	nmdc:mga08x19_606480_c1_132_557	137
2245	3300050515	nmdc:mga0a205_10695_c1	nmdc:mga0a205_10695_c1_4231_4647	137
2246	3300050515	nmdc:mga0a205_1287823_c1	nmdc:mga0a205_1287823_c1_128_553	137
2247	3300050515	nmdc:mga0a205_1418121_c1	nmdc:mga0a205_1418121_c1_29_445	137
2248	3300050515	nmdc:mga0a205_1574712_c1	nmdc:mga0a205_1574712_c1_25_450	137
2249	3300050515	nmdc:mga0a205_203776_c1	nmdc:mga0a205_203776_c1_723_1148	137
2250	3300050515	nmdc:mga0a205_228133_c1	nmdc:mga0a205_228133_c1_1023_1439	137
2251	3300050515	nmdc:mga0a205_232843_c1	nmdc:mga0a205_232843_c1_1090_1515	137
2252	3300050515	nmdc:mga0a205_24132_c1	nmdc:mga0a205_24132_c1_3515_3940	137
2253	3300050515	nmdc:mga0a205_249769_c1	nmdc:mga0a205_249769_c1_518_943	137
2254	3300050515	nmdc:mga0a205_26068_c1	nmdc:mga0a205_26068_c1_4789_5214	137
2255	3300050515	nmdc:mga0a205_267551_c1	nmdc:mga0a205_267551_c1_582_1007	137
2256	3300050515	nmdc:mga0a205_3001_c1	nmdc:mga0a205_3001_c1_4396_4821	137
2257	3300050515	nmdc:mga0a205_3048_c1	nmdc:mga0a205_3048_c1_9861_10286	137
2258	3300050515	nmdc:mga0a205_30905_c1	nmdc:mga0a205_30905_c1_4181_4597	137
2259	3300050515	nmdc:mga0a205_317090_c2	nmdc:mga0a205_317090_c2_68_490	137
2260	3300050515	nmdc:mga0a205_354900_c1	nmdc:mga0a205_354900_c1_385_810	137
2261	3300050515	nmdc:mga0a205_379993_c1	nmdc:mga0a205_379993_c1_111_551	137
2262	3300050515	nmdc:mga0a205_600537_c1	nmdc:mga0a205_600537_c1_311_751	137
2263	3300050515	nmdc:mga0a205_6280_c1	nmdc:mga0a205_6280_c1_2030_2446	137
2264	3300050515	nmdc:mga0a205_74220_c1	nmdc:mga0a205_74220_c1_2553_2978	137
2265	3300050515	nmdc:mga0a205_7607_c1	nmdc:mga0a205_7607_c1_9070_9510	137
2266	3300050515	nmdc:mga0a205_7753_c2	nmdc:mga0a205_7753_c2_4399_4824	137
2267	3300050515	nmdc:mga0a205_818402_c1	nmdc:mga0a205_818402_c1_208_621	137
2268	3300050515	nmdc:mga0a205_832780_c1	nmdc:mga0a205_832780_c1_73_495	137
2269	3300053085	Ga0495619_0119959	Ga0495619_0119959_178_603	137
2270	3300053096	Ga0500641_0005245	Ga0500641_0005245_3667_4089	137
2271	3300053104	Ga0500556_0112794	Ga0500556_0112794_172_597	137
2272	3300053129	Ga0500628_021149	Ga0500628_021149_404_829	137
2273	3300053129	Ga0500628_116926	Ga0500628_116926_218_643	137
2274	3300053134	Ga0500658_0169562	Ga0500658_0169562_421_843	137
2275	3300053139	Ga0500568_0002524	Ga0500568_0002524_6023_6445	137
2276	3300053158	Ga0500627_0323977	Ga0500627_0323977_131_556	137
2277	3300054114	Ga0501084_0029531	Ga0501084_0029531_2755_3180	137
2278	3300054114	Ga0501084_0031787	Ga0501084_0031787_590_1006	137
2279	3300054114	Ga0501084_0032922	Ga0501084_0032922_2344_2784	137
2280	3300054114	Ga0501084_0139760	Ga0501084_0139760_879_1304	137
2281	3300054114	Ga0501084_0146768	Ga0501084_0146768_733_1158	137
2282	3300054114	Ga0501084_0148992	Ga0501084_0148992_1368_1793	137
2283	3300059421	Ga0590071_000185	Ga0590071_000185_12809_13231	137
2284	3300059421	Ga0590071_002230	Ga0590071_002230_2674_3096	137
2285	3300059421	Ga0590071_002630	Ga0590071_002630_2009_2434	137
2286	3300059421	Ga0590071_014932	Ga0590071_014932_289_714	137
2287	3300059421	Ga0590071_065848	Ga0590071_065848_181_606	137
2288	3300059421	Ga0590071_113679	Ga0590071_113679_169_591	137
2289	3300059421	Ga0590071_120580	Ga0590071_120580_91_516	137
2290	3300059421	Ga0590071_129332	Ga0590071_129332_90_515	137
2291	3300059421	Ga0590071_199301	Ga0590071_199301_35_460	137
2292	3300059423	Ga0590074_000624	Ga0590074_000624_2772_3194	137
2293	3300059423	Ga0590074_001499	Ga0590074_001499_145_567	137
2294	3300059423	Ga0590074_085454	Ga0590074_085454_98_523	137
2295	3300059424	Ga0590075_000204	Ga0590075_000204_14529_14951	137
2296	3300059424	Ga0590075_001831	Ga0590075_001831_1000_1422	137
2297	3300059424	Ga0590075_011111	Ga0590075_011111_45_470	137
2298	3300059424	Ga0590075_037586	Ga0590075_037586_94_519	137
2299	3300059424	Ga0590075_067606	Ga0590075_067606_102_524	137
2300	3300059426	Ga0590077_001004	Ga0590077_001004_710_1132	137
2301	3300059426	Ga0590077_017613	Ga0590077_017613_31_453	137
2302	3300059426	Ga0590077_038028	Ga0590077_038028_263_688	137
2303	3300059490	Ga0587066_092639	Ga0587066_092639_94_519	137
2304	3300059506	Ga0587085_131632	Ga0587085_131632_62_487	137
2305	3300059511	Ga0587091_215394	Ga0587091_215394_70_495	137
2306	3300059623	Ga0587101_124978	Ga0587101_124978_63_488	137
2307	3300059625	Ga0587113_011289	Ga0587113_011289_366_791	137
2308	3300059655	Ga0587114_014789	Ga0587114_014789_516_941	137
2309	3300060353	Ga0501082_0004163	Ga0501082_0004163_7014_7430	137
2310	3300060353	Ga0501082_0016570	Ga0501082_0016570_1251_1691	137
2311	3300060353	Ga0501082_0025650	Ga0501082_0025650_821_1246	137
2312	3300060353	Ga0501082_0063820	Ga0501082_0063820_2714_3130	137
2313	3300060353	Ga0501082_0246947	Ga0501082_0246947_990_1415	137
2314	3300060353	Ga0501082_0372611	Ga0501082_0372611_340_753	137
2315	3300060353	Ga0501082_0490967	Ga0501082_0490967_241_663	137
2316	3300060353	Ga0501082_0978599	Ga0501082_0978599_302_727	137
2317	3300060353	Ga0501082_1534311	Ga0501082_1534311_133_546	137
2318	3300061734	Ga0530510_0004587	Ga0530510_0004587_1704_2129	137
2319	3300061734	Ga0530510_0006572	Ga0530510_0006572_6607_7032	137
2320	3300061734	Ga0530510_0006698	Ga0530510_0006698_2731_3144	137
2321	3300061734	Ga0530510_0176519	Ga0530510_0176519_790_1215	137
2322	3300061734	Ga0530510_0229520	Ga0530510_0229520_479_904	137
2323	3300061734	Ga0530510_0267037	Ga0530510_0267037_760_1185	137
2324	3300061734	Ga0530510_0323333	Ga0530510_0323333_335_760	137
2325	3300061734	Ga0530510_0368464	Ga0530510_0368464_399_815	137
2326	3300061734	Ga0530510_0381627	Ga0530510_0381627_464_886	137
2327	3300061734	Ga0530510_0602086	Ga0530510_0602086_390_815	137
2328	3300061734	Ga0530510_0728425	Ga0530510_0728425_94_519	137
2329	3300061734	Ga0530510_0777776	Ga0530510_0777776_65_505	137
2330	3300061734	Ga0530510_1158270	Ga0530510_1158270_112_537	137
2331	3300000546	LJNas_1001687	LJNas_10016872	138
2332	3300005327	Ga0070658_10724255	Ga0070658_107242551	138
2333	3300005331	Ga0070670_100268411	Ga0070670_1002684113	138
2334	3300005333	Ga0070677_10051828	Ga0070677_100518282	138
2335	3300005333	Ga0070677_10804046	Ga0070677_108040461	138
2336	3300005334	Ga0068869_100368006	Ga0068869_1003680063	138
2337	3300005336	Ga0070680_100002147	Ga0070680_10000214719	138
2338	3300005336	Ga0070680_100211172	Ga0070680_1002111724	138
2339	3300005337	Ga0070682_100244290	Ga0070682_1002442904	138
2340	3300005337	Ga0070682_100340832	Ga0070682_1003408322	138
2341	3300005338	Ga0068868_101316151	Ga0068868_1013161512	138
2342	3300005339	Ga0070660_100141693	Ga0070660_1001416932	138
2343	3300005340	Ga0070689_100041808	Ga0070689_1000418085	138
2344	3300005340	Ga0070689_100115211	Ga0070689_1001152114	138
2345	3300005341	Ga0070691_10011131	Ga0070691_100111318	138
2346	3300005345	Ga0070692_10683548	Ga0070692_106835481	138
2347	3300005353	Ga0070669_100094162	Ga0070669_1000941625	138
2348	3300005354	Ga0070675_100294187	Ga0070675_1002941872	138
2349	3300005354	Ga0070675_100910863	Ga0070675_1009108632	138
2350	3300005355	Ga0070671_101110137	Ga0070671_1011101371	138
2351	3300005364	Ga0070673_100312532	Ga0070673_1003125323	138
2352	3300005434	Ga0070709_10001304	Ga0070709_1000130413	138
2353	3300005434	Ga0070709_10087532	Ga0070709_100875324	138
2354	3300005434	Ga0070709_10105469	Ga0070709_101054692	138
2355	3300005434	Ga0070709_10315667	Ga0070709_103156672	138
2356	3300005434	Ga0070709_10973490	Ga0070709_109734901	138
2357	3300005434	Ga0070709_11143934	Ga0070709_111439341	138
2358	3300005435	Ga0070714_100479264	Ga0070714_1004792641	138
2359	3300005435	Ga0070714_100610761	Ga0070714_1006107612	138
2360	3300005435	Ga0070714_101062460	Ga0070714_1010624601	138
2361	3300005435	Ga0070714_101075338	Ga0070714_1010753382	138
2362	3300005436	Ga0070713_100003189	Ga0070713_10000318910	138
2363	3300005436	Ga0070713_100004545	Ga0070713_1000045457	138
2364	3300005436	Ga0070713_100107581	Ga0070713_1001075814	138
2365	3300005436	Ga0070713_100130441	Ga0070713_1001304414	138
2366	3300005436	Ga0070713_100237985	Ga0070713_1002379853	138
2367	3300005436	Ga0070713_101324980	Ga0070713_1013249801	138
2368	3300005437	Ga0070710_10007025	Ga0070710_100070259	138
2369	3300005437	Ga0070710_10278323	Ga0070710_102783233	138
2370	3300005437	Ga0070710_10687860	Ga0070710_106878601	138
2371	3300005439	Ga0070711_100001361	Ga0070711_10000136115	138
2372	3300005439	Ga0070711_100011497	Ga0070711_1000114974	138
2373	3300005439	Ga0070711_100069416	Ga0070711_1000694162	138
2374	3300005440	Ga0070705_100131563	Ga0070705_1001315632	138
2375	3300005441	Ga0070700_100548611	Ga0070700_1005486112	138
2376	3300005455	Ga0070663_100006907	Ga0070663_1000069075	138
2377	3300005457	Ga0070662_100450781	Ga0070662_1004507813	138
2378	3300005458	Ga0070681_10012326	Ga0070681_1001232610	138
2379	3300005458	Ga0070681_10048010	Ga0070681_100480107	138
2380	3300005458	Ga0070681_10197421	Ga0070681_101974213	138
2381	3300005458	Ga0070681_10870718	Ga0070681_108707182	138
2382	3300005458	Ga0070681_10937401	Ga0070681_109374011	138
2383	3300005459	Ga0068867_100153181	Ga0068867_1001531814	138
2384	3300005466	Ga0070685_10594422	Ga0070685_105944221	138
2385	3300005467	Ga0070706_100113508	Ga0070706_1001135084	138
2386	3300005467	Ga0070706_100154037	Ga0070706_1001540376	138
2387	3300005467	Ga0070706_100188506	Ga0070706_1001885061	138
2388	3300005467	Ga0070706_101070506	Ga0070706_1010705061	138
2389	3300005468	Ga0070707_100179164	Ga0070707_1001791643	138
2390	3300005471	Ga0070698_100036969	Ga0070698_1000369693	138
2391	3300005471	Ga0070698_100378004	Ga0070698_1003780044	138
2392	3300005518	Ga0070699_101452480	Ga0070699_1014524801	138
2393	3300005530	Ga0070679_100002074	Ga0070679_10000207424	138
2394	3300005530	Ga0070679_100178886	Ga0070679_1001788864	138
2395	3300005530	Ga0070679_100200414	Ga0070679_1002004142	138
2396	3300005535	Ga0070684_100002839	Ga0070684_10000283920	138
2397	3300005535	Ga0070684_100766927	Ga0070684_1007669272	138
2398	3300005536	Ga0070697_100208884	Ga0070697_1002088843	138
2399	3300005536	Ga0070697_100255520	Ga0070697_1002555202	138
2400	3300005536	Ga0070697_100824633	Ga0070697_1008246331	138
2401	3300005536	Ga0070697_100946470	Ga0070697_1009464701	138
2402	3300005539	Ga0068853_101103149	Ga0068853_1011031491	138
2403	3300005543	Ga0070672_100482402	Ga0070672_1004824023	138
2404	3300005544	Ga0070686_100706582	Ga0070686_1007065821	138
2405	3300005548	Ga0070665_100496293	Ga0070665_1004962932	138
2406	3300005549	Ga0070704_100521098	Ga0070704_1005210982	138
2407	3300005563	Ga0068855_100050186	Ga0068855_1000501869	138
2408	3300005563	Ga0068855_100471757	Ga0068855_1004717573	138
2409	3300005563	Ga0068855_101911150	Ga0068855_1019111502	138
2410	3300005577	Ga0068857_100001770	Ga0068857_10000177010	138
2411	3300005577	Ga0068857_100330068	Ga0068857_1003300681	138
2412	3300005577	Ga0068857_100730820	Ga0068857_1007308202	138
2413	3300005614	Ga0068856_100012640	Ga0068856_1000126409	138
2414	3300005614	Ga0068856_100014911	Ga0068856_1000149115	138
2415	3300005614	Ga0068856_100021410	Ga0068856_1000214106	138
2416	3300005614	Ga0068856_100186927	Ga0068856_1001869273	138
2417	3300005614	Ga0068856_101145685	Ga0068856_1011456851	138
2418	3300005616	Ga0068852_100007501	Ga0068852_1000075014	138
2419	3300005834	Ga0068851_10126664	Ga0068851_101266642	138
2420	3300005840	Ga0068870_10164326	Ga0068870_101643262	138
2421	3300005842	Ga0068858_100182744	Ga0068858_1001827444	138
2422	3300005843	Ga0068860_100886993	Ga0068860_1008869931	138
2423	3300005844	Ga0068862_100405817	Ga0068862_1004058172	138
2424	3300005985	Ga0081539_10047557	Ga0081539_100475576	138
2425	3300006028	Ga0070717_10014243	Ga0070717_100142436	138
2426	3300006028	Ga0070717_10057068	Ga0070717_100570684	138
2427	3300006028	Ga0070717_10196786	Ga0070717_101967863	138
2428	3300006028	Ga0070717_10227353	Ga0070717_102273533	138
2429	3300006028	Ga0070717_11069906	Ga0070717_110699062	138
2430	3300006028	Ga0070717_11143382	Ga0070717_111433821	138
2431	3300006163	Ga0070715_10002090	Ga0070715_100020908	138
2432	3300006163	Ga0070715_10080382	Ga0070715_100803822	138
2433	3300006163	Ga0070715_10500960	Ga0070715_105009602	138
2434	3300006173	Ga0070716_100002371	Ga0070716_1000023715	138
2435	3300006173	Ga0070716_100041894	Ga0070716_1000418944	138
2436	3300006173	Ga0070716_100325494	Ga0070716_1003254942	138
2437	3300006175	Ga0070712_100003121	Ga0070712_10000312110	138
2438	3300006175	Ga0070712_100009424	Ga0070712_1000094241	138
2439	3300006175	Ga0070712_100010884	Ga0070712_10001088410	138
2440	3300006175	Ga0070712_100245876	Ga0070712_1002458764	138
2441	3300006175	Ga0070712_100528140	Ga0070712_1005281402	138
2442	3300006871	Ga0075434_100232068	Ga0075434_1002320683	138
2443	3300006914	Ga0075436_100001836	Ga0075436_10000183610	138
2444	3300007265	Ga0099794_10373329	Ga0099794_103733292	138
2445	3300007788	Ga0099795_10019472	Ga0099795_100194726	138
2446	3300009093	Ga0105240_10011307	Ga0105240_1001130714	138
2447	3300009093	Ga0105240_10026271	Ga0105240_100262716	138
2448	3300009093	Ga0105240_10037897	Ga0105240_1003789713	138
2449	3300009093	Ga0105240_10274195	Ga0105240_102741955	138
2450	3300009093	Ga0105240_10403321	Ga0105240_104033213	138
2451	3300009093	Ga0105240_10427013	Ga0105240_104270132	138
2452	3300009098	Ga0105245_11355940	Ga0105245_113559401	138
2453	3300009174	Ga0105241_10052965	Ga0105241_100529656	138
2454	3300009174	Ga0105241_10364923	Ga0105241_103649233	138
2455	3300009174	Ga0105241_10562630	Ga0105241_105626302	138
2456	3300009177	Ga0105248_10129099	Ga0105248_101290992	138
2457	3300009177	Ga0105248_10632415	Ga0105248_106324152	138
2458	3300009545	Ga0105237_10011322	Ga0105237_1001132211	138
2459	3300009545	Ga0105237_10017171	Ga0105237_1001717113	138
2460	3300009545	Ga0105237_10438935	Ga0105237_104389353	138
2461	3300009545	Ga0105237_11366120	Ga0105237_113661202	138
2462	3300009551	Ga0105238_10002481	Ga0105238_1000248110	138
2463	3300009551	Ga0105238_10629998	Ga0105238_106299981	138
2464	3300009553	Ga0105249_10415926	Ga0105249_104159261	138
2465	3300010375	Ga0105239_10006176	Ga0105239_1000617610	138
2466	3300010375	Ga0105239_10913751	Ga0105239_109137511	138
2467	3300013104	Ga0157370_10023523	Ga0157370_100235235	138
2468	3300013104	Ga0157370_10072430	Ga0157370_100724304	138
2469	3300013104	Ga0157370_11823087	Ga0157370_118230871	138
2470	3300013105	Ga0157369_10004249	Ga0157369_100042498	138
2471	3300013105	Ga0157369_10099148	Ga0157369_100991485	138
2472	3300013105	Ga0157369_10378043	Ga0157369_103780434	138
2473	3300013105	Ga0157369_10460654	Ga0157369_104606543	138
2474	3300013105	Ga0157369_10762224	Ga0157369_107622242	138
2475	3300013105	Ga0157369_10845608	Ga0157369_108456082	138
2476	3300013105	Ga0157369_10883094	Ga0157369_108830942	138
2477	3300013105	Ga0157369_10971173	Ga0157369_109711732	138
2478	3300013105	Ga0157369_12379243	Ga0157369_123792431	138
2479	3300013296	Ga0157374_10240017	Ga0157374_102400175	138
2480	3300013297	Ga0157378_13240245	Ga0157378_132402451	138
2481	3300013307	Ga0157372_10003029	Ga0157372_1000302925	138
2482	3300013307	Ga0157372_10195048	Ga0157372_101950483	138
2483	3300014969	Ga0157376_10108272	Ga0157376_101082721	138
2484	3300021361	Ga0213872_10001460	Ga0213872_100014608	138
2485	3300021384	Ga0213876_10000941	Ga0213876_100009413	138
2486	3300021384	Ga0213876_10025160	Ga0213876_100251603	138
2487	3300021384	Ga0213876_10031839	Ga0213876_100318393	138
2488	3300021384	Ga0213876_10090144	Ga0213876_100901442	138
2489	3300021384	Ga0213876_10184345	Ga0213876_101843453	138
2490	3300021384	Ga0213876_10375449	Ga0213876_103754492	138
2491	3300021384	Ga0213876_10478401	Ga0213876_104784011	138
2492	3300021388	Ga0213875_10000015	Ga0213875_10000015229	138
2493	3300021388	Ga0213875_10000208	Ga0213875_1000020814	138
2494	3300021388	Ga0213875_10006316	Ga0213875_1000631611	138
2495	3300021388	Ga0213875_10082696	Ga0213875_100826963	138
2496	3300021388	Ga0213875_10251359	Ga0213875_102513591	138
2497	3300021388	Ga0213875_10287188	Ga0213875_102871882	138
2498	3300021441	Ga0213871_10017296	Ga0213871_100172962	138
2499	3300022734	Ga0224571_100767	Ga0224571_1007674	138
2500	3300023547	Ga0247554_105199	Ga0247554_1051992	138
2501	3300024225	Ga0224572_1007637	Ga0224572_10076372	138
2502	3300025315	Ga0207697_10137639	Ga0207697_101376392	138
2503	3300025893	Ga0207682_10035982	Ga0207682_100359824	138
2504	3300025893	Ga0207682_10241721	Ga0207682_102417212	138
2505	3300025898	Ga0207692_10005572	Ga0207692_100055723	138
2506	3300025898	Ga0207692_10060899	Ga0207692_100608991	138
2507	3300025898	Ga0207692_10404427	Ga0207692_104044271	138
2508	3300025900	Ga0207710_10222924	Ga0207710_102229243	138
2509	3300025905	Ga0207685_10006052	Ga0207685_100060525	138
2510	3300025905	Ga0207685_10271077	Ga0207685_102710771	138
2511	3300025905	Ga0207685_10298010	Ga0207685_102980101	138
2512	3300025905	Ga0207685_10602150	Ga0207685_106021501	138
2513	3300025906	Ga0207699_10001057	Ga0207699_1000105713	138
2514	3300025906	Ga0207699_10026977	Ga0207699_100269772	138
2515	3300025906	Ga0207699_10262871	Ga0207699_102628712	138
2516	3300025906	Ga0207699_10543871	Ga0207699_105438711	138
2517	3300025908	Ga0207643_10159542	Ga0207643_101595422	138
2518	3300025909	Ga0207705_10036023	Ga0207705_100360234	138
2519	3300025910	Ga0207684_10143739	Ga0207684_101437393	138
2520	3300025910	Ga0207684_10161632	Ga0207684_101616322	138
2521	3300025910	Ga0207684_11151260	Ga0207684_111512602	138
2522	3300025911	Ga0207654_10109702	Ga0207654_101097022	138
2523	3300025912	Ga0207707_10004150	Ga0207707_1000415012	138
2524	3300025912	Ga0207707_10035593	Ga0207707_100355937	138
2525	3300025912	Ga0207707_10231749	Ga0207707_102317492	138
2526	3300025912	Ga0207707_10952796	Ga0207707_109527962	138
2527	3300025913	Ga0207695_10004731	Ga0207695_1000473110	138
2528	3300025913	Ga0207695_10033343	Ga0207695_100333436	138
2529	3300025913	Ga0207695_10042750	Ga0207695_100427504	138
2530	3300025913	Ga0207695_11243412	Ga0207695_112434121	138
2531	3300025914	Ga0207671_10000762	Ga0207671_1000076260	138
2532	3300025914	Ga0207671_10016045	Ga0207671_100160452	138
2533	3300025915	Ga0207693_10000026	Ga0207693_1000002684	138
2534	3300025915	Ga0207693_10001260	Ga0207693_1000126026	138
2535	3300025915	Ga0207693_10004232	Ga0207693_1000423219	138
2536	3300025915	Ga0207693_10260302	Ga0207693_102603022	138
2537	3300025915	Ga0207693_10659380	Ga0207693_106593801	138
2538	3300025916	Ga0207663_10003762	Ga0207663_100037624	138
2539	3300025916	Ga0207663_10009591	Ga0207663_100095914	138
2540	3300025916	Ga0207663_10074711	Ga0207663_100747114	138
2541	3300025916	Ga0207663_11669661	Ga0207663_116696611	138
2542	3300025917	Ga0207660_10006183	Ga0207660_1000618310	138
2543	3300025917	Ga0207660_10051923	Ga0207660_100519233	138
2544	3300025918	Ga0207662_10069776	Ga0207662_100697762	138
2545	3300025919	Ga0207657_10051764	Ga0207657_100517648	138
2546	3300025921	Ga0207652_10002066	Ga0207652_100020665	138
2547	3300025922	Ga0207646_10072024	Ga0207646_100720242	138
2548	3300025923	Ga0207681_10160800	Ga0207681_101608003	138
2549	3300025924	Ga0207694_10005630	Ga0207694_1000563010	138
2550	3300025925	Ga0207650_10625721	Ga0207650_106257212	138
2551	3300025926	Ga0207659_10194635	Ga0207659_101946354	138
2552	3300025926	Ga0207659_11242311	Ga0207659_112423111	138
2553	3300025928	Ga0207700_10004917	Ga0207700_1000491711	138
2554	3300025928	Ga0207700_10008755	Ga0207700_100087559	138
2555	3300025928	Ga0207700_10056645	Ga0207700_100566452	138
2556	3300025928	Ga0207700_10072432	Ga0207700_100724322	138
2557	3300025928	Ga0207700_10142004	Ga0207700_101420045	138
2558	3300025928	Ga0207700_10355012	Ga0207700_103550123	138
2559	3300025929	Ga0207664_10087127	Ga0207664_100871272	138
2560	3300025929	Ga0207664_10095778	Ga0207664_100957782	138
2561	3300025929	Ga0207664_10517984	Ga0207664_105179842	138
2562	3300025929	Ga0207664_11090757	Ga0207664_110907571	138
2563	3300025929	Ga0207664_11742109	Ga0207664_117421091	138
2564	3300025934	Ga0207686_10173876	Ga0207686_101738762	138
2565	3300025936	Ga0207670_10131652	Ga0207670_101316525	138
2566	3300025936	Ga0207670_10297732	Ga0207670_102977323	138
2567	3300025938	Ga0207704_10384772	Ga0207704_103847721	138
2568	3300025939	Ga0207665_10002747	Ga0207665_1000274716	138
2569	3300025939	Ga0207665_10048900	Ga0207665_100489004	138
2570	3300025939	Ga0207665_10136661	Ga0207665_101366611	138
2571	3300025940	Ga0207691_10113744	Ga0207691_101137442	138
2572	3300025940	Ga0207691_10206001	Ga0207691_102060014	138
2573	3300025940	Ga0207691_10388411	Ga0207691_103884111	138
2574	3300025941	Ga0207711_10104634	Ga0207711_101046344	138
2575	3300025941	Ga0207711_10441063	Ga0207711_104410632	138
2576	3300025944	Ga0207661_10026560	Ga0207661_100265608	138
2577	3300025944	Ga0207661_10543483	Ga0207661_105434832	138
2578	3300025949	Ga0207667_10003860	Ga0207667_1000386010	138
2579	3300025949	Ga0207667_11474617	Ga0207667_114746172	138
2580	3300025961	Ga0207712_10273591	Ga0207712_102735914	138
2581	3300025961	Ga0207712_10426773	Ga0207712_104267732	138
2582	3300025961	Ga0207712_10658267	Ga0207712_106582673	138
2583	3300025986	Ga0207658_11089113	Ga0207658_110891132	138
2584	3300026023	Ga0207677_10272123	Ga0207677_102721234	138
2585	3300026041	Ga0207639_10058554	Ga0207639_100585545	138
2586	3300026067	Ga0207678_10009839	Ga0207678_1000983911	138
2587	3300026078	Ga0207702_10002606	Ga0207702_1000260610	138
2588	3300026078	Ga0207702_10003851	Ga0207702_100038515	138
2589	3300026078	Ga0207702_10026671	Ga0207702_100266717	138
2590	3300026095	Ga0207676_10138259	Ga0207676_101382594	138
2591	3300026095	Ga0207676_11909119	Ga0207676_119091191	138
2592	3300026095	Ga0207676_12456531	Ga0207676_124565311	138
2593	3300026116	Ga0207674_10003800	Ga0207674_1000380025	138
2594	3300026116	Ga0207674_10025546	Ga0207674_100255468	138
2595	3300026116	Ga0207674_10545389	Ga0207674_105453892	138
2596	3300026116	Ga0207674_11444834	Ga0207674_114448342	138
2597	3300026118	Ga0207675_100023752	Ga0207675_1000237524	138
2598	3300026121	Ga0207683_10015889	Ga0207683_100158892	138
2599	3300026142	Ga0207698_10068264	Ga0207698_100682643	138
2600	3300026142	Ga0207698_10670309	Ga0207698_106703092	138
2601	3300026142	Ga0207698_10844610	Ga0207698_108446102	138
2602	3300028017	Ga0265356_1007366	Ga0265356_10073662	138
2603	3300028036	Ga0265355_1003073	Ga0265355_10030733	138
2604	3300028379	Ga0268266_10006831	Ga0268266_1000683117	138
2605	3300028379	Ga0268266_10458663	Ga0268266_104586631	138
2606	3300028380	Ga0268265_12086172	Ga0268265_120861721	138
2607	3300028381	Ga0268264_10364592	Ga0268264_103645923	138
2608	3300028556	Ga0265337_1075517	Ga0265337_10755172	138
2609	3300028558	Ga0265326_10155493	Ga0265326_101554931	138
2610	3300028563	Ga0265319_1070993	Ga0265319_10709932	138
2611	3300028800	Ga0265338_10002857	Ga0265338_1000285710	138
2612	3300029957	Ga0265324_10173337	Ga0265324_101733371	138
2613	3300030760	Ga0265762_1008735	Ga0265762_10087355	138
2614	3300030760	Ga0265762_1014812	Ga0265762_10148123	138
2615	3300030760	Ga0265762_1026261	Ga0265762_10262612	138
2616	3300030760	Ga0265762_1163547	Ga0265762_11635471	138
2617	3300030878	Ga0265770_1006606	Ga0265770_10066061	138
2618	3300030886	Ga0265772_103393	Ga0265772_1033931	138
2619	3300031018	Ga0265773_1025439	Ga0265773_10254391	138
2620	3300031090	Ga0265760_10019459	Ga0265760_100194595	138
2621	3300031090	Ga0265760_10040636	Ga0265760_100406363	138
2622	3300031238	Ga0265332_10243435	Ga0265332_102434352	138
2623	3300031240	Ga0265320_10138400	Ga0265320_101384002	138
2624	3300031241	Ga0265325_10011719	Ga0265325_100117198	138
2625	3300031249	Ga0265339_10032749	Ga0265339_100327496	138
2626	3300031249	Ga0265339_10119958	Ga0265339_101199584	138
2627	3300031344	Ga0265316_10027700	Ga0265316_100277003	138
2628	3300031344	Ga0265316_10280053	Ga0265316_102800531	138
2629	3300031595	Ga0265313_10244883	Ga0265313_102448832	138
2630	3300031711	Ga0265314_10122093	Ga0265314_101220932	138
2631	3300031712	Ga0265342_10008579	Ga0265342_1000857912	138
2632	3300032168	Ga0316593_10004142	Ga0316593_100041427	138
2633	3300032168	Ga0316593_10013084	Ga0316593_100130846	138
2634	3300033541	Ga0316596_1003008	Ga0316596_10030089	138
2635	3300033541	Ga0316596_1053656	Ga0316596_10536562	138
2636	3300035086	Ga0373934_0039778	Ga0373934_0039778_278_697	138
2637	3300035111	Ga0373923_0065334	Ga0373923_0065334_396_812	138
2638	3300035111	Ga0373923_0098556	Ga0373923_0098556_14_433	138
2639	3300035113	Ga0373936_0024125	Ga0373936_0024125_576_995	138
2640	3300035116	Ga0373945_0034528	Ga0373945_0034528_524_943	138
2641	3300035118	Ga0373954_0662541	Ga0373954_0662541_17_433	138
2642	3300035120	Ga0373957_0188454	Ga0373957_0188454_378_797	138
2643	3300035170	Ga0373943_0126228	Ga0373943_0126228_148_567	138
2644	3300035170	Ga0373943_0235419	Ga0373943_0235419_512_931	138
2645	3300035170	Ga0373943_0474431	Ga0373943_0474431_94_513	138
2646	3300035171	Ga0373946_0036665	Ga0373946_0036665_166_600	138
2647	3300035171	Ga0373946_0122329	Ga0373946_0122329_255_674	138
2648	3300035172	Ga0373955_0104192	Ga0373955_0104192_720_1139	138
2649	3300035172	Ga0373955_0144108	Ga0373955_0144108_541_957	138
2650	3300035692	Ga0373935_0011909	Ga0373935_0011909_3957_4391	138
2651	3300035692	Ga0373935_0042503	Ga0373935_0042503_1005_1424	138
2652	3300035692	Ga0373935_0462301	Ga0373935_0462301_367_783	138
2653	3300035692	Ga0373935_0505529	Ga0373935_0505529_239_658	138
2654	3300035692	Ga0373935_1510541	Ga0373935_1510541_49_465	138
2655	3300035695	Ga0373927_0093471	Ga0373927_0093471_1000_1419	138
2656	3300035724	Ga0373933_0136680	Ga0373933_0136680_39_458	138
2657	3300035724	Ga0373933_0309385	Ga0373933_0309385_435_854	138
2658	3300035725	Ga0373947_0043634	Ga0373947_0043634_1268_1687	138
2659	3300035725	Ga0373947_0353195	Ga0373947_0353195_312_746	138
2660	3300036401	Ga0373937_0033312	Ga0373937_0033312_2249_2668	138
2661	3300036401	Ga0373937_0131289	Ga0373937_0131289_62_481	138
2662	3300036457	Ga0265778_000084	Ga0265778_000084_4726_5142	138
2663	3300036712	Ga0316584_0568767	Ga0316584_0568767_255_689	138
2664	3300037068	Ga0373925_0111916	Ga0373925_0111916_1230_1664	138
2665	3300037068	Ga0373925_0153738	Ga0373925_0153738_1326_1745	138
2666	3300037068	Ga0373925_0465916	Ga0373925_0465916_298_717	138
2667	3300037418	Ga0395900_0246523	Ga0395900_0246523_921_1337	138
2668	3300037466	Ga0395898_0717426	Ga0395898_0717426_31_447	138
2669	3300037853	Ga0436364_0071007	Ga0436364_0071007_363_797	138
2670	3300037853	Ga0436364_0100477	Ga0436364_0100477_774_1211	138
2671	3300037853	Ga0436364_0202564	Ga0436364_0202564_594_1031	138
2672	3300037853	Ga0436364_0240413	Ga0436364_0240413_4444_4878	138
2673	3300037853	Ga0436364_0336877	Ga0436364_0336877_350_778	138
2674	3300037853	Ga0436364_0637057	Ga0436364_0637057_191_619	138
2675	3300037853	Ga0436364_0729405	Ga0436364_0729405_49_483	138
2676	3300037853	Ga0436364_1048251	Ga0436364_1048251_567_1001	138
2677	3300037853	Ga0436364_1058247	Ga0436364_1058247_3525_3959	138
2678	3300037853	Ga0436364_1113127	Ga0436364_1113127_4640_5083	138
2679	3300037853	Ga0436364_1121262	Ga0436364_1121262_8227_8661	138
2680	3300037853	Ga0436364_1191769	Ga0436364_1191769_1867_2304	138
2681	3300037853	Ga0436364_1400193	Ga0436364_1400193_1188_1625	138
2682	3300037853	Ga0436364_1503533	Ga0436364_1503533_178_612	138
2683	3300038443	Ga0395901_1322845	Ga0395901_1322845_82_498	138
2684	3300039437	Ga0436365_0196842	Ga0436365_0196842_1873_2301	138
2685	3300039437	Ga0436365_0446695	Ga0436365_0446695_29_463	138
2686	3300039437	Ga0436365_0821682	Ga0436365_0821682_4661_5089	138
2687	3300039437	Ga0436365_0890233	Ga0436365_0890233_8175_8609	138
2688	3300039437	Ga0436365_1446940	Ga0436365_1446940_346_780	138
2689	3300039437	Ga0436365_1496060	Ga0436365_1496060_38_475	138
2690	3300039437	Ga0436365_1589353	Ga0436365_1589353_581_1015	138
2691	3300039437	Ga0436365_1636383	Ga0436365_1636383_1352_1783	138
2692	3300039437	Ga0436365_1657880	Ga0436365_1657880_1480_1917	138
2693	3300039438	Ga0436360_0222243	Ga0436360_0222243_16485_16919	138
2694	3300039438	Ga0436360_0599497	Ga0436360_0599497_694_1122	138
2695	3300039438	Ga0436360_1041824	Ga0436360_1041824_1077_1505	138
2696	3300039447	Ga0436361_0420648	Ga0436361_0420648_78_512	138
2697	3300039447	Ga0436361_0754359	Ga0436361_0754359_4846_5280	138
2698	3300039447	Ga0436361_1030968	Ga0436361_1030968_3391_3825	138
2699	3300039447	Ga0436361_1065605	Ga0436361_1065605_45_479	138
2700	3300039450	Ga0436363_0325843	Ga0436363_0325843_68_502	138
2701	3300039450	Ga0436363_0418035	Ga0436363_0418035_17_451	138
2702	3300039450	Ga0436363_1351619	Ga0436363_1351619_2338_2772	138
2703	3300039450	Ga0436363_1375689	Ga0436363_1375689_745_1176	138
2704	3300039450	Ga0436363_1464689	Ga0436363_1464689_89_526	138
2705	3300039450	Ga0436363_1684757	Ga0436363_1684757_2407_2841	138
2706	3300039453	Ga0436362_0060795	Ga0436362_0060795_1777_2211	138
2707	3300039453	Ga0436362_0300827	Ga0436362_0300827_275_712	138
2708	3300039453	Ga0436362_0325756	Ga0436362_0325756_237_671	138
2709	3300039453	Ga0436362_0336800	Ga0436362_0336800_1122_1556	138
2710	3300039453	Ga0436362_0378468	Ga0436362_0378468_1276_1710	138
2711	3300039453	Ga0436362_0678590	Ga0436362_0678590_2329_2763	138
2712	3300039453	Ga0436362_0803568	Ga0436362_0803568_686_1117	138
2713	3300039453	Ga0436362_1240431	Ga0436362_1240431_2248_2685	138
2714	3300039453	Ga0436362_1302949	Ga0436362_1302949_221_649	138
2715	3300042123	Ga0450921_013421	Ga0450921_013421_212_640	138
2716	3300042876	Ga0451577_1170952	Ga0451577_1170952_30_452	138
2717	3300044684	Ga0466966_0097377	Ga0466966_0097377_660_1088	138
2718	3300044684	Ga0466966_0348609	Ga0466966_0348609_388_825	138
2719	3300044694	Ga0466963_0034085	Ga0466963_0034085_1509_1928	138
2720	3300044694	Ga0466963_0370629	Ga0466963_0370629_312_746	138
2721	3300044694	Ga0466963_0449609	Ga0466963_0449609_147_581	138
2722	3300044694	Ga0466963_0908171	Ga0466963_0908171_50_487	138
2723	3300044706	Ga0466964_0038031	Ga0466964_0038031_1291_1710	138
2724	3300044706	Ga0466964_0661092	Ga0466964_0661092_137_556	138
2725	3300044712	Ga0453684_0060757	Ga0453684_0060757_2478_2903	138
2726	3300044712	Ga0453684_0366242	Ga0453684_0366242_366_788	138
2727	3300044765	Ga0466970_0296093	Ga0466970_0296093_190_624	138
2728	3300044765	Ga0466970_0465988	Ga0466970_0465988_52_489	138
2729	3300044842	Ga0466957_0241364	Ga0466957_0241364_56_490	138
2730	3300044901	Ga0466960_0086709	Ga0466960_0086709_196_612	138
2731	3300045836	Ga0466958_0078521	Ga0466958_0078521_323_760	138
2732	3300045836	Ga0466958_0168574	Ga0466958_0168574_703_1173	138
2733	3300045836	Ga0466958_0467981	Ga0466958_0467981_12_446	138
2734	3300045976	Ga0466967_0011957	Ga0466967_0011957_5680_6099	138
2735	3300045976	Ga0466967_0041111	Ga0466967_0041111_2003_2422	138
2736	3300046459	Ga0495629_0039073	Ga0495629_0039073_1854_2273	138
2737	3300046463	Ga0495653_0774795	Ga0495653_0774795_149_565	138
2738	3300046472	Ga0495580_0001845	Ga0495580_0001845_12864_13283	138
2739	3300046472	Ga0495580_0006027	Ga0495580_0006027_6321_6737	138
2740	3300046472	Ga0495580_0467656	Ga0495580_0467656_319_738	138
2741	3300046473	Ga0495582_0004179	Ga0495582_0004179_1739_2158	138
2742	3300046492	Ga0495585_0243046	Ga0495585_0243046_461_883	138
2743	3300046516	Ga0495628_0691306	Ga0495628_0691306_121_540	138
2744	3300046517	Ga0495630_0339591	Ga0495630_0339591_419_838	138
2745	3300046533	Ga0495640_0222183	Ga0495640_0222183_431_850	138
2746	3300046675	Ga0495657_0139699	Ga0495657_0139699_984_1403	138
2747	3300046675	Ga0495657_0550148	Ga0495657_0550148_46_462	138
2748	3300046678	Ga0495599_0055135	Ga0495599_0055135_1439_1858	138
2749	3300046683	Ga0495658_0069813	Ga0495658_0069813_321_740	138
2750	3300046684	Ga0495669_0451705	Ga0495669_0451705_150_569	138
2751	3300046689	Ga0495613_0210387	Ga0495613_0210387_145_564	138
2752	3300047315	Ga0495581_0128728	Ga0495581_0128728_44_463	138
2753	3300047315	Ga0495581_0207563	Ga0495581_0207563_662_1081	138
2754	3300047319	Ga0495674_0099749	Ga0495674_0099749_1909_2328	138
2755	3300047444	Ga0495675_0594303	Ga0495675_0594303_169_588	138
2756	3300047673	Ga0495593_0191818	Ga0495593_0191818_80_499	138
2757	3300048088	Ga0495602_0362643	Ga0495602_0362643_341_757	138
2758	3300048904	Ga0496101_1291302	Ga0496101_1291302_84_503	138
2759	3300048907	Ga0496104_0122124	Ga0496104_0122124_1269_1688	138
2760	3300048915	Ga0496112_0571013	Ga0496112_0571013_270_686	138
2761	3300048917	Ga0496114_0117000	Ga0496114_0117000_1321_1740	138
2762	3300048918	Ga0496115_0088120	Ga0496115_0088120_514_933	138
2763	3300049568	Ga0501031_0291892	Ga0501031_0291892_73_489	138
2764	3300049569	Ga0501032_0009972	Ga0501032_0009972_6019_6435	138
2765	3300049570	Ga0501033_0009806	Ga0501033_0009806_5945_6361	138
2766	3300049570	Ga0501033_0413416	Ga0501033_0413416_413_829	138
2767	3300049571	Ga0501034_0027734	Ga0501034_0027734_713_1129	138
2768	3300049571	Ga0501034_0828072	Ga0501034_0828072_267_683	138
2769	3300049573	Ga0501037_0450494	Ga0501037_0450494_313_729	138
2770	3300049574	Ga0501038_0006023	Ga0501038_0006023_6478_6894	138
2771	3300049579	Ga0501043_0017963	Ga0501043_0017963_4645_5061	138
2772	3300049579	Ga0501043_0244315	Ga0501043_0244315_207_623	138
2773	3300049580	Ga0501046_0153859	Ga0501046_0153859_144_560	138
2774	3300049581	Ga0501047_0038476	Ga0501047_0038476_2909_3325	138
2775	3300049581	Ga0501047_0062299	Ga0501047_0062299_181_597	138
2776	3300049581	Ga0501047_0106831	Ga0501047_0106831_1876_2292	138
2777	3300049582	Ga0501048_0941381	Ga0501048_0941381_34_450	138
2778	3300049583	Ga0501067_0132288	Ga0501067_0132288_364_780	138
2779	3300049585	Ga0501069_0132204	Ga0501069_0132204_685_1101	138
2780	3300049586	Ga0501070_0018074	Ga0501070_0018074_4826_5242	138
2781	3300049586	Ga0501070_0257666	Ga0501070_0257666_339_755	138
2782	3300049589	Ga0501073_0341782	Ga0501073_0341782_437_853	138
2783	3300049590	Ga0501074_0043689	Ga0501074_0043689_1506_1922	138
2784	3300049742	Ga0501080_0616412	Ga0501080_0616412_432_848	138
2785	3300049744	Ga0501083_1075986	Ga0501083_1075986_64_480	138
2786	3300049822	Ga0501035_0102841	Ga0501035_0102841_1370_1786	138
2787	3300049822	Ga0501035_0400779	Ga0501035_0400779_153_569	138
2788	3300049823	Ga0501044_0002703	Ga0501044_0002703_4665_5081	138
2789	3300049823	Ga0501044_0003143	Ga0501044_0003143_13792_14208	138
2790	3300049823	Ga0501044_0010929	Ga0501044_0010929_8053_8469	138
2791	3300049823	Ga0501044_0246715	Ga0501044_0246715_284_700	138
2792	3300050513	nmdc:mga0rr50_276564_c1	nmdc:mga0rr50_276564_c1_230_646	138
2793	3300053085	Ga0495619_0569128	Ga0495619_0569128_83_502	138
2794	3300059491	Ga0587070_068133	Ga0587070_068133_93_527	138
2795	3300059506	Ga0587085_120968	Ga0587085_120968_54_488	138
2796	3300059513	Ga0587094_063288	Ga0587094_063288_112_555	138
2797	3300059627	Ga0587117_066425	Ga0587117_066425_172_606	138
2798	3300059640	Ga0587067_056166	Ga0587067_056166_205_639	138
2799	3300060353	Ga0501082_0625274	Ga0501082_0625274_292_708	138
2800	3300061719	Ga0466962_0197036	Ga0466962_0197036_32_469	138

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00252

Ribosomal_L16

Ribosomal protein L16p/L10e

26

154

0.99 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
6gbz-assembly1.cif.gz_M	50s ribosomal subunit assembly intermediate state 5	0.8525	18	136
5mrc-assembly1.cif.gz_K	structure of the yeast mitochondrial ribosome - class a	0.8229	23	133
6ywv-assembly1.cif.gz_K	the structure of the atp25 bound assembly intermediate of the mitoribosome from neurospora crassa	0.8019	18	133
7po4-assembly1.cif.gz_N	assembly intermediate of human mitochondrial ribosome large subunit (largely unfolded rrna with malsu1, l0r8f8 and acp)	0.797	15	134
6lqm-assembly1.cif.gz_J	cryo-em structure of a pre-60s ribosomal subunit - state c	0.7965	32	132

ID	Description	Score	Start	End	Superfamily
6gbzM01	Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Ribosomal protein L16/L10	0.8787	23	136	3.90.1170.10
6gbzM01	Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Ribosomal protein L16/L10	0.8631	23	136	3.90.1170.10
af_A0A1D8PG94_22_213_3.90.1170.10	Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Ribosomal protein L16/L10	0.8172	24	135	3.90.1170.10
af_Q9Y822_37_214_3.90.1170.10	Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Ribosomal protein L16/L10	0.8075	23	135	3.90.1170.10
6qulN01	Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Ribosomal protein L16/L10	0.8036	23	136	3.90.1170.10

ID	Description	Score	Start	End	GO Terms
AF-A0A2H5PR85-F1-model_v4	Ribosomal protein L10e/L16 domain-containing protein	0.9099	19	135	GO:0003735 GO:0005762 GO:0019843 GO:0032543
AF-A0A2H5PR85-F1-model_v4	Ribosomal protein L10e/L16 domain-containing protein	0.883	19	135	GO:0003735 GO:0005762 GO:0019843 GO:0032543
AF-A0A446PLD0-F1-model_v4	deleted	0.8694	19	136
AF-A0A446PLD0-F1-model_v4	deleted	0.8461	19	136
AF-A0A5N5QMV7-F1-model_v4	Ribosomal protein L16	0.8275	23	134	GO:0003735 GO:0005762 GO:0019843 GO:0032543

Feature Viewer

pLDDT	pTM	Quality
82.61	0.72	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F497066

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00252

Ribosomal_L16

Ribosomal protein L16p/L10e

26

154

0.99

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map