F496887

General Info

Members Datasets Scaffolds Average Seq Length
2527 758 1973 405

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8016583857|8016591556
Length 480
Sequence SIASFLLGTALALASTSGAMAQDKTIKVGVLTDNSGLYADLGGPGSTLAAQMAIEDSGLAAKGWKVDLISADHQNKPDIGTAIARQWIDVEKIDVFMDVLNSGVALAVNNVVREKNAILIDTGAATSDLTNAQCSPNTIHWVYDTYMLANSTGQALVKAGGDTWYFLTADYAFGHALERDTAAVVVKSGGKVIGSVKHPLNTADFSSFLLQAQASKAKIIGMANAGGDTTNTIKQAAEFGIVAGGQKLAGLLLFITDVHALGLKVAQGLNFTETFYWDLNDGTRAFSKRFSERMKNKAMPSMVQAGVYSGLIHYFKTLEALGGNPHDGTKVVAKMKEMPTDDPLFGQGTIRADGRKLHPAYLFEVKKPEESKGPWDYYKLIGTTPADQAFRPLSDSACSAGEEVTPTAPAGGRCQQQNGTGCGIDAGSLRSATGGIDQRLVLRAAQSRACRDLRHAQHHQFRPRRALHDGRVRRLFPAQQ

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
5 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
6 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
7 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
8 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
9 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
10 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
11 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
12 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
13 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
14 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
15 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
16 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
17 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
18 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
19 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
20 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
21 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
22 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
23 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
24 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
25 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
26 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
27 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
28 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
29 2643221651 Afipia sp. Root123D2 Isolate Unclassified
30 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
31 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
32 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
33 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
34 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
35 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
36 2791355199
37 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
38 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
39 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
40 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
41 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
42 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
43 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
44 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
45 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
46 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
47 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
48 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
49 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
50 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
51 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
52 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
53 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
54 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
55 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
56 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
57 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
58 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
59 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
60 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
61 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
62 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
63 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
64 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
65 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
66 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
67 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
68 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
69 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
70 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
71 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
72 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
73 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
74 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
75 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
76 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
77 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
78 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
79 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
80 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
81 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
82 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
83 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
84 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
85 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
86 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
87 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
88 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
89 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
90 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
91 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
92 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
93 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
94 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
95 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
96 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
97 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
98 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
99 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
100 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
101 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
102 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
103 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
104 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
105 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
106 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
107 2904699407
108 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
109 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
110 2906610324
111 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
112 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
113 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
114 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
115 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
116 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
117 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
118 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
119 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
120 2922368715
121 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
122 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
123 2922425934
124 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
125 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
126 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
127 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
128 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
129 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
130 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
131 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
132 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
133 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
134 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
135 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
136 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
137 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
138 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
139 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
140 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
141 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
142 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
143 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
144 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
145 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
146 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
147 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
148 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
149 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
150 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
151 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
152 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
153 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
154 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
155 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
156 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
157 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
158 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
159 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
160 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
161 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
162 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
163 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
164 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
165 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
166 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
167 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
168 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
169 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
170 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
171 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
172 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
173 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
174 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
175 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
176 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
177 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
178 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
179 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
180 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
181 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
182 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
183 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
184 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
185 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
186 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
187 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
188 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
189 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
190 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
191 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
192 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
193 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
194 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
195 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
196 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
197 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
198 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
199 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
200 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
201 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
202 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
203 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
204 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
205 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
206 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
207 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
208 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
209 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
210 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
211 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
212 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
213 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
214 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
215 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
216 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
217 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
218 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
219 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
220 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
221 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
222 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
223 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
224 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
225 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
226 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
227 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
228 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
229 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
230 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
231 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
232 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
233 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
234 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
235 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
236 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
237 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
238 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
239 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
240 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
241 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
242 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
243 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
244 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
245 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
246 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
247 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
248 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
249 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
250 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
251 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
252 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
253 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
254 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
255 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
256 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
257 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
258 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
259 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
260 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
261 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
262 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
263 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
264 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
265 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
266 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
267 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
268 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
269 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
270 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
271 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
272 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
273 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
274 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
275 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
276 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
277 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
278 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
279 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
280 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
281 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
282 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
283 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
284 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
285 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
286 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
287 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
288 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
289 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
290 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
291 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
292 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
293 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
294 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
295 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
296 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
297 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
298 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
299 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
300 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
301 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
302 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
303 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
304 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
305 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
306 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
307 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
308 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
309 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
310 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
311 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
312 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
313 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
314 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
315 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
316 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
317 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
318 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
319 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
320 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
321 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
322 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
323 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
324 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
325 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
326 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
327 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
328 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
329 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
330 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
331 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
332 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
333 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
334 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
335 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
336 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
337 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
338 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
339 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
340 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
341 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
342 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
343 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
344 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
345 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
346 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
347 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
348 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
349 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
350 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
351 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
352 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
353 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
354 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
355 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
356 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
357 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
358 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
359 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
360 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
361 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
362 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
363 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
364 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
365 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
366 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
367 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
368 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
369 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
370 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
371 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
372 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
373 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
374 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
375 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
376 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
377 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
378 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
379 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
380 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
381 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
382 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
383 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
384 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
385 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
386 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
387 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
388 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
389 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
390 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
391 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
392 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
393 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
394 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
395 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
396 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
397 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
398 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
399 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
400 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
401 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
402 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
403 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
404 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
405 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
406 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
407 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
408 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
409 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
410 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
411 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
412 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
413 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
414 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
415 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
416 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
417 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
418 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
419 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
420 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
421 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
422 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
423 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
424 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
425 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
426 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
427 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
428 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
429 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
430 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
431 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
432 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
433 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
434 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
435 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
436 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
437 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
438 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
439 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
440 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
441 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
442 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
443 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
444 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
445 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
446 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
447 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
448 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
449 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
450 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
451 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
452 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
453 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
454 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
455 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
456 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
457 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
458 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
459 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
460 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
461 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
462 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
463 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
464 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
465 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
466 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
467 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
468 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
469 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
470 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
471 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
472 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
473 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
474 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
475 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
476 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
477 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
478 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
479 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
480 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
481 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
482 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
483 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
484 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
485 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
486 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
487 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
488 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
489 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
490 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
491 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
492 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
493 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
494 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
495 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
496 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
497 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
498 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
499 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
500 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
501 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
502 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
503 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
504 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
505 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
506 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
507 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
508 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
509 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
510 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
511 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
512 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
513 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
514 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
515 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
516 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
517 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
518 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
519 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
520 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
521 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
522 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
523 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
524 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
525 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
526 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
527 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
528 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
529 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
530 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
531 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
532 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
533 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
534 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
535 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
536 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
537 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
538 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
539 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
540 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
541 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
542 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
543 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
544 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
545 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
546 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
547 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
548 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
549 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
550 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
551 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
552 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
553 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
554 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
555 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
556 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
557 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
558 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
559 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
560 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
561 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
562 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
563 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
564 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
565 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
566 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
567 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
568 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
569 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
570 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
571 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
572 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
573 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
574 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
575 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
576 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
577 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
578 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
579 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
580 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
581 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
582 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
583 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
584 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
585 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
586 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
587 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
588 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
589 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
590 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
591 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
592 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
593 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
594 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
595 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
596 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
597 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
598 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
599 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
600 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
601 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
602 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
603 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
604 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
605 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
606 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
607 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
608 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
609 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
610 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
611 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
612 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
613 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
614 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
615 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
616 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
617 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
618 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
619 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
620 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
621 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
622 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
623 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
624 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
625 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
626 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
627 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
628 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
629 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
630 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
631 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
632 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
633 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
634 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
635 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
636 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
637 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
638 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
639 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
640 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
641 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
642 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
643 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
644 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
645 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
646 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
647 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
648 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
649 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
650 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
651 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
652 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
653 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
654 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
655 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
656 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
657 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
658 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
659 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
660 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
661 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
662 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
663 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
664 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
665 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
666 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
667 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
668 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
669 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
670 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
671 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
672 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
673 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
674 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
675 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
676 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
677 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
678 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
679 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
680 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
681 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
682 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
683 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
684 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
685 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
686 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
687 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
688 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
689 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
690 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
691 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
692 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
693 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
694 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
695 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
696 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
697 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
698 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
699 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
700 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
701 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
702 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
703 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
704 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
705 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
706 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
707 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
708 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
709 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
710 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
711 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
712 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
713 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
714 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
715 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
716 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
717 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
718 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
719 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
720 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
721 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
722 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
723 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
724 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
725 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
726 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
727 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
728 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
729 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
730 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
731 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
732 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
733 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
734 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
735 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
736 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
737 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
738 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
739 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
740 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
741 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
742 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
743 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
744 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
745 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
746 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
747 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
748 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
749 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
750 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
751 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
752 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
753 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
754 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
755 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
756 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
757 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
758 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 80.58
Metatranscriptomes 0.04
Isolates 19.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.12
Nodule 15.55
Rhizoplane 5.26
Rhizosphere 57.1
Stem 0
Stem Tuber 0
Unclassified 10.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1003744 3300001904 Bacteria 2624
2 JGI24740J21852_10013130 3300001979 Bacteria 3102
3 JGI24739J22299_10002406 3300001989 Bacteria 7218
4 JGI24737J22298_10002958 3300001990 Bacteria 6023
5 JGI24735J21928_10030063 3300002067 Bacteria 1614
6 JGI24738J21930_10010688 3300002075 Bacteria 2037
7 JGI25406J46586_10000018 3300003203 Bacteria 88860
8 JGI25406J46586_10000047 3300003203 Bacteria 54770
9 JGI25406J46586_10000078 3300003203 Bacteria 44054
10 JGI25406J46586_10011634 3300003203 Bacteria 3853
11 JGI25406J46586_10015609 3300003203 Bacteria 3197
12 JGI25153J46596_10000767 3300003215 Bacteria 19660
13 JGI25153J46596_10003048 3300003215 Bacteria 9466
14 JGI25153J46596_10006696 3300003215 Bacteria 5792
15 JGI25153J46596_10009098 3300003215 Bacteria 4662
16 JGI25153J46596_10011019 3300003215 Bacteria 4032
17 JGI25153J46596_10012096 3300003215 Bacteria 3759
18 JGI25153J46596_10030267 3300003215 Bacteria 1844
19 JGI25153J46596_10031973 3300003215 Bacteria 1762
20 JGI25153J46596_10037987 3300003215 Bacteria 1524
21 rootH1_10038628 3300003323 Bacteria 2062
22 JGI25160J50197_1000847 3300003354 Bacteria 16257
23 JGI25160J50197_1001193 3300003354 Bacteria 13206
24 JGI25160J50197_1001218 3300003354 Bacteria 13076
25 JGI25160J50197_1004453 3300003354 Bacteria 6056
26 JGI25160J50197_1004825 3300003354 Bacteria 5747
27 JGI25160J50197_1028395 3300003354 Bacteria 1503
28 JGI25404J52841_10007069 3300003659 Bacteria 2365
29 JGI25404J52841_10011788 3300003659 Bacteria 1888
30 JGI25404J52841_10016974 3300003659 Bacteria 1579
31 Ga0055531_10007226 3300003794 Bacteria 6107
32 Ga0055543_1005693 3300004625 Bacteria 3140
33 Ga0065165_1000348 3300005262 Bacteria 75762
34 Ga0065165_1001524 3300005262 Bacteria 24366
35 Ga0065165_1003137 3300005262 Bacteria 12207
36 Ga0065165_1003351 3300005262 Bacteria 11391
37 Ga0065165_1010602 3300005262 Bacteria 3957
38 Ga0065165_1011649 3300005262 Bacteria 3640
39 Ga0065165_1020475 3300005262 Bacteria 2326
40 Ga0065165_1039787 3300005262 Bacteria 1405
41 Ga0065715_10099425 3300005293 Bacteria 3414
42 Ga0065715_10143551 3300005293 Bacteria 1819
43 Ga0065707_10013358 3300005295 Bacteria 3021
44 Ga0070683_100011949 3300005329 Bacteria 7531
45 Ga0070690_100087730 3300005330 Bacteria 2044
46 Ga0070670_100104274 3300005331 Bacteria 2443
47 Ga0070677_10003948 3300005333 Bacteria 4815
48 Ga0068869_100001877 3300005334 Bacteria 12626
49 Ga0068869_100019670 3300005334 Bacteria 4619
50 Ga0068869_100078244 3300005334 Bacteria 2462
51 Ga0068869_100086684 3300005334 Bacteria 2347
52 Ga0068869_100217356 3300005334 Bacteria 1513
53 Ga0070666_10156910 3300005335 Bacteria 1590
54 Ga0070680_100001711 3300005336 Bacteria 16114
55 Ga0070680_100018006 3300005336 Bacteria 5578
56 Ga0070680_100026234 3300005336 Bacteria 4659
57 Ga0070680_100029010 3300005336 Bacteria 4443
58 Ga0070680_100043257 3300005336 Bacteria 3659
59 Ga0070680_100049897 3300005336 Bacteria 3413
60 Ga0070680_100086668 3300005336 Bacteria 2589
61 Ga0070680_100134802 3300005336 Bacteria 2068
62 Ga0070682_100015659 3300005337 Bacteria 4396
63 Ga0070682_100039303 3300005337 Bacteria 2907
64 Ga0068868_100014107 3300005338 Bacteria 5882
65 Ga0068868_100015336 3300005338 Bacteria 5665
66 Ga0068868_100025540 3300005338 Bacteria 4495
67 Ga0070660_100000724 3300005339 Bacteria 21893
68 Ga0070660_100109780 3300005339 Bacteria 2193
69 Ga0070660_100120710 3300005339 Bacteria 2091
70 Ga0070660_100226163 3300005339 Bacteria 1522
71 Ga0070660_100266697 3300005339 Bacteria 1399
72 Ga0070689_100090135 3300005340 Bacteria 2416
73 Ga0070689_100188949 3300005340 Bacteria 1677
74 Ga0070691_10078724 3300005341 Bacteria 1610
75 Ga0070661_100019484 3300005344 Bacteria 4837
76 Ga0070661_100051071 3300005344 Bacteria 3026
77 Ga0070668_100019213 3300005347 Bacteria 5141
78 Ga0070668_100095175 3300005347 Bacteria 2352
79 Ga0070668_100169920 3300005347 Bacteria 1774
80 Ga0070668_100192764 3300005347 Bacteria 1670
81 Ga0070675_100128068 3300005354 Bacteria 2161
82 Ga0070671_100023164 3300005355 Bacteria 5078
83 Ga0070671_100045047 3300005355 Bacteria 3667
84 Ga0070674_100120886 3300005356 Bacteria 1939
85 Ga0070674_100143937 3300005356 Bacteria 1792
86 Ga0070688_100023196 3300005365 Bacteria 3647
87 Ga0070688_100048956 3300005365 Bacteria 2628
88 Ga0070659_100002581 3300005366 Bacteria 12874
89 Ga0070659_100009498 3300005366 Bacteria 7146
90 Ga0070659_100026271 3300005366 Bacteria 4478
91 Ga0070659_100055803 3300005366 Bacteria 3114
92 Ga0070659_100079965 3300005366 Bacteria 2609
93 Ga0070667_100099088 3300005367 Bacteria 2515
94 Ga0070667_100183437 3300005367 Bacteria 1851
95 Ga0070709_10004463 3300005434 Bacteria 7552
96 Ga0070709_10005128 3300005434 Bacteria 7085
97 Ga0070709_10008476 3300005434 Bacteria 5648
98 Ga0070709_10037311 3300005434 Bacteria 2967
99 Ga0070709_10082645 3300005434 Bacteria 2099
100 Ga0070709_10084828 3300005434 Bacteria 2076
101 Ga0070714_100001950 3300005435 Bacteria 15066
102 Ga0070714_100009084 3300005435 Bacteria 7794
103 Ga0070714_100033046 3300005435 Bacteria 4323
104 Ga0070714_100040248 3300005435 Bacteria 3938
105 Ga0070714_100055472 3300005435 Bacteria 3386
106 Ga0070714_100063580 3300005435 Bacteria 3174
107 Ga0070714_100171348 3300005435 Bacteria 1970
108 Ga0070714_100214858 3300005435 Bacteria 1765
109 Ga0070713_100015728 3300005436 Bacteria 5668
110 Ga0070713_100036242 3300005436 Bacteria 3979
111 Ga0070713_100094317 3300005436 Bacteria 2580
112 Ga0070713_100160266 3300005436 Bacteria 2007
113 Ga0070713_100165992 3300005436 Bacteria 1974
114 Ga0070713_100178753 3300005436 Bacteria 1905
115 Ga0070710_10001928 3300005437 Bacteria 9829
116 Ga0070710_10006419 3300005437 Bacteria 5648
117 Ga0070710_10023896 3300005437 Bacteria 3219
118 Ga0070710_10044123 3300005437 Bacteria 2472
119 Ga0070710_10114129 3300005437 Bacteria 1627
120 Ga0070701_10055284 3300005438 Bacteria 2073
121 Ga0070701_10059601 3300005438 Bacteria 2007
122 Ga0070711_100000566 3300005439 Bacteria 19333
123 Ga0070711_100004427 3300005439 Bacteria 8290
124 Ga0070711_100004672 3300005439 Bacteria 8106
125 Ga0070711_100004805 3300005439 Bacteria 8013
126 Ga0070711_100010118 3300005439 Bacteria 5828
127 Ga0070711_100039439 3300005439 Bacteria 3182
128 Ga0070700_100084101 3300005441 Bacteria 2061
129 Ga0070700_100095059 3300005441 Bacteria 1952
130 Ga0070700_100143850 3300005441 Bacteria 1623
131 Ga0070708_100003380 3300005445 Bacteria 12502
132 Ga0070708_100029812 3300005445 Bacteria 4709
133 Ga0070708_100043098 3300005445 Bacteria 3964
134 Ga0070708_100249120 3300005445 Bacteria 1668
135 Ga0070663_100005434 3300005455 Bacteria 7566
136 Ga0070663_100023049 3300005455 Bacteria 4168
137 Ga0070663_100025725 3300005455 Bacteria 3977
138 Ga0070663_100061701 3300005455 Bacteria 2700
139 Ga0070663_100080927 3300005455 Bacteria 2386
140 Ga0070663_100083288 3300005455 Bacteria 2355
141 Ga0070663_100100599 3300005455 Bacteria 2156
142 Ga0070663_100206390 3300005455 Bacteria 1536
143 Ga0070678_100016197 3300005456 Bacteria 4760
144 Ga0070678_100086598 3300005456 Bacteria 2390
145 Ga0070678_100146943 3300005456 Bacteria 1894
146 Ga0070678_100171935 3300005456 Bacteria 1765
147 Ga0070678_100180985 3300005456 Bacteria 1725
148 Ga0070662_100010579 3300005457 Bacteria 6063
149 Ga0070681_10005696 3300005458 Bacteria 12042
150 Ga0070681_10042460 3300005458 Bacteria 4556
151 Ga0070681_10054701 3300005458 Bacteria 3977
152 Ga0070681_10075588 3300005458 Bacteria 3328
153 Ga0070681_10136004 3300005458 Bacteria 2388
154 Ga0070681_10149222 3300005458 Bacteria 2265
155 Ga0070681_10160678 3300005458 Bacteria 2171
156 Ga0070681_10212702 3300005458 Bacteria 1849
157 Ga0068867_100052680 3300005459 Bacteria 3003
158 Ga0070685_10146011 3300005466 Bacteria 1494
159 Ga0070706_100006190 3300005467 Bacteria 11322
160 Ga0070706_100074414 3300005467 Bacteria 3144
161 Ga0070707_100001543 3300005468 Bacteria 22396
162 Ga0070707_100001868 3300005468 Bacteria 20255
163 Ga0070707_100090611 3300005468 Bacteria 2959
164 Ga0070698_100006229 3300005471 Bacteria 12983
165 Ga0070698_100174065 3300005471 Bacteria 2092
166 Ga0070699_100002671 3300005518 Bacteria 15939
167 Ga0070699_100018233 3300005518 Bacteria 6031
168 Ga0070679_100003053 3300005530 Bacteria 15300
169 Ga0070679_100005756 3300005530 Bacteria 11497
170 Ga0070679_100012175 3300005530 Bacteria 8217
171 Ga0070679_100013007 3300005530 Bacteria 7970
172 Ga0070679_100022370 3300005530 Bacteria 6180
173 Ga0070679_100053055 3300005530 Bacteria 4036
174 Ga0070679_100104357 3300005530 Bacteria 2821
175 Ga0070679_100186692 3300005530 Bacteria 2043
176 Ga0070679_100206005 3300005530 Bacteria 1931
177 Ga0070684_100034917 3300005535 Bacteria 4302
178 Ga0070684_100040713 3300005535 Bacteria 4002
179 Ga0070684_100040868 3300005535 Bacteria 3995
180 Ga0070684_100046980 3300005535 Bacteria 3741
181 Ga0070684_100157478 3300005535 Bacteria 2060
182 Ga0070697_100018950 3300005536 Bacteria 5429
183 Ga0070697_100162013 3300005536 Bacteria 1890
184 Ga0068853_100005841 3300005539 Bacteria 9693
185 Ga0068853_100014456 3300005539 Bacteria 6464
186 Ga0068853_100016544 3300005539 Bacteria 6073
187 Ga0068853_100043255 3300005539 Bacteria 3853
188 Ga0068853_100062551 3300005539 Bacteria 3221
189 Ga0068853_100123466 3300005539 Bacteria 2312
190 Ga0070672_100055148 3300005543 Bacteria 3113
191 Ga0070672_100240481 3300005543 Bacteria 1522
192 Ga0070696_100138420 3300005546 Bacteria 1776
193 Ga0070693_100086592 3300005547 Bacteria 1880
194 Ga0070665_100033305 3300005548 Bacteria 5185
195 Ga0070665_100052425 3300005548 Bacteria 4091
196 Ga0070665_100064957 3300005548 Bacteria 3661
197 Ga0070665_100077795 3300005548 Bacteria 3323
198 Ga0070665_100133383 3300005548 Bacteria 2485
199 Ga0070665_100178559 3300005548 Bacteria 2124
200 Ga0070665_100232028 3300005548 Bacteria 1846
201 Ga0070665_100290544 3300005548 Bacteria 1637
202 Ga0070665_100363408 3300005548 Bacteria 1453
203 Ga0070704_100012912 3300005549 Bacteria 5168
204 Ga0070704_100040512 3300005549 Bacteria 3207
205 Ga0070704_100088145 3300005549 Bacteria 2305
206 Ga0068855_100007720 3300005563 Bacteria 12990
207 Ga0068855_100012186 3300005563 Bacteria 10389
208 Ga0068855_100015651 3300005563 Bacteria 9126
209 Ga0068855_100025903 3300005563 Bacteria 7015
210 Ga0068855_100027404 3300005563 Bacteria 6815
211 Ga0068855_100033743 3300005563 Bacteria 6106
212 Ga0068855_100055016 3300005563 Bacteria 4675
213 Ga0068855_100076921 3300005563 Bacteria 3872
214 Ga0068855_100120242 3300005563 Bacteria 3006
215 Ga0068855_100152792 3300005563 Bacteria 2624
216 Ga0068855_100274524 3300005563 Bacteria 1874
217 Ga0070664_100003967 3300005564 Bacteria 11906
218 Ga0070664_100118752 3300005564 Bacteria 2313
219 Ga0070664_100285662 3300005564 Bacteria 1488
220 Ga0068857_100022565 3300005577 Bacteria 5535
221 Ga0068857_100031478 3300005577 Bacteria 4688
222 Ga0068857_100065118 3300005577 Bacteria 3240
223 Ga0068857_100088899 3300005577 Bacteria 2764
224 Ga0068857_100106543 3300005577 Bacteria 2517
225 Ga0068857_100234053 3300005577 Bacteria 1681
226 Ga0068854_100031940 3300005578 Bacteria 3661
227 Ga0068854_100044708 3300005578 Bacteria 3145
228 Ga0068854_100159820 3300005578 Bacteria 1744
229 Ga0068856_100000197 3300005614 Bacteria 63857
230 Ga0068856_100000535 3300005614 Bacteria 41862
231 Ga0068856_100001185 3300005614 Bacteria 27475
232 Ga0068856_100006599 3300005614 Bacteria 11374
233 Ga0068856_100020287 3300005614 Bacteria 6455
234 Ga0068856_100281841 3300005614 Bacteria 1678
235 Ga0068856_100430281 3300005614 Bacteria 1340
236 Ga0068852_100009344 3300005616 Bacteria 7278
237 Ga0068852_100015291 3300005616 Bacteria 5943
238 Ga0068852_100025264 3300005616 Bacteria 4810
239 Ga0068852_100043131 3300005616 Bacteria 3824
240 Ga0068852_100049908 3300005616 Bacteria 3582
241 Ga0068852_100109115 3300005616 Bacteria 2513
242 Ga0068852_100217465 3300005616 Bacteria 1816
243 Ga0068852_100220431 3300005616 Bacteria 1804
244 Ga0068852_100234016 3300005616 Bacteria 1752
245 Ga0068859_100052906 3300005617 Bacteria 4083
246 Ga0068859_100160203 3300005617 Bacteria 2329
247 Ga0068859_100244868 3300005617 Bacteria 1882
248 Ga0068859_100272312 3300005617 Bacteria 1785
249 Ga0068864_100035170 3300005618 Bacteria 4264
250 Ga0068864_100200244 3300005618 Bacteria 1834
251 Ga0068864_100217014 3300005618 Bacteria 1763
252 Ga0068864_100236581 3300005618 Bacteria 1691
253 Ga0068866_10006508 3300005718 Bacteria 4868
254 Ga0068866_10028243 3300005718 Bacteria 2671
255 Ga0068861_100015012 3300005719 Bacteria 5449
256 Ga0068861_100129684 3300005719 Bacteria 2045
257 Ga0068851_10003594 3300005834 Bacteria 6913
258 Ga0068851_10003991 3300005834 Bacteria 6619
259 Ga0068851_10011381 3300005834 Bacteria 4170
260 Ga0068863_100306665 3300005841 Bacteria 1540
261 Ga0068858_100044329 3300005842 Bacteria 4123
262 Ga0068858_100077486 3300005842 Bacteria 3088
263 Ga0068858_100122486 3300005842 Bacteria 2433
264 Ga0068858_100333229 3300005842 Bacteria 1452
265 Ga0068860_100002461 3300005843 Bacteria 19440
266 Ga0068860_100010373 3300005843 Bacteria 9215
267 Ga0068860_100079139 3300005843 Bacteria 3125
268 Ga0068862_100051983 3300005844 Bacteria 3505
269 Ga0068862_100121209 3300005844 Bacteria 2305
270 Ga0068862_100185231 3300005844 Bacteria 1870
271 Ga0068862_100222708 3300005844 Bacteria 1708
272 Ga0068862_100293704 3300005844 Bacteria 1493
273 Ga0081455_10001796 3300005937 Bacteria 25915
274 Ga0081455_10006892 3300005937 Bacteria 12092
275 Ga0081455_10006941 3300005937 Bacteria 12041
276 Ga0081455_10007694 3300005937 Bacteria 11311
277 Ga0081455_10010171 3300005937 Bacteria 9579
278 Ga0081455_10023773 3300005937 Bacteria 5694
279 Ga0081455_10034950 3300005937 Bacteria 4498
280 Ga0081455_10056843 3300005937 Bacteria 3320
281 Ga0081455_10063680 3300005937 Bacteria 3093
282 Ga0081455_10095415 3300005937 Bacteria 2400
283 Ga0081455_10166935 3300005937 Bacteria 1681
284 Ga0081455_10218283 3300005937 Bacteria 1415
285 Ga0081538_10021648 3300005981 Bacteria 4682
286 Ga0081538_10051228 3300005981 Bacteria 2482
287 Ga0081540_1000430 3300005983 Bacteria 41337
288 Ga0081540_1000979 3300005983 Bacteria 25757
289 Ga0081540_1002120 3300005983 Bacteria 16520
290 Ga0081540_1004076 3300005983 Bacteria 11311
291 Ga0081540_1004971 3300005983 Bacteria 9998
292 Ga0081540_1009134 3300005983 Bacteria 6842
293 Ga0081540_1009393 3300005983 Bacteria 6742
294 Ga0081540_1011445 3300005983 Bacteria 5927
295 Ga0081540_1012053 3300005983 Bacteria 5720
296 Ga0081540_1012218 3300005983 Bacteria 5677
297 Ga0081540_1012797 3300005983 Bacteria 5490
298 Ga0081540_1016805 3300005983 Bacteria 4561
299 Ga0081540_1018169 3300005983 Bacteria 4325
300 Ga0081540_1018760 3300005983 Bacteria 4229
301 Ga0081540_1022988 3300005983 Bacteria 3664
302 Ga0081540_1030591 3300005983 Bacteria 2978
303 Ga0081540_1034249 3300005983 Bacteria 2743
304 Ga0081540_1034270 3300005983 Bacteria 2742
305 Ga0081540_1035864 3300005983 Bacteria 2654
306 Ga0081540_1059102 3300005983 Bacteria 1843
307 Ga0081540_1065898 3300005983 Bacteria 1700
308 Ga0081539_10000003 3300005985 Bacteria 594833
309 Ga0081539_10000140 3300005985 Bacteria 166746
310 Ga0081539_10000273 3300005985 Bacteria 117936
311 Ga0081539_10000423 3300005985 Bacteria 89970
312 Ga0081539_10001457 3300005985 Bacteria 40268
313 Ga0081539_10016652 3300005985 Bacteria 5228
314 Ga0081539_10037373 3300005985 Bacteria 2893
315 Ga0081539_10044785 3300005985 Bacteria 2551
316 Ga0070717_10002238 3300006028 Bacteria 13559
317 Ga0070717_10004040 3300006028 Bacteria 10570
318 Ga0070717_10006817 3300006028 Bacteria 8433
319 Ga0070717_10107879 3300006028 Bacteria 2372
320 Ga0070717_10149515 3300006028 Bacteria 2019
321 Ga0075365_10021616 3300006038 Bacteria 4016
322 Ga0075365_10027419 3300006038 Bacteria 3625
323 Ga0075365_10030380 3300006038 Bacteria 3460
324 Ga0075365_10033601 3300006038 Bacteria 3307
325 Ga0075365_10064340 3300006038 Bacteria 2457
326 Ga0075365_10066431 3300006038 Bacteria 2419
327 Ga0075365_10075469 3300006038 Bacteria 2275
328 Ga0075365_10076083 3300006038 Bacteria 2267
329 Ga0075365_10101918 3300006038 Bacteria 1966
330 Ga0075365_10131483 3300006038 Bacteria 1732
331 Ga0075365_10142797 3300006038 Bacteria 1662
332 Ga0075365_10180367 3300006038 Bacteria 1476
333 Ga0075365_10212801 3300006038 Bacteria 1355
334 Ga0075368_10000258 3300006042 Bacteria 15196
335 Ga0075368_10015526 3300006042 Bacteria 2827
336 Ga0075368_10017178 3300006042 Bacteria 2705
337 Ga0075368_10038842 3300006042 Bacteria 1864
338 Ga0075368_10041672 3300006042 Bacteria 1804
339 Ga0075368_10056194 3300006042 Bacteria 1570
340 Ga0075363_100002988 3300006048 Bacteria 7065
341 Ga0075363_100056792 3300006048 Bacteria 2099
342 Ga0075363_100082840 3300006048 Bacteria 1757
343 Ga0075364_10010235 3300006051 Bacteria 5657
344 Ga0075364_10031243 3300006051 Bacteria 3421
345 Ga0075364_10068592 3300006051 Bacteria 2332
346 Ga0070715_10000273 3300006163 Bacteria 12463
347 Ga0070715_10000384 3300006163 Bacteria 11062
348 Ga0070716_100022330 3300006173 Bacteria 3343
349 Ga0070716_100030811 3300006173 Bacteria 2914
350 Ga0070712_100000721 3300006175 Bacteria 19494
351 Ga0070712_100006564 3300006175 Bacteria 7221
352 Ga0070712_100013148 3300006175 Bacteria 5281
353 Ga0070712_100016629 3300006175 Bacteria 4752
354 Ga0070712_100022457 3300006175 Bacteria 4157
355 Ga0070712_100036232 3300006175 Bacteria 3355
356 Ga0070712_100070119 3300006175 Bacteria 2503
357 Ga0075367_10001631 3300006178 Bacteria 9753
358 Ga0075367_10004888 3300006178 Bacteria 6600
359 Ga0075367_10004919 3300006178 Bacteria 6582
360 Ga0075367_10013998 3300006178 Bacteria 4332
361 Ga0075367_10041096 3300006178 Bacteria 2702
362 Ga0075367_10122777 3300006178 Bacteria 1601
363 Ga0075369_10022486 3300006186 Bacteria 2600
364 Ga0075369_10037855 3300006186 Bacteria 2056
365 Ga0075369_10042989 3300006186 Bacteria 1938
366 Ga0075369_10050537 3300006186 Bacteria 1798
367 Ga0075369_10057775 3300006186 Bacteria 1688
368 Ga0075366_10029384 3300006195 Bacteria 3229
369 Ga0075366_10046116 3300006195 Bacteria 2582
370 Ga0075366_10080724 3300006195 Bacteria 1942
371 Ga0075366_10087436 3300006195 Bacteria 1865
372 Ga0097621_100110600 3300006237 Bacteria 2321
373 Ga0097621_100269548 3300006237 Bacteria 1495
374 Ga0075370_10018963 3300006353 Bacteria 3737
375 Ga0075370_10019487 3300006353 Bacteria 3696
376 Ga0075370_10075597 3300006353 Bacteria 1931
377 Ga0075370_10098650 3300006353 Bacteria 1689
378 Ga0075428_100000643 3300006844 Bacteria 35894
379 Ga0075428_100006057 3300006844 Bacteria 13440
380 Ga0075428_100056741 3300006844 Bacteria 4288
381 Ga0075428_100323286 3300006844 Bacteria 1657
382 Ga0075430_100000052 3300006846 Bacteria 60703
383 Ga0075430_100010397 3300006846 Bacteria 7881
384 Ga0075430_100025544 3300006846 Bacteria 5026
385 Ga0075430_100177411 3300006846 Bacteria 1772
386 Ga0075431_100000441 3300006847 Bacteria 33990
387 Ga0075431_100000802 3300006847 Bacteria 27440
388 Ga0075431_100003541 3300006847 Bacteria 15120
389 Ga0075431_100063661 3300006847 Bacteria 3806
390 Ga0075431_100114539 3300006847 Bacteria 2783
391 Ga0075431_100199693 3300006847 Bacteria 2046
392 Ga0075431_100364748 3300006847 Bacteria 1450
393 Ga0075433_10000633 3300006852 Bacteria 23526
394 Ga0075433_10014960 3300006852 Bacteria 6352
395 Ga0075433_10084163 3300006852 Bacteria 2807
396 Ga0075433_10085821 3300006852 Bacteria 2779
397 Ga0075433_10193242 3300006852 Bacteria 1810
398 Ga0075433_10241491 3300006852 Bacteria 1603
399 Ga0075434_100029033 3300006871 Bacteria 5439
400 Ga0075434_100097215 3300006871 Bacteria 2949
401 Ga0075434_100109276 3300006871 Bacteria 2776
402 Ga0075434_100280969 3300006871 Bacteria 1684
403 Ga0075429_100001562 3300006880 Bacteria 18820
404 Ga0075429_100021707 3300006880 Bacteria 5565
405 Ga0075429_100059216 3300006880 Bacteria 3336
406 Ga0075429_100232329 3300006880 Bacteria 1615
407 Ga0068865_100025011 3300006881 Bacteria 3923
408 Ga0068865_100080168 3300006881 Bacteria 2340
409 Ga0075436_100023912 3300006914 Bacteria 4199
410 Ga0097620_100052905 3300006931 Bacteria 4083
411 Ga0097620_100160199 3300006931 Bacteria 2329
412 Ga0097620_100244881 3300006931 Bacteria 1882
413 Ga0097620_100272308 3300006931 Bacteria 1785
414 Ga0099824_1004403 3300006942 Bacteria 20285
415 Ga0099824_1006748 3300006942 Bacteria 15616
416 Ga0099824_1027442 3300006942 Bacteria 2749
417 Ga0099822_1004857 3300006943 Bacteria 17534
418 Ga0099822_1018335 3300006943 Bacteria 7305
419 Ga0099823_1031333 3300006944 Bacteria 4393
420 Ga0099823_1052075 3300006944 Bacteria 2455
421 Ga0075435_100012560 3300007076 Bacteria 6274
422 Ga0075435_100036737 3300007076 Bacteria 3895
423 Ga0075435_100056799 3300007076 Bacteria 3165
424 Ga0099794_10014454 3300007265 Bacteria 3459
425 Ga0099794_10016781 3300007265 Bacteria 3252
426 Ga0099794_10018817 3300007265 Bacteria 3102
427 Ga0099795_10005356 3300007788 Bacteria 3404
428 Ga0105240_10002078 3300009093 Bacteria 32819
429 Ga0105240_10027569 3300009093 Bacteria 7435
430 Ga0105240_10029263 3300009093 Bacteria 7181
431 Ga0105240_10032127 3300009093 Bacteria 6798
432 Ga0105240_10038351 3300009093 Bacteria 6146
433 Ga0105240_10041521 3300009093 Bacteria 5870
434 Ga0105240_10073858 3300009093 Bacteria 4211
435 Ga0105240_10114272 3300009093 Bacteria 3261
436 Ga0105240_10118520 3300009093 Bacteria 3190
437 Ga0105240_10180331 3300009093 Bacteria 2493
438 Ga0105240_10249402 3300009093 Bacteria 2054
439 Ga0111539_10006916 3300009094 Bacteria 14566
440 Ga0111539_10013178 3300009094 Bacteria 10337
441 Ga0111539_10032630 3300009094 Bacteria 6322
442 Ga0111539_10074229 3300009094 Bacteria 4008
443 Ga0105245_10037871 3300009098 Bacteria 4288
444 Ga0105245_10143359 3300009098 Bacteria 2252
445 Ga0105245_10174669 3300009098 Bacteria 2048
446 Ga0105245_10271600 3300009098 Bacteria 1654
447 Ga0105247_10025745 3300009101 Bacteria 3551
448 Ga0105247_10033351 3300009101 Bacteria 3131
449 Ga0105247_10050897 3300009101 Bacteria 2549
450 Ga0105247_10110734 3300009101 Bacteria 1767
451 Ga0114129_10002725 3300009147 Bacteria 24625
452 Ga0114129_10038145 3300009147 Bacteria 6780
453 Ga0114129_10040031 3300009147 Bacteria 6610
454 Ga0114129_10040610 3300009147 Bacteria 6558
455 Ga0114129_10103836 3300009147 Bacteria 3929
456 Ga0114129_10180769 3300009147 Bacteria 2870
457 Ga0114129_10308898 3300009147 Bacteria 2105
458 Ga0105243_10098942 3300009148 Bacteria 2417
459 Ga0105243_10362515 3300009148 Bacteria 1334
460 Ga0105241_10011171 3300009174 Bacteria 6585
461 Ga0105241_10042448 3300009174 Bacteria 3441
462 Ga0105241_10076695 3300009174 Bacteria 2607
463 Ga0105248_10043613 3300009177 Bacteria 5030
464 Ga0105248_10132194 3300009177 Bacteria 2816
465 Ga0105248_10212164 3300009177 Bacteria 2181
466 Ga0105237_10007647 3300009545 Bacteria 11810
467 Ga0105237_10023507 3300009545 Bacteria 6314
468 Ga0105237_10027425 3300009545 Bacteria 5815
469 Ga0105237_10047336 3300009545 Bacteria 4323
470 Ga0105237_10053351 3300009545 Bacteria 4055
471 Ga0105237_10070520 3300009545 Bacteria 3491
472 Ga0105237_10086279 3300009545 Bacteria 3129
473 Ga0105237_10128445 3300009545 Bacteria 2529
474 Ga0105237_10227803 3300009545 Bacteria 1864
475 Ga0105238_10020769 3300009551 Bacteria 6688
476 Ga0105238_10029110 3300009551 Bacteria 5627
477 Ga0105238_10040037 3300009551 Bacteria 4750
478 Ga0105238_10055590 3300009551 Bacteria 3972
479 Ga0105238_10056096 3300009551 Bacteria 3953
480 Ga0105238_10164509 3300009551 Bacteria 2194
481 Ga0105238_10195133 3300009551 Bacteria 2000
482 Ga0105238_10233232 3300009551 Bacteria 1817
483 Ga0105249_10026667 3300009553 Bacteria 5209
484 Ga0099796_10060610 3300010159 Bacteria 1340
485 Ga0105239_10005426 3300010375 Bacteria 14965
486 Ga0105239_10009271 3300010375 Bacteria 11127
487 Ga0105239_10044848 3300010375 Bacteria 4846
488 Ga0105239_10049782 3300010375 Bacteria 4595
489 Ga0105239_10060186 3300010375 Bacteria 4168
490 Ga0105239_10063610 3300010375 Bacteria 4051
491 Ga0105239_10071911 3300010375 Bacteria 3801
492 Ga0105239_10117803 3300010375 Bacteria 2947
493 Ga0105239_10165128 3300010375 Bacteria 2475
494 Ga0105239_10188796 3300010375 Bacteria 2307
495 Ga0105239_10208529 3300010375 Bacteria 2190
496 Ga0105239_10289133 3300010375 Bacteria 1846
497 Ga0105239_10319652 3300010375 Bacteria 1750
498 Ga0105246_10003677 3300011119 Bacteria 9284
499 Ga0105246_10194990 3300011119 Bacteria 1570
500 Ga0157373_10014696 3300013100 Bacteria 5735
501 Ga0157371_10001965 3300013102 Bacteria 20388
502 Ga0157371_10032595 3300013102 Bacteria 3749
503 Ga0157370_10012436 3300013104 Bacteria 8824
504 Ga0157369_10003343 3300013105 Bacteria 19049
505 Ga0157369_10006140 3300013105 Bacteria 13943
506 Ga0157369_10028862 3300013105 Bacteria 6136
507 Ga0157369_10042205 3300013105 Bacteria 4977
508 Ga0157369_10047137 3300013105 Bacteria 4682
509 Ga0157369_10134876 3300013105 Bacteria 2614
510 Ga0157369_10135833 3300013105 Bacteria 2604
511 Ga0157374_10020915 3300013296 Bacteria 5813
512 Ga0157378_10010352 3300013297 Bacteria 8141
513 Ga0157378_10027154 3300013297 Bacteria 5051
514 Ga0157378_10044937 3300013297 Bacteria 3923
515 Ga0157378_10203353 3300013297 Bacteria 1874
516 Ga0163162_10229895 3300013306 Bacteria 1985
517 Ga0163162_10298978 3300013306 Bacteria 1741
518 Ga0163162_10344586 3300013306 Bacteria 1623
519 Ga0157372_10001631 3300013307 Bacteria 24355
520 Ga0157372_10133750 3300013307 Bacteria 2855
521 Ga0157372_10157824 3300013307 Bacteria 2621
522 Ga0157372_10305280 3300013307 Bacteria 1852
523 Ga0157372_10337132 3300013307 Bacteria 1756
524 Ga0157375_10055282 3300013308 Bacteria 3914
525 Ga0157375_10204944 3300013308 Bacteria 2129
526 Ga0157375_10543501 3300013308 Bacteria 1324
527 Ga0163163_10005862 3300014325 Bacteria 10689
528 Ga0163163_10023786 3300014325 Bacteria 5820
529 Ga0163163_10067632 3300014325 Bacteria 3552
530 Ga0163163_10112333 3300014325 Bacteria 2754
531 Ga0163163_10194274 3300014325 Bacteria 2077
532 Ga0163163_10232078 3300014325 Bacteria 1894
533 Ga0163163_10236479 3300014325 Bacteria 1876
534 Ga0163163_10467499 3300014325 Bacteria 1322
535 Ga0182008_10109937 3300014497 Bacteria 1366
536 Ga0157379_10014180 3300014968 Bacteria 6989
537 Ga0157376_10008383 3300014969 Bacteria 7455
538 Ga0157376_10266738 3300014969 Bacteria 1606
539 Ga0163161_10004994 3300017792 Bacteria 9229
540 Ga0163161_10089270 3300017792 Bacteria 2280
541 Ga0214544_1000002 3300021320 Bacteria 753857
542 Ga0214542_1000001 3300021321 Bacteria 1018696
543 Ga0214545_1000001 3300021324 Bacteria 1092817
544 Ga0214543_1000001 3300021327 Bacteria 776921
545 Ga0213873_10004466 3300021358 Bacteria 2613
546 Ga0213876_10001690 3300021384 Bacteria 13424
547 Ga0213876_10091430 3300021384 Bacteria 1612
548 Ga0213871_10001515 3300021441 Bacteria 3933
549 Ga0209563_100864 3300025230 Bacteria 9008
550 Ga0207425_1006454 3300025245 Bacteria 3205
551 Ga0209677_100537 3300025253 Bacteria 21070
552 Ga0209677_103297 3300025253 Bacteria 5335
553 Ga0209677_104828 3300025253 Bacteria 3725
554 Ga0209148_1000613 3300025254 Bacteria 31818
555 Ga0209148_1000841 3300025254 Bacteria 21793
556 Ga0209148_1005138 3300025254 Bacteria 3058
557 Ga0209233_1001871 3300025261 Bacteria 8085
558 Ga0209233_1004495 3300025261 Bacteria 4732
559 Ga0209233_1008594 3300025261 Bacteria 3147
560 Ga0209455_1001277 3300025272 Bacteria 11778
561 Ga0209455_1003926 3300025272 Bacteria 5064
562 Ga0209455_1004047 3300025272 Bacteria 4951
563 Ga0209564_1003012 3300025295 Bacteria 12050
564 Ga0209564_1003264 3300025295 Bacteria 11319
565 Ga0209564_1008506 3300025295 Bacteria 5050
566 Ga0209564_1012867 3300025295 Bacteria 3606
567 Ga0209564_1014212 3300025295 Bacteria 3327
568 Ga0209758_1000140 3300025297 Bacteria 174267
569 Ga0209758_1000164 3300025297 Bacteria 151759
570 Ga0209758_1001346 3300025297 Bacteria 29651
571 Ga0209758_1001601 3300025297 Bacteria 25859
572 Ga0209758_1002251 3300025297 Bacteria 20027
573 Ga0209758_1002397 3300025297 Bacteria 19252
574 Ga0209758_1002853 3300025297 Bacteria 16777
575 Ga0209758_1003241 3300025297 Bacteria 15100
576 Ga0209758_1003800 3300025297 Bacteria 13297
577 Ga0209758_1006517 3300025297 Bacteria 8334
578 Ga0209758_1007245 3300025297 Bacteria 7628
579 Ga0209758_1007676 3300025297 Bacteria 7258
580 Ga0209758_1017749 3300025297 Bacteria 3523
581 Ga0209758_1038310 3300025297 Bacteria 1840
582 Ga0209256_1006146 3300025299 Bacteria 6496
583 Ga0209256_1009403 3300025299 Bacteria 4294
584 Ga0209256_1018544 3300025299 Bacteria 2254
585 Ga0207426_1000626 3300025302 Bacteria 44875
586 Ga0207426_1000822 3300025302 Bacteria 33249
587 Ga0207426_1001216 3300025302 Bacteria 22731
588 Ga0207426_1001803 3300025302 Bacteria 15932
589 Ga0207426_1002280 3300025302 Bacteria 12650
590 Ga0207426_1002722 3300025302 Bacteria 10753
591 Ga0207426_1009840 3300025302 Bacteria 3749
592 Ga0207426_1011102 3300025302 Bacteria 3454
593 Ga0207426_1013581 3300025302 Bacteria 3012
594 Ga0207426_1027750 3300025302 Bacteria 1882
595 Ga0209257_1002059 3300025304 Bacteria 21302
596 Ga0209257_1002227 3300025304 Bacteria 19938
597 Ga0209257_1026420 3300025304 Bacteria 1957
598 Ga0209257_1033673 3300025304 Bacteria 1608
599 Ga0207697_10004888 3300025315 Bacteria 6320
600 Ga0207697_10016374 3300025315 Bacteria 3054
601 Ga0207697_10073450 3300025315 Bacteria 1436
602 Ga0207656_10007922 3300025321 Bacteria 3893
603 Ga0207656_10027596 3300025321 Bacteria 2323
604 Ga0207682_10000233 3300025893 Bacteria 24983
605 Ga0207692_10000214 3300025898 Bacteria 19493
606 Ga0207692_10009204 3300025898 Bacteria 4116
607 Ga0207692_10060872 3300025898 Bacteria 1954
608 Ga0207642_10013332 3300025899 Bacteria 2997
609 Ga0207710_10048973 3300025900 Bacteria 1892
610 Ga0207710_10117111 3300025900 Bacteria 1269
611 Ga0207688_10050156 3300025901 Bacteria 2335
612 Ga0207688_10085575 3300025901 Bacteria 1805
613 Ga0207688_10096000 3300025901 Bacteria 1707
614 Ga0207688_10149583 3300025901 Bacteria 1378
615 Ga0207680_10022163 3300025903 Bacteria 3450
616 Ga0207680_10140666 3300025903 Bacteria 1600
617 Ga0207647_10000712 3300025904 Bacteria 26107
618 Ga0207647_10025278 3300025904 Bacteria 3905
619 Ga0207647_10033656 3300025904 Bacteria 3280
620 Ga0207647_10063221 3300025904 Bacteria 2251
621 Ga0207685_10005804 3300025905 Bacteria 3299
622 Ga0207699_10000379 3300025906 Bacteria 23393
623 Ga0207699_10001095 3300025906 Bacteria 12787
624 Ga0207699_10027860 3300025906 Bacteria 3133
625 Ga0207699_10045190 3300025906 Bacteria 2569
626 Ga0207645_10019420 3300025907 Bacteria 4455
627 Ga0207645_10032640 3300025907 Bacteria 3347
628 Ga0207643_10028396 3300025908 Bacteria 3107
629 Ga0207705_10035725 3300025909 Bacteria 3555
630 Ga0207684_10002538 3300025910 Bacteria 18333
631 Ga0207684_10002971 3300025910 Bacteria 16802
632 Ga0207684_10027469 3300025910 Bacteria 4849
633 Ga0207684_10045020 3300025910 Bacteria 3743
634 Ga0207684_10212938 3300025910 Bacteria 1667
635 Ga0207654_10002421 3300025911 Bacteria 9531
636 Ga0207654_10006353 3300025911 Bacteria 5942
637 Ga0207654_10012132 3300025911 Bacteria 4410
638 Ga0207654_10012820 3300025911 Bacteria 4302
639 Ga0207654_10023984 3300025911 Bacteria 3274
640 Ga0207707_10000359 3300025912 Bacteria 47942
641 Ga0207707_10002327 3300025912 Bacteria 17115
642 Ga0207707_10004014 3300025912 Bacteria 13065
643 Ga0207707_10007742 3300025912 Bacteria 9352
644 Ga0207707_10008741 3300025912 Bacteria 8790
645 Ga0207707_10013921 3300025912 Bacteria 7014
646 Ga0207707_10035480 3300025912 Bacteria 4361
647 Ga0207707_10043631 3300025912 Bacteria 3910
648 Ga0207707_10093928 3300025912 Bacteria 2620
649 Ga0207707_10119750 3300025912 Bacteria 2301
650 Ga0207707_10215459 3300025912 Bacteria 1672
651 Ga0207707_10227195 3300025912 Bacteria 1624
652 Ga0207695_10000910 3300025913 Bacteria 53286
653 Ga0207695_10001998 3300025913 Bacteria 31500
654 Ga0207695_10035157 3300025913 Bacteria 5438
655 Ga0207695_10068321 3300025913 Bacteria 3641
656 Ga0207695_10069051 3300025913 Bacteria 3618
657 Ga0207695_10073106 3300025913 Bacteria 3495
658 Ga0207695_10293540 3300025913 Bacteria 1518
659 Ga0207695_10308493 3300025913 Bacteria 1473
660 Ga0207695_10356756 3300025913 Bacteria 1349
661 Ga0207671_10002587 3300025914 Bacteria 19123
662 Ga0207671_10006943 3300025914 Bacteria 9965
663 Ga0207671_10014047 3300025914 Bacteria 6349
664 Ga0207671_10020564 3300025914 Bacteria 5022
665 Ga0207671_10025479 3300025914 Bacteria 4443
666 Ga0207671_10052004 3300025914 Bacteria 3035
667 Ga0207671_10107404 3300025914 Bacteria 2120
668 Ga0207671_10216729 3300025914 Bacteria 1499
669 Ga0207693_10001226 3300025915 Bacteria 22876
670 Ga0207693_10003562 3300025915 Bacteria 13302
671 Ga0207693_10009473 3300025915 Bacteria 7932
672 Ga0207693_10010251 3300025915 Bacteria 7607
673 Ga0207693_10017377 3300025915 Bacteria 5738
674 Ga0207693_10024965 3300025915 Bacteria 4740
675 Ga0207693_10026683 3300025915 Bacteria 4570
676 Ga0207693_10057257 3300025915 Bacteria 3055
677 Ga0207693_10073149 3300025915 Bacteria 2683
678 Ga0207663_10000628 3300025916 Bacteria 15643
679 Ga0207663_10002632 3300025916 Bacteria 8644
680 Ga0207663_10009673 3300025916 Bacteria 5103
681 Ga0207663_10027788 3300025916 Bacteria 3302
682 Ga0207663_10097600 3300025916 Bacteria 1965
683 Ga0207663_10220692 3300025916 Bacteria 1379
684 Ga0207660_10008313 3300025917 Bacteria 6708
685 Ga0207660_10045952 3300025917 Bacteria 3079
686 Ga0207660_10054672 3300025917 Bacteria 2850
687 Ga0207662_10101648 3300025918 Bacteria 1782
688 Ga0207657_10000371 3300025919 Bacteria 47425
689 Ga0207657_10002789 3300025919 Bacteria 18797
690 Ga0207657_10008747 3300025919 Bacteria 10247
691 Ga0207657_10016670 3300025919 Bacteria 7079
692 Ga0207657_10019432 3300025919 Bacteria 6451
693 Ga0207649_10044696 3300025920 Bacteria 2713
694 Ga0207652_10010009 3300025921 Bacteria 7636
695 Ga0207652_10018726 3300025921 Bacteria 5682
696 Ga0207652_10030769 3300025921 Bacteria 4498
697 Ga0207652_10032026 3300025921 Bacteria 4417
698 Ga0207652_10034932 3300025921 Bacteria 4240
699 Ga0207652_10037570 3300025921 Bacteria 4099
700 Ga0207652_10058518 3300025921 Bacteria 3321
701 Ga0207652_10092077 3300025921 Bacteria 2666
702 Ga0207646_10001054 3300025922 Bacteria 35091
703 Ga0207646_10005295 3300025922 Bacteria 13598
704 Ga0207646_10007223 3300025922 Bacteria 11333
705 Ga0207646_10059976 3300025922 Bacteria 3397
706 Ga0207646_10144919 3300025922 Bacteria 2140
707 Ga0207694_10000157 3300025924 Bacteria 70076
708 Ga0207694_10053295 3300025924 Bacteria 3136
709 Ga0207694_10055889 3300025924 Bacteria 3065
710 Ga0207694_10109193 3300025924 Bacteria 2199
711 Ga0207694_10280143 3300025924 Bacteria 1369
712 Ga0207650_10005860 3300025925 Bacteria 8389
713 Ga0207650_10036096 3300025925 Bacteria 3594
714 Ga0207650_10090519 3300025925 Bacteria 2337
715 Ga0207659_10003917 3300025926 Bacteria 8979
716 Ga0207659_10017546 3300025926 Bacteria 4678
717 Ga0207659_10173002 3300025926 Bacteria 1705
718 Ga0207687_10072339 3300025927 Bacteria 2466
719 Ga0207687_10118367 3300025927 Bacteria 1977
720 Ga0207687_10138239 3300025927 Bacteria 1845
721 Ga0207700_10006989 3300025928 Bacteria 6868
722 Ga0207700_10010013 3300025928 Bacteria 5957
723 Ga0207700_10017812 3300025928 Bacteria 4754
724 Ga0207700_10023291 3300025928 Bacteria 4266
725 Ga0207700_10043564 3300025928 Bacteria 3297
726 Ga0207700_10139046 3300025928 Bacteria 1993
727 Ga0207700_10163270 3300025928 Bacteria 1852
728 Ga0207700_10241838 3300025928 Bacteria 1539
729 Ga0207664_10008537 3300025929 Bacteria 7154
730 Ga0207664_10027649 3300025929 Bacteria 4303
731 Ga0207664_10040218 3300025929 Bacteria 3634
732 Ga0207664_10042081 3300025929 Bacteria 3564
733 Ga0207664_10100541 3300025929 Bacteria 2388
734 Ga0207664_10186531 3300025929 Bacteria 1783
735 Ga0207664_10195437 3300025929 Bacteria 1743
736 Ga0207664_10227587 3300025929 Bacteria 1620
737 Ga0207644_10014609 3300025931 Bacteria 5257
738 Ga0207644_10065259 3300025931 Bacteria 2647
739 Ga0207644_10077073 3300025931 Bacteria 2454
740 Ga0207644_10153702 3300025931 Bacteria 1783
741 Ga0207690_10001921 3300025932 Bacteria 12738
742 Ga0207690_10050336 3300025932 Bacteria 2781
743 Ga0207706_10000179 3300025933 Bacteria 70768
744 Ga0207706_10008198 3300025933 Bacteria 9637
745 Ga0207706_10011412 3300025933 Bacteria 8094
746 Ga0207706_10032041 3300025933 Bacteria 4682
747 Ga0207706_10146897 3300025933 Bacteria 2074
748 Ga0207706_10277773 3300025933 Bacteria 1461
749 Ga0207709_10117562 3300025935 Bacteria 1789
750 Ga0207709_10191009 3300025935 Bacteria 1455
751 Ga0207670_10061736 3300025936 Bacteria 2558
752 Ga0207669_10026912 3300025937 Bacteria 3137
753 Ga0207669_10065085 3300025937 Bacteria 2259
754 Ga0207704_10053582 3300025938 Bacteria 2453
755 Ga0207665_10001305 3300025939 Bacteria 16794
756 Ga0207665_10055356 3300025939 Bacteria 2676
757 Ga0207665_10109693 3300025939 Bacteria 1937
758 Ga0207691_10005440 3300025940 Bacteria 12297
759 Ga0207691_10071690 3300025940 Bacteria 3126
760 Ga0207691_10110729 3300025940 Bacteria 2442
761 Ga0207711_10035548 3300025941 Bacteria 4224
762 Ga0207711_10132179 3300025941 Bacteria 2239
763 Ga0207689_10011579 3300025942 Bacteria 7557
764 Ga0207689_10135761 3300025942 Bacteria 2025
765 Ga0207661_10006014 3300025944 Bacteria 8571
766 Ga0207661_10006099 3300025944 Bacteria 8514
767 Ga0207661_10009972 3300025944 Bacteria 6825
768 Ga0207661_10018653 3300025944 Bacteria 5156
769 Ga0207661_10100386 3300025944 Bacteria 2429
770 Ga0207661_10148136 3300025944 Bacteria 2027
771 Ga0207679_10211546 3300025945 Bacteria 1626
772 Ga0207667_10011520 3300025949 Bacteria 10275
773 Ga0207667_10016633 3300025949 Bacteria 8304
774 Ga0207667_10026324 3300025949 Bacteria 6358
775 Ga0207667_10047244 3300025949 Bacteria 4557
776 Ga0207667_10060098 3300025949 Bacteria 3979
777 Ga0207667_10085227 3300025949 Bacteria 3271
778 Ga0207667_10106279 3300025949 Bacteria 2895
779 Ga0207667_10111037 3300025949 Bacteria 2828
780 Ga0207667_10147724 3300025949 Bacteria 2419
781 Ga0207651_10151632 3300025960 Bacteria 1805
782 Ga0207668_10009212 3300025972 Bacteria 5906
783 Ga0207668_10016413 3300025972 Bacteria 4621
784 Ga0207668_10030484 3300025972 Bacteria 3544
785 Ga0207640_10042167 3300025981 Bacteria 2908
786 Ga0207677_10044918 3300026023 Bacteria 2947
787 Ga0207677_10062741 3300026023 Bacteria 2579
788 Ga0207703_10067369 3300026035 Bacteria 2946
789 Ga0207703_10168578 3300026035 Bacteria 1924
790 Ga0207703_10282785 3300026035 Bacteria 1507
791 Ga0207639_10030650 3300026041 Bacteria 3946
792 Ga0207639_10034004 3300026041 Bacteria 3765
793 Ga0207639_10044374 3300026041 Bacteria 3343
794 Ga0207639_10073521 3300026041 Bacteria 2680
795 Ga0207639_10098703 3300026041 Bacteria 2355
796 Ga0207639_10106443 3300026041 Bacteria 2276
797 Ga0207639_10220099 3300026041 Bacteria 1639
798 Ga0207639_10249787 3300026041 Bacteria 1546
799 Ga0207678_10006632 3300026067 Bacteria 10261
800 Ga0207678_10007352 3300026067 Bacteria 9752
801 Ga0207678_10044979 3300026067 Bacteria 3818
802 Ga0207678_10054731 3300026067 Bacteria 3436
803 Ga0207678_10061977 3300026067 Bacteria 3216
804 Ga0207678_10079940 3300026067 Bacteria 2799
805 Ga0207678_10113616 3300026067 Bacteria 2310
806 Ga0207678_10122698 3300026067 Bacteria 2217
807 Ga0207678_10131781 3300026067 Bacteria 2133
808 Ga0207678_10150261 3300026067 Bacteria 1988
809 Ga0207678_10232846 3300026067 Bacteria 1577
810 Ga0207708_10027461 3300026075 Bacteria 4309
811 Ga0207702_10000002 3300026078 Bacteria 491507
812 Ga0207702_10000044 3300026078 Bacteria 149419
813 Ga0207702_10000081 3300026078 Bacteria 108009
814 Ga0207702_10000997 3300026078 Bacteria 29032
815 Ga0207702_10032981 3300026078 Bacteria 4323
816 Ga0207702_10104157 3300026078 Bacteria 2510
817 Ga0207702_10148419 3300026078 Bacteria 2130
818 Ga0207702_10253604 3300026078 Bacteria 1653
819 Ga0207702_10319707 3300026078 Bacteria 1478
820 Ga0207641_10114037 3300026088 Bacteria 2401
821 Ga0207641_10398181 3300026088 Bacteria 1321
822 Ga0207648_10003625 3300026089 Bacteria 16145
823 Ga0207648_10044202 3300026089 Bacteria 3908
824 Ga0207648_10109161 3300026089 Bacteria 2429
825 Ga0207648_10139548 3300026089 Bacteria 2136
826 Ga0207676_10013792 3300026095 Bacteria 5802
827 Ga0207676_10090780 3300026095 Bacteria 2508
828 Ga0207676_10173041 3300026095 Bacteria 1883
829 Ga0207676_10215008 3300026095 Bacteria 1708
830 Ga0207676_10326140 3300026095 Bacteria 1411
831 Ga0207674_10009531 3300026116 Bacteria 11081
832 Ga0207674_10018412 3300026116 Bacteria 7592
833 Ga0207674_10023874 3300026116 Bacteria 6541
834 Ga0207674_10041515 3300026116 Bacteria 4757
835 Ga0207674_10153455 3300026116 Bacteria 2259
836 Ga0207674_10322592 3300026116 Bacteria 1494
837 Ga0207675_100002865 3300026118 Bacteria 16968
838 Ga0207675_100021301 3300026118 Bacteria 6038
839 Ga0207675_100031537 3300026118 Bacteria 4936
840 Ga0207675_100120126 3300026118 Bacteria 2486
841 Ga0207675_100133127 3300026118 Bacteria 2357
842 Ga0207675_100168586 3300026118 Bacteria 2092
843 Ga0207675_100292939 3300026118 Bacteria 1583
844 Ga0207683_10019414 3300026121 Bacteria 5805
845 Ga0207683_10019699 3300026121 Bacteria 5765
846 Ga0207683_10030000 3300026121 Bacteria 4711
847 Ga0207683_10037080 3300026121 Bacteria 4246
848 Ga0207683_10110859 3300026121 Bacteria 2457
849 Ga0207683_10277308 3300026121 Bacteria 1532
850 Ga0207698_10015437 3300026142 Bacteria 5113
851 Ga0207698_10027206 3300026142 Bacteria 4057
852 Ga0207698_10037047 3300026142 Bacteria 3588
853 Ga0207698_10098849 3300026142 Bacteria 2412
854 Ga0207698_10102070 3300026142 Bacteria 2380
855 Ga0209389_1000061 3300027296 Bacteria 105698
856 Ga0209389_1000201 3300027296 Bacteria 42938
857 Ga0209389_1000233 3300027296 Bacteria 36791
858 Ga0209589_1000001 3300027357 Bacteria 794224
859 Ga0209589_1000465 3300027357 Bacteria 56891
860 Ga0209969_1002972 3300027360 Bacteria 2348
861 Ga0209489_100001 3300027361 Bacteria 794224
862 Ga0209489_100006 3300027361 Bacteria 475698
863 Ga0209489_100035 3300027361 Bacteria 168255
864 Ga0209489_102560 3300027361 Bacteria 36742
865 Ga0209700_100001 3300027363 Bacteria 794224
866 Ga0209700_100005 3300027363 Bacteria 573969
867 Ga0209700_100062 3300027363 Bacteria 145471
868 Ga0209967_1003797 3300027364 Bacteria 1994
869 Ga0209179_1007355 3300027512 Bacteria 1816
870 Ga0209983_1002077 3300027665 Bacteria 4417
871 Ga0209588_1004305 3300027671 Bacteria 4006
872 Ga0209971_1006564 3300027682 Bacteria 2751
873 Ga0209813_10000241 3300027866 Bacteria 16251
874 Ga0209974_10000323 3300027876 Bacteria 15625
875 Ga0207428_10000018 3300027907 Bacteria 293117
876 Ga0207428_10064578 3300027907 Bacteria 2890
877 Ga0268266_10002410 3300028379 Bacteria 20158
878 Ga0268266_10003390 3300028379 Bacteria 15951
879 Ga0268266_10005649 3300028379 Bacteria 11601
880 Ga0268266_10025598 3300028379 Bacteria 5019
881 Ga0268266_10030373 3300028379 Bacteria 4590
882 Ga0268266_10034718 3300028379 Bacteria 4289
883 Ga0268266_10094186 3300028379 Bacteria 2628
884 Ga0268266_10124114 3300028379 Bacteria 2301
885 Ga0268266_10143239 3300028379 Bacteria 2146
886 Ga0268266_10165099 3300028379 Bacteria 2005
887 Ga0268265_10036239 3300028380 Bacteria 3612
888 Ga0268265_10038885 3300028380 Bacteria 3502
889 Ga0268265_10085253 3300028380 Bacteria 2506
890 Ga0268264_10000149 3300028381 Bacteria 163972
891 Ga0268264_10016783 3300028381 Bacteria 5992
892 Ga0268264_10141726 3300028381 Bacteria 2144
893 Ga0265337_1016243 3300028556 Bacteria 2411
894 Ga0265326_10002417 3300028558 Bacteria 6290
895 Ga0265319_1003112 3300028563 Bacteria 8766
896 Ga0265319_1019665 3300028563 Bacteria 2516
897 Ga0265334_10004574 3300028573 Bacteria 6128
898 Ga0265334_10006531 3300028573 Bacteria 5018
899 Ga0265318_10002252 3300028577 Bacteria 10404
900 Ga0265323_10000280 3300028653 Bacteria 29540
901 Ga0265323_10004599 3300028653 Bacteria 5932
902 Ga0265322_10017668 3300028654 Bacteria 2053
903 Ga0265336_10000434 3300028666 Bacteria 25752
904 Ga0265336_10001016 3300028666 Bacteria 13775
905 Ga0307517_10000008 3300028786 Bacteria 243202
906 Ga0307517_10000772 3300028786 Bacteria 55020
907 Ga0307517_10011552 3300028786 Bacteria 12229
908 Ga0307517_10042025 3300028786 Bacteria 4918
909 Ga0307515_10038891 3300028794 Bacteria 7588
910 Ga0307515_10243880 3300028794 Bacteria 1562
911 Ga0265338_10000776 3300028800 Bacteria 54431
912 Ga0265338_10001205 3300028800 Bacteria 42738
913 Ga0265324_10004764 3300029957 Bacteria 6007
914 Ga0265324_10006841 3300029957 Bacteria 4700
915 Ga0307511_10107907 3300030521 Bacteria 1789
916 Ga0265330_10024452 3300031235 Bacteria 2740
917 Ga0265332_10023610 3300031238 Bacteria 2712
918 Ga0265325_10003329 3300031241 Bacteria 10565
919 Ga0265340_10000903 3300031247 Bacteria 16830
920 Ga0265339_10028260 3300031249 Bacteria 3191
921 Ga0307513_10005868 3300031456 Bacteria 16133
922 Ga0307513_10220710 3300031456 Bacteria 1717
923 Ga0307509_10037791 3300031507 Bacteria 5275
924 Ga0307509_10093588 3300031507 Bacteria 3066
925 Ga0307508_10000009 3300031616 Bacteria 256966
926 Ga0307508_10000213 3300031616 Bacteria 70156
927 Ga0307508_10008975 3300031616 Bacteria 9213
928 Ga0307508_10009580 3300031616 Bacteria 8900
929 Ga0307508_10036557 3300031616 Bacteria 4421
930 Ga0307508_10044235 3300031616 Bacteria 3985
931 Ga0307508_10076621 3300031616 Bacteria 2922
932 Ga0307508_10093534 3300031616 Bacteria 2596
933 Ga0265314_10002371 3300031711 Bacteria 19414
934 Ga0265314_10005412 3300031711 Bacteria 11534
935 Ga0265314_10009299 3300031711 Bacteria 8318
936 Ga0265314_10025825 3300031711 Bacteria 4423
937 Ga0265314_10027041 3300031711 Bacteria 4300
938 Ga0265314_10085675 3300031711 Bacteria 2065
939 Ga0265342_10067315 3300031712 Bacteria 2096
940 Ga0307516_10002828 3300031730 Bacteria 22862
941 Ga0307516_10005403 3300031730 Bacteria 15313
942 Ga0307516_10008211 3300031730 Bacteria 11855
943 Ga0307516_10013909 3300031730 Bacteria 8540
944 Ga0307516_10044284 3300031730 Bacteria 4404
945 Ga0307516_10052133 3300031730 Bacteria 4007
946 Ga0307516_10078013 3300031730 Bacteria 3159
947 Ga0307516_10147974 3300031730 Bacteria 2112
948 Ga0307410_10081736 3300031852 Bacteria 2271
949 Ga0307412_10160792 3300031911 Bacteria 1668
950 Ga0307416_100048634 3300032002 Bacteria 3366
951 Ga0307416_100067979 3300032002 Bacteria 2942
952 Ga0307416_100072477 3300032002 Bacteria 2867
953 Ga0307414_10196208 3300032004 Bacteria 1638
954 Ga0307411_10055799 3300032005 Bacteria 2601
955 Ga0307411_10081443 3300032005 Bacteria 2229
956 Ga0307411_10318101 3300032005 Bacteria 1255
957 Ga0307507_10059932 3300033179 Bacteria 3559
958 Ga0307510_10005184 3300033180 Bacteria 15491
959 Ga0307510_10024366 3300033180 Bacteria 6992
960 Ga0307510_10030365 3300033180 Bacteria 6126
961 Ga0307510_10052336 3300033180 Bacteria 4306
962 Ga0307510_10063180 3300033180 Bacteria 3774
963 Ga0307510_10064293 3300033180 Bacteria 3727
964 Ga0307510_10148559 3300033180 Bacteria 1969
965 Ga0307510_10159470 3300033180 Bacteria 1856
966 Ga0315911_1000001 3300033442 Bacteria 1088602
967 Ga0315911_1000006 3300033442 Bacteria 414563
968 Ga0316215_1003151 3300033544 Bacteria 1568
969 Ga0373926_0006210 3300035083 Bacteria 3964
970 Ga0373951_0021202 3300035091 Bacteria 1492
971 Ga0373923_0047531 3300035111 Bacteria 1789
972 Ga0373936_0000012 3300035113 Bacteria 228915
973 Ga0373936_0012550 3300035113 Bacteria 3225
974 Ga0373939_0015998 3300035114 Bacteria 1972
975 Ga0373941_0055204 3300035115 Bacteria 1276
976 Ga0373945_0005196 3300035116 Bacteria 4160
977 Ga0373953_0060402 3300035117 Bacteria 1549
978 Ga0373954_0005241 3300035118 Bacteria 5601
979 Ga0373954_0011301 3300035118 Bacteria 3954
980 Ga0373954_0023809 3300035118 Bacteria 2788
981 Ga0373956_0023481 3300035119 Bacteria 2647
982 Ga0373956_0026692 3300035119 Bacteria 2503
983 Ga0373957_0010573 3300035120 Bacteria 3055
984 Ga0373957_0017756 3300035120 Bacteria 2484
985 Ga0373957_0039787 3300035120 Bacteria 1765
986 Ga0373957_0070331 3300035120 Bacteria 1368
987 Ga0373943_0059921 3300035170 Bacteria 1899
988 Ga0373943_0087722 3300035170 Bacteria 1606
989 Ga0373955_0000210 3300035172 Bacteria 24373
990 Ga0373955_0021420 3300035172 Bacteria 3263
991 Ga0373955_0028931 3300035172 Bacteria 2877
992 Ga0373955_0035358 3300035172 Bacteria 2645
993 Ga0373955_0174155 3300035172 Bacteria 1275
994 Ga0373961_0010213 3300035241 Bacteria 2310
995 Ga0373961_0019772 3300035241 Bacteria 1773
996 Ga0373931_0001664 3300035691 Bacteria 9623
997 Ga0373931_0001805 3300035691 Bacteria 9315
998 Ga0373935_0000146 3300035692 Bacteria 32473
999 Ga0373935_0000382 3300035692 Bacteria 22745
1000 Ga0373935_0000602 3300035692 Bacteria 18790
1001 Ga0373935_0017006 3300035692 Bacteria 4405
1002 Ga0373935_0051822 3300035692 Bacteria 2607
1003 Ga0373927_0000069 3300035695 Bacteria 74096
1004 Ga0373927_0007415 3300035695 Bacteria 7427
1005 Ga0373927_0008315 3300035695 Bacteria 6986
1006 Ga0373927_0009820 3300035695 Bacteria 6415
1007 Ga0373927_0025913 3300035695 Bacteria 3832
1008 Ga0373927_0051893 3300035695 Bacteria 2652
1009 Ga0373927_0052766 3300035695 Bacteria 2629
1010 Ga0373927_0057746 3300035695 Bacteria 2509
1011 Ga0373927_0062734 3300035695 Bacteria 2403
1012 Ga0373927_0108626 3300035695 Bacteria 1807
1013 Ga0373927_0120305 3300035695 Bacteria 1714
1014 Ga0373933_0000445 3300035724 Bacteria 25820
1015 Ga0373933_0001755 3300035724 Bacteria 12583
1016 Ga0373933_0009054 3300035724 Bacteria 5433
1017 Ga0373933_0012105 3300035724 Bacteria 4763
1018 Ga0373933_0080933 3300035724 Bacteria 1992
1019 Ga0373947_0000385 3300035725 Bacteria 24888
1020 Ga0373947_0002022 3300035725 Bacteria 12373
1021 Ga0373947_0010182 3300035725 Bacteria 5398
1022 Ga0373947_0024081 3300035725 Bacteria 3545
1023 Ga0373947_0042886 3300035725 Bacteria 2701
1024 Ga0373947_0042950 3300035725 Bacteria 2699
1025 Ga0373947_0109264 3300035725 Bacteria 1745
1026 Ga0373947_0133007 3300035725 Bacteria 1589
1027 Ga0373947_0137542 3300035725 Bacteria 1564
1028 Ga0373947_0198619 3300035725 Bacteria 1311
1029 Ga0373937_0011760 3300036401 Bacteria 7678
1030 Ga0373937_0038193 3300036401 Bacteria 4376
1031 Ga0373937_0044445 3300036401 Bacteria 4057
1032 Ga0373937_0047885 3300036401 Bacteria 3911
1033 Ga0373937_0049800 3300036401 Bacteria 3836
1034 Ga0373937_0049980 3300036401 Bacteria 3829
1035 Ga0373937_0076440 3300036401 Bacteria 3092
1036 Ga0373937_0086387 3300036401 Bacteria 2903
1037 Ga0373937_0128498 3300036401 Bacteria 2365
1038 Ga0373925_0022731 3300037068 Bacteria 4575
1039 Ga0373925_0023950 3300037068 Bacteria 4454
1040 Ga0373925_0031253 3300037068 Bacteria 3912
1041 Ga0373925_0093009 3300037068 Bacteria 2307
1042 Ga0373925_0096352 3300037068 Bacteria 2268
1043 Ga0373925_0209660 3300037068 Bacteria 1552
1044 Ga0395899_0012313 3300037312 Bacteria 6553
1045 Ga0395899_0051385 3300037312 Bacteria 3059
1046 Ga0395900_0001120 3300037418 Bacteria 33947
1047 Ga0395900_0008437 3300037418 Bacteria 10598
1048 Ga0395900_0019170 3300037418 Bacteria 6975
1049 Ga0395900_0057396 3300037418 Bacteria 4008
1050 Ga0395900_0125874 3300037418 Bacteria 2628
1051 Ga0395900_0203299 3300037418 Bacteria 2003
1052 Ga0395898_0012798 3300037466 Bacteria 8662
1053 Ga0395898_0017966 3300037466 Bacteria 7216
1054 Ga0395898_0136444 3300037466 Bacteria 2349
1055 Ga0395898_0141457 3300037466 Bacteria 2303
1056 Ga0395898_0142442 3300037466 Bacteria 2295
1057 Ga0395898_0291364 3300037466 Bacteria 1557
1058 Ga0395905_0038754 3300037471 Bacteria 4470
1059 Ga0395905_0045219 3300037471 Bacteria 4129
1060 Ga0395905_0191275 3300037471 Bacteria 1919
1061 Ga0436364_0154921 3300037853 Bacteria 3496
1062 Ga0436364_0794198 3300037853 Bacteria 1904
1063 Ga0436364_1394003 3300037853 Bacteria 2778
1064 Ga0395901_0002127 3300038443 Bacteria 20290
1065 Ga0395901_0029033 3300038443 Bacteria 5690
1066 Ga0395901_0077651 3300038443 Bacteria 3466
1067 Ga0395901_0131762 3300038443 Bacteria 2627
1068 Ga0395901_0239417 3300038443 Bacteria 1893
1069 Ga0395901_0240634 3300038443 Bacteria 1888
1070 Ga0395901_0407197 3300038443 Bacteria 1397
1071 Ga0395901_0489680 3300038443 Bacteria 1253
1072 Ga0436365_0613407 3300039437 Bacteria 2810
1073 Ga0436365_0655688 3300039437 Bacteria 1706
1074 Ga0436365_1233295 3300039437 Bacteria 2685
1075 Ga0436365_1440273 3300039437 Bacteria 9786
1076 Ga0436365_1540038 3300039437 Bacteria 1524
1077 Ga0436360_1071774 3300039438 Bacteria 1297
1078 Ga0436360_1105678 3300039438 Bacteria 2638
1079 Ga0436361_0209695 3300039447 Bacteria 1480
1080 Ga0436361_0549184 3300039447 Bacteria 2976
1081 Ga0436361_0848594 3300039447 Bacteria 1945
1082 Ga0436361_0904316 3300039447 Bacteria 2028
1083 Ga0436363_0361238 3300039450 Bacteria 3058
1084 Ga0436363_0814578 3300039450 Bacteria 1322
1085 Ga0436363_0918081 3300039450 Bacteria 3766
1086 Ga0436363_1092037 3300039450 Bacteria 1728
1087 Ga0436362_0554704 3300039453 Bacteria 1270
1088 Ga0436362_0680219 3300039453 Bacteria 2614
1089 Ga0439441_002408 3300042001 Bacteria 2633
1090 Ga0439435_0007906 3300042436 Bacteria 2454
1091 Ga0439460_0018470 3300042461 Bacteria 1878
1092 Ga0451577_0001635 3300042876 Bacteria 29060
1093 Ga0451577_0013589 3300042876 Bacteria 7614
1094 Ga0466969_0049680 3300044656 Bacteria 2069
1095 Ga0466972_0000189 3300044658 Bacteria 47501
1096 Ga0466972_0007356 3300044658 Bacteria 5533
1097 Ga0466972_0021981 3300044658 Bacteria 3177
1098 Ga0453683_0005342 3300044673 Bacteria 8976
1099 Ga0453683_0005758 3300044673 Bacteria 8595
1100 Ga0453683_0006980 3300044673 Bacteria 7698
1101 Ga0453683_0020767 3300044673 Bacteria 4196
1102 Ga0466965_0003215 3300044683 Bacteria 7142
1103 Ga0466966_0000196 3300044684 Bacteria 40708
1104 Ga0466966_0000655 3300044684 Bacteria 22032
1105 Ga0466966_0016313 3300044684 Bacteria 4912
1106 Ga0466961_0000239 3300044693 Bacteria 36887
1107 Ga0466961_0001465 3300044693 Bacteria 14665
1108 Ga0466963_0035708 3300044694 Bacteria 3239
1109 Ga0466963_0054556 3300044694 Bacteria 2657
1110 Ga0466963_0116741 3300044694 Bacteria 1834
1111 Ga0466964_0039299 3300044706 Bacteria 1906
1112 Ga0453684_0026520 3300044712 Bacteria 8362
1113 Ga0453684_0049587 3300044712 Bacteria 5534
1114 Ga0466968_0003867 3300044735 Bacteria 5560
1115 Ga0466960_0037541 3300044901 Bacteria 2273
1116 Ga0466959_0021923 3300045049 Bacteria 4718
1117 Ga0466959_0043086 3300045049 Bacteria 3329
1118 Ga0466959_0095878 3300045049 Bacteria 2127
1119 Ga0451576_0021367 3300045051 Bacteria 7033
1120 Ga0466967_0024787 3300045976 Bacteria 4937
1121 Ga0466967_0115555 3300045976 Bacteria 2471
1122 Ga0466967_0135163 3300045976 Bacteria 2293
1123 Ga0466967_0135494 3300045976 Bacteria 2290
1124 Ga0495617_027881 3300046452 Bacteria 1899
1125 Ga0495592_0004668 3300046454 Bacteria 10040
1126 Ga0495592_0036870 3300046454 Bacteria 3681
1127 Ga0495592_0047310 3300046454 Bacteria 3203
1128 Ga0495592_0057851 3300046454 Bacteria 2861
1129 Ga0495592_0066030 3300046454 Bacteria 2648
1130 Ga0495592_0087144 3300046454 Bacteria 2247
1131 Ga0495592_0089703 3300046454 Bacteria 2207
1132 Ga0495603_0000191 3300046455 Bacteria 32052
1133 Ga0495603_0000429 3300046455 Bacteria 23279
1134 Ga0495603_0000499 3300046455 Bacteria 21732
1135 Ga0495603_0004726 3300046455 Bacteria 8135
1136 Ga0495603_0009824 3300046455 Bacteria 5790
1137 Ga0495603_0010882 3300046455 Bacteria 5520
1138 Ga0495603_0017980 3300046455 Bacteria 4278
1139 Ga0495603_0031657 3300046455 Bacteria 3184
1140 Ga0495603_0041717 3300046455 Bacteria 2744
1141 Ga0495603_0058221 3300046455 Bacteria 2285
1142 Ga0495629_0000083 3300046459 Bacteria 83715
1143 Ga0495629_0000500 3300046459 Bacteria 32861
1144 Ga0495629_0000721 3300046459 Bacteria 26824
1145 Ga0495638_0004605 3300046460 Bacteria 10436
1146 Ga0495638_0015687 3300046460 Bacteria 5081
1147 Ga0495638_0019634 3300046460 Bacteria 4470
1148 Ga0495638_0052980 3300046460 Bacteria 2525
1149 Ga0495638_0098190 3300046460 Bacteria 1755
1150 Ga0495638_0103032 3300046460 Bacteria 1704
1151 Ga0495638_0110496 3300046460 Bacteria 1633
1152 Ga0495641_0001436 3300046461 Bacteria 20225
1153 Ga0495641_0062784 3300046461 Bacteria 1675
1154 Ga0495651_0000395 3300046462 Bacteria 33751
1155 Ga0495651_0013879 3300046462 Bacteria 6233
1156 Ga0495651_0019048 3300046462 Bacteria 5318
1157 Ga0495651_0040157 3300046462 Bacteria 3640
1158 Ga0495651_0064755 3300046462 Bacteria 2793
1159 Ga0495653_0004234 3300046463 Bacteria 11627
1160 Ga0495653_0034425 3300046463 Bacteria 4007
1161 Ga0495580_0000143 3300046472 Bacteria 51276
1162 Ga0495580_0000716 3300046472 Bacteria 28310
1163 Ga0495580_0001842 3300046472 Bacteria 18644
1164 Ga0495580_0010080 3300046472 Bacteria 7381
1165 Ga0495582_0000094 3300046473 Bacteria 45642
1166 Ga0495582_0000251 3300046473 Bacteria 29816
1167 Ga0495582_0036966 3300046473 Bacteria 2686
1168 Ga0495639_0000077 3300046475 Bacteria 46394
1169 Ga0495639_0000150 3300046475 Bacteria 36003
1170 Ga0495639_0000926 3300046475 Bacteria 13254
1171 Ga0495639_0039079 3300046475 Bacteria 2132
1172 Ga0495662_0000080 3300046476 Bacteria 34571
1173 Ga0495662_0000826 3300046476 Bacteria 15060
1174 Ga0495662_0031332 3300046476 Bacteria 2569
1175 Ga0495664_0005360 3300046477 Bacteria 7035
1176 Ga0495664_0014962 3300046477 Bacteria 4405
1177 Ga0495664_0028264 3300046477 Bacteria 3275
1178 Ga0495664_0045999 3300046477 Bacteria 2589
1179 Ga0495664_0065612 3300046477 Bacteria 2164
1180 Ga0495584_0042407 3300046491 Bacteria 2297
1181 Ga0495584_0061875 3300046491 Bacteria 1882
1182 Ga0495584_0092153 3300046491 Bacteria 1528
1183 Ga0495585_0061664 3300046492 Bacteria 2061
1184 Ga0495594_0000433 3300046499 Bacteria 21075
1185 Ga0495594_0000648 3300046499 Bacteria 17955
1186 Ga0495594_0001874 3300046499 Bacteria 10943
1187 Ga0495594_0039280 3300046499 Bacteria 2588
1188 Ga0495606_0001450 3300046507 Bacteria 31779
1189 Ga0495606_0002520 3300046507 Bacteria 21082
1190 Ga0495606_0002700 3300046507 Bacteria 20045
1191 Ga0495606_0032276 3300046507 Bacteria 3630
1192 Ga0495606_0049185 3300046507 Bacteria 2767
1193 Ga0495606_0056101 3300046507 Bacteria 2544
1194 Ga0495606_0058297 3300046507 Bacteria 2482
1195 Ga0495606_0085077 3300046507 Bacteria 1957
1196 Ga0495606_0106427 3300046507 Bacteria 1698
1197 Ga0495608_0020761 3300046511 Bacteria 4512
1198 Ga0495608_0037629 3300046511 Bacteria 3253
1199 Ga0495608_0055907 3300046511 Bacteria 2607
1200 Ga0495610_0084470 3300046512 Bacteria 1451
1201 Ga0495618_0026652 3300046514 Bacteria 3596
1202 Ga0495618_0092429 3300046514 Bacteria 1935
1203 Ga0495620_0052979 3300046515 Bacteria 1720
1204 Ga0495628_0003637 3300046516 Bacteria 13765
1205 Ga0495628_0026802 3300046516 Bacteria 4693
1206 Ga0495628_0026806 3300046516 Bacteria 4692
1207 Ga0495628_0064553 3300046516 Bacteria 2866
1208 Ga0495628_0068444 3300046516 Bacteria 2770
1209 Ga0495628_0228721 3300046516 Bacteria 1395
1210 Ga0495630_0003796 3300046517 Bacteria 10535
1211 Ga0495630_0111703 3300046517 Bacteria 2070
1212 Ga0495630_0128620 3300046517 Bacteria 1923
1213 Ga0495631_0060901 3300046518 Bacteria 1637
1214 Ga0495632_0105296 3300046519 Bacteria 1327
1215 Ga0495637_0045179 3300046520 Bacteria 1871
1216 Ga0495643_0006299 3300046522 Bacteria 7849
1217 Ga0495643_0015625 3300046522 Bacteria 4480
1218 Ga0495643_0052418 3300046522 Bacteria 2191
1219 Ga0495644_0046239 3300046523 Bacteria 1636
1220 Ga0495648_0013070 3300046524 Bacteria 6158
1221 Ga0495648_0017835 3300046524 Bacteria 5058
1222 Ga0495648_0039534 3300046524 Bacteria 3001
1223 Ga0495648_0066948 3300046524 Bacteria 2103
1224 Ga0495663_0042220 3300046525 Bacteria 1389
1225 Ga0495666_0099252 3300046526 Bacteria 1372
1226 Ga0495642_0020776 3300046528 Bacteria 2581
1227 Ga0495652_0006074 3300046529 Bacteria 11294
1228 Ga0495652_0019988 3300046529 Bacteria 5956
1229 Ga0495652_0028621 3300046529 Bacteria 4901
1230 Ga0495652_0030569 3300046529 Bacteria 4722
1231 Ga0495652_0031471 3300046529 Bacteria 4646
1232 Ga0495652_0080952 3300046529 Bacteria 2680
1233 Ga0495652_0102748 3300046529 Bacteria 2315
1234 Ga0495652_0110898 3300046529 Bacteria 2206
1235 Ga0495652_0143984 3300046529 Bacteria 1871
1236 Ga0495652_0195722 3300046529 Bacteria 1539
1237 Ga0495654_0044567 3300046530 Bacteria 2194
1238 Ga0495665_0000784 3300046531 Bacteria 16556
1239 Ga0495665_0003088 3300046531 Bacteria 9016
1240 Ga0495665_0016458 3300046531 Bacteria 3985
1241 Ga0495665_0021744 3300046531 Bacteria 3450
1242 Ga0495640_0003320 3300046533 Bacteria 12954
1243 Ga0495640_0011232 3300046533 Bacteria 6895
1244 Ga0495640_0013662 3300046533 Bacteria 6171
1245 Ga0495640_0018041 3300046533 Bacteria 5246
1246 Ga0495640_0025555 3300046533 Bacteria 4281
1247 Ga0495640_0031230 3300046533 Bacteria 3803
1248 Ga0495586_0044679 3300046535 Bacteria 2387
1249 Ga0495587_0008275 3300046536 Bacteria 6696
1250 Ga0495587_0017472 3300046536 Bacteria 4456
1251 Ga0495587_0080594 3300046536 Bacteria 1886
1252 Ga0495621_0031684 3300046539 Bacteria 1815
1253 Ga0495597_0004537 3300046542 Bacteria 7597
1254 Ga0495645_0000805 3300046543 Bacteria 21490
1255 Ga0495645_0020048 3300046543 Bacteria 4820
1256 Ga0495645_0021210 3300046543 Bacteria 4695
1257 Ga0495645_0058920 3300046543 Bacteria 2785
1258 Ga0495645_0082855 3300046543 Bacteria 2299
1259 Ga0495622_0001916 3300046557 Bacteria 10222
1260 Ga0495622_0008222 3300046557 Bacteria 4833
1261 Ga0495622_0028444 3300046557 Bacteria 2611
1262 Ga0495622_0037832 3300046557 Bacteria 2247
1263 Ga0495622_0050528 3300046557 Bacteria 1929
1264 Ga0495622_0068828 3300046557 Bacteria 1635
1265 Ga0495633_0059289 3300046558 Bacteria 1795
1266 Ga0495667_0005217 3300046559 Bacteria 8782
1267 Ga0495667_0007037 3300046559 Bacteria 7634
1268 Ga0495667_0008195 3300046559 Bacteria 7092
1269 Ga0495667_0010501 3300046559 Bacteria 6266
1270 Ga0495667_0041370 3300046559 Bacteria 3057
1271 Ga0495667_0059642 3300046559 Bacteria 2504
1272 Ga0495667_0139449 3300046559 Bacteria 1563
1273 Ga0495656_0006988 3300046615 Bacteria 3973
1274 Ga0495656_0053353 3300046615 Bacteria 1737
1275 Ga0495668_0103416 3300046616 Bacteria 1558
1276 Ga0495668_0107575 3300046616 Bacteria 1525
1277 Ga0495668_0138146 3300046616 Bacteria 1334
1278 Ga0495634_0001187 3300046642 Bacteria 24132
1279 Ga0495634_0002836 3300046642 Bacteria 14230
1280 Ga0495634_0017869 3300046642 Bacteria 5055
1281 Ga0495634_0020590 3300046642 Bacteria 4676
1282 Ga0495634_0026647 3300046642 Bacteria 4032
1283 Ga0495634_0104942 3300046642 Bacteria 1822
1284 Ga0495625_0104872 3300046660 Bacteria 1937
1285 Ga0495635_0000229 3300046663 Bacteria 35647
1286 Ga0495635_0000425 3300046663 Bacteria 26748
1287 Ga0495635_0001333 3300046663 Bacteria 16433
1288 Ga0495635_0009501 3300046663 Bacteria 6797
1289 Ga0495635_0026189 3300046663 Bacteria 4061
1290 Ga0495635_0048856 3300046663 Bacteria 2916
1291 Ga0495635_0063005 3300046663 Bacteria 2546
1292 Ga0495659_0061544 3300046664 Bacteria 1387
1293 Ga0495661_0050951 3300046665 Bacteria 2502
1294 Ga0495588_0007431 3300046674 Bacteria 4986
1295 Ga0495588_0029437 3300046674 Bacteria 2754
1296 Ga0495588_0034106 3300046674 Bacteria 2574
1297 Ga0495657_0005171 3300046675 Bacteria 10333
1298 Ga0495657_0010875 3300046675 Bacteria 6831
1299 Ga0495657_0020820 3300046675 Bacteria 4713
1300 Ga0495657_0036819 3300046675 Bacteria 3378
1301 Ga0495657_0150771 3300046675 Bacteria 1443
1302 Ga0495599_0000421 3300046678 Bacteria 24238
1303 Ga0495599_0001555 3300046678 Bacteria 13210
1304 Ga0495599_0016576 3300046678 Bacteria 4575
1305 Ga0495599_0044339 3300046678 Bacteria 2789
1306 Ga0495599_0050075 3300046678 Bacteria 2618
1307 Ga0495599_0077243 3300046678 Bacteria 2079
1308 Ga0495599_0078053 3300046678 Bacteria 2067
1309 Ga0495599_0082341 3300046678 Bacteria 2010
1310 Ga0495599_0126498 3300046678 Bacteria 1588
1311 Ga0495599_0156362 3300046678 Bacteria 1410
1312 Ga0495623_0007010 3300046679 Bacteria 7325
1313 Ga0495623_0009021 3300046679 Bacteria 6470
1314 Ga0495623_0026676 3300046679 Bacteria 3717
1315 Ga0495623_0052619 3300046679 Bacteria 2572
1316 Ga0495646_0019582 3300046680 Bacteria 4281
1317 Ga0495646_0031778 3300046680 Bacteria 3288
1318 Ga0495646_0037047 3300046680 Bacteria 3019
1319 Ga0495646_0070124 3300046680 Bacteria 2065
1320 Ga0495647_0002127 3300046681 Bacteria 6194
1321 Ga0495647_0008621 3300046681 Bacteria 3430
1322 Ga0495658_0000334 3300046683 Bacteria 26467
1323 Ga0495658_0001408 3300046683 Bacteria 12626
1324 Ga0495658_0002435 3300046683 Bacteria 9368
1325 Ga0495658_0031544 3300046683 Bacteria 2887
1326 Ga0495669_0027773 3300046684 Bacteria 2476
1327 Ga0495669_0028233 3300046684 Bacteria 2456
1328 Ga0495613_0010577 3300046689 Bacteria 6844
1329 Ga0495613_0028367 3300046689 Bacteria 4162
1330 Ga0495613_0048297 3300046689 Bacteria 3143
1331 Ga0495613_0056346 3300046689 Bacteria 2886
1332 Ga0495624_0000096 3300046690 Bacteria 59307
1333 Ga0495624_0000786 3300046690 Bacteria 24993
1334 Ga0495624_0000818 3300046690 Bacteria 24567
1335 Ga0495624_0042731 3300046690 Bacteria 2896
1336 Ga0495624_0094070 3300046690 Bacteria 1848
1337 Ga0495670_0034442 3300046691 Bacteria 2522
1338 Ga0495670_0104087 3300046691 Bacteria 1464
1339 Ga0495649_0010278 3300046694 Bacteria 5526
1340 Ga0495649_0069484 3300046694 Bacteria 1889
1341 Ga0495600_0000440 3300046809 Bacteria 21379
1342 Ga0495600_0003908 3300046809 Bacteria 8849
1343 Ga0495600_0011116 3300046809 Bacteria 5604
1344 Ga0495600_0012843 3300046809 Bacteria 5246
1345 Ga0495600_0083511 3300046809 Bacteria 2084
1346 Ga0495600_0159146 3300046809 Bacteria 1460
1347 Ga0495581_0000095 3300047315 Bacteria 36670
1348 Ga0495581_0009576 3300047315 Bacteria 5602
1349 Ga0495581_0024060 3300047315 Bacteria 3529
1350 Ga0495604_0000797 3300047317 Bacteria 26510
1351 Ga0495604_0017963 3300047317 Bacteria 5659
1352 Ga0495604_0024509 3300047317 Bacteria 4813
1353 Ga0495604_0024712 3300047317 Bacteria 4793
1354 Ga0495604_0066064 3300047317 Bacteria 2752
1355 Ga0495604_0138526 3300047317 Bacteria 1741
1356 Ga0495674_0001326 3300047319 Bacteria 24110
1357 Ga0495674_0001342 3300047319 Bacteria 23999
1358 Ga0495674_0002711 3300047319 Bacteria 17225
1359 Ga0495674_0017800 3300047319 Bacteria 6616
1360 Ga0495674_0048096 3300047319 Bacteria 3777
1361 Ga0495674_0048881 3300047319 Bacteria 3740
1362 Ga0495674_0098531 3300047319 Bacteria 2489
1363 Ga0495674_0099667 3300047319 Bacteria 2473
1364 Ga0495674_0188994 3300047319 Bacteria 1712
1365 Ga0495672_0010757 3300047320 Bacteria 6494
1366 Ga0495672_0029155 3300047320 Bacteria 3480
1367 Ga0495672_0031567 3300047320 Bacteria 3306
1368 Ga0495672_0079353 3300047320 Bacteria 1833
1369 Ga0495676_0035190 3300047321 Bacteria 4191
1370 Ga0495676_0051777 3300047321 Bacteria 3282
1371 Ga0495676_0053391 3300047321 Bacteria 3221
1372 Ga0495676_0061193 3300047321 Bacteria 2946
1373 Ga0495676_0185413 3300047321 Bacteria 1455
1374 Ga0495680_0002991 3300047322 Bacteria 16880
1375 Ga0495680_0004264 3300047322 Bacteria 13730
1376 Ga0495680_0008649 3300047322 Bacteria 9238
1377 Ga0495683_0063682 3300047323 Bacteria 1822
1378 Ga0495687_009315 3300047443 Bacteria 5503
1379 Ga0495675_0042433 3300047444 Bacteria 2897
1380 Ga0495675_0091167 3300047444 Bacteria 1913
1381 Ga0495677_0031930 3300047445 Bacteria 1917
1382 Ga0495673_0055053 3300047469 Bacteria 1727
1383 Ga0495684_0001579 3300047471 Bacteria 18262
1384 Ga0495684_0019491 3300047471 Bacteria 5225
1385 Ga0495684_0045177 3300047471 Bacteria 3371
1386 Ga0495684_0066747 3300047471 Bacteria 2735
1387 Ga0495684_0089076 3300047471 Bacteria 2338
1388 Ga0495684_0145377 3300047471 Bacteria 1776
1389 Ga0495686_0104291 3300047472 Bacteria 1707
1390 Ga0495686_0158388 3300047472 Bacteria 1325
1391 Ga0495593_0000071 3300047673 Bacteria 43314
1392 Ga0495593_0000192 3300047673 Bacteria 32140
1393 Ga0495593_0000531 3300047673 Bacteria 21606
1394 Ga0495593_0004346 3300047673 Bacteria 8432
1395 Ga0495593_0004557 3300047673 Bacteria 8236
1396 Ga0495602_0002266 3300048088 Bacteria 19452
1397 Ga0495602_0032999 3300048088 Bacteria 4864
1398 Ga0495602_0046834 3300048088 Bacteria 3902
1399 Ga0495602_0058117 3300048088 Bacteria 3388
1400 Ga0495602_0061680 3300048088 Bacteria 3258
1401 Ga0495614_0008512 3300048089 Bacteria 4560
1402 Ga0495614_0014224 3300048089 Bacteria 3487
1403 Ga0495626_0079765 3300048091 Bacteria 1456
1404 Ga0496100_0017746 3300048903 Bacteria 4209
1405 Ga0496100_0048864 3300048903 Bacteria 2733
1406 Ga0496101_0002722 3300048904 Bacteria 10847
1407 Ga0496101_0050241 3300048904 Bacteria 3001
1408 Ga0496101_0070462 3300048904 Bacteria 2560
1409 Ga0496101_0081798 3300048904 Bacteria 2389
1410 Ga0496101_0112214 3300048904 Bacteria 2053
1411 Ga0496101_0181810 3300048904 Bacteria 1619
1412 Ga0496101_0199879 3300048904 Bacteria 1545
1413 Ga0496101_0221803 3300048904 Bacteria 1467
1414 Ga0496102_0006460 3300048905 Bacteria 9999
1415 Ga0496102_0013510 3300048905 Bacteria 7074
1416 Ga0496102_0014728 3300048905 Bacteria 6798
1417 Ga0496102_0023779 3300048905 Bacteria 5444
1418 Ga0496102_0035750 3300048905 Bacteria 4473
1419 Ga0496102_0047263 3300048905 Bacteria 3910
1420 Ga0496102_0056044 3300048905 Bacteria 3595
1421 Ga0496102_0069039 3300048905 Bacteria 3244
1422 Ga0496102_0130421 3300048905 Bacteria 2352
1423 Ga0496102_0216315 3300048905 Bacteria 1806
1424 Ga0496102_0289006 3300048905 Bacteria 1545
1425 Ga0496103_0006318 3300048906 Bacteria 7084
1426 Ga0496103_0034796 3300048906 Bacteria 3082
1427 Ga0496103_0063663 3300048906 Bacteria 2298
1428 Ga0496103_0092632 3300048906 Bacteria 1907
1429 Ga0496103_0125495 3300048906 Bacteria 1637
1430 Ga0496103_0186500 3300048906 Bacteria 1333
1431 Ga0496104_0003416 3300048907 Bacteria 13701
1432 Ga0496104_0006365 3300048907 Bacteria 10386
1433 Ga0496104_0007294 3300048907 Bacteria 9756
1434 Ga0496104_0007469 3300048907 Bacteria 9661
1435 Ga0496104_0013863 3300048907 Bacteria 7272
1436 Ga0496104_0020552 3300048907 Bacteria 6052
1437 Ga0496104_0028484 3300048907 Bacteria 5177
1438 Ga0496104_0050018 3300048907 Bacteria 3943
1439 Ga0496104_0082079 3300048907 Bacteria 3074
1440 Ga0496104_0305797 3300048907 Bacteria 1502
1441 Ga0496105_0000885 3300048908 Bacteria 20493
1442 Ga0496105_0002584 3300048908 Bacteria 13164
1443 Ga0496105_0003408 3300048908 Bacteria 11760
1444 Ga0496105_0020255 3300048908 Bacteria 5374
1445 Ga0496105_0033690 3300048908 Bacteria 4208
1446 Ga0496105_0035975 3300048908 Bacteria 4077
1447 Ga0496105_0083660 3300048908 Bacteria 2635
1448 Ga0496105_0114640 3300048908 Bacteria 2223
1449 Ga0496106_0001915 3300048909 Bacteria 15604
1450 Ga0496106_0007345 3300048909 Bacteria 8144
1451 Ga0496106_0022766 3300048909 Bacteria 4655
1452 Ga0496106_0030731 3300048909 Bacteria 4003
1453 Ga0496106_0037921 3300048909 Bacteria 3606
1454 Ga0496106_0088810 3300048909 Bacteria 2383
1455 Ga0496106_0118644 3300048909 Bacteria 2066
1456 Ga0496106_0127378 3300048909 Bacteria 1994
1457 Ga0496106_0145099 3300048909 Bacteria 1869
1458 Ga0496106_0150552 3300048909 Bacteria 1835
1459 Ga0496107_0012151 3300048910 Bacteria 6006
1460 Ga0496107_0016613 3300048910 Bacteria 5170
1461 Ga0496107_0027783 3300048910 Bacteria 4019
1462 Ga0496107_0038938 3300048910 Bacteria 3410
1463 Ga0496107_0053387 3300048910 Bacteria 2915
1464 Ga0496107_0055102 3300048910 Bacteria 2872
1465 Ga0496107_0098347 3300048910 Bacteria 2143
1466 Ga0496107_0188217 3300048910 Bacteria 1533
1467 Ga0496108_0003824 3300048911 Bacteria 12064
1468 Ga0496108_0017452 3300048911 Bacteria 5873
1469 Ga0496108_0030364 3300048911 Bacteria 4479
1470 Ga0496108_0036356 3300048911 Bacteria 4097
1471 Ga0496108_0040146 3300048911 Bacteria 3900
1472 Ga0496108_0160188 3300048911 Bacteria 1944
1473 Ga0496108_0178103 3300048911 Bacteria 1841
1474 Ga0496108_0253998 3300048911 Bacteria 1529
1475 Ga0496108_0327267 3300048911 Bacteria 1336
1476 Ga0496109_0004518 3300048912 Bacteria 11631
1477 Ga0496109_0032449 3300048912 Bacteria 4695
1478 Ga0496109_0035989 3300048912 Bacteria 4469
1479 Ga0496109_0041003 3300048912 Bacteria 4194
1480 Ga0496109_0154347 3300048912 Bacteria 2150
1481 Ga0496109_0201653 3300048912 Bacteria 1870
1482 Ga0496109_0288186 3300048912 Bacteria 1548
1483 Ga0496110_0014347 3300048913 Bacteria 6575
1484 Ga0496110_0049494 3300048913 Bacteria 3686
1485 Ga0496110_0233224 3300048913 Bacteria 1674
1486 Ga0496110_0238793 3300048913 Bacteria 1653
1487 Ga0496111_0002213 3300048914 Bacteria 11663
1488 Ga0496111_0025164 3300048914 Bacteria 4198
1489 Ga0496111_0030899 3300048914 Bacteria 3811
1490 Ga0496111_0036997 3300048914 Bacteria 3492
1491 Ga0496111_0066009 3300048914 Bacteria 2627
1492 Ga0496111_0072734 3300048914 Bacteria 2503
1493 Ga0496111_0219523 3300048914 Bacteria 1412
1494 Ga0496112_0000004 3300048915 Bacteria 553294
1495 Ga0496112_0000021 3300048915 Bacteria 156561
1496 Ga0496112_0009718 3300048915 Bacteria 8683
1497 Ga0496112_0011381 3300048915 Bacteria 8122
1498 Ga0496112_0012673 3300048915 Bacteria 7753
1499 Ga0496112_0014868 3300048915 Bacteria 7241
1500 Ga0496112_0024366 3300048915 Bacteria 5792
1501 Ga0496112_0034410 3300048915 Bacteria 4931
1502 Ga0496112_0035695 3300048915 Bacteria 4845
1503 Ga0496112_0039660 3300048915 Bacteria 4603
1504 Ga0496112_0069176 3300048915 Bacteria 3488
1505 Ga0496112_0079666 3300048915 Bacteria 3240
1506 Ga0496112_0101340 3300048915 Bacteria 2849
1507 Ga0496112_0104503 3300048915 Bacteria 2802
1508 Ga0496112_0132785 3300048915 Bacteria 2460
1509 Ga0496112_0207383 3300048915 Bacteria 1917
1510 Ga0496113_0001858 3300048916 Bacteria 12026
1511 Ga0496113_0004219 3300048916 Bacteria 8792
1512 Ga0496113_0043607 3300048916 Bacteria 3320
1513 Ga0496113_0045592 3300048916 Bacteria 3252
1514 Ga0496113_0053851 3300048916 Bacteria 3009
1515 Ga0496113_0101787 3300048916 Bacteria 2227
1516 Ga0496113_0106471 3300048916 Bacteria 2178
1517 Ga0496113_0142693 3300048916 Bacteria 1885
1518 Ga0496113_0145583 3300048916 Bacteria 1866
1519 Ga0496114_0002125 3300048917 Bacteria 15068
1520 Ga0496114_0010449 3300048917 Bacteria 7386
1521 Ga0496114_0011440 3300048917 Bacteria 7091
1522 Ga0496114_0043187 3300048917 Bacteria 3738
1523 Ga0496114_0085349 3300048917 Bacteria 2674
1524 Ga0496115_0012349 3300048918 Bacteria 6423
1525 Ga0496115_0054052 3300048918 Bacteria 3224
1526 Ga0496115_0062305 3300048918 Bacteria 3008
1527 Ga0496115_0063546 3300048918 Bacteria 2978
1528 Ga0496115_0088782 3300048918 Bacteria 2524
1529 Ga0496115_0096715 3300048918 Bacteria 2418
1530 Ga0496115_0111608 3300048918 Bacteria 2246
1531 Ga0496115_0134043 3300048918 Bacteria 2042
1532 Ga0496116_0027209 3300048919 Bacteria 4166
1533 Ga0496116_0045503 3300048919 Bacteria 2970
1534 Ga0496116_0123106 3300048919 Bacteria 1496
1535 Ga0496117_0165819 3300048920 Bacteria 1288
1536 Ga0496118_0008788 3300048921 Bacteria 10358
1537 Ga0496118_0011620 3300048921 Bacteria 8564
1538 Ga0496118_0016895 3300048921 Bacteria 6667
1539 Ga0496118_0017343 3300048921 Bacteria 6557
1540 Ga0496118_0018968 3300048921 Bacteria 6167
1541 Ga0496118_0044117 3300048921 Bacteria 3495
1542 Ga0496118_0048374 3300048921 Bacteria 3286
1543 Ga0496118_0100933 3300048921 Bacteria 1950
1544 Ga0496118_0131137 3300048921 Bacteria 1609
1545 Ga0496119_0020237 3300048922 Bacteria 4861
1546 Ga0496119_0070625 3300048922 Bacteria 2047
1547 Ga0496119_0074171 3300048922 Bacteria 1982
1548 Ga0496119_0079911 3300048922 Bacteria 1887
1549 Ga0496119_0090397 3300048922 Bacteria 1741
1550 Ga0496119_0104706 3300048922 Bacteria 1582
1551 Ga0496120_0040496 3300048923 Bacteria 2738
1552 Ga0496121_0000937 3300048924 Bacteria 52775
1553 Ga0496121_0001335 3300048924 Bacteria 42241
1554 Ga0496121_0001474 3300048924 Bacteria 39613
1555 Ga0496121_0005471 3300048924 Bacteria 16264
1556 Ga0496121_0007499 3300048924 Bacteria 13165
1557 Ga0496121_0007715 3300048924 Bacteria 12909
1558 Ga0496121_0014083 3300048924 Bacteria 8529
1559 Ga0496121_0026412 3300048924 Bacteria 5473
1560 Ga0496121_0041760 3300048924 Bacteria 4003
1561 Ga0496121_0073661 3300048924 Bacteria 2735
1562 Ga0496121_0081235 3300048924 Bacteria 2566
1563 Ga0496121_0093945 3300048924 Bacteria 2334
1564 Ga0496121_0137266 3300048924 Bacteria 1820
1565 Ga0496121_0156348 3300048924 Bacteria 1672
1566 Ga0496122_0040041 3300048925 Bacteria 3730
1567 Ga0496122_0068684 3300048925 Bacteria 2542
1568 Ga0496122_0096640 3300048925 Bacteria 1991
1569 Ga0496122_0107191 3300048925 Bacteria 1847
1570 Ga0496123_0051156 3300048926 Bacteria 2753
1571 Ga0496123_0059734 3300048926 Bacteria 2462
1572 Ga0496123_0144221 3300048926 Bacteria 1296
1573 Ga0496124_0000837 3300048927 Bacteria 50140
1574 Ga0496124_0043395 3300048927 Bacteria 3866
1575 Ga0496124_0060408 3300048927 Bacteria 3180
1576 Ga0496124_0139227 3300048927 Bacteria 1917
1577 Ga0496125_0000272 3300048928 Bacteria 105490
1578 Ga0496125_0002607 3300048928 Bacteria 23149
1579 Ga0496125_0003504 3300048928 Bacteria 18949
1580 Ga0496125_0005748 3300048928 Bacteria 13643
1581 Ga0496125_0007108 3300048928 Bacteria 11948
1582 Ga0496125_0018180 3300048928 Bacteria 6680
1583 Ga0496125_0048277 3300048928 Bacteria 3551
1584 Ga0496125_0054870 3300048928 Bacteria 3253
1585 Ga0496125_0076497 3300048928 Bacteria 2584
1586 Ga0496125_0101821 3300048928 Bacteria 2112
1587 Ga0496125_0133241 3300048928 Bacteria 1744
1588 Ga0496126_0003412 3300048929 Bacteria 20085
1589 Ga0496126_0004659 3300048929 Bacteria 16215
1590 Ga0496126_0009003 3300048929 Bacteria 10678
1591 Ga0496126_0012203 3300048929 Bacteria 8815
1592 Ga0496126_0012755 3300048929 Bacteria 8591
1593 Ga0496126_0013528 3300048929 Bacteria 8292
1594 Ga0496126_0018680 3300048929 Bacteria 6860
1595 Ga0496126_0019511 3300048929 Bacteria 6675
1596 Ga0496126_0023543 3300048929 Bacteria 5967
1597 Ga0496126_0023619 3300048929 Bacteria 5956
1598 Ga0496126_0025545 3300048929 Bacteria 5680
1599 Ga0496126_0028347 3300048929 Bacteria 5338
1600 Ga0496126_0030336 3300048929 Bacteria 5124
1601 Ga0496126_0032620 3300048929 Bacteria 4905
1602 Ga0496126_0034632 3300048929 Bacteria 4741
1603 Ga0496126_0044721 3300048929 Bacteria 4075
1604 Ga0496126_0055970 3300048929 Bacteria 3566
1605 Ga0496126_0082690 3300048929 Bacteria 2836
1606 Ga0496126_0092699 3300048929 Bacteria 2653
1607 Ga0496126_0131750 3300048929 Bacteria 2160
1608 Ga0496126_0142588 3300048929 Bacteria 2061
1609 Ga0496126_0151118 3300048929 Bacteria 1990
1610 Ga0496126_0170032 3300048929 Bacteria 1857
1611 Ga0496126_0173685 3300048929 Bacteria 1834
1612 Ga0496126_0251839 3300048929 Bacteria 1471
1613 Ga0496126_0279475 3300048929 Bacteria 1383
1614 Ga0501031_0000910 3300049568 Bacteria 17813
1615 Ga0501031_0001421 3300049568 Bacteria 14827
1616 Ga0501031_0002962 3300049568 Bacteria 10865
1617 Ga0501031_0010568 3300049568 Bacteria 6009
1618 Ga0501031_0016428 3300049568 Bacteria 4807
1619 Ga0501032_0000129 3300049569 Bacteria 62082
1620 Ga0501032_0000421 3300049569 Bacteria 35100
1621 Ga0501032_0000537 3300049569 Bacteria 30708
1622 Ga0501032_0006576 3300049569 Bacteria 8534
1623 Ga0501032_0145628 3300049569 Bacteria 1559
1624 Ga0501033_0000124 3300049570 Bacteria 74731
1625 Ga0501033_0000864 3300049570 Bacteria 27713
1626 Ga0501033_0001179 3300049570 Bacteria 23588
1627 Ga0501033_0002170 3300049570 Bacteria 16951
1628 Ga0501033_0025694 3300049570 Bacteria 4437
1629 Ga0501034_0000503 3300049571 Bacteria 63099
1630 Ga0501034_0012060 3300049571 Bacteria 8935
1631 Ga0501034_0014541 3300049571 Bacteria 8105
1632 Ga0501034_0089178 3300049571 Bacteria 3082
1633 Ga0501036_0000232 3300049572 Bacteria 37236
1634 Ga0501036_0001453 3300049572 Bacteria 18220
1635 Ga0501036_0002128 3300049572 Bacteria 15451
1636 Ga0501036_0018030 3300049572 Bacteria 5909
1637 Ga0501036_0023998 3300049572 Bacteria 5140
1638 Ga0501036_0081321 3300049572 Bacteria 2738
1639 Ga0501036_0294028 3300049572 Bacteria 1359
1640 Ga0501037_0000106 3300049573 Bacteria 79430
1641 Ga0501037_0000469 3300049573 Bacteria 32951
1642 Ga0501037_0002855 3300049573 Bacteria 12528
1643 Ga0501037_0005891 3300049573 Bacteria 8954
1644 Ga0501037_0158054 3300049573 Bacteria 1617
1645 Ga0501038_0000041 3300049574 Bacteria 120557
1646 Ga0501038_0000108 3300049574 Bacteria 70323
1647 Ga0501038_0000274 3300049574 Bacteria 43657
1648 Ga0501038_0001655 3300049574 Bacteria 20704
1649 Ga0501038_0003879 3300049574 Bacteria 13900
1650 Ga0501038_0008504 3300049574 Bacteria 9432
1651 Ga0501038_0053911 3300049574 Bacteria 3460
1652 Ga0501038_0143838 3300049574 Bacteria 1949
1653 Ga0501039_0000097 3300049575 Bacteria 60744
1654 Ga0501039_0000416 3300049575 Bacteria 30616
1655 Ga0501039_0000472 3300049575 Bacteria 29218
1656 Ga0501039_0003027 3300049575 Bacteria 12569
1657 Ga0501040_0155305 3300049576 Bacteria 1616
1658 Ga0501040_0189619 3300049576 Bacteria 1458
1659 Ga0501042_0016537 3300049578 Bacteria 5066
1660 Ga0501042_0017067 3300049578 Bacteria 5001
1661 Ga0501042_0022677 3300049578 Bacteria 4386
1662 Ga0501042_0039520 3300049578 Bacteria 3353
1663 Ga0501043_0000035 3300049579 Bacteria 133200
1664 Ga0501043_0000498 3300049579 Bacteria 35297
1665 Ga0501043_0004728 3300049579 Bacteria 11042
1666 Ga0501043_0019247 3300049579 Bacteria 5359
1667 Ga0501043_0130370 3300049579 Bacteria 1970
1668 Ga0501043_0176288 3300049579 Bacteria 1666
1669 Ga0501046_0000235 3300049580 Bacteria 57005
1670 Ga0501046_0000461 3300049580 Bacteria 40695
1671 Ga0501046_0003612 3300049580 Bacteria 14167
1672 Ga0501046_0128024 3300049580 Bacteria 1927
1673 Ga0501047_0000579 3300049581 Bacteria 38948
1674 Ga0501047_0000844 3300049581 Bacteria 31650
1675 Ga0501047_0001740 3300049581 Bacteria 21108
1676 Ga0501047_0015400 3300049581 Bacteria 7284
1677 Ga0501047_0076446 3300049581 Bacteria 3222
1678 Ga0501047_0084470 3300049581 Bacteria 3051
1679 Ga0501047_0108258 3300049581 Bacteria 2661
1680 Ga0501047_0236068 3300049581 Bacteria 1680
1681 Ga0501047_0236159 3300049581 Bacteria 1680
1682 Ga0501048_0000116 3300049582 Bacteria 45512
1683 Ga0501048_0001444 3300049582 Bacteria 18038
1684 Ga0501048_0002032 3300049582 Bacteria 15376
1685 Ga0501048_0013490 3300049582 Bacteria 6065
1686 Ga0501048_0080046 3300049582 Bacteria 2305
1687 Ga0501067_0000160 3300049583 Bacteria 37883
1688 Ga0501067_0001562 3300049583 Bacteria 12506
1689 Ga0501067_0012440 3300049583 Bacteria 4721
1690 Ga0501067_0048969 3300049583 Bacteria 2342
1691 Ga0501067_0077355 3300049583 Bacteria 1844
1692 Ga0501068_0000014 3300049584 Bacteria 62762
1693 Ga0501068_0001689 3300049584 Bacteria 11774
1694 Ga0501068_0002139 3300049584 Bacteria 10521
1695 Ga0501068_0004794 3300049584 Bacteria 7364
1696 Ga0501068_0045654 3300049584 Bacteria 2639
1697 Ga0501069_0003571 3300049585 Bacteria 8013
1698 Ga0501069_0004593 3300049585 Bacteria 7142
1699 Ga0501070_0000175 3300049586 Bacteria 59483
1700 Ga0501070_0000451 3300049586 Bacteria 37429
1701 Ga0501070_0003132 3300049586 Bacteria 14403
1702 Ga0501070_0010549 3300049586 Bacteria 7810
1703 Ga0501070_0012185 3300049586 Bacteria 7255
1704 Ga0501070_0034852 3300049586 Bacteria 4206
1705 Ga0501070_0133927 3300049586 Bacteria 2046
1706 Ga0501070_0171048 3300049586 Bacteria 1789
1707 Ga0501070_0222193 3300049586 Bacteria 1549
1708 Ga0501071_0033623 3300049587 Bacteria 3643
1709 Ga0501072_0001159 3300049588 Bacteria 19618
1710 Ga0501072_0013749 3300049588 Bacteria 6197
1711 Ga0501072_0041392 3300049588 Bacteria 3619
1712 Ga0501072_0047145 3300049588 Bacteria 3393
1713 Ga0501073_0000417 3300049589 Bacteria 29149
1714 Ga0501073_0002573 3300049589 Bacteria 13565
1715 Ga0501073_0012416 3300049589 Bacteria 6216
1716 Ga0501073_0015408 3300049589 Bacteria 5546
1717 Ga0501073_0020039 3300049589 Bacteria 4822
1718 Ga0501073_0020288 3300049589 Bacteria 4795
1719 Ga0501073_0036142 3300049589 Bacteria 3510
1720 Ga0501073_0062358 3300049589 Bacteria 2601
1721 Ga0501074_0000596 3300049590 Bacteria 22464
1722 Ga0501074_0002156 3300049590 Bacteria 13623
1723 Ga0501074_0014111 3300049590 Bacteria 5809
1724 Ga0501074_0018698 3300049590 Bacteria 5035
1725 Ga0501074_0020304 3300049590 Bacteria 4828
1726 Ga0501074_0027193 3300049590 Bacteria 4147
1727 Ga0501074_0036536 3300049590 Bacteria 3558
1728 Ga0501075_0025051 3300049591 Bacteria 4381
1729 Ga0501077_0061693 3300049593 Bacteria 2379
1730 Ga0501079_0000261 3300049741 Bacteria 32317
1731 Ga0501079_0026383 3300049741 Bacteria 4454
1732 Ga0501079_0120547 3300049741 Bacteria 2040
1733 Ga0501080_0000638 3300049742 Bacteria 27778
1734 Ga0501080_0000917 3300049742 Bacteria 24141
1735 Ga0501080_0002860 3300049742 Bacteria 15179
1736 Ga0501080_0016248 3300049742 Bacteria 6873
1737 Ga0501080_0024764 3300049742 Bacteria 5566
1738 Ga0501080_0024865 3300049742 Bacteria 5553
1739 Ga0501080_0034324 3300049742 Bacteria 4734
1740 Ga0501080_0052344 3300049742 Bacteria 3800
1741 Ga0501083_0000301 3300049744 Bacteria 31182
1742 Ga0501035_0000155 3300049822 Bacteria 84012
1743 Ga0501035_0000250 3300049822 Bacteria 64768
1744 Ga0501035_0000324 3300049822 Bacteria 55297
1745 Ga0501035_0005480 3300049822 Bacteria 11991
1746 Ga0501035_0056563 3300049822 Bacteria 3499
1747 Ga0501035_0113570 3300049822 Bacteria 2372
1748 Ga0501035_0195280 3300049822 Bacteria 1738
1749 Ga0501044_0000051 3300049823 Bacteria 143658
1750 Ga0501044_0000393 3300049823 Bacteria 54257
1751 Ga0501044_0006565 3300049823 Bacteria 12844
1752 Ga0501044_0037167 3300049823 Bacteria 5090
1753 Ga0501044_0042768 3300049823 Bacteria 4710
1754 Ga0501044_0061028 3300049823 Bacteria 3858
1755 Ga0501044_0061265 3300049823 Bacteria 3850
1756 Ga0501044_0099578 3300049823 Bacteria 2925
1757 Ga0501044_0130487 3300049823 Bacteria 2507
1758 Ga0501044_0141531 3300049823 Bacteria 2394
1759 Ga0501044_0277526 3300049823 Bacteria 1610
1760 Ga0501044_0325052 3300049823 Bacteria 1462
1761 Ga0501044_0343767 3300049823 Bacteria 1412
1762 Ga0501045_0016881 3300049824 Bacteria 5186
1763 Ga0501045_0122313 3300049824 Bacteria 1932
1764 Ga0501045_0193984 3300049824 Bacteria 1514
1765 nmdc:mga03n38_11031_c1 3300050490 Bacteria 3351
1766 nmdc:mga03n38_1152_c1 3300050490 Bacteria 7330
1767 nmdc:mga03n38_6491_c1 3300050490 Bacteria 4069
1768 nmdc:mga03n38_70748_c1 3300050490 Bacteria 1614
1769 nmdc:mga00v17_5870_c1 3300050491 Bacteria 6485
1770 nmdc:mga00v17_65415_c1 3300050491 Bacteria 2243
1771 nmdc:mga00v17_71047_c1 3300050491 Bacteria 2157
1772 nmdc:mga0yw44_126840_c1 3300050492 Bacteria 1649
1773 nmdc:mga0yw44_132499_c1 3300050492 Bacteria 1615
1774 nmdc:mga0yw44_26596_c1 3300050492 Bacteria 3307
1775 nmdc:mga0yw44_56770_c1 3300050492 Bacteria 2387
1776 nmdc:mga0yw44_58545_c1 3300050492 Bacteria 2354
1777 nmdc:mga0yw44_65387_c1 3300050492 Bacteria 2241
1778 nmdc:mga0yw44_92434_c1 3300050492 Bacteria 1915
1779 nmdc:mga0k408_16450_c2 3300050493 Bacteria 2495
1780 nmdc:mga0k408_48401_c1 3300050493 Bacteria 2459
1781 nmdc:mga0k408_50969_c2 3300050493 Bacteria 1890
1782 nmdc:mga06z11_18028_c1 3300050494 Bacteria 3217
1783 nmdc:mga06z11_265_c1 3300050494 Bacteria 20369
1784 nmdc:mga06z11_29777_c1 3300050494 Bacteria 2634
1785 nmdc:mga06z11_7714_c1 3300050494 Bacteria 4444
1786 nmdc:mga06z11_96712_c1 3300050494 Bacteria 1613
1787 nmdc:mga04h51_277_c1 3300050495 Bacteria 13149
1788 nmdc:mga07m45_13400_c1 3300050496 Bacteria 4350
1789 nmdc:mga07m45_20941_c1 3300050496 Bacteria 3555
1790 nmdc:mga07m45_24289_c1 3300050496 Bacteria 3319
1791 nmdc:mga07m45_25821_c1 3300050496 Bacteria 3225
1792 nmdc:mga07m45_49310_c1 3300050496 Bacteria 2370
1793 nmdc:mga07m45_54286_c1 3300050496 Bacteria 2265
1794 nmdc:mga05p37_133238_c1 3300050507 Bacteria 3048
1795 nmdc:mga05p37_14166_c1 3300050507 Bacteria 9571
1796 nmdc:mga05p37_168429_c1 3300050507 Bacteria 2673
1797 nmdc:mga05p37_19161_c1 3300050507 Bacteria 8276
1798 nmdc:mga05p37_21718_c1 3300050507 Bacteria 7776
1799 nmdc:mga05p37_38812_c1 3300050507 Bacteria 5843
1800 nmdc:mga05p37_56222_c1 3300050507 Bacteria 4844
1801 nmdc:mga05p37_99586_c1 3300050507 Bacteria 3580
1802 nmdc:mga09592_139305_c1 3300050508 Bacteria 2090
1803 nmdc:mga09592_43756_c1 3300050508 Bacteria 3767
1804 nmdc:mga09592_47189_c1 3300050508 Bacteria 3629
1805 nmdc:mga0qj67_1874_c1 3300050509 Bacteria 14910
1806 nmdc:mga0qj67_3798_c1 3300050509 Bacteria 10908
1807 nmdc:mga0qj67_676_c1 3300050509 Bacteria 23252
1808 nmdc:mga0qj67_77360_c1 3300050509 Bacteria 2661
1809 nmdc:mga06r32_109119_c1 3300050510 Bacteria 2721
1810 nmdc:mga06r32_1475_c1 3300050510 Bacteria 21176
1811 nmdc:mga06r32_1637_c1 3300050510 Bacteria 20211
1812 nmdc:mga06r32_33334_c1 3300050510 Bacteria 4850
1813 nmdc:mga06r32_338775_c1 3300050510 Bacteria 1489
1814 nmdc:mga06r32_543_c1 3300050510 Bacteria 32734
1815 nmdc:mga08y16_111404_c1 3300050511 Bacteria 2849
1816 nmdc:mga08y16_1251_c1 3300050511 Bacteria 25187
1817 nmdc:mga08y16_3110_c1 3300050511 Bacteria 17190
1818 nmdc:mga08y16_6269_c1 3300050511 Bacteria 12468
1819 nmdc:mga0n895_127644_c1 3300050512 Bacteria 2567
1820 nmdc:mga0n895_158611_c1 3300050512 Bacteria 2294
1821 nmdc:mga0n895_62290_c1 3300050512 Bacteria 3686
1822 nmdc:mga0n895_6506_c1 3300050512 Bacteria 9936
1823 nmdc:mga0n895_67363_c1 3300050512 Bacteria 3546
1824 nmdc:mga0n895_70689_c1 3300050512 Bacteria 3459
1825 nmdc:mga0n895_71097_c1 3300050512 Bacteria 3450
1826 nmdc:mga0n895_87513_c1 3300050512 Bacteria 3113
1827 nmdc:mga0rr50_14270_c1 3300050513 Bacteria 5205
1828 nmdc:mga0rr50_57318_c1 3300050513 Bacteria 2914
1829 nmdc:mga08x19_211757_c1 3300050514 Bacteria 1330
1830 nmdc:mga08x19_6146_c1 3300050514 Bacteria 7105
1831 nmdc:mga08x19_69282_c1 3300050514 Bacteria 2297
1832 nmdc:mga0a205_11259_c1 3300050515 Bacteria 8233
1833 nmdc:mga0a205_12648_c1 3300050515 Bacteria 7816
1834 nmdc:mga0a205_16908_c1 3300050515 Bacteria 6829
1835 nmdc:mga0a205_32349_c1 3300050515 Bacteria 5016
1836 nmdc:mga0a205_38197_c1 3300050515 Bacteria 4618
1837 nmdc:mga0a205_53745_c1 3300050515 Bacteria 3887
1838 nmdc:mga0a205_68159_c1 3300050515 Bacteria 3436
1839 nmdc:mga0a205_7303_c1 3300050515 Bacteria 9995
1840 nmdc:mga0sz30_4529_c2 3300050516 Bacteria 2012
1841 nmdc:mga0sz30_48151_c1 3300050516 Bacteria 1803
1842 nmdc:mga0sz30_50417_c1 3300050516 Bacteria 1765
1843 nmdc:mga0sz30_5857_c1 3300050516 Bacteria 4530
1844 nmdc:mga0sz30_72610_c1 3300050516 Bacteria 1483
1845 Ga0495601_0021200 3300053077 Bacteria 3978
1846 Ga0495601_0028822 3300053077 Bacteria 3441
1847 Ga0495601_0131066 3300053077 Bacteria 1633
1848 Ga0495612_0004165 3300053078 Bacteria 5996
1849 Ga0495612_0008179 3300053078 Bacteria 4250
1850 Ga0495612_0036583 3300053078 Bacteria 1992
1851 Ga0500635_0002738 3300053080 Bacteria 4376
1852 Ga0500635_0017508 3300053080 Bacteria 2148
1853 Ga0495619_0000176 3300053085 Bacteria 47128
1854 Ga0495619_0007164 3300053085 Bacteria 7065
1855 Ga0495619_0021997 3300053085 Bacteria 4076
1856 Ga0495619_0030263 3300053085 Bacteria 3504
1857 Ga0495619_0054846 3300053085 Bacteria 2639
1858 Ga0495619_0064738 3300053085 Bacteria 2438
1859 Ga0495619_0093482 3300053085 Bacteria 2038
1860 Ga0500643_000032 3300053087 Bacteria 200350
1861 Ga0500643_015047 3300053087 Bacteria 2665
1862 Ga0500647_0031804 3300053091 Bacteria 2512
1863 Ga0500647_0041985 3300053091 Bacteria 2195
1864 Ga0500566_0000009 3300053094 Bacteria 131668
1865 Ga0500566_0002219 3300053094 Bacteria 11462
1866 Ga0500566_0003778 3300053094 Bacteria 9037
1867 Ga0500566_0005587 3300053094 Bacteria 7469
1868 Ga0500566_0006693 3300053094 Bacteria 6824
1869 Ga0500566_0015610 3300053094 Bacteria 4457
1870 Ga0500566_0019346 3300053094 Bacteria 3997
1871 Ga0500566_0019862 3300053094 Bacteria 3943
1872 Ga0500566_0039944 3300053094 Bacteria 2712
1873 Ga0500640_000068 3300053095 Bacteria 17078
1874 Ga0500640_049776 3300053095 Bacteria 1834
1875 Ga0500641_0003846 3300053096 Bacteria 5306
1876 Ga0500641_0006701 3300053096 Bacteria 4093
1877 Ga0500641_0025396 3300053096 Bacteria 2291
1878 Ga0500641_0060461 3300053096 Bacteria 1576
1879 Ga0500650_0002825 3300053098 Bacteria 5854
1880 Ga0500554_003367 3300053102 Bacteria 3265
1881 Ga0500554_015669 3300053102 Bacteria 1986
1882 Ga0500556_0000004 3300053104 Bacteria 666287
1883 Ga0500556_0001973 3300053104 Bacteria 7240
1884 Ga0500556_0016734 3300053104 Bacteria 2285
1885 Ga0500557_000004 3300053105 Bacteria 202318
1886 Ga0500562_007827 3300053108 Bacteria 2697
1887 Ga0500569_010111 3300053109 Bacteria 2211
1888 Ga0500572_000070 3300053111 Bacteria 32133
1889 Ga0500572_000148 3300053111 Bacteria 24267
1890 Ga0500572_000326 3300053111 Bacteria 17035
1891 Ga0500572_000505 3300053111 Bacteria 13397
1892 Ga0500595_000152 3300053119 Bacteria 45452
1893 Ga0500595_000480 3300053119 Bacteria 24621
1894 Ga0500595_000735 3300053119 Bacteria 19469
1895 Ga0500595_000759 3300053119 Bacteria 18981
1896 Ga0500595_001524 3300053119 Bacteria 12298
1897 Ga0500595_001714 3300053119 Bacteria 11446
1898 Ga0500595_004779 3300053119 Bacteria 6002
1899 Ga0500595_006746 3300053119 Bacteria 4840
1900 Ga0500608_001229 3300053122 Bacteria 9146
1901 Ga0500614_000329 3300053123 Bacteria 12280
1902 Ga0500614_003149 3300053123 Bacteria 3576
1903 Ga0500614_003281 3300053123 Bacteria 3498
1904 Ga0500642_0000173 3300053130 Bacteria 26732
1905 Ga0500642_0000186 3300053130 Bacteria 25633
1906 Ga0500642_0018753 3300053130 Bacteria 2684
1907 Ga0500642_0044404 3300053130 Bacteria 1935
1908 Ga0500652_011396 3300053131 Bacteria 3078
1909 Ga0500559_0000081 3300053136 Bacteria 75262
1910 Ga0500559_0002268 3300053136 Bacteria 10160
1911 Ga0500559_0008102 3300053136 Bacteria 4622
1912 Ga0500564_032900 3300053138 Bacteria 2392
1913 Ga0500564_065104 3300053138 Bacteria 1650
1914 Ga0500568_0001430 3300053139 Bacteria 15482
1915 Ga0500568_0036451 3300053139 Bacteria 2001
1916 Ga0500577_0000153 3300053142 Bacteria 17131
1917 Ga0500577_0038254 3300053142 Bacteria 1731
1918 Ga0500589_011534 3300053147 Bacteria 3829
1919 Ga0500590_077293 3300053148 Bacteria 1642
1920 Ga0500603_000175 3300053150 Bacteria 16391
1921 Ga0500603_000352 3300053150 Bacteria 12039
1922 Ga0500603_000754 3300053150 Bacteria 7829
1923 Ga0500603_000885 3300053150 Bacteria 7123
1924 Ga0500603_023189 3300053150 Bacteria 1543
1925 Ga0500604_0002499 3300053151 Bacteria 5013
1926 Ga0500604_0010784 3300053151 Bacteria 2448
1927 Ga0500616_0000014 3300053153 Bacteria 637918
1928 Ga0500616_0000372 3300053153 Bacteria 62890
1929 Ga0500619_021446 3300053154 Bacteria 1861
1930 Ga0500619_031021 3300053154 Bacteria 1628
1931 Ga0500620_003626 3300053155 Bacteria 3331
1932 Ga0500620_004101 3300053155 Bacteria 3209
1933 Ga0500622_0000513 3300053156 Bacteria 35999
1934 Ga0500622_0080217 3300053156 Bacteria 1635
1935 Ga0500627_0057982 3300053158 Bacteria 1700
1936 Ga0500630_000849 3300053159 Bacteria 14175
1937 Ga0500633_0009242 3300053160 Bacteria 2583
1938 Ga0500634_0075667 3300053161 Bacteria 1750
1939 Ga0500638_000086 3300053162 Bacteria 16892
1940 Ga0500638_000252 3300053162 Bacteria 11670
1941 Ga0500638_051842 3300053162 Bacteria 1983
1942 Ga0500639_000199 3300053163 Bacteria 29793
1943 Ga0500639_000545 3300053163 Bacteria 18833
1944 Ga0500639_007542 3300053163 Bacteria 5652
1945 Ga0500636_0000122 3300053177 Bacteria 40577
1946 Ga0500636_0001016 3300053177 Bacteria 15031
1947 Ga0500636_0071295 3300053177 Bacteria 2014
1948 Ga0500636_0074876 3300053177 Bacteria 1959
1949 Ga0500636_0127047 3300053177 Bacteria 1424
1950 Ga0500637_0000142 3300053178 Bacteria 26117
1951 Ga0500637_0001163 3300053178 Bacteria 10930
1952 Ga0500637_0005306 3300053178 Bacteria 6228
1953 Ga0500637_0009759 3300053178 Bacteria 4900
1954 Ga0500637_0057366 3300053178 Bacteria 2226
1955 Ga0500637_0078172 3300053178 Bacteria 1909
1956 Ga0500625_007714 3300053729 Bacteria 4698
1957 Ga0500625_014344 3300053729 Bacteria 3659
1958 Ga0500645_008570 3300053730 Bacteria 3484
1959 Ga0500645_021765 3300053730 Bacteria 1976
1960 Ga0500596_000198 3300053735 Bacteria 9955
1961 Ga0500596_003453 3300053735 Bacteria 3002
1962 Ga0500601_000050 3300053737 Bacteria 24752
1963 Ga0500601_000509 3300053737 Bacteria 5981
1964 Ga0501084_0014689 3300054114 Bacteria 6493
1965 Ga0501084_0045232 3300054114 Bacteria 3686
1966 Ga0501084_0109964 3300054114 Bacteria 2316
1967 Ga0501084_0325820 3300054114 Bacteria 1297
1968 Ga0500661_000398 3300055283 Bacteria 8059
1969 Ga0500661_001246 3300055283 Bacteria 4759
1970 Ga0500661_007104 3300055283 Bacteria 2076
1971 Ga0587070_010389 3300059491 Bacteria 1371
1972 Ga0501082_0000965 3300060353 Bacteria 25410
1973 Ga0501082_0018584 3300060353 Bacteria 5991

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046454 Ga0495592_0087144 Ga0495592_0087144_44_1114 347
2 3300050510 nmdc:mga06r32_338775_c1 nmdc:mga06r32_338775_c1_391_1440 349
3 3300053085 Ga0495619_0030263 Ga0495619_0030263_2423_3487 350
4 3300009093 Ga0105240_10114272 Ga0105240_101142721 376
5 3300013105 Ga0157369_10042205 Ga0157369_100422052 376
6 3300005340 Ga0070689_100090135 Ga0070689_1000901352 378
7 3300005438 Ga0070701_10055284 Ga0070701_100552842 378
8 3300009093 Ga0105240_10038351 Ga0105240_100383512 378
9 3300013105 Ga0157369_10135833 Ga0157369_101358332 378
10 3300025913 Ga0207695_10035157 Ga0207695_100351574 378
11 3300025936 Ga0207670_10061736 Ga0207670_100617362 378
12 3300037418 Ga0395900_0203299 Ga0395900_0203299_664_1866 378
13 3300037466 Ga0395898_0017966 Ga0395898_0017966_5452_6654 378
14 3300053123 Ga0500614_003281 Ga0500614_003281_1464_2744 378
15 3300039447 Ga0436361_0549184 Ga0436361_0549184_987_2201 379
16 3300009101 Ga0105247_10050897 Ga0105247_100508972 382
17 3300048907 Ga0496104_0007469 Ga0496104_0007469_3640_4878 382
18 3300048908 Ga0496105_0114640 Ga0496105_0114640_316_1554 382
19 3300048914 Ga0496111_0036997 Ga0496111_0036997_985_2223 382
20 3300048915 Ga0496112_0035695 Ga0496112_0035695_514_1752 382
21 3300048916 Ga0496113_0101787 Ga0496113_0101787_409_1647 382
22 3300053119 Ga0500595_000152 Ga0500595_000152_8811_10049 382
23 3300053162 Ga0500638_000086 Ga0500638_000086_5390_6628 382
24 3300053178 Ga0500637_0009759 Ga0500637_0009759_1768_3006 382
25 3300055283 Ga0500661_000398 Ga0500661_000398_5472_6710 382
26 3300006038 Ga0075365_10101918 Ga0075365_101019182 384
27 3300047320 Ga0495672_0079353 Ga0495672_0079353_24_1178 384
28 3300005336 Ga0070680_100043257 Ga0070680_1000432573 385
29 3300005458 Ga0070681_10075588 Ga0070681_100755882 385
30 3300005535 Ga0070684_100046980 Ga0070684_1000469803 385
31 3300025912 Ga0207707_10043631 Ga0207707_100436312 385
32 3300025917 Ga0207660_10054672 Ga0207660_100546722 385
33 3300025921 Ga0207652_10037570 Ga0207652_100375703 385
34 3300025944 Ga0207661_10009972 Ga0207661_100099723 385
35 3300005518 Ga0070699_100018233 Ga0070699_1000182335 386
36 3300025922 Ga0207646_10005295 Ga0207646_100052956 386
37 3300014325 Ga0163163_10005862 Ga0163163_1000586210 387
38 3300048903 Ga0496100_0048864 Ga0496100_0048864_639_1853 387
39 3300048904 Ga0496101_0050241 Ga0496101_0050241_1298_2512 387
40 3300048908 Ga0496105_0002584 Ga0496105_0002584_6488_7702 387
41 3300048911 Ga0496108_0003824 Ga0496108_0003824_3936_5150 387
42 3300048912 Ga0496109_0004518 Ga0496109_0004518_5874_7088 387
43 3300048913 Ga0496110_0049494 Ga0496110_0049494_763_1977 387
44 3300048913 Ga0496110_0238793 Ga0496110_0238793_41_1255 387
45 3300048914 Ga0496111_0002213 Ga0496111_0002213_4074_5288 387
46 3300048915 Ga0496112_0012673 Ga0496112_0012673_5500_6714 387
47 3300048916 Ga0496113_0001858 Ga0496113_0001858_1193_2407 387
48 3300053130 Ga0500642_0044404 Ga0500642_0044404_566_1870 387
49 3300035113 Ga0373936_0000012 Ga0373936_0000012_174573_175835 388
50 3300031616 Ga0307508_10008975 Ga0307508_100089753 389
51 3300039450 Ga0436363_1092037 Ga0436363_1092037_397_1566 389
52 3300049568 Ga0501031_0001421 Ga0501031_0001421_12212_13381 389
53 3300049570 Ga0501033_0001179 Ga0501033_0001179_18710_19879 389
54 3300049571 Ga0501034_0000503 Ga0501034_0000503_20302_21471 389
55 3300049572 Ga0501036_0001453 Ga0501036_0001453_12458_13627 389
56 3300049573 Ga0501037_0000106 Ga0501037_0000106_66024_67193 389
57 3300049574 Ga0501038_0001655 Ga0501038_0001655_12394_13563 389
58 3300049575 Ga0501039_0000416 Ga0501039_0000416_13400_14569 389
59 3300049576 Ga0501040_0189619 Ga0501040_0189619_176_1357 389
60 3300049579 Ga0501043_0019247 Ga0501043_0019247_3165_4334 389
61 3300049580 Ga0501046_0000235 Ga0501046_0000235_36724_37893 389
62 3300049581 Ga0501047_0000844 Ga0501047_0000844_12288_13457 389
63 3300049582 Ga0501048_0001444 Ga0501048_0001444_4747_5916 389
64 3300049583 Ga0501067_0000160 Ga0501067_0000160_28372_29541 389
65 3300049583 Ga0501067_0048969 Ga0501067_0048969_142_1323 389
66 3300049584 Ga0501068_0045654 Ga0501068_0045654_990_2171 389
67 3300049585 Ga0501069_0004593 Ga0501069_0004593_1674_2843 389
68 3300049586 Ga0501070_0034852 Ga0501070_0034852_2170_3339 389
69 3300049588 Ga0501072_0001159 Ga0501072_0001159_4235_5404 389
70 3300049589 Ga0501073_0002573 Ga0501073_0002573_323_1492 389
71 3300049589 Ga0501073_0020039 Ga0501073_0020039_2819_4000 389
72 3300049590 Ga0501074_0000596 Ga0501074_0000596_20331_21500 389
73 3300049590 Ga0501074_0036536 Ga0501074_0036536_833_2014 389
74 3300049742 Ga0501080_0000917 Ga0501080_0000917_12770_13939 389
75 3300049744 Ga0501083_0000301 Ga0501083_0000301_28261_29430 389
76 3300049822 Ga0501035_0000324 Ga0501035_0000324_33827_34996 389
77 3300049822 Ga0501035_0113570 Ga0501035_0113570_188_1369 389
78 3300049823 Ga0501044_0000051 Ga0501044_0000051_130122_131291 389
79 3300049823 Ga0501044_0343767 Ga0501044_0343767_188_1369 389
80 3300049824 Ga0501045_0016881 Ga0501045_0016881_2190_3359 389
81 3300053080 Ga0500635_0002738 Ga0500635_0002738_1701_3029 389
82 3300053094 Ga0500566_0006693 Ga0500566_0006693_2776_4104 389
83 3300053138 Ga0500564_065104 Ga0500564_065104_24_1352 389
84 3300054114 Ga0501084_0014689 Ga0501084_0014689_3882_5051 389
85 3300060353 Ga0501082_0018584 Ga0501082_0018584_4708_5877 389
86 3300003203 JGI25406J46586_10000018 JGI25406J46586_1000001849 390
87 3300005937 Ga0081455_10063680 Ga0081455_100636803 390
88 3300005985 Ga0081539_10000003 Ga0081539_10000003352 390
89 3300031711 Ga0265314_10002371 Ga0265314_1000237116 390
90 iso_pu_bacteria 8054563764 8054566151 390
91 3300006846 Ga0075430_100177411 Ga0075430_1001774112 391
92 3300006847 Ga0075431_100003541 Ga0075431_1000035412 391
93 3300035172 Ga0373955_0174155 Ga0373955_0174155_26_1201 391
94 3300035725 Ga0373947_0137542 Ga0373947_0137542_364_1539 391
95 3300050507 nmdc:mga05p37_14166_c1 nmdc:mga05p37_14166_c1_6033_7244 391
96 3300050510 nmdc:mga06r32_1475_c1 nmdc:mga06r32_1475_c1_990_2201 391
97 3300053156 Ga0500622_0080217 Ga0500622_0080217_281_1540 391
98 3300009545 Ga0105237_10128445 Ga0105237_101284453 392
99 3300010375 Ga0105239_10071911 Ga0105239_100719115 392
100 3300013297 Ga0157378_10044937 Ga0157378_100449373 392
101 3300013306 Ga0163162_10344586 Ga0163162_103445862 392
102 3300014325 Ga0163163_10236479 Ga0163163_102364792 392
103 3300035241 Ga0373961_0010213 Ga0373961_0010213_72_1253 392
104 3300035691 Ga0373931_0001664 Ga0373931_0001664_1712_2890 392
105 3300035692 Ga0373935_0017006 Ga0373935_0017006_1829_3067 392
106 3300035695 Ga0373927_0062734 Ga0373927_0062734_22_1260 392
107 3300035725 Ga0373947_0133007 Ga0373947_0133007_27_1265 392
108 3300036401 Ga0373937_0049800 Ga0373937_0049800_1599_2837 392
109 3300037068 Ga0373925_0209660 Ga0373925_0209660_294_1472 392
110 3300039437 Ga0436365_0613407 Ga0436365_0613407_1243_2466 392
111 3300046454 Ga0495592_0066030 Ga0495592_0066030_166_1410 392
112 3300046475 Ga0495639_0039079 Ga0495639_0039079_649_1893 392
113 3300046529 Ga0495652_0143984 Ga0495652_0143984_473_1711 392
114 3300046642 Ga0495634_0026647 Ga0495634_0026647_1227_2465 392
115 3300046663 Ga0495635_0026189 Ga0495635_0026189_1798_3036 392
116 3300046683 Ga0495658_0031544 Ga0495658_0031544_844_2088 392
117 3300046684 Ga0495669_0027773 Ga0495669_0027773_642_1835 392
118 3300047319 Ga0495674_0048881 Ga0495674_0048881_2090_3328 392
119 3300048903 Ga0496100_0017746 Ga0496100_0017746_2658_3836 392
120 3300048904 Ga0496101_0002722 Ga0496101_0002722_6560_7738 392
121 3300048905 Ga0496102_0006460 Ga0496102_0006460_6301_7479 392
122 3300048906 Ga0496103_0063663 Ga0496103_0063663_265_1443 392
123 3300048907 Ga0496104_0082079 Ga0496104_0082079_772_1950 392
124 3300048908 Ga0496105_0033690 Ga0496105_0033690_2669_3847 392
125 3300048909 Ga0496106_0030731 Ga0496106_0030731_2474_3652 392
126 3300048910 Ga0496107_0016613 Ga0496107_0016613_2358_3536 392
127 3300048911 Ga0496108_0040146 Ga0496108_0040146_653_1831 392
128 3300048913 Ga0496110_0014347 Ga0496110_0014347_5046_6224 392
129 3300048914 Ga0496111_0025164 Ga0496111_0025164_1519_2697 392
130 3300048915 Ga0496112_0011381 Ga0496112_0011381_5264_6442 392
131 3300048916 Ga0496113_0004219 Ga0496113_0004219_6971_8149 392
132 3300048917 Ga0496114_0002125 Ga0496114_0002125_5534_6712 392
133 3300048918 Ga0496115_0012349 Ga0496115_0012349_3760_4938 392
134 3300053078 Ga0495612_0008179 Ga0495612_0008179_1972_3210 392
135 3300053096 Ga0500641_0025396 Ga0500641_0025396_138_1331 392
136 3300049568 Ga0501031_0010568 Ga0501031_0010568_534_1715 393
137 3300049569 Ga0501032_0006576 Ga0501032_0006576_3792_4973 393
138 3300049570 Ga0501033_0002170 Ga0501033_0002170_8423_9604 393
139 3300049571 Ga0501034_0012060 Ga0501034_0012060_3825_5006 393
140 3300049572 Ga0501036_0023998 Ga0501036_0023998_3096_4277 393
141 3300049573 Ga0501037_0005891 Ga0501037_0005891_4897_6078 393
142 3300049574 Ga0501038_0008504 Ga0501038_0008504_2585_3766 393
143 3300049579 Ga0501043_0004728 Ga0501043_0004728_6252_7433 393
144 3300049580 Ga0501046_0003612 Ga0501046_0003612_5756_6937 393
145 3300049581 Ga0501047_0015400 Ga0501047_0015400_3519_4700 393
146 3300049582 Ga0501048_0013490 Ga0501048_0013490_1693_2874 393
147 3300049584 Ga0501068_0001689 Ga0501068_0001689_3889_5070 393
148 3300049586 Ga0501070_0003132 Ga0501070_0003132_4310_5491 393
149 3300049589 Ga0501073_0015408 Ga0501073_0015408_448_1629 393
150 3300049590 Ga0501074_0027193 Ga0501074_0027193_335_1516 393
151 3300049742 Ga0501080_0002860 Ga0501080_0002860_9393_10574 393
152 3300049822 Ga0501035_0005480 Ga0501035_0005480_3986_5167 393
153 3300049823 Ga0501044_0037167 Ga0501044_0037167_3519_4700 393
154 3300005458 Ga0070681_10160678 Ga0070681_101606782 394
155 3300005983 Ga0081540_1012053 Ga0081540_10120534 394
156 3300009545 Ga0105237_10023507 Ga0105237_100235077 394
157 3300047472 Ga0495686_0158388 Ga0495686_0158388_96_1295 394
158 3300048929 Ga0496126_0009003 Ga0496126_0009003_6461_7681 394
159 3300003323 rootH1_10038628 rootH1_100386281 395
160 3300005329 Ga0070683_100011949 Ga0070683_1000119497 395
161 3300005336 Ga0070680_100134802 Ga0070680_1001348021 395
162 3300005437 Ga0070710_10114129 Ga0070710_101141291 395
163 3300005458 Ga0070681_10005696 Ga0070681_100056964 395
164 3300005530 Ga0070679_100003053 Ga0070679_10000305311 395
165 3300005535 Ga0070684_100040868 Ga0070684_1000408682 395
166 3300005614 Ga0068856_100430281 Ga0068856_1004302811 395
167 3300006175 Ga0070712_100070119 Ga0070712_1000701192 395
168 3300009174 Ga0105241_10042448 Ga0105241_100424483 395
169 3300009545 Ga0105237_10086279 Ga0105237_100862792 395
170 3300009551 Ga0105238_10056096 Ga0105238_100560962 395
171 3300013307 Ga0157372_10133750 Ga0157372_101337502 395
172 3300025898 Ga0207692_10060872 Ga0207692_100608721 395
173 3300025912 Ga0207707_10007742 Ga0207707_100077425 395
174 3300025916 Ga0207663_10097600 Ga0207663_100976002 395
175 3300025921 Ga0207652_10010009 Ga0207652_100100098 395
176 3300025928 Ga0207700_10163270 Ga0207700_101632701 395
177 3300025944 Ga0207661_10018653 Ga0207661_100186532 395
178 3300025949 Ga0207667_10111037 Ga0207667_101110372 395
179 3300031507 Ga0307509_10037791 Ga0307509_100377912 395
180 3300032002 Ga0307416_100072477 Ga0307416_1000724772 395
181 3300035111 Ga0373923_0047531 Ga0373923_0047531_210_1427 395
182 3300035118 Ga0373954_0023809 Ga0373954_0023809_1332_2621 395
183 3300035119 Ga0373956_0026692 Ga0373956_0026692_481_1770 395
184 3300035172 Ga0373955_0028931 Ga0373955_0028931_1235_2524 395
185 3300035695 Ga0373927_0057746 Ga0373927_0057746_809_2026 395
186 3300038443 Ga0395901_0489680 Ga0395901_0489680_40_1239 395
187 3300045049 Ga0466959_0095878 Ga0466959_0095878_822_2039 395
188 3300046454 Ga0495592_0089703 Ga0495592_0089703_99_1388 395
189 3300046462 Ga0495651_0064755 Ga0495651_0064755_220_1509 395
190 3300046477 Ga0495664_0065612 Ga0495664_0065612_415_1632 395
191 3300046511 Ga0495608_0055907 Ga0495608_0055907_137_1426 395
192 3300046519 Ga0495632_0105296 Ga0495632_0105296_29_1219 395
193 3300046543 Ga0495645_0021210 Ga0495645_0021210_226_1515 395
194 3300046543 Ga0495645_0058920 Ga0495645_0058920_438_1655 395
195 3300046559 Ga0495667_0007037 Ga0495667_0007037_4710_5999 395
196 3300046663 Ga0495635_0048856 Ga0495635_0048856_304_1593 395
197 3300046678 Ga0495599_0016576 Ga0495599_0016576_1426_2643 395
198 3300046689 Ga0495613_0048297 Ga0495613_0048297_465_1754 395
199 3300046690 Ga0495624_0094070 Ga0495624_0094070_19_1236 395
200 3300047319 Ga0495674_0098531 Ga0495674_0098531_932_2149 395
201 3300047471 Ga0495684_0066747 Ga0495684_0066747_1182_2471 395
202 3300048088 Ga0495602_0058117 Ga0495602_0058117_1991_3280 395
203 3300048929 Ga0496126_0023619 Ga0496126_0023619_2553_3743 395
204 3300049569 Ga0501032_0000537 Ga0501032_0000537_3673_4860 395
205 3300049570 Ga0501033_0000864 Ga0501033_0000864_1028_2215 395
206 3300049572 Ga0501036_0018030 Ga0501036_0018030_3488_4675 395
207 3300049572 Ga0501036_0294028 Ga0501036_0294028_114_1319 395
208 3300049575 Ga0501039_0000097 Ga0501039_0000097_12044_13231 395
209 3300049580 Ga0501046_0000461 Ga0501046_0000461_30723_31910 395
210 3300049581 Ga0501047_0000579 Ga0501047_0000579_37718_38905 395
211 3300049583 Ga0501067_0001562 Ga0501067_0001562_1563_2750 395
212 3300049584 Ga0501068_0004794 Ga0501068_0004794_5656_6843 395
213 3300049585 Ga0501069_0003571 Ga0501069_0003571_2755_3942 395
214 3300049586 Ga0501070_0000451 Ga0501070_0000451_25512_26699 395
215 3300049586 Ga0501070_0171048 Ga0501070_0171048_414_1628 395
216 3300049588 Ga0501072_0041392 Ga0501072_0041392_1940_3127 395
217 3300049589 Ga0501073_0012416 Ga0501073_0012416_3487_4674 395
218 3300049589 Ga0501073_0036142 Ga0501073_0036142_1422_2636 395
219 3300049590 Ga0501074_0018698 Ga0501074_0018698_991_2178 395
220 3300049590 Ga0501074_0020304 Ga0501074_0020304_967_2181 395
221 3300049742 Ga0501080_0034324 Ga0501080_0034324_1097_2311 395
222 3300049822 Ga0501035_0000250 Ga0501035_0000250_11393_12580 395
223 3300049823 Ga0501044_0042768 Ga0501044_0042768_44_1231 395
224 3300049823 Ga0501044_0061265 Ga0501044_0061265_1321_2535 395
225 3300050510 nmdc:mga06r32_543_c1 nmdc:mga06r32_543_c1_13104_14300 395
226 iso_pu_bacteria 2932794094 2932801095 395
227 3300003659 JGI25404J52841_10007069 JGI25404J52841_100070692 396
228 3300005563 Ga0068855_100274524 Ga0068855_1002745242 396
229 3300005614 Ga0068856_100000197 Ga0068856_10000019724 396
230 3300005983 Ga0081540_1009134 Ga0081540_10091342 396
231 3300026078 Ga0207702_10000044 Ga0207702_10000044141 396
232 3300027364 Ga0209967_1003797 Ga0209967_10037971 396
233 3300031616 Ga0307508_10000213 Ga0307508_1000021342 396
234 3300039450 Ga0436363_0361238 Ga0436363_0361238_372_1565 396
235 3300046476 Ga0495662_0031332 Ga0495662_0031332_602_1891 396
236 iso_pu_bacteria 2513237096 2513655082 396
237 iso_pu_bacteria 2513237137 2513861105 396
238 iso_pu_bacteria 2513237145 2513915895 396
239 iso_pu_bacteria 2517572143 2517894800 396
240 iso_pu_bacteria 2524023228 2524534554 396
241 iso_pu_bacteria 2791355197 2793068828 396
242 iso_pu_bacteria 2842333319 2842340784 396
243 iso_pu_bacteria 2885374607 2885381721 396
244 iso_pu_bacteria 2904690495 2904697785 396
245 iso_pu_bacteria 2904699407 2904705945 396
246 iso_pu_bacteria 2906635258 2906642437 396
247 iso_pu_bacteria 2906660503 2906660744 396
248 iso_pu_bacteria 2908756301 2908757119 396
249 iso_pu_bacteria 3005474847 3005480522 396
250 iso_pu_bacteria 8006933436 8006933688 396
251 iso_pu_bacteria 8006973647 8006983360 396
252 iso_pu_bacteria 8019530166 8019537115 396
253 iso_pu_bacteria 8056689827 8056695216 396
254 3300005295 Ga0065707_10013358 Ga0065707_100133582 397
255 3300005445 Ga0070708_100029812 Ga0070708_1000298124 397
256 3300005467 Ga0070706_100006190 Ga0070706_10000619010 397
257 3300005468 Ga0070707_100001868 Ga0070707_10000186815 397
258 3300005471 Ga0070698_100006229 Ga0070698_1000062299 397
259 3300005518 Ga0070699_100002671 Ga0070699_1000026717 397
260 3300005530 Ga0070679_100013007 Ga0070679_1000130077 397
261 3300005536 Ga0070697_100162013 Ga0070697_1001620132 397
262 3300005549 Ga0070704_100040512 Ga0070704_1000405123 397
263 3300005563 Ga0068855_100055016 Ga0068855_1000550162 397
264 3300005937 Ga0081455_10095415 Ga0081455_100954152 397
265 3300006852 Ga0075433_10084163 Ga0075433_100841632 397
266 3300009094 Ga0111539_10013178 Ga0111539_100131788 397
267 3300009147 Ga0114129_10040031 Ga0114129_100400313 397
268 3300014969 Ga0157376_10266738 Ga0157376_102667382 397
269 3300025907 Ga0207645_10019420 Ga0207645_100194205 397
270 3300025910 Ga0207684_10002971 Ga0207684_100029717 397
271 3300025921 Ga0207652_10032026 Ga0207652_100320263 397
272 3300025922 Ga0207646_10001054 Ga0207646_1000105426 397
273 3300025949 Ga0207667_10047244 Ga0207667_100472442 397
274 3300026041 Ga0207639_10098703 Ga0207639_100987032 397
275 3300027907 Ga0207428_10064578 Ga0207428_100645782 397
276 3300042001 Ga0439441_002408 Ga0439441_002408_568_1776 397
277 3300042876 Ga0451577_0001635 Ga0451577_0001635_1050_2300 397
278 3300042876 Ga0451577_0013589 Ga0451577_0013589_2945_4159 397
279 3300044673 Ga0453683_0005342 Ga0453683_0005342_1469_2683 397
280 3300044673 Ga0453683_0005758 Ga0453683_0005758_1177_2385 397
281 3300044673 Ga0453683_0006980 Ga0453683_0006980_3340_4590 397
282 3300044712 Ga0453684_0026520 Ga0453684_0026520_6436_7686 397
283 3300044712 Ga0453684_0049587 Ga0453684_0049587_673_1887 397
284 3300045051 Ga0451576_0021367 Ga0451576_0021367_5650_6900 397
285 3300046491 Ga0495584_0042407 Ga0495584_0042407_970_2178 397
286 3300046680 Ga0495646_0031778 Ga0495646_0031778_1430_2719 397
287 3300048911 Ga0496108_0030364 Ga0496108_0030364_572_1813 397
288 3300048915 Ga0496112_0034410 Ga0496112_0034410_1394_2635 397
289 3300048921 Ga0496118_0017343 Ga0496118_0017343_5001_6197 397
290 3300048924 Ga0496121_0014083 Ga0496121_0014083_510_1706 397
291 3300048926 Ga0496123_0144221 Ga0496123_0144221_64_1260 397
292 3300048928 Ga0496125_0000272 Ga0496125_0000272_12026_13222 397
293 3300049822 Ga0501035_0195280 Ga0501035_0195280_146_1345 397
294 3300049823 Ga0501044_0325052 Ga0501044_0325052_189_1385 397
295 3300050511 nmdc:mga08y16_6269_c1 nmdc:mga08y16_6269_c1_10826_12076 397
296 3300050512 nmdc:mga0n895_62290_c1 nmdc:mga0n895_62290_c1_690_1916 397
297 3300050514 nmdc:mga08x19_211757_c1 nmdc:mga08x19_211757_c1_26_1237 397
298 3300050515 nmdc:mga0a205_16908_c1 nmdc:mga0a205_16908_c1_282_1508 397
299 3300050515 nmdc:mga0a205_32349_c1 nmdc:mga0a205_32349_c1_1214_2422 397
300 3300050515 nmdc:mga0a205_7303_c1 nmdc:mga0a205_7303_c1_3915_5165 397
301 3300054114 Ga0501084_0325820 Ga0501084_0325820_73_1281 397
302 iso_pu_bacteria 2524023228 2524534171 397
303 iso_pu_bacteria 2728368998 2728753301 397
304 iso_pu_bacteria 2904690495 2904694847 397
305 iso_pu_bacteria 2904699407 2904702207 397
306 iso_pu_bacteria 2908756301 2908760011 397
307 iso_pu_bacteria 2922361189 2922365655 397
308 iso_pu_bacteria 2935630451 2935631224 397
309 iso_pu_bacteria 2941507105 2941509965 397
310 iso_pu_bacteria 2941515067 2941518948 397
311 iso_pu_bacteria 2941523033 2941525364 397
312 iso_pu_bacteria 8006933436 8006940254 397
313 iso_pu_bacteria 8006973647 8006980032 397
314 iso_pu_bacteria 8056689827 8056694260 397
315 3300005293 Ga0065715_10143551 Ga0065715_101435512 398
316 3300005333 Ga0070677_10003948 Ga0070677_100039485 398
317 3300005334 Ga0068869_100019670 Ga0068869_1000196704 398
318 3300005338 Ga0068868_100025540 Ga0068868_1000255404 398
319 3300005339 Ga0070660_100000724 Ga0070660_10000072420 398
320 3300005344 Ga0070661_100019484 Ga0070661_1000194842 398
321 3300005355 Ga0070671_100023164 Ga0070671_1000231644 398
322 3300005365 Ga0070688_100023196 Ga0070688_1000231963 398
323 3300005366 Ga0070659_100002581 Ga0070659_1000025815 398
324 3300005438 Ga0070701_10059601 Ga0070701_100596012 398
325 3300005445 Ga0070708_100003380 Ga0070708_1000033805 398
326 3300005457 Ga0070662_100010579 Ga0070662_1000105795 398
327 3300005467 Ga0070706_100074414 Ga0070706_1000744143 398
328 3300005468 Ga0070707_100001543 Ga0070707_10000154313 398
329 3300005536 Ga0070697_100018950 Ga0070697_1000189502 398
330 3300005539 Ga0068853_100043255 Ga0068853_1000432552 398
331 3300005543 Ga0070672_100055148 Ga0070672_1000551482 398
332 3300005546 Ga0070696_100138420 Ga0070696_1001384202 398
333 3300005549 Ga0070704_100012912 Ga0070704_1000129121 398
334 3300005563 Ga0068855_100012186 Ga0068855_1000121869 398
335 3300005563 Ga0068855_100033743 Ga0068855_1000337433 398
336 3300005564 Ga0070664_100003967 Ga0070664_10000396710 398
337 3300005577 Ga0068857_100022565 Ga0068857_1000225654 398
338 3300005614 Ga0068856_100001185 Ga0068856_10000118511 398
339 3300005617 Ga0068859_100272312 Ga0068859_1002723122 398
340 3300005618 Ga0068864_100200244 Ga0068864_1002002442 398
341 3300005718 Ga0068866_10006508 Ga0068866_100065083 398
342 3300005834 Ga0068851_10011381 Ga0068851_100113815 398
343 3300006175 Ga0070712_100016629 Ga0070712_1000166292 398
344 3300006844 Ga0075428_100006057 Ga0075428_1000060573 398
345 3300006846 Ga0075430_100010397 Ga0075430_1000103977 398
346 3300006846 Ga0075430_100025544 Ga0075430_1000255442 398
347 3300006847 Ga0075431_100000802 Ga0075431_10000080225 398
348 3300006847 Ga0075431_100063661 Ga0075431_1000636611 398
349 3300006847 Ga0075431_100199693 Ga0075431_1001996932 398
350 3300006852 Ga0075433_10000633 Ga0075433_1000063320 398
351 3300006852 Ga0075433_10014960 Ga0075433_100149607 398
352 3300006852 Ga0075433_10085821 Ga0075433_100858213 398
353 3300006852 Ga0075433_10241491 Ga0075433_102414911 398
354 3300006871 Ga0075434_100029033 Ga0075434_1000290333 398
355 3300006871 Ga0075434_100097215 Ga0075434_1000972152 398
356 3300006871 Ga0075434_100280969 Ga0075434_1002809691 398
357 3300006880 Ga0075429_100001562 Ga0075429_10000156219 398
358 3300006880 Ga0075429_100021707 Ga0075429_1000217073 398
359 3300006880 Ga0075429_100059216 Ga0075429_1000592162 398
360 3300006880 Ga0075429_100232329 Ga0075429_1002323291 398
361 3300006881 Ga0068865_100025011 Ga0068865_1000250114 398
362 3300006914 Ga0075436_100023912 Ga0075436_1000239122 398
363 3300006931 Ga0097620_100272308 Ga0097620_1002723082 398
364 3300007076 Ga0075435_100012560 Ga0075435_1000125605 398
365 3300007076 Ga0075435_100036737 Ga0075435_1000367373 398
366 3300007076 Ga0075435_100056799 Ga0075435_1000567992 398
367 3300007265 Ga0099794_10018817 Ga0099794_100188171 398
368 3300009094 Ga0111539_10006916 Ga0111539_1000691611 398
369 3300009094 Ga0111539_10032630 Ga0111539_100326301 398
370 3300009094 Ga0111539_10074229 Ga0111539_100742294 398
371 3300009147 Ga0114129_10038145 Ga0114129_100381455 398
372 3300009147 Ga0114129_10040610 Ga0114129_100406104 398
373 3300009147 Ga0114129_10103836 Ga0114129_101038363 398
374 3300009147 Ga0114129_10180769 Ga0114129_101807693 398
375 3300009147 Ga0114129_10308898 Ga0114129_103088982 398
376 3300013100 Ga0157373_10014696 Ga0157373_100146965 398
377 3300013102 Ga0157371_10001965 Ga0157371_100019652 398
378 3300013306 Ga0163162_10229895 Ga0163162_102298952 398
379 3300013307 Ga0157372_10001631 Ga0157372_1000163112 398
380 3300014325 Ga0163163_10112333 Ga0163163_101123333 398
381 3300014968 Ga0157379_10014180 Ga0157379_100141804 398
382 3300025315 Ga0207697_10004888 Ga0207697_100048884 398
383 3300025893 Ga0207682_10000233 Ga0207682_1000023312 398
384 3300025899 Ga0207642_10013332 Ga0207642_100133323 398
385 3300025903 Ga0207680_10022163 Ga0207680_100221633 398
386 3300025907 Ga0207645_10032640 Ga0207645_100326402 398
387 3300025908 Ga0207643_10028396 Ga0207643_100283963 398
388 3300025910 Ga0207684_10002538 Ga0207684_100025389 398
389 3300025910 Ga0207684_10027469 Ga0207684_100274695 398
390 3300025910 Ga0207684_10045020 Ga0207684_100450203 398
391 3300025915 Ga0207693_10010251 Ga0207693_100102515 398
392 3300025919 Ga0207657_10000371 Ga0207657_1000037125 398
393 3300025922 Ga0207646_10007223 Ga0207646_100072233 398
394 3300025922 Ga0207646_10059976 Ga0207646_100599761 398
395 3300025925 Ga0207650_10005860 Ga0207650_100058608 398
396 3300025925 Ga0207650_10036096 Ga0207650_100360962 398
397 3300025926 Ga0207659_10003917 Ga0207659_100039175 398
398 3300025926 Ga0207659_10017546 Ga0207659_100175463 398
399 3300025931 Ga0207644_10014609 Ga0207644_100146094 398
400 3300025931 Ga0207644_10065259 Ga0207644_100652592 398
401 3300025932 Ga0207690_10001921 Ga0207690_1000192114 398
402 3300025933 Ga0207706_10000179 Ga0207706_1000017910 398
403 3300025933 Ga0207706_10008198 Ga0207706_100081985 398
404 3300025940 Ga0207691_10005440 Ga0207691_1000544012 398
405 3300025940 Ga0207691_10071690 Ga0207691_100716902 398
406 3300025942 Ga0207689_10011579 Ga0207689_100115795 398
407 3300025949 Ga0207667_10026324 Ga0207667_100263242 398
408 3300025949 Ga0207667_10085227 Ga0207667_100852273 398
409 3300026041 Ga0207639_10030650 Ga0207639_100306503 398
410 3300026067 Ga0207678_10006632 Ga0207678_100066322 398
411 3300026078 Ga0207702_10000997 Ga0207702_100009972 398
412 3300026088 Ga0207641_10398181 Ga0207641_103981811 398
413 3300026089 Ga0207648_10003625 Ga0207648_1000362516 398
414 3300026095 Ga0207676_10013792 Ga0207676_100137924 398
415 3300026116 Ga0207674_10023874 Ga0207674_100238744 398
416 3300026118 Ga0207675_100021301 Ga0207675_1000213015 398
417 3300026121 Ga0207683_10030000 Ga0207683_100300003 398
418 3300026142 Ga0207698_10098849 Ga0207698_100988493 398
419 3300027360 Ga0209969_1002972 Ga0209969_10029723 398
420 3300027665 Ga0209983_1002077 Ga0209983_10020773 398
421 3300027682 Ga0209971_1006564 Ga0209971_10065643 398
422 3300027876 Ga0209974_10000323 Ga0209974_1000032314 398
423 3300027907 Ga0207428_10000018 Ga0207428_10000018188 398
424 3300031711 Ga0265314_10027041 Ga0265314_100270414 398
425 3300031712 Ga0265342_10067315 Ga0265342_100673152 398
426 3300032005 Ga0307411_10055799 Ga0307411_100557991 398
427 3300032005 Ga0307411_10081443 Ga0307411_100814432 398
428 3300035091 Ga0373951_0021202 Ga0373951_0021202_206_1417 398
429 3300035114 Ga0373939_0015998 Ga0373939_0015998_667_1878 398
430 3300035120 Ga0373957_0070331 Ga0373957_0070331_14_1228 398
431 3300035170 Ga0373943_0087722 Ga0373943_0087722_241_1455 398
432 3300035241 Ga0373961_0019772 Ga0373961_0019772_118_1329 398
433 3300035695 Ga0373927_0120305 Ga0373927_0120305_44_1258 398
434 3300036401 Ga0373937_0044445 Ga0373937_0044445_2186_3400 398
435 3300037068 Ga0373925_0031253 Ga0373925_0031253_1871_3067 398
436 3300037312 Ga0395899_0012313 Ga0395899_0012313_4401_5612 398
437 3300037466 Ga0395898_0012798 Ga0395898_0012798_1826_3037 398
438 3300038443 Ga0395901_0002127 Ga0395901_0002127_7375_8586 398
439 3300039447 Ga0436361_0904316 Ga0436361_0904316_406_1602 398
440 3300042436 Ga0439435_0007906 Ga0439435_0007906_1080_2291 398
441 3300042461 Ga0439460_0018470 Ga0439460_0018470_376_1587 398
442 3300046454 Ga0495592_0004668 Ga0495592_0004668_43_1263 398
443 3300046472 Ga0495580_0000143 Ga0495580_0000143_34314_35525 398
444 3300046516 Ga0495628_0003637 Ga0495628_0003637_11936_13156 398
445 3300046528 Ga0495642_0020776 Ga0495642_0020776_20_1231 398
446 3300046529 Ga0495652_0028621 Ga0495652_0028621_3641_4861 398
447 3300046543 Ga0495645_0000805 Ga0495645_0000805_9719_10939 398
448 3300046678 Ga0495599_0001555 Ga0495599_0001555_9757_10977 398
449 3300046684 Ga0495669_0028233 Ga0495669_0028233_112_1323 398
450 3300048904 Ga0496101_0070462 Ga0496101_0070462_281_1495 398
451 3300048905 Ga0496102_0035750 Ga0496102_0035750_610_1830 398
452 3300048906 Ga0496103_0006318 Ga0496103_0006318_1962_3182 398
453 3300048907 Ga0496104_0006365 Ga0496104_0006365_2782_3996 398
454 3300048909 Ga0496106_0022766 Ga0496106_0022766_1101_2315 398
455 3300048910 Ga0496107_0055102 Ga0496107_0055102_1043_2263 398
456 3300048914 Ga0496111_0072734 Ga0496111_0072734_1012_2226 398
457 3300048917 Ga0496114_0011440 Ga0496114_0011440_2011_3225 398
458 3300048929 Ga0496126_0028347 Ga0496126_0028347_675_1916 398
459 3300048929 Ga0496126_0173685 Ga0496126_0173685_72_1292 398
460 3300049568 Ga0501031_0000910 Ga0501031_0000910_86_1282 398
461 3300049571 Ga0501034_0089178 Ga0501034_0089178_416_1612 398
462 3300049573 Ga0501037_0000469 Ga0501037_0000469_5954_7150 398
463 3300049574 Ga0501038_0000274 Ga0501038_0000274_1130_2326 398
464 3300049574 Ga0501038_0143838 Ga0501038_0143838_360_1571 398
465 3300049576 Ga0501040_0155305 Ga0501040_0155305_325_1536 398
466 3300049578 Ga0501042_0017067 Ga0501042_0017067_1559_2770 398
467 3300049581 Ga0501047_0076446 Ga0501047_0076446_1023_2234 398
468 3300049581 Ga0501047_0108258 Ga0501047_0108258_1169_2380 398
469 3300049583 Ga0501067_0012440 Ga0501067_0012440_160_1371 398
470 3300049588 Ga0501072_0013749 Ga0501072_0013749_1411_2622 398
471 3300049591 Ga0501075_0025051 Ga0501075_0025051_2955_4166 398
472 3300049593 Ga0501077_0061693 Ga0501077_0061693_559_1770 398
473 3300049741 Ga0501079_0026383 Ga0501079_0026383_177_1388 398
474 3300049741 Ga0501079_0120547 Ga0501079_0120547_83_1294 398
475 3300049742 Ga0501080_0016248 Ga0501080_0016248_3767_4978 398
476 3300049822 Ga0501035_0056563 Ga0501035_0056563_245_1441 398
477 3300049823 Ga0501044_0141531 Ga0501044_0141531_32_1228 398
478 3300049824 Ga0501045_0193984 Ga0501045_0193984_248_1459 398
479 3300050507 nmdc:mga05p37_168429_c1 nmdc:mga05p37_168429_c1_985_2196 398
480 3300050507 nmdc:mga05p37_21718_c1 nmdc:mga05p37_21718_c1_3140_4351 398
481 3300050507 nmdc:mga05p37_38812_c1 nmdc:mga05p37_38812_c1_3198_4409 398
482 3300050507 nmdc:mga05p37_99586_c1 nmdc:mga05p37_99586_c1_237_1448 398
483 3300050508 nmdc:mga09592_139305_c1 nmdc:mga09592_139305_c1_830_2041 398
484 3300050508 nmdc:mga09592_43756_c1 nmdc:mga09592_43756_c1_1200_2411 398
485 3300050508 nmdc:mga09592_47189_c1 nmdc:mga09592_47189_c1_2052_3263 398
486 3300050509 nmdc:mga0qj67_3798_c1 nmdc:mga0qj67_3798_c1_3558_4769 398
487 3300050509 nmdc:mga0qj67_676_c1 nmdc:mga0qj67_676_c1_11917_13128 398
488 3300050510 nmdc:mga06r32_109119_c1 nmdc:mga06r32_109119_c1_132_1343 398
489 3300050510 nmdc:mga06r32_33334_c1 nmdc:mga06r32_33334_c1_2351_3562 398
490 3300050511 nmdc:mga08y16_1251_c1 nmdc:mga08y16_1251_c1_20287_21498 398
491 3300050511 nmdc:mga08y16_3110_c1 nmdc:mga08y16_3110_c1_2800_4011 398
492 3300050512 nmdc:mga0n895_158611_c1 nmdc:mga0n895_158611_c1_900_2111 398
493 3300050512 nmdc:mga0n895_6506_c1 nmdc:mga0n895_6506_c1_3355_4566 398
494 3300050512 nmdc:mga0n895_67363_c1 nmdc:mga0n895_67363_c1_1975_3186 398
495 3300050512 nmdc:mga0n895_71097_c1 nmdc:mga0n895_71097_c1_1259_2470 398
496 3300050512 nmdc:mga0n895_87513_c1 nmdc:mga0n895_87513_c1_509_1723 398
497 3300050513 nmdc:mga0rr50_14270_c1 nmdc:mga0rr50_14270_c1_1711_2922 398
498 3300050513 nmdc:mga0rr50_57318_c1 nmdc:mga0rr50_57318_c1_725_1936 398
499 3300050514 nmdc:mga08x19_6146_c1 nmdc:mga08x19_6146_c1_5792_7003 398
500 3300050514 nmdc:mga08x19_69282_c1 nmdc:mga08x19_69282_c1_703_1914 398
501 3300050515 nmdc:mga0a205_11259_c1 nmdc:mga0a205_11259_c1_3044_4255 398
502 3300050515 nmdc:mga0a205_12648_c1 nmdc:mga0a205_12648_c1_450_1661 398
503 3300050515 nmdc:mga0a205_38197_c1 nmdc:mga0a205_38197_c1_1418_2629 398
504 3300050515 nmdc:mga0a205_53745_c1 nmdc:mga0a205_53745_c1_838_2049 398
505 3300050515 nmdc:mga0a205_68159_c1 nmdc:mga0a205_68159_c1_1327_2538 398
506 3300054114 Ga0501084_0109964 Ga0501084_0109964_928_2139 398
507 iso_pu_bacteria 2903748898 2903753399 398
508 3300002075 JGI24738J21930_10010688 JGI24738J21930_100106882 399
509 3300003203 JGI25406J46586_10000078 JGI25406J46586_1000007832 399
510 3300005347 Ga0070668_100192764 Ga0070668_1001927641 399
511 3300005435 Ga0070714_100214858 Ga0070714_1002148581 399
512 3300005445 Ga0070708_100249120 Ga0070708_1002491201 399
513 3300005547 Ga0070693_100086592 Ga0070693_1000865921 399
514 3300005549 Ga0070704_100088145 Ga0070704_1000881453 399
515 3300005843 Ga0068860_100010373 Ga0068860_1000103735 399
516 3300005985 Ga0081539_10000273 Ga0081539_1000027344 399
517 3300006844 Ga0075428_100000643 Ga0075428_10000064319 399
518 3300006846 Ga0075430_100000052 Ga0075430_10000005216 399
519 3300006847 Ga0075431_100000441 Ga0075431_1000004416 399
520 3300006847 Ga0075431_100114539 Ga0075431_1001145393 399
521 3300006847 Ga0075431_100364748 Ga0075431_1003647481 399
522 3300006852 Ga0075433_10193242 Ga0075433_101932422 399
523 3300006871 Ga0075434_100109276 Ga0075434_1001092762 399
524 3300009093 Ga0105240_10032127 Ga0105240_100321278 399
525 3300009147 Ga0114129_10002725 Ga0114129_1000272514 399
526 3300013307 Ga0157372_10157824 Ga0157372_101578241 399
527 3300025915 Ga0207693_10009473 Ga0207693_100094733 399
528 3300025933 Ga0207706_10277773 Ga0207706_102777732 399
529 3300026078 Ga0207702_10319707 Ga0207702_103197072 399
530 3300028381 Ga0268264_10016783 Ga0268264_100167835 399
531 3300028786 Ga0307517_10042025 Ga0307517_100420253 399
532 3300031456 Ga0307513_10005868 Ga0307513_100058682 399
533 3300035724 Ga0373933_0012105 Ga0373933_0012105_3512_4753 399
534 3300037471 Ga0395905_0038754 Ga0395905_0038754_1125_2324 399
535 3300037853 Ga0436364_0154921 Ga0436364_0154921_1060_2262 399
536 3300044673 Ga0453683_0020767 Ga0453683_0020767_2167_3378 399
537 3300046542 Ga0495597_0004537 Ga0495597_0004537_3517_4716 399
538 3300046616 Ga0495668_0103416 Ga0495668_0103416_231_1430 399
539 3300046678 Ga0495599_0044339 Ga0495599_0044339_319_1608 399
540 3300046809 Ga0495600_0083511 Ga0495600_0083511_287_1576 399
541 3300047317 Ga0495604_0017963 Ga0495604_0017963_1420_2709 399
542 3300048905 Ga0496102_0047263 Ga0496102_0047263_416_1630 399
543 3300048906 Ga0496103_0092632 Ga0496103_0092632_497_1696 399
544 3300048907 Ga0496104_0013863 Ga0496104_0013863_1280_2521 399
545 3300048928 Ga0496125_0101821 Ga0496125_0101821_212_1411 399
546 3300050507 nmdc:mga05p37_19161_c1 nmdc:mga05p37_19161_c1_2818_4029 399
547 3300050509 nmdc:mga0qj67_1874_c1 nmdc:mga0qj67_1874_c1_2018_3229 399
548 3300050509 nmdc:mga0qj67_77360_c1 nmdc:mga0qj67_77360_c1_306_1520 399
549 3300050510 nmdc:mga06r32_1637_c1 nmdc:mga06r32_1637_c1_2150_3361 399
550 3300050512 nmdc:mga0n895_127644_c1 nmdc:mga0n895_127644_c1_981_2198 399
551 3300053077 Ga0495601_0021200 Ga0495601_0021200_2299_3588 399
552 3300053105 Ga0500557_000004 Ga0500557_000004_184313_185512 399
553 3300053111 Ga0500572_000505 Ga0500572_000505_3311_4513 399
554 3300053136 Ga0500559_0000081 Ga0500559_0000081_59258_60460 399
555 3300053163 Ga0500639_007542 Ga0500639_007542_2995_4197 399
556 3300053735 Ga0500596_003453 Ga0500596_003453_394_1596 399
557 iso_pu_bacteria 2513237096 2513657100 399
558 iso_pu_bacteria 2513237137 2513855542 399
559 iso_pu_bacteria 2513237145 2513918840 399
560 iso_pu_bacteria 2517572143 2517892087 399
561 iso_pu_bacteria 2667528175 2671121875 399
562 iso_pu_bacteria 2906610324 2906617217 399
563 iso_pu_bacteria 2906635258 2906643393 399
564 iso_pu_bacteria 2906660503 2906662476 399
565 iso_pu_bacteria 2908739725 2908742367 399
566 iso_pu_bacteria 2922425934 2922430611 399
567 iso_pu_bacteria 8019565922 8019569072 399
568 3300005436 Ga0070713_100094317 Ga0070713_1000943172 400
569 3300005530 Ga0070679_100053055 Ga0070679_1000530555 400
570 3300013102 Ga0157371_10032595 Ga0157371_100325953 400
571 3300025914 Ga0207671_10020564 Ga0207671_100205644 400
572 3300025919 Ga0207657_10002789 Ga0207657_100027898 400
573 3300025921 Ga0207652_10092077 Ga0207652_100920772 400
574 3300025928 Ga0207700_10241838 Ga0207700_102418381 400
575 3300025929 Ga0207664_10186531 Ga0207664_101865312 400
576 3300026041 Ga0207639_10106443 Ga0207639_101064432 400
577 3300046507 Ga0495606_0001450 Ga0495606_0001450_16120_17331 400
578 3300048929 Ga0496126_0032620 Ga0496126_0032620_2330_3553 400
579 3300049568 Ga0501031_0016428 Ga0501031_0016428_2535_3746 400
580 3300049569 Ga0501032_0000421 Ga0501032_0000421_9352_10563 400
581 3300049570 Ga0501033_0000124 Ga0501033_0000124_50003_51214 400
582 3300049571 Ga0501034_0014541 Ga0501034_0014541_5872_7083 400
583 3300049572 Ga0501036_0002128 Ga0501036_0002128_3107_4318 400
584 3300049573 Ga0501037_0002855 Ga0501037_0002855_5518_6729 400
585 3300049574 Ga0501038_0000041 Ga0501038_0000041_22854_24065 400
586 3300049575 Ga0501039_0000472 Ga0501039_0000472_499_1710 400
587 3300049579 Ga0501043_0000498 Ga0501043_0000498_29897_31108 400
588 3300049581 Ga0501047_0001740 Ga0501047_0001740_11202_12413 400
589 3300049582 Ga0501048_0002032 Ga0501048_0002032_2449_3660 400
590 3300049584 Ga0501068_0002139 Ga0501068_0002139_8554_9765 400
591 3300049586 Ga0501070_0000175 Ga0501070_0000175_51643_52854 400
592 3300049589 Ga0501073_0020288 Ga0501073_0020288_1997_3208 400
593 3300049742 Ga0501080_0000638 Ga0501080_0000638_21405_22616 400
594 3300049822 Ga0501035_0000155 Ga0501035_0000155_4064_5275 400
595 3300049823 Ga0501044_0000393 Ga0501044_0000393_8859_10070 400
596 3300049823 Ga0501044_0099578 Ga0501044_0099578_195_1412 400
597 3300049824 Ga0501045_0122313 Ga0501045_0122313_151_1362 400
598 3300053111 Ga0500572_000148 Ga0500572_000148_20394_21632 400
599 3300053119 Ga0500595_006746 Ga0500595_006746_30_1367 400
600 iso_pu_bacteria 2507262055 2507508430 400
601 iso_pu_bacteria 2508501009 2508542498 400
602 iso_pu_bacteria 2508501042 2508691729 400
603 iso_pu_bacteria 2508501128 2509150550 400
604 iso_pu_bacteria 2511231028 2511394186 400
605 iso_pu_bacteria 2513237092 2513625537 400
606 iso_pu_bacteria 2513237094 2513644478 400
607 iso_pu_bacteria 2513237095 2513645687 400
608 iso_pu_bacteria 2513237096 2513658023 400
609 iso_pu_bacteria 2513237098 2513676108 400
610 iso_pu_bacteria 2513237101 2513692719 400
611 iso_pu_bacteria 2513237102 2513701127 400
612 iso_pu_bacteria 2513237104 2513717148 400
613 iso_pu_bacteria 2513237137 2513855727 400
614 iso_pu_bacteria 2513237139 2513872928 400
615 iso_pu_bacteria 2513237141 2513893981 400
616 iso_pu_bacteria 2513237145 2513919883 400
617 iso_pu_bacteria 2513237161 2514013687 400
618 iso_pu_bacteria 2515154112 2515627075 400
619 iso_pu_bacteria 2517093001 2517107766 400
620 iso_pu_bacteria 2517572143 2517892264 400
621 iso_pu_bacteria 2524023205 2524437506 400
622 iso_pu_bacteria 2524023210 2524465664 400
623 iso_pu_bacteria 2524023228 2524540300 400
624 iso_pu_bacteria 2528768022 2528852385 400
625 iso_pu_bacteria 2617270735 2617347356 400
626 iso_pu_bacteria 2617270741 2617375590 400
627 iso_pu_bacteria 2667528175 2671120488 400
628 iso_pu_bacteria 2721755755 2723844901 400
629 iso_pu_bacteria 2744054633 2745076502 400
630 iso_pu_bacteria 2791355196 2793065422 400
631 iso_pu_bacteria 2791355197 2793072395 400
632 iso_pu_bacteria 2791355199 2793082228 400
633 iso_pu_bacteria 2802429603 2805915174 400
634 iso_pu_bacteria 2816332527 2818238732 400
635 iso_pu_bacteria 2824600985 2824608164 400
636 iso_pu_bacteria 2824609381 2824610297 400
637 iso_pu_bacteria 2824617872 2824617890 400
638 iso_pu_bacteria 2824626560 2824634355 400
639 iso_pu_bacteria 2824635225 2824643472 400
640 iso_pu_bacteria 2824644064 2824649706 400
641 iso_pu_bacteria 2824653114 2824661154 400
642 iso_pu_bacteria 2824661429 2824669299 400
643 iso_pu_bacteria 2824671348 2824678704 400
644 iso_pu_bacteria 2824679649 2824685182 400
645 iso_pu_bacteria 2824687955 2824695164 400
646 iso_pu_bacteria 2824696289 2824701479 400
647 iso_pu_bacteria 2824704595 2824709046 400
648 iso_pu_bacteria 2824714736 2824722334 400
649 iso_pu_bacteria 2824723954 2824731957 400
650 iso_pu_bacteria 2824732956 2824735269 400
651 iso_pu_bacteria 2824746037 2824752346 400
652 iso_pu_bacteria 2824753945 2824761808 400
653 iso_pu_bacteria 2824763712 2824770001 400
654 iso_pu_bacteria 2824773399 2824780895 400
655 iso_pu_bacteria 2838122688 2838123581 400
656 iso_pu_bacteria 2841941048 2841946775 400
657 iso_pu_bacteria 2841949485 2841949681 400
658 iso_pu_bacteria 2841957949 2841958817 400
659 iso_pu_bacteria 2841966195 2841971812 400
660 iso_pu_bacteria 2841974524 2841974843 400
661 iso_pu_bacteria 2841983080 2841983596 400
662 iso_pu_bacteria 2842038055 2842038901 400
663 iso_pu_bacteria 2842045827 2842048153 400
664 iso_pu_bacteria 2844315083 2844319225 400
665 iso_pu_bacteria 2847930680 2847936377 400
666 iso_pu_bacteria 2847939898 2847946727 400
667 iso_pu_bacteria 2849076700 2849079156 400
668 iso_pu_bacteria 2857509624 2857514143 400
669 iso_pu_bacteria 2874590934 2874598205 400
670 iso_pu_bacteria 2874604998 2874605378 400
671 iso_pu_bacteria 2874612657 2874615081 400
672 iso_pu_bacteria 2874620515 2874627682 400
673 iso_pu_bacteria 2874628541 2874632016 400
674 iso_pu_bacteria 2874645413 2874652738 400
675 iso_pu_bacteria 2876761206 2876764674 400
676 iso_pu_bacteria 2876771140 2876778317 400
677 iso_pu_bacteria 2876808645 2876809905 400
678 iso_pu_bacteria 2876818435 2876825814 400
679 iso_pu_bacteria 2879074833 2879082111 400
680 iso_pu_bacteria 2879083081 2879090548 400
681 iso_pu_bacteria 2879099564 2879105745 400
682 iso_pu_bacteria 2879110137 2879110199 400
683 iso_pu_bacteria 2879127579 2879135258 400
684 iso_pu_bacteria 2879142872 2879150467 400
685 iso_pu_bacteria 2881364244 2881368681 400
686 iso_pu_bacteria 2881665667 2881673522 400
687 iso_pu_bacteria 2885366525 2885373003 400
688 iso_pu_bacteria 2885374607 2885379555 400
689 iso_pu_bacteria 2885383462 2885389913 400
690 iso_pu_bacteria 2885409591 2885411340 400
691 iso_pu_bacteria 2888378607 2888384222 400
692 iso_pu_bacteria 2888388044 2888393648 400
693 iso_pu_bacteria 2888419890 2888424698 400
694 iso_pu_bacteria 2889033259 2889039670 400
695 iso_pu_bacteria 2903727486 2903731067 400
696 iso_pu_bacteria 2903748898 2903755251 400
697 iso_pu_bacteria 2903768456 2903776948 400
698 iso_pu_bacteria 2904666416 2904672998 400
699 iso_pu_bacteria 2904690495 2904694604 400
700 iso_pu_bacteria 2904699407 2904702431 400
701 iso_pu_bacteria 2904711408 2904714826 400
702 iso_pu_bacteria 2906602504 2906607426 400
703 iso_pu_bacteria 2906610324 2906618759 400
704 iso_pu_bacteria 2906626472 2906626961 400
705 iso_pu_bacteria 2906635258 2906638088 400
706 iso_pu_bacteria 2906643746 2906649025 400
707 iso_pu_bacteria 2906660503 2906666238 400
708 iso_pu_bacteria 2908739725 2908742548 400
709 iso_pu_bacteria 2908756301 2908760159 400
710 iso_pu_bacteria 2908775508 2908780343 400
711 iso_pu_bacteria 2922361189 2922365521 400
712 iso_pu_bacteria 2922368715 2922374571 400
713 iso_pu_bacteria 2922386360 2922391147 400
714 iso_pu_bacteria 2922393267 2922400643 400
715 iso_pu_bacteria 2922425934 2922430429 400
716 iso_pu_bacteria 2929615660 2929618236 400
717 iso_pu_bacteria 2929624759 2929632424 400
718 iso_pu_bacteria 2932784394 2932790530 400
719 iso_pu_bacteria 2932794094 2932799791 400
720 iso_pu_bacteria 2932801729 2932806958 400
721 iso_pu_bacteria 2932809354 2932810951 400
722 iso_pu_bacteria 2932818245 2932823719 400
723 iso_pu_bacteria 2932828146 2932830161 400
724 iso_pu_bacteria 2933577622 2933580164 400
725 iso_pu_bacteria 2935608549 2935609030 400
726 iso_pu_bacteria 2935616580 2935622613 400
727 iso_pu_bacteria 2935630451 2935631536 400
728 iso_pu_bacteria 2935638405 2935642587 400
729 iso_pu_bacteria 2935648319 2935653262 400
730 iso_pu_bacteria 2935656913 2935660267 400
731 iso_pu_bacteria 2935665750 2935668109 400
732 iso_pu_bacteria 2935675223 2935676142 400
733 iso_pu_bacteria 2935684952 2935686126 400
734 iso_pu_bacteria 2935694250 2935701248 400
735 iso_pu_bacteria 2935703347 2935705969 400
736 iso_pu_bacteria 2935713505 2935714678 400
737 iso_pu_bacteria 2935722832 2935725297 400
738 iso_pu_bacteria 2935732158 2935732343 400
739 iso_pu_bacteria 2935741537 2935741722 400
740 iso_pu_bacteria 2935750917 2935752091 400
741 iso_pu_bacteria 2935760218 2935766439 400
742 iso_pu_bacteria 2935769743 2935771887 400
743 iso_pu_bacteria 2935777560 2935778681 400
744 iso_pu_bacteria 2935785616 2935788933 400
745 iso_pu_bacteria 2935793552 2935795267 400
746 iso_pu_bacteria 2935801545 2935802968 400
747 iso_pu_bacteria 2935810662 2935814285 400
748 iso_pu_bacteria 2935819856 2935822190 400
749 iso_pu_bacteria 2935827899 2935831422 400
750 iso_pu_bacteria 2935837841 2935838282 400
751 iso_pu_bacteria 2935847175 2935847772 400
752 iso_pu_bacteria 2935855204 2935860862 400
753 iso_pu_bacteria 2935864058 2935869801 400
754 iso_pu_bacteria 2935873716 2935878780 400
755 iso_pu_bacteria 2935883170 2935886918 400
756 iso_pu_bacteria 2935908558 2935908956 400
757 iso_pu_bacteria 2935916978 2935919674 400
758 iso_pu_bacteria 2935926038 2935926470 400
759 iso_pu_bacteria 2935934488 2935934920 400
760 iso_pu_bacteria 2935942939 2935943370 400
761 iso_pu_bacteria 2935951376 2935951808 400
762 iso_pu_bacteria 2935959822 2935960569 400
763 iso_pu_bacteria 2935967501 2935967933 400
764 iso_pu_bacteria 2935975950 2935978558 400
765 iso_pu_bacteria 2935984226 2935991274 400
766 iso_pu_bacteria 2935992306 2935994824 400
767 iso_pu_bacteria 2936002035 2936003466 400
768 iso_pu_bacteria 2936011229 2936016132 400
769 iso_pu_bacteria 2936019824 2936024765 400
770 iso_pu_bacteria 2936028420 2936032013 400
771 iso_pu_bacteria 2936037263 2936039841 400
772 iso_pu_bacteria 2936046547 2936049874 400
773 iso_pu_bacteria 2936055302 2936060826 400
774 iso_pu_bacteria 2940556831 2940557106 400
775 iso_pu_bacteria 2941507105 2941511330 400
776 iso_pu_bacteria 2941515067 2941519031 400
777 iso_pu_bacteria 2941523033 2941526389 400
778 iso_pu_bacteria 2941531003 2941532980 400
779 iso_pu_bacteria 2941538514 2941539050 400
780 iso_pu_bacteria 3005474847 3005480343 400
781 iso_pu_bacteria 3005483717 3005484474 400
782 iso_pu_bacteria 3005506211 3005510488 400
783 iso_pu_bacteria 3005587118 3005587886 400
784 iso_pu_bacteria 3005594810 3005599395 400
785 iso_pu_bacteria 3005710791 3005715057 400
786 iso_pu_bacteria 3005718088 3005722470 400
787 iso_pu_bacteria 8006926726 8006931876 400
788 iso_pu_bacteria 8006933436 8006940533 400
789 iso_pu_bacteria 8006964411 8006967153 400
790 iso_pu_bacteria 8006973647 8006980222 400
791 iso_pu_bacteria 8006984368 8006986567 400
792 iso_pu_bacteria 8006994254 8006995849 400
793 iso_pu_bacteria 8016522445 8016529459 400
794 iso_pu_bacteria 8016530956 8016534670 400
795 iso_pu_bacteria 8016539877 8016547888 400
796 iso_pu_bacteria 8016548790 8016554245 400
797 iso_pu_bacteria 8016557553 8016562618 400
798 iso_pu_bacteria 8016575299 8016577166 400
799 iso_pu_bacteria 8016595262 8016600404 400
800 iso_pu_bacteria 8016603502 8016610334 400
801 iso_pu_bacteria 8016613128 8016614596 400
802 iso_pu_bacteria 8016622563 8016626403 400
803 iso_pu_bacteria 8016630954 8016640162 400
804 iso_pu_bacteria 8017057580 8017063519 400
805 iso_pu_bacteria 8019530166 8019534435 400
806 iso_pu_bacteria 8019538911 8019545034 400
807 iso_pu_bacteria 8019555841 8019556599 400
808 iso_pu_bacteria 8019565922 8019568709 400
809 iso_pu_bacteria 8019576017 8019582839 400
810 iso_pu_bacteria 8019586578 8019590633 400
811 iso_pu_bacteria 8019597564 8019600721 400
812 iso_pu_bacteria 8019608314 8019617829 400
813 iso_pu_bacteria 8019638758 8019645447 400
814 iso_pu_bacteria 8019648815 8019658562 400
815 iso_pu_bacteria 8019659431 8019662162 400
816 iso_pu_bacteria 8019668869 8019671679 400
817 iso_pu_bacteria 8019678201 8019684419 400
818 iso_pu_bacteria 8019687851 8019690231 400
819 iso_pu_bacteria 8055742211 8055746175 400
820 iso_pu_bacteria 8056673599 8056673687 400
821 iso_pu_bacteria 8056681323 8056686773 400
822 iso_pu_bacteria 8056689827 8056691370 400
823 iso_pu_bacteria 8056967851 8056968185 400
824 3300003215 JGI25153J46596_10037987 JGI25153J46596_100379871 401
825 3300003354 JGI25160J50197_1000847 JGI25160J50197_100084723 401
826 3300003354 JGI25160J50197_1001218 JGI25160J50197_10012188 401
827 3300005262 Ga0065165_1003351 Ga0065165_10033514 401
828 3300005330 Ga0070690_100087730 Ga0070690_1000877302 401
829 3300005334 Ga0068869_100001877 Ga0068869_1000018779 401
830 3300005336 Ga0070680_100086668 Ga0070680_1000866681 401
831 3300005337 Ga0070682_100039303 Ga0070682_1000393032 401
832 3300005338 Ga0068868_100015336 Ga0068868_1000153364 401
833 3300005340 Ga0070689_100188949 Ga0070689_1001889492 401
834 3300005347 Ga0070668_100019213 Ga0070668_1000192134 401
835 3300005355 Ga0070671_100045047 Ga0070671_1000450474 401
836 3300005356 Ga0070674_100143937 Ga0070674_1001439371 401
837 3300005439 Ga0070711_100039439 Ga0070711_1000394395 401
838 3300005441 Ga0070700_100084101 Ga0070700_1000841012 401
839 3300005455 Ga0070663_100061701 Ga0070663_1000617013 401
840 3300005455 Ga0070663_100080927 Ga0070663_1000809272 401
841 3300005456 Ga0070678_100016197 Ga0070678_1000161973 401
842 3300005456 Ga0070678_100171935 Ga0070678_1001719352 401
843 3300005459 Ga0068867_100052680 Ga0068867_1000526802 401
844 3300005530 Ga0070679_100012175 Ga0070679_1000121754 401
845 3300005530 Ga0070679_100186692 Ga0070679_1001866921 401
846 3300005543 Ga0070672_100240481 Ga0070672_1002404811 401
847 3300005548 Ga0070665_100064957 Ga0070665_1000649572 401
848 3300005548 Ga0070665_100133383 Ga0070665_1001333833 401
849 3300005563 Ga0068855_100015651 Ga0068855_10001565110 401
850 3300005577 Ga0068857_100106543 Ga0068857_1001065433 401
851 3300005577 Ga0068857_100234053 Ga0068857_1002340531 401
852 3300005617 Ga0068859_100052906 Ga0068859_1000529063 401
853 3300005718 Ga0068866_10028243 Ga0068866_100282432 401
854 3300005719 Ga0068861_100015012 Ga0068861_1000150122 401
855 3300005842 Ga0068858_100044329 Ga0068858_1000443296 401
856 3300005844 Ga0068862_100051983 Ga0068862_1000519834 401
857 3300005937 Ga0081455_10006892 Ga0081455_1000689210 401
858 3300005937 Ga0081455_10034950 Ga0081455_100349502 401
859 3300005937 Ga0081455_10218283 Ga0081455_102182831 401
860 3300005983 Ga0081540_1011445 Ga0081540_10114453 401
861 3300005983 Ga0081540_1016805 Ga0081540_10168052 401
862 3300005983 Ga0081540_1018760 Ga0081540_10187603 401
863 3300006038 Ga0075365_10021616 Ga0075365_100216165 401
864 3300006038 Ga0075365_10076083 Ga0075365_100760832 401
865 3300006042 Ga0075368_10000258 Ga0075368_1000025815 401
866 3300006042 Ga0075368_10041672 Ga0075368_100416722 401
867 3300006048 Ga0075363_100002988 Ga0075363_1000029884 401
868 3300006175 Ga0070712_100006564 Ga0070712_1000065644 401
869 3300006178 Ga0075367_10004888 Ga0075367_100048884 401
870 3300006178 Ga0075367_10004919 Ga0075367_100049197 401
871 3300006353 Ga0075370_10018963 Ga0075370_100189634 401
872 3300006353 Ga0075370_10098650 Ga0075370_100986501 401
873 3300006931 Ga0097620_100052905 Ga0097620_1000529053 401
874 3300006942 Ga0099824_1004403 Ga0099824_10044036 401
875 3300006943 Ga0099822_1018335 Ga0099822_10183356 401
876 3300007265 Ga0099794_10014454 Ga0099794_100144543 401
877 3300009093 Ga0105240_10041521 Ga0105240_100415213 401
878 3300009093 Ga0105240_10180331 Ga0105240_101803312 401
879 3300009098 Ga0105245_10174669 Ga0105245_101746692 401
880 3300009177 Ga0105248_10043613 Ga0105248_100436133 401
881 3300010159 Ga0099796_10060610 Ga0099796_100606101 401
882 3300010375 Ga0105239_10063610 Ga0105239_100636104 401
883 3300013104 Ga0157370_10012436 Ga0157370_100124369 401
884 3300013105 Ga0157369_10028862 Ga0157369_100288624 401
885 3300013297 Ga0157378_10027154 Ga0157378_100271544 401
886 3300013308 Ga0157375_10055282 Ga0157375_100552823 401
887 3300014325 Ga0163163_10067632 Ga0163163_100676324 401
888 3300017792 Ga0163161_10004994 Ga0163161_100049943 401
889 3300025297 Ga0209758_1007245 Ga0209758_10072456 401
890 3300025297 Ga0209758_1038310 Ga0209758_10383101 401
891 3300025302 Ga0207426_1001216 Ga0207426_100121621 401
892 3300025315 Ga0207697_10073450 Ga0207697_100734501 401
893 3300025901 Ga0207688_10085575 Ga0207688_100855752 401
894 3300025901 Ga0207688_10149583 Ga0207688_101495831 401
895 3300025912 Ga0207707_10000359 Ga0207707_1000035915 401
896 3300025912 Ga0207707_10093928 Ga0207707_100939281 401
897 3300025913 Ga0207695_10068321 Ga0207695_100683213 401
898 3300025914 Ga0207671_10216729 Ga0207671_102167291 401
899 3300025924 Ga0207694_10055889 Ga0207694_100558893 401
900 3300025926 Ga0207659_10173002 Ga0207659_101730021 401
901 3300025928 Ga0207700_10017812 Ga0207700_100178125 401
902 3300025933 Ga0207706_10011412 Ga0207706_100114123 401
903 3300025941 Ga0207711_10035548 Ga0207711_100355485 401
904 3300025949 Ga0207667_10147724 Ga0207667_101477243 401
905 3300025960 Ga0207651_10151632 Ga0207651_101516322 401
906 3300025972 Ga0207668_10009212 Ga0207668_100092122 401
907 3300025972 Ga0207668_10016413 Ga0207668_100164133 401
908 3300026067 Ga0207678_10044979 Ga0207678_100449793 401
909 3300026075 Ga0207708_10027461 Ga0207708_100274615 401
910 3300026089 Ga0207648_10109161 Ga0207648_101091613 401
911 3300026095 Ga0207676_10215008 Ga0207676_102150081 401
912 3300026116 Ga0207674_10153455 Ga0207674_101534552 401
913 3300026118 Ga0207675_100002865 Ga0207675_10000286517 401
914 3300026121 Ga0207683_10019414 Ga0207683_100194143 401
915 3300027357 Ga0209589_1000001 Ga0209589_1000001224 401
916 3300027361 Ga0209489_100001 Ga0209489_100001224 401
917 3300027363 Ga0209700_100001 Ga0209700_100001224 401
918 3300027866 Ga0209813_10000241 Ga0209813_100002415 401
919 3300028379 Ga0268266_10002410 Ga0268266_100024108 401
920 3300028379 Ga0268266_10005649 Ga0268266_100056498 401
921 3300028379 Ga0268266_10025598 Ga0268266_100255982 401
922 3300028786 Ga0307517_10000008 Ga0307517_1000000817 401
923 3300031711 Ga0265314_10005412 Ga0265314_100054128 401
924 3300031852 Ga0307410_10081736 Ga0307410_100817362 401
925 3300033180 Ga0307510_10030365 Ga0307510_100303652 401
926 3300035083 Ga0373926_0006210 Ga0373926_0006210_627_1847 401
927 3300035115 Ga0373941_0055204 Ga0373941_0055204_43_1263 401
928 3300035116 Ga0373945_0005196 Ga0373945_0005196_1985_3205 401
929 3300035725 Ga0373947_0109264 Ga0373947_0109264_187_1407 401
930 3300036401 Ga0373937_0128498 Ga0373937_0128498_633_1853 401
931 3300037068 Ga0373925_0096352 Ga0373925_0096352_100_1320 401
932 3300037466 Ga0395898_0291364 Ga0395898_0291364_45_1265 401
933 3300038443 Ga0395901_0407197 Ga0395901_0407197_162_1382 401
934 3300039437 Ga0436365_1233295 Ga0436365_1233295_1087_2307 401
935 3300039437 Ga0436365_1540038 Ga0436365_1540038_176_1396 401
936 3300039450 Ga0436363_0918081 Ga0436363_0918081_509_1729 401
937 3300044694 Ga0466963_0054556 Ga0466963_0054556_1199_2419 401
938 3300046452 Ga0495617_027881 Ga0495617_027881_259_1479 401
939 3300046455 Ga0495603_0009824 Ga0495603_0009824_3059_4282 401
940 3300046455 Ga0495603_0010882 Ga0495603_0010882_1229_2449 401
941 3300046460 Ga0495638_0015687 Ga0495638_0015687_21_1241 401
942 3300046473 Ga0495582_0036966 Ga0495582_0036966_373_1659 401
943 3300046477 Ga0495664_0014962 Ga0495664_0014962_2304_3524 401
944 3300046499 Ga0495594_0039280 Ga0495594_0039280_807_2027 401
945 3300046507 Ga0495606_0002700 Ga0495606_0002700_6649_7872 401
946 3300046512 Ga0495610_0084470 Ga0495610_0084470_213_1433 401
947 3300046518 Ga0495631_0060901 Ga0495631_0060901_81_1301 401
948 3300046526 Ga0495666_0099252 Ga0495666_0099252_43_1266 401
949 3300046531 Ga0495665_0021744 Ga0495665_0021744_249_1466 401
950 3300046533 Ga0495640_0013662 Ga0495640_0013662_2039_3259 401
951 3300046559 Ga0495667_0059642 Ga0495667_0059642_217_1437 401
952 3300046642 Ga0495634_0104942 Ga0495634_0104942_394_1614 401
953 3300047315 Ga0495581_0024060 Ga0495581_0024060_556_1776 401
954 3300047319 Ga0495674_0017800 Ga0495674_0017800_4613_5899 401
955 3300047320 Ga0495672_0010757 Ga0495672_0010757_1771_2994 401
956 3300047321 Ga0495676_0053391 Ga0495676_0053391_1067_2353 401
957 3300047471 Ga0495684_0019491 Ga0495684_0019491_3496_4716 401
958 3300047673 Ga0495593_0004557 Ga0495593_0004557_4723_5943 401
959 3300048905 Ga0496102_0069039 Ga0496102_0069039_219_1439 401
960 3300048910 Ga0496107_0038938 Ga0496107_0038938_1500_2720 401
961 3300048911 Ga0496108_0017452 Ga0496108_0017452_1606_2826 401
962 3300048914 Ga0496111_0219523 Ga0496111_0219523_169_1389 401
963 3300048915 Ga0496112_0024366 Ga0496112_0024366_4454_5674 401
964 3300048915 Ga0496112_0039660 Ga0496112_0039660_2839_4059 401
965 3300048916 Ga0496113_0106471 Ga0496113_0106471_937_2157 401
966 3300048917 Ga0496114_0043187 Ga0496114_0043187_1761_2981 401
967 3300048918 Ga0496115_0134043 Ga0496115_0134043_181_1401 401
968 3300048929 Ga0496126_0004659 Ga0496126_0004659_8790_10010 401
969 3300048929 Ga0496126_0030336 Ga0496126_0030336_1691_2914 401
970 3300049581 Ga0501047_0084470 Ga0501047_0084470_77_1297 401
971 3300049583 Ga0501067_0077355 Ga0501067_0077355_402_1622 401
972 3300049589 Ga0501073_0062358 Ga0501073_0062358_446_1666 401
973 3300049742 Ga0501080_0052344 Ga0501080_0052344_57_1277 401
974 3300050490 nmdc:mga03n38_1152_c1 nmdc:mga03n38_1152_c1_3373_4593 401
975 3300050494 nmdc:mga06z11_265_c1 nmdc:mga06z11_265_c1_2438_3658 401
976 3300050495 nmdc:mga04h51_277_c1 nmdc:mga04h51_277_c1_2438_3658 401
977 3300050496 nmdc:mga07m45_24289_c1 nmdc:mga07m45_24289_c1_1486_2706 401
978 3300050512 nmdc:mga0n895_70689_c1 nmdc:mga0n895_70689_c1_1500_2720 401
979 3300053102 Ga0500554_015669 Ga0500554_015669_547_1770 401
980 3300053119 Ga0500595_001524 Ga0500595_001524_3405_4628 401
981 3300053150 Ga0500603_000352 Ga0500603_000352_1063_2286 401
982 3300053178 Ga0500637_0005306 Ga0500637_0005306_2846_4069 401
983 iso_pu_bacteria 2513237101 2513692737 401
984 iso_pu_bacteria 2517093001 2517107781 401
985 iso_pu_bacteria 2617270735 2617347342 401
986 iso_pu_bacteria 2721755755 2723844884 401
987 iso_pu_bacteria 2824773399 2824775467 401
988 iso_pu_bacteria 2874604998 2874605396 401
989 iso_pu_bacteria 2922361189 2922365541 401
990 iso_pu_bacteria 3005506211 3005510504 401
991 iso_pu_bacteria 8006984368 8006986585 401
992 iso_pu_bacteria 8006994254 8006995830 401
993 3300005434 Ga0070709_10005128 Ga0070709_100051281 402
994 3300005458 Ga0070681_10136004 Ga0070681_101360042 402
995 3300005616 Ga0068852_100025264 Ga0068852_1000252643 402
996 3300005981 Ga0081538_10021648 Ga0081538_100216482 402
997 3300005983 Ga0081540_1018169 Ga0081540_10181692 402
998 3300006038 Ga0075365_10033601 Ga0075365_100336013 402
999 3300006042 Ga0075368_10056194 Ga0075368_100561941 402
1000 3300006051 Ga0075364_10010235 Ga0075364_100102352 402
1001 3300006175 Ga0070712_100013148 Ga0070712_1000131487 402
1002 3300006178 Ga0075367_10001631 Ga0075367_1000163115 402
1003 3300006178 Ga0075367_10013998 Ga0075367_100139982 402
1004 3300006178 Ga0075367_10122777 Ga0075367_101227771 402
1005 3300006186 Ga0075369_10057775 Ga0075369_100577752 402
1006 3300006942 Ga0099824_1006748 Ga0099824_10067485 402
1007 3300009093 Ga0105240_10027569 Ga0105240_100275696 402
1008 3300009098 Ga0105245_10271600 Ga0105245_102716002 402
1009 3300009545 Ga0105237_10007647 Ga0105237_100076476 402
1010 3300010375 Ga0105239_10044848 Ga0105239_100448482 402
1011 3300021320 Ga0214544_1000002 Ga0214544_1000002271 402
1012 3300021321 Ga0214542_1000001 Ga0214542_1000001621 402
1013 3300021324 Ga0214545_1000001 Ga0214545_1000001687 402
1014 3300021327 Ga0214543_1000001 Ga0214543_1000001508 402
1015 3300021384 Ga0213876_10091430 Ga0213876_100914301 402
1016 3300025254 Ga0209148_1000613 Ga0209148_100061327 402
1017 3300025272 Ga0209455_1001277 Ga0209455_10012773 402
1018 3300025295 Ga0209564_1008506 Ga0209564_10085063 402
1019 3300025297 Ga0209758_1001601 Ga0209758_100160112 402
1020 3300025299 Ga0209256_1009403 Ga0209256_10094031 402
1021 3300025906 Ga0207699_10045190 Ga0207699_100451903 402
1022 3300025911 Ga0207654_10006353 Ga0207654_100063534 402
1023 3300025912 Ga0207707_10119750 Ga0207707_101197502 402
1024 3300025913 Ga0207695_10000910 Ga0207695_100009106 402
1025 3300025914 Ga0207671_10002587 Ga0207671_1000258714 402
1026 3300025915 Ga0207693_10017377 Ga0207693_100173778 402
1027 3300025928 Ga0207700_10139046 Ga0207700_101390462 402
1028 3300027296 Ga0209389_1000061 Ga0209389_100006122 402
1029 3300027357 Ga0209589_1000465 Ga0209589_100046522 402
1030 3300027361 Ga0209489_100006 Ga0209489_10000624 402
1031 3300031711 Ga0265314_10085675 Ga0265314_100856752 402
1032 3300045049 Ga0466959_0043086 Ga0466959_0043086_1137_2345 402
1033 3300045976 Ga0466967_0135494 Ga0466967_0135494_425_1648 402
1034 3300046462 Ga0495651_0000395 Ga0495651_0000395_8468_9691 402
1035 3300046516 Ga0495628_0068444 Ga0495628_0068444_1261_2484 402
1036 3300046522 Ga0495643_0015625 Ga0495643_0015625_491_1714 402
1037 3300046529 Ga0495652_0006074 Ga0495652_0006074_2938_4161 402
1038 3300046529 Ga0495652_0195722 Ga0495652_0195722_273_1511 402
1039 3300046536 Ga0495587_0008275 Ga0495587_0008275_2704_3927 402
1040 3300046675 Ga0495657_0020820 Ga0495657_0020820_2175_3398 402
1041 3300046678 Ga0495599_0078053 Ga0495599_0078053_258_1481 402
1042 3300046679 Ga0495623_0009021 Ga0495623_0009021_3454_4677 402
1043 3300046809 Ga0495600_0003908 Ga0495600_0003908_220_1443 402
1044 3300047317 Ga0495604_0000797 Ga0495604_0000797_19725_20948 402
1045 3300047322 Ga0495680_0002991 Ga0495680_0002991_8145_9368 402
1046 3300048088 Ga0495602_0002266 Ga0495602_0002266_15499_16722 402
1047 3300048915 Ga0496112_0000021 Ga0496112_0000021_32790_34013 402
1048 3300048921 Ga0496118_0018968 Ga0496118_0018968_4778_6001 402
1049 3300049569 Ga0501032_0145628 Ga0501032_0145628_76_1305 402
1050 3300049574 Ga0501038_0003879 Ga0501038_0003879_778_1998 402
1051 3300049579 Ga0501043_0130370 Ga0501043_0130370_187_1416 402
1052 3300049823 Ga0501044_0006565 Ga0501044_0006565_951_2171 402
1053 3300049823 Ga0501044_0130487 Ga0501044_0130487_507_1736 402
1054 3300050491 nmdc:mga00v17_5870_c1 nmdc:mga00v17_5870_c1_1074_2327 402
1055 3300050491 nmdc:mga00v17_71047_c1 nmdc:mga00v17_71047_c1_693_1916 402
1056 3300050492 nmdc:mga0yw44_26596_c1 nmdc:mga0yw44_26596_c1_997_2250 402
1057 3300050494 nmdc:mga06z11_7714_c1 nmdc:mga06z11_7714_c1_142_1395 402
1058 3300050496 nmdc:mga07m45_49310_c1 nmdc:mga07m45_49310_c1_164_1387 402
1059 3300050516 nmdc:mga0sz30_48151_c1 nmdc:mga0sz30_48151_c1_292_1515 402
1060 3300053178 Ga0500637_0057366 Ga0500637_0057366_90_1313 402
1061 iso_pu_bacteria 2513237092 2513625552 402
1062 iso_pu_bacteria 2513237094 2513644464 402
1063 iso_pu_bacteria 2513237096 2513658003 402
1064 iso_pu_bacteria 2513237098 2513676090 402
1065 iso_pu_bacteria 2513237137 2513855705 402
1066 iso_pu_bacteria 2513237145 2513919903 402
1067 iso_pu_bacteria 2513237145 2513920424 402
1068 iso_pu_bacteria 2513237161 2514013702 402
1069 iso_pu_bacteria 2517572143 2517892244 402
1070 iso_pu_bacteria 2524023210 2524465682 402
1071 iso_pu_bacteria 2524023228 2524540321 402
1072 iso_pu_bacteria 2602042107 2603859618 402
1073 iso_pu_bacteria 2602042107 2603859619 402
1074 iso_pu_bacteria 2617270741 2617375575 402
1075 iso_pu_bacteria 2643221651 2644288819 402
1076 iso_pu_bacteria 2667528175 2671120508 402
1077 iso_pu_bacteria 2728368998 2728747401 402
1078 iso_pu_bacteria 2791355197 2793072415 402
1079 iso_pu_bacteria 2791355199 2793082245 402
1080 iso_pu_bacteria 2824661429 2824668332 402
1081 iso_pu_bacteria 2824671348 2824676871 402
1082 iso_pu_bacteria 2824679649 2824684508 402
1083 iso_pu_bacteria 2824687955 2824693178 402
1084 iso_pu_bacteria 2824732956 2824735284 402
1085 iso_pu_bacteria 2824746037 2824746616 402
1086 iso_pu_bacteria 2838122688 2838123566 402
1087 iso_pu_bacteria 2841941048 2841946789 402
1088 iso_pu_bacteria 2841949485 2841949666 402
1089 iso_pu_bacteria 2841957949 2841958833 402
1090 iso_pu_bacteria 2841966195 2841971827 402
1091 iso_pu_bacteria 2841974524 2841974827 402
1092 iso_pu_bacteria 2841983080 2841983611 402
1093 iso_pu_bacteria 2844315083 2844319239 402
1094 iso_pu_bacteria 2857509624 2857514127 402
1095 iso_pu_bacteria 2857524615 2857528974 402
1096 iso_pu_bacteria 2857524615 2857528975 402
1097 iso_pu_bacteria 2874612657 2874615098 402
1098 iso_pu_bacteria 2874628541 2874632030 402
1099 iso_pu_bacteria 2876771140 2876778302 402
1100 iso_pu_bacteria 2879074833 2879082096 402
1101 iso_pu_bacteria 2879099564 2879105730 402
1102 iso_pu_bacteria 2879110137 2879110218 402
1103 iso_pu_bacteria 2885366525 2885372988 402
1104 iso_pu_bacteria 2885374607 2885381927 402
1105 iso_pu_bacteria 2885383462 2885389999 402
1106 iso_pu_bacteria 2888388044 2888393634 402
1107 iso_pu_bacteria 2889033259 2889039650 402
1108 iso_pu_bacteria 2893066018 2893070431 402
1109 iso_pu_bacteria 2893066018 2893070432 402
1110 iso_pu_bacteria 2903727486 2903731081 402
1111 iso_pu_bacteria 2903748898 2903749168 402
1112 iso_pu_bacteria 2903768456 2903772426 402
1113 iso_pu_bacteria 2904690495 2904694621 402
1114 iso_pu_bacteria 2904699407 2904702402 402
1115 iso_pu_bacteria 2906602504 2906607412 402
1116 iso_pu_bacteria 2906610324 2906618775 402
1117 iso_pu_bacteria 2906635258 2906643124 402
1118 iso_pu_bacteria 2906660503 2906666216 402
1119 iso_pu_bacteria 2908739725 2908742524 402
1120 iso_pu_bacteria 2908756301 2908760176 402
1121 iso_pu_bacteria 2908775508 2908780359 402
1122 iso_pu_bacteria 2919073203 2919076373 402
1123 iso_pu_bacteria 2919073203 2919076374 402
1124 iso_pu_bacteria 2922368715 2922374586 402
1125 iso_pu_bacteria 2922386360 2922391164 402
1126 iso_pu_bacteria 2922393267 2922400628 402
1127 iso_pu_bacteria 2922425934 2922430454 402
1128 iso_pu_bacteria 2932784394 2932790545 402
1129 iso_pu_bacteria 2932794094 2932799777 402
1130 iso_pu_bacteria 2932801729 2932806972 402
1131 iso_pu_bacteria 2932809354 2932810966 402
1132 iso_pu_bacteria 2932818245 2932823704 402
1133 iso_pu_bacteria 2932828146 2932830176 402
1134 iso_pu_bacteria 2935616580 2935622598 402
1135 iso_pu_bacteria 2935630451 2935631514 402
1136 iso_pu_bacteria 2935638405 2935642602 402
1137 iso_pu_bacteria 2935665750 2935668094 402
1138 iso_pu_bacteria 2935675223 2935676127 402
1139 iso_pu_bacteria 2935684952 2935686111 402
1140 iso_pu_bacteria 2935694250 2935701263 402
1141 iso_pu_bacteria 2935703347 2935705954 402
1142 iso_pu_bacteria 2935713505 2935714663 402
1143 iso_pu_bacteria 2935722832 2935725282 402
1144 iso_pu_bacteria 2935732158 2935732358 402
1145 iso_pu_bacteria 2935741537 2935741737 402
1146 iso_pu_bacteria 2935750917 2935752076 402
1147 iso_pu_bacteria 2935760218 2935766424 402
1148 iso_pu_bacteria 2935801545 2935802953 402
1149 iso_pu_bacteria 2935810662 2935814270 402
1150 iso_pu_bacteria 2935827899 2935831407 402
1151 iso_pu_bacteria 2935837841 2935838267 402
1152 iso_pu_bacteria 2935855204 2935860847 402
1153 iso_pu_bacteria 2935864058 2935869816 402
1154 iso_pu_bacteria 2935873716 2935878765 402
1155 iso_pu_bacteria 2935883170 2935886904 402
1156 iso_pu_bacteria 2935992306 2935994839 402
1157 iso_pu_bacteria 2936002035 2936003481 402
1158 iso_pu_bacteria 2936037263 2936039826 402
1159 iso_pu_bacteria 2940556831 2940557121 402
1160 iso_pu_bacteria 2941507105 2941511308 402
1161 iso_pu_bacteria 2941515067 2941519009 402
1162 iso_pu_bacteria 2941523033 2941526411 402
1163 iso_pu_bacteria 2941531003 2941532995 402
1164 iso_pu_bacteria 2941538514 2941539065 402
1165 iso_pu_bacteria 3005474847 3005480365 402
1166 iso_pu_bacteria 3005483717 3005484489 402
1167 iso_pu_bacteria 3005587118 3005587870 402
1168 iso_pu_bacteria 3005594810 3005599409 402
1169 iso_pu_bacteria 3005718088 3005722484 402
1170 iso_pu_bacteria 8006926726 8006929122 402
1171 iso_pu_bacteria 8006933436 8006940509 402
1172 iso_pu_bacteria 8006964411 8006967134 402
1173 iso_pu_bacteria 8006973647 8006980197 402
1174 iso_pu_bacteria 8016511872 8016522134 402
1175 iso_pu_bacteria 8017057580 8017063535 402
1176 iso_pu_bacteria 8019555841 8019556581 402
1177 iso_pu_bacteria 8019565922 8019568725 402
1178 iso_pu_bacteria 8019576017 8019582854 402
1179 iso_pu_bacteria 8019586578 8019590648 402
1180 iso_pu_bacteria 8019597564 8019600705 402
1181 iso_pu_bacteria 8019608314 8019617845 402
1182 iso_pu_bacteria 8056673599 8056673668 402
1183 iso_pu_bacteria 8056681323 8056686796 402
1184 iso_pu_bacteria 8056689827 8056691352 402
1185 iso_pu_bacteria 8056967851 8056968200 402
1186 3300003215 JGI25153J46596_10003048 JGI25153J46596_100030482 403
1187 3300003215 JGI25153J46596_10009098 JGI25153J46596_100090984 403
1188 3300003215 JGI25153J46596_10012096 JGI25153J46596_100120962 403
1189 3300003215 JGI25153J46596_10030267 JGI25153J46596_100302671 403
1190 3300003215 JGI25153J46596_10031973 JGI25153J46596_100319732 403
1191 3300003354 JGI25160J50197_1001193 JGI25160J50197_10011939 403
1192 3300003354 JGI25160J50197_1004825 JGI25160J50197_10048251 403
1193 3300004625 Ga0055543_1005693 Ga0055543_10056931 403
1194 3300005262 Ga0065165_1001524 Ga0065165_100152413 403
1195 3300005262 Ga0065165_1003137 Ga0065165_10031372 403
1196 3300005262 Ga0065165_1020475 Ga0065165_10204752 403
1197 3300005293 Ga0065715_10099425 Ga0065715_100994252 403
1198 3300005334 Ga0068869_100086684 Ga0068869_1000866842 403
1199 3300005336 Ga0070680_100026234 Ga0070680_1000262344 403
1200 3300005336 Ga0070680_100029010 Ga0070680_1000290102 403
1201 3300005338 Ga0068868_100014107 Ga0068868_1000141074 403
1202 3300005339 Ga0070660_100120710 Ga0070660_1001207102 403
1203 3300005366 Ga0070659_100026271 Ga0070659_1000262712 403
1204 3300005366 Ga0070659_100079965 Ga0070659_1000799653 403
1205 3300005367 Ga0070667_100099088 Ga0070667_1000990881 403
1206 3300005434 Ga0070709_10004463 Ga0070709_100044638 403
1207 3300005434 Ga0070709_10008476 Ga0070709_100084761 403
1208 3300005434 Ga0070709_10037311 Ga0070709_100373111 403
1209 3300005435 Ga0070714_100001950 Ga0070714_10000195010 403
1210 3300005435 Ga0070714_100063580 Ga0070714_1000635805 403
1211 3300005435 Ga0070714_100171348 Ga0070714_1001713481 403
1212 3300005436 Ga0070713_100036242 Ga0070713_1000362423 403
1213 3300005436 Ga0070713_100160266 Ga0070713_1001602662 403
1214 3300005436 Ga0070713_100178753 Ga0070713_1001787531 403
1215 3300005437 Ga0070710_10001928 Ga0070710_100019286 403
1216 3300005437 Ga0070710_10006419 Ga0070710_100064191 403
1217 3300005437 Ga0070710_10023896 Ga0070710_100238964 403
1218 3300005439 Ga0070711_100004427 Ga0070711_1000044274 403
1219 3300005439 Ga0070711_100004672 Ga0070711_1000046723 403
1220 3300005439 Ga0070711_100004805 Ga0070711_1000048054 403
1221 3300005441 Ga0070700_100095059 Ga0070700_1000950592 403
1222 3300005455 Ga0070663_100023049 Ga0070663_1000230492 403
1223 3300005455 Ga0070663_100025725 Ga0070663_1000257252 403
1224 3300005455 Ga0070663_100206390 Ga0070663_1002063901 403
1225 3300005458 Ga0070681_10149222 Ga0070681_101492221 403
1226 3300005466 Ga0070685_10146011 Ga0070685_101460111 403
1227 3300005468 Ga0070707_100090611 Ga0070707_1000906112 403
1228 3300005471 Ga0070698_100174065 Ga0070698_1001740652 403
1229 3300005530 Ga0070679_100005756 Ga0070679_1000057561 403
1230 3300005530 Ga0070679_100022370 Ga0070679_1000223706 403
1231 3300005535 Ga0070684_100034917 Ga0070684_1000349172 403
1232 3300005548 Ga0070665_100033305 Ga0070665_1000333052 403
1233 3300005548 Ga0070665_100232028 Ga0070665_1002320282 403
1234 3300005548 Ga0070665_100290544 Ga0070665_1002905442 403
1235 3300005548 Ga0070665_100363408 Ga0070665_1003634081 403
1236 3300005563 Ga0068855_100076921 Ga0068855_1000769211 403
1237 3300005564 Ga0070664_100118752 Ga0070664_1001187522 403
1238 3300005564 Ga0070664_100285662 Ga0070664_1002856621 403
1239 3300005577 Ga0068857_100065118 Ga0068857_1000651182 403
1240 3300005577 Ga0068857_100088899 Ga0068857_1000888992 403
1241 3300005614 Ga0068856_100000535 Ga0068856_10000053524 403
1242 3300005616 Ga0068852_100109115 Ga0068852_1001091151 403
1243 3300005616 Ga0068852_100220431 Ga0068852_1002204312 403
1244 3300005617 Ga0068859_100244868 Ga0068859_1002448682 403
1245 3300005618 Ga0068864_100035170 Ga0068864_1000351702 403
1246 3300005618 Ga0068864_100217014 Ga0068864_1002170141 403
1247 3300005618 Ga0068864_100236581 Ga0068864_1002365811 403
1248 3300005834 Ga0068851_10003594 Ga0068851_100035942 403
1249 3300005842 Ga0068858_100077486 Ga0068858_1000774863 403
1250 3300005843 Ga0068860_100002461 Ga0068860_1000024619 403
1251 3300005844 Ga0068862_100121209 Ga0068862_1001212092 403
1252 3300005937 Ga0081455_10006941 Ga0081455_100069417 403
1253 3300005937 Ga0081455_10010171 Ga0081455_100101718 403
1254 3300005937 Ga0081455_10023773 Ga0081455_100237733 403
1255 3300005983 Ga0081540_1004076 Ga0081540_10040769 403
1256 3300005983 Ga0081540_1009393 Ga0081540_10093936 403
1257 3300005983 Ga0081540_1012218 Ga0081540_10122182 403
1258 3300005983 Ga0081540_1022988 Ga0081540_10229882 403
1259 3300005985 Ga0081539_10037373 Ga0081539_100373733 403
1260 3300006028 Ga0070717_10002238 Ga0070717_1000223812 403
1261 3300006028 Ga0070717_10006817 Ga0070717_100068173 403
1262 3300006028 Ga0070717_10107879 Ga0070717_101078792 403
1263 3300006038 Ga0075365_10027419 Ga0075365_100274192 403
1264 3300006038 Ga0075365_10064340 Ga0075365_100643402 403
1265 3300006038 Ga0075365_10075469 Ga0075365_100754692 403
1266 3300006038 Ga0075365_10131483 Ga0075365_101314831 403
1267 3300006038 Ga0075365_10212801 Ga0075365_102128011 403
1268 3300006042 Ga0075368_10017178 Ga0075368_100171782 403
1269 3300006051 Ga0075364_10031243 Ga0075364_100312431 403
1270 3300006051 Ga0075364_10068592 Ga0075364_100685922 403
1271 3300006163 Ga0070715_10000273 Ga0070715_100002739 403
1272 3300006173 Ga0070716_100022330 Ga0070716_1000223303 403
1273 3300006173 Ga0070716_100030811 Ga0070716_1000308112 403
1274 3300006175 Ga0070712_100022457 Ga0070712_1000224571 403
1275 3300006175 Ga0070712_100036232 Ga0070712_1000362324 403
1276 3300006178 Ga0075367_10041096 Ga0075367_100410962 403
1277 3300006186 Ga0075369_10022486 Ga0075369_100224862 403
1278 3300006186 Ga0075369_10042989 Ga0075369_100429892 403
1279 3300006186 Ga0075369_10050537 Ga0075369_100505372 403
1280 3300006195 Ga0075366_10046116 Ga0075366_100461162 403
1281 3300006195 Ga0075366_10087436 Ga0075366_100874362 403
1282 3300006237 Ga0097621_100110600 Ga0097621_1001106001 403
1283 3300006237 Ga0097621_100269548 Ga0097621_1002695482 403
1284 3300006353 Ga0075370_10019487 Ga0075370_100194872 403
1285 3300006844 Ga0075428_100323286 Ga0075428_1003232862 403
1286 3300006931 Ga0097620_100244881 Ga0097620_1002448812 403
1287 3300006943 Ga0099822_1004857 Ga0099822_10048574 403
1288 3300006944 Ga0099823_1031333 Ga0099823_10313332 403
1289 3300007788 Ga0099795_10005356 Ga0099795_100053562 403
1290 3300009093 Ga0105240_10029263 Ga0105240_100292632 403
1291 3300009093 Ga0105240_10118520 Ga0105240_101185202 403
1292 3300009098 Ga0105245_10037871 Ga0105245_100378714 403
1293 3300009101 Ga0105247_10025745 Ga0105247_100257452 403
1294 3300009101 Ga0105247_10033351 Ga0105247_100333511 403
1295 3300009148 Ga0105243_10098942 Ga0105243_100989421 403
1296 3300009177 Ga0105248_10212164 Ga0105248_102121642 403
1297 3300009545 Ga0105237_10053351 Ga0105237_100533515 403
1298 3300009545 Ga0105237_10227803 Ga0105237_102278032 403
1299 3300009551 Ga0105238_10020769 Ga0105238_100207692 403
1300 3300009551 Ga0105238_10164509 Ga0105238_101645092 403
1301 3300009553 Ga0105249_10026667 Ga0105249_100266674 403
1302 3300010375 Ga0105239_10060186 Ga0105239_100601862 403
1303 3300010375 Ga0105239_10188796 Ga0105239_101887962 403
1304 3300010375 Ga0105239_10319652 Ga0105239_103196522 403
1305 3300013105 Ga0157369_10006140 Ga0157369_100061404 403
1306 3300013105 Ga0157369_10134876 Ga0157369_101348762 403
1307 3300013296 Ga0157374_10020915 Ga0157374_100209152 403
1308 3300013308 Ga0157375_10204944 Ga0157375_102049442 403
1309 3300014325 Ga0163163_10194274 Ga0163163_101942742 403
1310 3300014325 Ga0163163_10467499 Ga0163163_104674991 403
1311 3300021358 Ga0213873_10004466 Ga0213873_100044663 403
1312 3300021384 Ga0213876_10001690 Ga0213876_100016904 403
1313 3300025253 Ga0209677_100537 Ga0209677_10053713 403
1314 3300025253 Ga0209677_103297 Ga0209677_1032972 403
1315 3300025254 Ga0209148_1005138 Ga0209148_10051383 403
1316 3300025261 Ga0209233_1004495 Ga0209233_10044953 403
1317 3300025261 Ga0209233_1008594 Ga0209233_10085942 403
1318 3300025272 Ga0209455_1004047 Ga0209455_10040474 403
1319 3300025295 Ga0209564_1012867 Ga0209564_10128671 403
1320 3300025297 Ga0209758_1000140 Ga0209758_1000140123 403
1321 3300025297 Ga0209758_1000164 Ga0209758_10001644 403
1322 3300025297 Ga0209758_1002397 Ga0209758_100239717 403
1323 3300025297 Ga0209758_1003800 Ga0209758_100380011 403
1324 3300025297 Ga0209758_1006517 Ga0209758_10065172 403
1325 3300025297 Ga0209758_1007676 Ga0209758_10076762 403
1326 3300025297 Ga0209758_1017749 Ga0209758_10177492 403
1327 3300025299 Ga0209256_1018544 Ga0209256_10185441 403
1328 3300025302 Ga0207426_1000626 Ga0207426_10006269 403
1329 3300025302 Ga0207426_1001803 Ga0207426_100180310 403
1330 3300025302 Ga0207426_1009840 Ga0207426_10098401 403
1331 3300025302 Ga0207426_1013581 Ga0207426_10135813 403
1332 3300025302 Ga0207426_1027750 Ga0207426_10277502 403
1333 3300025304 Ga0209257_1002059 Ga0209257_10020598 403
1334 3300025304 Ga0209257_1026420 Ga0209257_10264202 403
1335 3300025321 Ga0207656_10007922 Ga0207656_100079223 403
1336 3300025898 Ga0207692_10009204 Ga0207692_100092042 403
1337 3300025900 Ga0207710_10048973 Ga0207710_100489732 403
1338 3300025900 Ga0207710_10117111 Ga0207710_101171111 403
1339 3300025903 Ga0207680_10140666 Ga0207680_101406662 403
1340 3300025904 Ga0207647_10033656 Ga0207647_100336562 403
1341 3300025905 Ga0207685_10005804 Ga0207685_100058042 403
1342 3300025906 Ga0207699_10000379 Ga0207699_100003792 403
1343 3300025906 Ga0207699_10001095 Ga0207699_100010955 403
1344 3300025910 Ga0207684_10212938 Ga0207684_102129382 403
1345 3300025911 Ga0207654_10023984 Ga0207654_100239842 403
1346 3300025912 Ga0207707_10008741 Ga0207707_100087416 403
1347 3300025912 Ga0207707_10227195 Ga0207707_102271951 403
1348 3300025913 Ga0207695_10308493 Ga0207695_103084931 403
1349 3300025913 Ga0207695_10356756 Ga0207695_103567561 403
1350 3300025914 Ga0207671_10014047 Ga0207671_100140473 403
1351 3300025915 Ga0207693_10003562 Ga0207693_1000356212 403
1352 3300025915 Ga0207693_10073149 Ga0207693_100731492 403
1353 3300025916 Ga0207663_10009673 Ga0207663_100096735 403
1354 3300025916 Ga0207663_10027788 Ga0207663_100277882 403
1355 3300025917 Ga0207660_10008313 Ga0207660_100083132 403
1356 3300025919 Ga0207657_10019432 Ga0207657_100194325 403
1357 3300025921 Ga0207652_10018726 Ga0207652_100187263 403
1358 3300025921 Ga0207652_10030769 Ga0207652_100307694 403
1359 3300025922 Ga0207646_10144919 Ga0207646_101449191 403
1360 3300025924 Ga0207694_10053295 Ga0207694_100532952 403
1361 3300025927 Ga0207687_10072339 Ga0207687_100723391 403
1362 3300025928 Ga0207700_10010013 Ga0207700_100100132 403
1363 3300025928 Ga0207700_10023291 Ga0207700_100232916 403
1364 3300025929 Ga0207664_10008537 Ga0207664_100085373 403
1365 3300025929 Ga0207664_10040218 Ga0207664_100402182 403
1366 3300025929 Ga0207664_10195437 Ga0207664_101954372 403
1367 3300025931 Ga0207644_10153702 Ga0207644_101537021 403
1368 3300025932 Ga0207690_10050336 Ga0207690_100503362 403
1369 3300025933 Ga0207706_10032041 Ga0207706_100320414 403
1370 3300025933 Ga0207706_10146897 Ga0207706_101468972 403
1371 3300025937 Ga0207669_10026912 Ga0207669_100269122 403
1372 3300025939 Ga0207665_10001305 Ga0207665_1000130515 403
1373 3300025939 Ga0207665_10109693 Ga0207665_101096932 403
1374 3300025941 Ga0207711_10132179 Ga0207711_101321792 403
1375 3300025942 Ga0207689_10135761 Ga0207689_101357612 403
1376 3300025944 Ga0207661_10006014 Ga0207661_100060144 403
1377 3300025944 Ga0207661_10100386 Ga0207661_101003864 403
1378 3300025944 Ga0207661_10148136 Ga0207661_101481362 403
1379 3300025949 Ga0207667_10106279 Ga0207667_101062791 403
1380 3300026023 Ga0207677_10062741 Ga0207677_100627412 403
1381 3300026035 Ga0207703_10168578 Ga0207703_101685782 403
1382 3300026041 Ga0207639_10073521 Ga0207639_100735211 403
1383 3300026041 Ga0207639_10220099 Ga0207639_102200991 403
1384 3300026067 Ga0207678_10061977 Ga0207678_100619774 403
1385 3300026067 Ga0207678_10079940 Ga0207678_100799402 403
1386 3300026067 Ga0207678_10131781 Ga0207678_101317812 403
1387 3300026067 Ga0207678_10150261 Ga0207678_101502612 403
1388 3300026078 Ga0207702_10000081 Ga0207702_1000008134 403
1389 3300026078 Ga0207702_10032981 Ga0207702_100329813 403
1390 3300026078 Ga0207702_10104157 Ga0207702_101041572 403
1391 3300026088 Ga0207641_10114037 Ga0207641_101140372 403
1392 3300026089 Ga0207648_10044202 Ga0207648_100442022 403
1393 3300026095 Ga0207676_10326140 Ga0207676_103261401 403
1394 3300026116 Ga0207674_10018412 Ga0207674_100184122 403
1395 3300026116 Ga0207674_10041515 Ga0207674_100415152 403
1396 3300026118 Ga0207675_100031537 Ga0207675_1000315373 403
1397 3300026118 Ga0207675_100168586 Ga0207675_1001685862 403
1398 3300026121 Ga0207683_10037080 Ga0207683_100370802 403
1399 3300026142 Ga0207698_10027206 Ga0207698_100272063 403
1400 3300026142 Ga0207698_10037047 Ga0207698_100370473 403
1401 3300027296 Ga0209389_1000233 Ga0209389_100023333 403
1402 3300027357 Ga0209589_1000001 Ga0209589_100000165 403
1403 3300027361 Ga0209489_100001 Ga0209489_10000165 403
1404 3300027361 Ga0209489_102560 Ga0209489_10256033 403
1405 3300027363 Ga0209700_100001 Ga0209700_10000165 403
1406 3300027363 Ga0209700_100062 Ga0209700_100062146 403
1407 3300028379 Ga0268266_10030373 Ga0268266_100303732 403
1408 3300028379 Ga0268266_10124114 Ga0268266_101241141 403
1409 3300028380 Ga0268265_10038885 Ga0268265_100388852 403
1410 3300028380 Ga0268265_10085253 Ga0268265_100852532 403
1411 3300028381 Ga0268264_10000149 Ga0268264_10000149129 403
1412 3300028556 Ga0265337_1016243 Ga0265337_10162432 403
1413 3300028563 Ga0265319_1019665 Ga0265319_10196652 403
1414 3300028573 Ga0265334_10006531 Ga0265334_100065314 403
1415 3300028653 Ga0265323_10004599 Ga0265323_100045994 403
1416 3300028654 Ga0265322_10017668 Ga0265322_100176682 403
1417 3300028666 Ga0265336_10001016 Ga0265336_100010164 403
1418 3300028786 Ga0307517_10000772 Ga0307517_1000077244 403
1419 3300028794 Ga0307515_10038891 Ga0307515_100388912 403
1420 3300028800 Ga0265338_10001205 Ga0265338_1000120511 403
1421 3300029957 Ga0265324_10006841 Ga0265324_100068413 403
1422 3300031235 Ga0265330_10024452 Ga0265330_100244523 403
1423 3300031238 Ga0265332_10023610 Ga0265332_100236102 403
1424 3300031241 Ga0265325_10003329 Ga0265325_100033298 403
1425 3300031247 Ga0265340_10000903 Ga0265340_100009038 403
1426 3300031249 Ga0265339_10028260 Ga0265339_100282603 403
1427 3300031616 Ga0307508_10000009 Ga0307508_1000000993 403
1428 3300031616 Ga0307508_10036557 Ga0307508_100365573 403
1429 3300031616 Ga0307508_10093534 Ga0307508_100935342 403
1430 3300031711 Ga0265314_10009299 Ga0265314_100092995 403
1431 3300031730 Ga0307516_10013909 Ga0307516_100139092 403
1432 3300031911 Ga0307412_10160792 Ga0307412_101607921 403
1433 3300032002 Ga0307416_100067979 Ga0307416_1000679792 403
1434 3300032005 Ga0307411_10318101 Ga0307411_103181011 403
1435 3300033179 Ga0307507_10059932 Ga0307507_100599322 403
1436 3300033180 Ga0307510_10024366 Ga0307510_100243663 403
1437 3300033180 Ga0307510_10159470 Ga0307510_101594701 403
1438 3300033442 Ga0315911_1000001 Ga0315911_100000110 403
1439 3300033442 Ga0315911_1000006 Ga0315911_1000006330 403
1440 3300033544 Ga0316215_1003151 Ga0316215_10031511 403
1441 3300035118 Ga0373954_0005241 Ga0373954_0005241_2757_3983 403
1442 3300035120 Ga0373957_0017756 Ga0373957_0017756_70_1296 403
1443 3300035120 Ga0373957_0039787 Ga0373957_0039787_456_1694 403
1444 3300035172 Ga0373955_0000210 Ga0373955_0000210_662_1888 403
1445 3300035172 Ga0373955_0021420 Ga0373955_0021420_740_1978 403
1446 3300035691 Ga0373931_0001805 Ga0373931_0001805_270_1496 403
1447 3300035692 Ga0373935_0000146 Ga0373935_0000146_22546_23772 403
1448 3300035692 Ga0373935_0000382 Ga0373935_0000382_2702_3940 403
1449 3300035695 Ga0373927_0000069 Ga0373927_0000069_28148_29374 403
1450 3300035695 Ga0373927_0007415 Ga0373927_0007415_5266_6492 403
1451 3300035695 Ga0373927_0025913 Ga0373927_0025913_2559_3797 403
1452 3300035695 Ga0373927_0052766 Ga0373927_0052766_52_1278 403
1453 3300035725 Ga0373947_0002022 Ga0373947_0002022_9949_11175 403
1454 3300035725 Ga0373947_0010182 Ga0373947_0010182_2824_4062 403
1455 3300035725 Ga0373947_0042950 Ga0373947_0042950_1131_2357 403
1456 3300035725 Ga0373947_0198619 Ga0373947_0198619_65_1291 403
1457 3300036401 Ga0373937_0011760 Ga0373937_0011760_3437_4663 403
1458 3300036401 Ga0373937_0047885 Ga0373937_0047885_1741_2967 403
1459 3300036401 Ga0373937_0049980 Ga0373937_0049980_1972_3198 403
1460 3300036401 Ga0373937_0086387 Ga0373937_0086387_1379_2605 403
1461 3300037068 Ga0373925_0022731 Ga0373925_0022731_2789_4027 403
1462 3300037418 Ga0395900_0001120 Ga0395900_0001120_4628_5854 403
1463 3300037466 Ga0395898_0141457 Ga0395898_0141457_607_1833 403
1464 3300037471 Ga0395905_0045219 Ga0395905_0045219_203_1429 403
1465 3300037853 Ga0436364_1394003 Ga0436364_1394003_268_1494 403
1466 3300038443 Ga0395901_0077651 Ga0395901_0077651_2226_3452 403
1467 3300039437 Ga0436365_0655688 Ga0436365_0655688_290_1516 403
1468 3300039437 Ga0436365_1440273 Ga0436365_1440273_7281_8507 403
1469 3300039438 Ga0436360_1071774 Ga0436360_1071774_29_1249 403
1470 3300039447 Ga0436361_0848594 Ga0436361_0848594_352_1584 403
1471 3300039450 Ga0436363_0814578 Ga0436363_0814578_67_1293 403
1472 3300039453 Ga0436362_0680219 Ga0436362_0680219_1259_2485 403
1473 3300044656 Ga0466969_0049680 Ga0466969_0049680_793_2019 403
1474 3300044658 Ga0466972_0000189 Ga0466972_0000189_2364_3590 403
1475 3300044658 Ga0466972_0007356 Ga0466972_0007356_2273_3499 403
1476 3300044683 Ga0466965_0003215 Ga0466965_0003215_677_1903 403
1477 3300044684 Ga0466966_0000655 Ga0466966_0000655_14783_16009 403
1478 3300044693 Ga0466961_0001465 Ga0466961_0001465_4826_6052 403
1479 3300044706 Ga0466964_0039299 Ga0466964_0039299_458_1684 403
1480 3300044901 Ga0466960_0037541 Ga0466960_0037541_1017_2243 403
1481 3300045976 Ga0466967_0115555 Ga0466967_0115555_194_1420 403
1482 3300045976 Ga0466967_0135163 Ga0466967_0135163_923_2149 403
1483 3300046454 Ga0495592_0036870 Ga0495592_0036870_1173_2399 403
1484 3300046455 Ga0495603_0000191 Ga0495603_0000191_20064_21302 403
1485 3300046455 Ga0495603_0000499 Ga0495603_0000499_15233_16459 403
1486 3300046455 Ga0495603_0004726 Ga0495603_0004726_5591_6817 403
1487 3300046455 Ga0495603_0031657 Ga0495603_0031657_1453_2679 403
1488 3300046459 Ga0495629_0000083 Ga0495629_0000083_37084_38310 403
1489 3300046459 Ga0495629_0000500 Ga0495629_0000500_12232_13470 403
1490 3300046459 Ga0495629_0000721 Ga0495629_0000721_14197_15423 403
1491 3300046460 Ga0495638_0004605 Ga0495638_0004605_276_1502 403
1492 3300046460 Ga0495638_0098190 Ga0495638_0098190_478_1704 403
1493 3300046460 Ga0495638_0103032 Ga0495638_0103032_254_1480 403
1494 3300046461 Ga0495641_0001436 Ga0495641_0001436_7239_8477 403
1495 3300046462 Ga0495651_0019048 Ga0495651_0019048_36_1262 403
1496 3300046472 Ga0495580_0001842 Ga0495580_0001842_7817_9043 403
1497 3300046472 Ga0495580_0010080 Ga0495580_0010080_4800_6038 403
1498 3300046473 Ga0495582_0000094 Ga0495582_0000094_7759_8985 403
1499 3300046473 Ga0495582_0000251 Ga0495582_0000251_13181_14419 403
1500 3300046475 Ga0495639_0000077 Ga0495639_0000077_20341_21579 403
1501 3300046475 Ga0495639_0000926 Ga0495639_0000926_3451_4677 403
1502 3300046476 Ga0495662_0000080 Ga0495662_0000080_32882_34108 403
1503 3300046476 Ga0495662_0000826 Ga0495662_0000826_7967_9205 403
1504 3300046477 Ga0495664_0005360 Ga0495664_0005360_618_1856 403
1505 3300046477 Ga0495664_0028264 Ga0495664_0028264_646_1872 403
1506 3300046477 Ga0495664_0045999 Ga0495664_0045999_33_1259 403
1507 3300046492 Ga0495585_0061664 Ga0495585_0061664_437_1663 403
1508 3300046499 Ga0495594_0000433 Ga0495594_0000433_3389_4615 403
1509 3300046499 Ga0495594_0000648 Ga0495594_0000648_11913_13151 403
1510 3300046507 Ga0495606_0032276 Ga0495606_0032276_1385_2611 403
1511 3300046507 Ga0495606_0056101 Ga0495606_0056101_1298_2524 403
1512 3300046507 Ga0495606_0058297 Ga0495606_0058297_500_1738 403
1513 3300046507 Ga0495606_0106427 Ga0495606_0106427_198_1424 403
1514 3300046516 Ga0495628_0026802 Ga0495628_0026802_2292_3530 403
1515 3300046516 Ga0495628_0026806 Ga0495628_0026806_2524_3750 403
1516 3300046517 Ga0495630_0128620 Ga0495630_0128620_41_1267 403
1517 3300046522 Ga0495643_0052418 Ga0495643_0052418_512_1738 403
1518 3300046523 Ga0495644_0046239 Ga0495644_0046239_91_1317 403
1519 3300046524 Ga0495648_0017835 Ga0495648_0017835_3663_5003 403
1520 3300046524 Ga0495648_0066948 Ga0495648_0066948_859_2085 403
1521 3300046529 Ga0495652_0019988 Ga0495652_0019988_36_1262 403
1522 3300046529 Ga0495652_0030569 Ga0495652_0030569_3368_4606 403
1523 3300046529 Ga0495652_0080952 Ga0495652_0080952_193_1419 403
1524 3300046529 Ga0495652_0102748 Ga0495652_0102748_883_2112 403
1525 3300046531 Ga0495665_0000784 Ga0495665_0000784_12994_14220 403
1526 3300046531 Ga0495665_0016458 Ga0495665_0016458_1894_3132 403
1527 3300046533 Ga0495640_0003320 Ga0495640_0003320_2076_3314 403
1528 3300046533 Ga0495640_0011232 Ga0495640_0011232_1876_3102 403
1529 3300046535 Ga0495586_0044679 Ga0495586_0044679_85_1311 403
1530 3300046543 Ga0495645_0082855 Ga0495645_0082855_149_1381 403
1531 3300046557 Ga0495622_0008222 Ga0495622_0008222_2850_4076 403
1532 3300046557 Ga0495622_0028444 Ga0495622_0028444_361_1587 403
1533 3300046557 Ga0495622_0037832 Ga0495622_0037832_141_1367 403
1534 3300046558 Ga0495633_0059289 Ga0495633_0059289_504_1742 403
1535 3300046559 Ga0495667_0005217 Ga0495667_0005217_1745_2971 403
1536 3300046559 Ga0495667_0041370 Ga0495667_0041370_515_1753 403
1537 3300046559 Ga0495667_0139449 Ga0495667_0139449_87_1331 403
1538 3300046615 Ga0495656_0006988 Ga0495656_0006988_2267_3493 403
1539 3300046615 Ga0495656_0053353 Ga0495656_0053353_301_1527 403
1540 3300046642 Ga0495634_0001187 Ga0495634_0001187_19933_21291 403
1541 3300046642 Ga0495634_0020590 Ga0495634_0020590_1794_3020 403
1542 3300046663 Ga0495635_0000229 Ga0495635_0000229_20618_21844 403
1543 3300046663 Ga0495635_0000425 Ga0495635_0000425_19568_20806 403
1544 3300046663 Ga0495635_0009501 Ga0495635_0009501_303_1541 403
1545 3300046663 Ga0495635_0063005 Ga0495635_0063005_1050_2276 403
1546 3300046664 Ga0495659_0061544 Ga0495659_0061544_56_1294 403
1547 3300046674 Ga0495588_0007431 Ga0495588_0007431_2157_3383 403
1548 3300046675 Ga0495657_0010875 Ga0495657_0010875_3757_4995 403
1549 3300046675 Ga0495657_0150771 Ga0495657_0150771_182_1408 403
1550 3300046678 Ga0495599_0050075 Ga0495599_0050075_1238_2464 403
1551 3300046678 Ga0495599_0126498 Ga0495599_0126498_288_1520 403
1552 3300046679 Ga0495623_0052619 Ga0495623_0052619_410_1636 403
1553 3300046680 Ga0495646_0037047 Ga0495646_0037047_141_1367 403
1554 3300046681 Ga0495647_0008621 Ga0495647_0008621_312_1538 403
1555 3300046683 Ga0495658_0000334 Ga0495658_0000334_9883_11109 403
1556 3300046683 Ga0495658_0002435 Ga0495658_0002435_5398_6636 403
1557 3300046689 Ga0495613_0010577 Ga0495613_0010577_2577_3815 403
1558 3300046690 Ga0495624_0000096 Ga0495624_0000096_20673_21899 403
1559 3300046690 Ga0495624_0000818 Ga0495624_0000818_3488_4726 403
1560 3300046694 Ga0495649_0010278 Ga0495649_0010278_319_1557 403
1561 3300046694 Ga0495649_0069484 Ga0495649_0069484_522_1748 403
1562 3300046809 Ga0495600_0000440 Ga0495600_0000440_4057_5283 403
1563 3300046809 Ga0495600_0011116 Ga0495600_0011116_2115_3353 403
1564 3300047315 Ga0495581_0009576 Ga0495581_0009576_1835_3061 403
1565 3300047317 Ga0495604_0024509 Ga0495604_0024509_3426_4652 403
1566 3300047319 Ga0495674_0001342 Ga0495674_0001342_14412_15650 403
1567 3300047319 Ga0495674_0002711 Ga0495674_0002711_13069_14295 403
1568 3300047319 Ga0495674_0048096 Ga0495674_0048096_1746_2972 403
1569 3300047319 Ga0495674_0188994 Ga0495674_0188994_245_1471 403
1570 3300047320 Ga0495672_0031567 Ga0495672_0031567_63_1289 403
1571 3300047321 Ga0495676_0035190 Ga0495676_0035190_2654_3880 403
1572 3300047321 Ga0495676_0051777 Ga0495676_0051777_1638_2876 403
1573 3300047321 Ga0495676_0061193 Ga0495676_0061193_1658_2896 403
1574 3300047444 Ga0495675_0042433 Ga0495675_0042433_1510_2736 403
1575 3300047445 Ga0495677_0031930 Ga0495677_0031930_132_1358 403
1576 3300047469 Ga0495673_0055053 Ga0495673_0055053_364_1590 403
1577 3300047471 Ga0495684_0045177 Ga0495684_0045177_1467_2705 403
1578 3300047673 Ga0495593_0000071 Ga0495593_0000071_28039_29265 403
1579 3300047673 Ga0495593_0000192 Ga0495593_0000192_10611_11849 403
1580 3300048088 Ga0495602_0032999 Ga0495602_0032999_1112_2338 403
1581 3300048088 Ga0495602_0046834 Ga0495602_0046834_2330_3559 403
1582 3300048089 Ga0495614_0014224 Ga0495614_0014224_1313_2551 403
1583 3300048904 Ga0496101_0081798 Ga0496101_0081798_928_2154 403
1584 3300048904 Ga0496101_0181810 Ga0496101_0181810_28_1254 403
1585 3300048904 Ga0496101_0221803 Ga0496101_0221803_21_1247 403
1586 3300048905 Ga0496102_0013510 Ga0496102_0013510_5651_6877 403
1587 3300048905 Ga0496102_0130421 Ga0496102_0130421_834_2060 403
1588 3300048905 Ga0496102_0216315 Ga0496102_0216315_385_1623 403
1589 3300048905 Ga0496102_0289006 Ga0496102_0289006_284_1510 403
1590 3300048906 Ga0496103_0034796 Ga0496103_0034796_1206_2432 403
1591 3300048906 Ga0496103_0125495 Ga0496103_0125495_344_1570 403
1592 3300048906 Ga0496103_0186500 Ga0496103_0186500_36_1319 403
1593 3300048907 Ga0496104_0003416 Ga0496104_0003416_8763_10001 403
1594 3300048907 Ga0496104_0028484 Ga0496104_0028484_2971_4197 403
1595 3300048907 Ga0496104_0050018 Ga0496104_0050018_2089_3315 403
1596 3300048908 Ga0496105_0000885 Ga0496105_0000885_16050_17288 403
1597 3300048908 Ga0496105_0020255 Ga0496105_0020255_1394_2620 403
1598 3300048908 Ga0496105_0035975 Ga0496105_0035975_2156_3382 403
1599 3300048908 Ga0496105_0083660 Ga0496105_0083660_467_1693 403
1600 3300048909 Ga0496106_0001915 Ga0496106_0001915_1153_2379 403
1601 3300048909 Ga0496106_0037921 Ga0496106_0037921_1563_2789 403
1602 3300048909 Ga0496106_0088810 Ga0496106_0088810_446_1672 403
1603 3300048909 Ga0496106_0118644 Ga0496106_0118644_769_1995 403
1604 3300048909 Ga0496106_0150552 Ga0496106_0150552_357_1583 403
1605 3300048910 Ga0496107_0012151 Ga0496107_0012151_3932_5158 403
1606 3300048910 Ga0496107_0027783 Ga0496107_0027783_1713_2939 403
1607 3300048911 Ga0496108_0253998 Ga0496108_0253998_61_1287 403
1608 3300048912 Ga0496109_0035989 Ga0496109_0035989_1567_2793 403
1609 3300048912 Ga0496109_0041003 Ga0496109_0041003_1995_3221 403
1610 3300048914 Ga0496111_0030899 Ga0496111_0030899_2320_3546 403
1611 3300048915 Ga0496112_0009718 Ga0496112_0009718_4625_5851 403
1612 3300048915 Ga0496112_0014868 Ga0496112_0014868_1680_2906 403
1613 3300048915 Ga0496112_0069176 Ga0496112_0069176_1428_2654 403
1614 3300048916 Ga0496113_0043607 Ga0496113_0043607_689_1915 403
1615 3300048916 Ga0496113_0045592 Ga0496113_0045592_156_1382 403
1616 3300048916 Ga0496113_0142693 Ga0496113_0142693_280_1506 403
1617 3300048917 Ga0496114_0010449 Ga0496114_0010449_270_1496 403
1618 3300048918 Ga0496115_0054052 Ga0496115_0054052_921_2147 403
1619 3300048918 Ga0496115_0063546 Ga0496115_0063546_99_1325 403
1620 3300048918 Ga0496115_0088782 Ga0496115_0088782_1165_2391 403
1621 3300048918 Ga0496115_0111608 Ga0496115_0111608_261_1487 403
1622 3300048919 Ga0496116_0123106 Ga0496116_0123106_92_1318 403
1623 3300048921 Ga0496118_0008788 Ga0496118_0008788_581_1807 403
1624 3300048921 Ga0496118_0044117 Ga0496118_0044117_2087_3313 403
1625 3300048921 Ga0496118_0048374 Ga0496118_0048374_1462_2691 403
1626 3300048922 Ga0496119_0070625 Ga0496119_0070625_643_1881 403
1627 3300048922 Ga0496119_0074171 Ga0496119_0074171_38_1264 403
1628 3300048922 Ga0496119_0090397 Ga0496119_0090397_456_1682 403
1629 3300048924 Ga0496121_0000937 Ga0496121_0000937_46464_47693 403
1630 3300048924 Ga0496121_0001335 Ga0496121_0001335_34491_35717 403
1631 3300048924 Ga0496121_0001474 Ga0496121_0001474_20729_21955 403
1632 3300048924 Ga0496121_0073661 Ga0496121_0073661_932_2158 403
1633 3300048927 Ga0496124_0060408 Ga0496124_0060408_1551_2777 403
1634 3300048928 Ga0496125_0003504 Ga0496125_0003504_2277_3503 403
1635 3300048928 Ga0496125_0018180 Ga0496125_0018180_3704_4930 403
1636 3300048928 Ga0496125_0054870 Ga0496125_0054870_427_1653 403
1637 3300048928 Ga0496125_0133241 Ga0496125_0133241_419_1645 403
1638 3300048929 Ga0496126_0012203 Ga0496126_0012203_2482_3708 403
1639 3300048929 Ga0496126_0019511 Ga0496126_0019511_1808_3046 403
1640 3300048929 Ga0496126_0023543 Ga0496126_0023543_1212_2438 403
1641 3300048929 Ga0496126_0034632 Ga0496126_0034632_1299_2525 403
1642 3300048929 Ga0496126_0170032 Ga0496126_0170032_400_1626 403
1643 3300048929 Ga0496126_0251839 Ga0496126_0251839_187_1413 403
1644 3300048929 Ga0496126_0279475 Ga0496126_0279475_77_1303 403
1645 3300049568 Ga0501031_0002962 Ga0501031_0002962_6594_7823 403
1646 3300049569 Ga0501032_0000129 Ga0501032_0000129_30404_31633 403
1647 3300049571 Ga0501034_0000503 Ga0501034_0000503_39203_40432 403
1648 3300049572 Ga0501036_0000232 Ga0501036_0000232_9163_10392 403
1649 3300049573 Ga0501037_0000106 Ga0501037_0000106_47063_48292 403
1650 3300049574 Ga0501038_0000108 Ga0501038_0000108_11730_12959 403
1651 3300049575 Ga0501039_0003027 Ga0501039_0003027_9749_10978 403
1652 3300049578 Ga0501042_0022677 Ga0501042_0022677_2623_3852 403
1653 3300049579 Ga0501043_0000035 Ga0501043_0000035_117277_118506 403
1654 3300049580 Ga0501046_0000235 Ga0501046_0000235_17763_18992 403
1655 3300049580 Ga0501046_0128024 Ga0501046_0128024_607_1848 403
1656 3300049582 Ga0501048_0000116 Ga0501048_0000116_37743_38972 403
1657 3300049583 Ga0501067_0000160 Ga0501067_0000160_9411_10640 403
1658 3300049584 Ga0501068_0000014 Ga0501068_0000014_24459_25688 403
1659 3300049586 Ga0501070_0010549 Ga0501070_0010549_4686_5915 403
1660 3300049586 Ga0501070_0012185 Ga0501070_0012185_1999_3240 403
1661 3300049587 Ga0501071_0033623 Ga0501071_0033623_1879_3108 403
1662 3300049588 Ga0501072_0047145 Ga0501072_0047145_1596_2825 403
1663 3300049589 Ga0501073_0000417 Ga0501073_0000417_17537_18766 403
1664 3300049590 Ga0501074_0002156 Ga0501074_0002156_3095_4324 403
1665 3300049590 Ga0501074_0014111 Ga0501074_0014111_3427_4668 403
1666 3300049741 Ga0501079_0000261 Ga0501079_0000261_20814_22043 403
1667 3300049742 Ga0501080_0024764 Ga0501080_0024764_1580_2821 403
1668 3300049742 Ga0501080_0024865 Ga0501080_0024865_921_2150 403
1669 3300049744 Ga0501083_0000301 Ga0501083_0000301_9300_10529 403
1670 3300049822 Ga0501035_0000324 Ga0501035_0000324_14866_16095 403
1671 3300049823 Ga0501044_0000051 Ga0501044_0000051_111161_112390 403
1672 3300050490 nmdc:mga03n38_6491_c1 nmdc:mga03n38_6491_c1_2000_3226 403
1673 3300050492 nmdc:mga0yw44_132499_c1 nmdc:mga0yw44_132499_c1_357_1583 403
1674 3300050492 nmdc:mga0yw44_58545_c1 nmdc:mga0yw44_58545_c1_756_1982 403
1675 3300050492 nmdc:mga0yw44_65387_c1 nmdc:mga0yw44_65387_c1_308_1534 403
1676 3300050493 nmdc:mga0k408_16450_c2 nmdc:mga0k408_16450_c2_712_1938 403
1677 3300050493 nmdc:mga0k408_50969_c2 nmdc:mga0k408_50969_c2_106_1332 403
1678 3300050494 nmdc:mga06z11_18028_c1 nmdc:mga06z11_18028_c1_416_1642 403
1679 3300050494 nmdc:mga06z11_96712_c1 nmdc:mga06z11_96712_c1_275_1501 403
1680 3300050496 nmdc:mga07m45_13400_c1 nmdc:mga07m45_13400_c1_669_1895 403
1681 3300050496 nmdc:mga07m45_20941_c1 nmdc:mga07m45_20941_c1_2259_3485 403
1682 3300050507 nmdc:mga05p37_133238_c1 nmdc:mga05p37_133238_c1_1268_2494 403
1683 3300050507 nmdc:mga05p37_56222_c1 nmdc:mga05p37_56222_c1_410_1636 403
1684 3300050516 nmdc:mga0sz30_50417_c1 nmdc:mga0sz30_50417_c1_350_1576 403
1685 3300050516 nmdc:mga0sz30_5857_c1 nmdc:mga0sz30_5857_c1_2879_4105 403
1686 3300053077 Ga0495601_0028822 Ga0495601_0028822_784_2016 403
1687 3300053078 Ga0495612_0004165 Ga0495612_0004165_815_2047 403
1688 3300053080 Ga0500635_0017508 Ga0500635_0017508_670_1896 403
1689 3300053085 Ga0495619_0021997 Ga0495619_0021997_2574_3800 403
1690 3300053087 Ga0500643_000032 Ga0500643_000032_97521_98747 403
1691 3300053091 Ga0500647_0041985 Ga0500647_0041985_418_1644 403
1692 3300053094 Ga0500566_0000009 Ga0500566_0000009_13769_14995 403
1693 3300053094 Ga0500566_0002219 Ga0500566_0002219_246_1484 403
1694 3300053094 Ga0500566_0003778 Ga0500566_0003778_4309_5535 403
1695 3300053094 Ga0500566_0015610 Ga0500566_0015610_969_2195 403
1696 3300053095 Ga0500640_049776 Ga0500640_049776_20_1246 403
1697 3300053096 Ga0500641_0006701 Ga0500641_0006701_101_1327 403
1698 3300053104 Ga0500556_0001973 Ga0500556_0001973_1025_2251 403
1699 3300053111 Ga0500572_000326 Ga0500572_000326_3012_4238 403
1700 3300053119 Ga0500595_000735 Ga0500595_000735_4878_6107 403
1701 3300053119 Ga0500595_001714 Ga0500595_001714_3732_4958 403
1702 3300053123 Ga0500614_000329 Ga0500614_000329_8650_9876 403
1703 3300053130 Ga0500642_0000173 Ga0500642_0000173_2320_3546 403
1704 3300053130 Ga0500642_0018753 Ga0500642_0018753_358_1584 403
1705 3300053136 Ga0500559_0002268 Ga0500559_0002268_1141_2367 403
1706 3300053139 Ga0500568_0036451 Ga0500568_0036451_578_1804 403
1707 3300053142 Ga0500577_0038254 Ga0500577_0038254_257_1483 403
1708 3300053147 Ga0500589_011534 Ga0500589_011534_1576_2802 403
1709 3300053150 Ga0500603_000175 Ga0500603_000175_12764_13990 403
1710 3300053150 Ga0500603_000754 Ga0500603_000754_580_1806 403
1711 3300053155 Ga0500620_003626 Ga0500620_003626_48_1274 403
1712 3300053159 Ga0500630_000849 Ga0500630_000849_2473_3699 403
1713 3300053162 Ga0500638_051842 Ga0500638_051842_10_1236 403
1714 3300053163 Ga0500639_000199 Ga0500639_000199_14662_15888 403
1715 3300053177 Ga0500636_0000122 Ga0500636_0000122_34761_35987 403
1716 3300053177 Ga0500636_0071295 Ga0500636_0071295_660_1886 403
1717 3300053177 Ga0500636_0074876 Ga0500636_0074876_654_1880 403
1718 3300053177 Ga0500636_0127047 Ga0500636_0127047_64_1275 403
1719 3300053178 Ga0500637_0001163 Ga0500637_0001163_3060_4286 403
1720 3300053729 Ga0500625_007714 Ga0500625_007714_399_1640 403
1721 3300053730 Ga0500645_008570 Ga0500645_008570_1963_3189 403
1722 3300053737 Ga0500601_000509 Ga0500601_000509_4674_5912 403
1723 3300055283 Ga0500661_007104 Ga0500661_007104_268_1494 403
1724 3300059491 Ga0587070_010389 Ga0587070_010389_40_1266 403
1725 3300060353 Ga0501082_0000965 Ga0501082_0000965_793_2022 403
1726 iso_pu_bacteria 2507262055 2507508416 403
1727 iso_pu_bacteria 2508501009 2508542483 403
1728 iso_pu_bacteria 2508501042 2508691743 403
1729 iso_pu_bacteria 2508501128 2509150525 403
1730 iso_pu_bacteria 2511231028 2511400721 403
1731 iso_pu_bacteria 2513237095 2513645670 403
1732 iso_pu_bacteria 2513237102 2513701113 403
1733 iso_pu_bacteria 2513237104 2513717135 403
1734 iso_pu_bacteria 2513237139 2513872942 403
1735 iso_pu_bacteria 2515154112 2515627091 403
1736 iso_pu_bacteria 2524023205 2524437522 403
1737 iso_pu_bacteria 2528768022 2528852400 403
1738 iso_pu_bacteria 2744054633 2745076486 403
1739 iso_pu_bacteria 2791355196 2793065436 403
1740 iso_pu_bacteria 2802429603 2805915160 403
1741 iso_pu_bacteria 2816332527 2818238713 403
1742 iso_pu_bacteria 2824600985 2824604043 403
1743 iso_pu_bacteria 2824609381 2824610312 403
1744 iso_pu_bacteria 2824617872 2824617905 403
1745 iso_pu_bacteria 2824626560 2824626573 403
1746 iso_pu_bacteria 2824635225 2824638590 403
1747 iso_pu_bacteria 2824644064 2824646058 403
1748 iso_pu_bacteria 2824653114 2824658047 403
1749 iso_pu_bacteria 2824696289 2824701810 403
1750 iso_pu_bacteria 2824704595 2824708999 403
1751 iso_pu_bacteria 2824714736 2824716244 403
1752 iso_pu_bacteria 2824723954 2824726543 403
1753 iso_pu_bacteria 2824753945 2824759581 403
1754 iso_pu_bacteria 2824763712 2824770016 403
1755 iso_pu_bacteria 2842038055 2842038885 403
1756 iso_pu_bacteria 2842045827 2842048169 403
1757 iso_pu_bacteria 2847930680 2847936392 403
1758 iso_pu_bacteria 2847939898 2847946741 403
1759 iso_pu_bacteria 2849076700 2849079141 403
1760 iso_pu_bacteria 2874590934 2874598220 403
1761 iso_pu_bacteria 2874620515 2874627666 403
1762 iso_pu_bacteria 2874645413 2874652723 403
1763 iso_pu_bacteria 2876761206 2876764691 403
1764 iso_pu_bacteria 2876818435 2876825829 403
1765 iso_pu_bacteria 2879083081 2879090175 403
1766 iso_pu_bacteria 2881364244 2881368667 403
1767 iso_pu_bacteria 2881665667 2881673506 403
1768 iso_pu_bacteria 2885409591 2885411447 403
1769 iso_pu_bacteria 2888378607 2888384239 403
1770 iso_pu_bacteria 2888419890 2888424713 403
1771 iso_pu_bacteria 2904666416 2904673014 403
1772 iso_pu_bacteria 2904711408 2904714841 403
1773 iso_pu_bacteria 2906626472 2906629729 403
1774 iso_pu_bacteria 2906643746 2906649011 403
1775 iso_pu_bacteria 2929615660 2929618251 403
1776 iso_pu_bacteria 2929624759 2929632439 403
1777 iso_pu_bacteria 2933577622 2933580179 403
1778 iso_pu_bacteria 2935608549 2935609044 403
1779 iso_pu_bacteria 2935648319 2935653247 403
1780 iso_pu_bacteria 2935656913 2935660434 403
1781 iso_pu_bacteria 2935769743 2935771867 403
1782 iso_pu_bacteria 2935777560 2935778696 403
1783 iso_pu_bacteria 2935785616 2935788918 403
1784 iso_pu_bacteria 2935793552 2935795282 403
1785 iso_pu_bacteria 2935819856 2935822204 403
1786 iso_pu_bacteria 2935847175 2935847786 403
1787 iso_pu_bacteria 2935908558 2935908941 403
1788 iso_pu_bacteria 2935916978 2935919659 403
1789 iso_pu_bacteria 2935926038 2935926485 403
1790 iso_pu_bacteria 2935934488 2935934935 403
1791 iso_pu_bacteria 2935942939 2935943385 403
1792 iso_pu_bacteria 2935951376 2935951823 403
1793 iso_pu_bacteria 2935959822 2935960584 403
1794 iso_pu_bacteria 2935967501 2935967948 403
1795 iso_pu_bacteria 2935975950 2935978573 403
1796 iso_pu_bacteria 2935984226 2935987573 403
1797 iso_pu_bacteria 2936011229 2936016117 403
1798 iso_pu_bacteria 2936019824 2936024750 403
1799 iso_pu_bacteria 2936028420 2936031846 403
1800 iso_pu_bacteria 2936046547 2936049707 403
1801 iso_pu_bacteria 2936055302 2936060811 403
1802 iso_pu_bacteria 3005710791 3005715067 403
1803 iso_pu_bacteria 8016539877 8016547873 403
1804 iso_pu_bacteria 8016548790 8016554261 403
1805 iso_pu_bacteria 8016557553 8016562635 403
1806 iso_pu_bacteria 8016575299 8016577151 403
1807 iso_pu_bacteria 8016583857 8016591556 403
1808 iso_pu_bacteria 8016595262 8016600419 403
1809 iso_pu_bacteria 8016603502 8016610319 403
1810 iso_pu_bacteria 8016613128 8016614612 403
1811 iso_pu_bacteria 8016622563 8016626386 403
1812 iso_pu_bacteria 8016630954 8016640145 403
1813 iso_pu_bacteria 8019530166 8019534419 403
1814 iso_pu_bacteria 8019538911 8019545050 403
1815 iso_pu_bacteria 8019547302 8019553477 403
1816 iso_pu_bacteria 8019619141 8019628358 403
1817 iso_pu_bacteria 8019638758 8019645463 403
1818 iso_pu_bacteria 8019659431 8019662147 403
1819 iso_pu_bacteria 8019668869 8019671662 403
1820 iso_pu_bacteria 8019678201 8019684437 403
1821 iso_pu_bacteria 8019687851 8019690247 403
1822 iso_pu_bacteria 8055742211 8055746160 403
1823 3300003203 JGI25406J46586_10015609 JGI25406J46586_100156094 404
1824 3300005336 Ga0070680_100018006 Ga0070680_1000180062 404
1825 3300005337 Ga0070682_100015659 Ga0070682_1000156592 404
1826 3300005458 Ga0070681_10054701 Ga0070681_100547012 404
1827 3300005563 Ga0068855_100152792 Ga0068855_1001527922 404
1828 3300005985 Ga0081539_10000423 Ga0081539_1000042325 404
1829 3300005985 Ga0081539_10001457 Ga0081539_1000145738 404
1830 3300009174 Ga0105241_10011171 Ga0105241_100111716 404
1831 3300025911 Ga0207654_10012132 Ga0207654_100121322 404
1832 3300025912 Ga0207707_10004014 Ga0207707_100040146 404
1833 3300025917 Ga0207660_10045952 Ga0207660_100459522 404
1834 3300025921 Ga0207652_10034932 Ga0207652_100349323 404
1835 3300035724 Ga0373933_0001755 Ga0373933_0001755_11094_12455 404
1836 3300046463 Ga0495653_0004234 Ga0495653_0004234_10239_11600 404
1837 3300046511 Ga0495608_0020761 Ga0495608_0020761_1919_3280 404
1838 3300046533 Ga0495640_0018041 Ga0495640_0018041_1395_2627 404
1839 3300046559 Ga0495667_0008195 Ga0495667_0008195_1112_2473 404
1840 3300046642 Ga0495634_0017869 Ga0495634_0017869_1169_2530 404
1841 3300046678 Ga0495599_0000421 Ga0495599_0000421_22850_24211 404
1842 3300046689 Ga0495613_0028367 Ga0495613_0028367_334_1695 404
1843 3300047322 Ga0495680_0004264 Ga0495680_0004264_28_1389 404
1844 3300047471 Ga0495684_0001579 Ga0495684_0001579_3226_4587 404
1845 3300047673 Ga0495593_0004346 Ga0495593_0004346_6069_7430 404
1846 3300053085 Ga0495619_0000176 Ga0495619_0000176_2706_4067 404
1847 3300003203 JGI25406J46586_10000047 JGI25406J46586_1000004740 405
1848 3300005334 Ga0068869_100078244 Ga0068869_1000782442 405
1849 3300005334 Ga0068869_100217356 Ga0068869_1002173562 405
1850 3300005354 Ga0070675_100128068 Ga0070675_1001280682 405
1851 3300005356 Ga0070674_100120886 Ga0070674_1001208862 405
1852 3300005365 Ga0070688_100048956 Ga0070688_1000489563 405
1853 3300005434 Ga0070709_10084828 Ga0070709_100848281 405
1854 3300005435 Ga0070714_100040248 Ga0070714_1000402482 405
1855 3300005436 Ga0070713_100015728 Ga0070713_1000157285 405
1856 3300005439 Ga0070711_100000566 Ga0070711_10000056618 405
1857 3300005441 Ga0070700_100143850 Ga0070700_1001438502 405
1858 3300005456 Ga0070678_100086598 Ga0070678_1000865982 405
1859 3300005456 Ga0070678_100180985 Ga0070678_1001809852 405
1860 3300005548 Ga0070665_100077795 Ga0070665_1000777953 405
1861 3300005617 Ga0068859_100160203 Ga0068859_1001602033 405
1862 3300005842 Ga0068858_100333229 Ga0068858_1003332291 405
1863 3300005983 Ga0081540_1000979 Ga0081540_100097928 405
1864 3300005985 Ga0081539_10000140 Ga0081539_1000014093 405
1865 3300006028 Ga0070717_10004040 Ga0070717_100040405 405
1866 3300006048 Ga0075363_100082840 Ga0075363_1000828402 405
1867 3300006175 Ga0070712_100000721 Ga0070712_1000007218 405
1868 3300006881 Ga0068865_100080168 Ga0068865_1000801682 405
1869 3300006931 Ga0097620_100160199 Ga0097620_1001601992 405
1870 3300009101 Ga0105247_10110734 Ga0105247_101107342 405
1871 3300013297 Ga0157378_10010352 Ga0157378_100103523 405
1872 3300017792 Ga0163161_10089270 Ga0163161_100892702 405
1873 3300025295 Ga0209564_1003012 Ga0209564_100301215 405
1874 3300025901 Ga0207688_10050156 Ga0207688_100501562 405
1875 3300025904 Ga0207647_10063221 Ga0207647_100632211 405
1876 3300025914 Ga0207671_10052004 Ga0207671_100520043 405
1877 3300025915 Ga0207693_10001226 Ga0207693_1000122613 405
1878 3300025916 Ga0207663_10002632 Ga0207663_100026325 405
1879 3300025927 Ga0207687_10118367 Ga0207687_101183672 405
1880 3300025928 Ga0207700_10043564 Ga0207700_100435642 405
1881 3300025929 Ga0207664_10100541 Ga0207664_101005412 405
1882 3300025935 Ga0207709_10117562 Ga0207709_101175622 405
1883 3300025937 Ga0207669_10065085 Ga0207669_100650852 405
1884 3300025938 Ga0207704_10053582 Ga0207704_100535823 405
1885 3300025939 Ga0207665_10055356 Ga0207665_100553562 405
1886 3300026023 Ga0207677_10044918 Ga0207677_100449182 405
1887 3300026118 Ga0207675_100133127 Ga0207675_1001331272 405
1888 3300026121 Ga0207683_10019699 Ga0207683_100196995 405
1889 3300027512 Ga0209179_1007355 Ga0209179_10073552 405
1890 3300028379 Ga0268266_10094186 Ga0268266_100941862 405
1891 3300028380 Ga0268265_10036239 Ga0268265_100362392 405
1892 3300028786 Ga0307517_10011552 Ga0307517_1001155210 405
1893 3300028794 Ga0307515_10243880 Ga0307515_102438802 405
1894 3300031456 Ga0307513_10220710 Ga0307513_102207102 405
1895 3300031616 Ga0307508_10044235 Ga0307508_100442353 405
1896 3300031616 Ga0307508_10076621 Ga0307508_100766212 405
1897 3300031730 Ga0307516_10002828 Ga0307516_1000282818 405
1898 3300031730 Ga0307516_10005403 Ga0307516_1000540313 405
1899 3300031730 Ga0307516_10044284 Ga0307516_100442843 405
1900 3300031730 Ga0307516_10052133 Ga0307516_100521333 405
1901 3300031730 Ga0307516_10078013 Ga0307516_100780133 405
1902 3300032002 Ga0307416_100048634 Ga0307416_1000486342 405
1903 3300032004 Ga0307414_10196208 Ga0307414_101962081 405
1904 3300033180 Ga0307510_10005184 Ga0307510_100051844 405
1905 3300047321 Ga0495676_0185413 Ga0495676_0185413_10_1227 405
1906 3300048910 Ga0496107_0188217 Ga0496107_0188217_82_1299 405
1907 3300048911 Ga0496108_0327267 Ga0496108_0327267_73_1290 405
1908 3300048926 Ga0496123_0059734 Ga0496123_0059734_895_2112 405
1909 3300048929 Ga0496126_0092699 Ga0496126_0092699_158_1375 405
1910 3300049572 Ga0501036_0081321 Ga0501036_0081321_1447_2664 405
1911 3300049578 Ga0501042_0039520 Ga0501042_0039520_922_2139 405
1912 3300050511 nmdc:mga08y16_111404_c1 nmdc:mga08y16_111404_c1_1447_2664 405
1913 3300053077 Ga0495601_0131066 Ga0495601_0131066_179_1396 405
1914 3300053085 Ga0495619_0007164 Ga0495619_0007164_96_1313 405
1915 3300053094 Ga0500566_0019346 Ga0500566_0019346_2744_3961 405
1916 3300053119 Ga0500595_000480 Ga0500595_000480_19607_20824 405
1917 3300053162 Ga0500638_000252 Ga0500638_000252_3204_4421 405
1918 3300053178 Ga0500637_0000142 Ga0500637_0000142_12077_13294 405
1919 3300055283 Ga0500661_001246 Ga0500661_001246_1378_2595 405
1920 3300003203 JGI25406J46586_10011634 JGI25406J46586_100116341 406
1921 3300003215 JGI25153J46596_10000767 JGI25153J46596_1000076716 406
1922 3300003215 JGI25153J46596_10011019 JGI25153J46596_100110193 406
1923 3300003659 JGI25404J52841_10011788 JGI25404J52841_100117882 406
1924 3300003659 JGI25404J52841_10016974 JGI25404J52841_100169741 406
1925 3300005262 Ga0065165_1011649 Ga0065165_10116493 406
1926 3300005335 Ga0070666_10156910 Ga0070666_101569101 406
1927 3300005336 Ga0070680_100001711 Ga0070680_1000017113 406
1928 3300005336 Ga0070680_100049897 Ga0070680_1000498973 406
1929 3300005339 Ga0070660_100109780 Ga0070660_1001097802 406
1930 3300005339 Ga0070660_100226163 Ga0070660_1002261631 406
1931 3300005339 Ga0070660_100266697 Ga0070660_1002666971 406
1932 3300005341 Ga0070691_10078724 Ga0070691_100787242 406
1933 3300005344 Ga0070661_100051071 Ga0070661_1000510713 406
1934 3300005347 Ga0070668_100095175 Ga0070668_1000951752 406
1935 3300005347 Ga0070668_100169920 Ga0070668_1001699202 406
1936 3300005366 Ga0070659_100009498 Ga0070659_1000094983 406
1937 3300005366 Ga0070659_100055803 Ga0070659_1000558032 406
1938 3300005435 Ga0070714_100033046 Ga0070714_1000330462 406
1939 3300005435 Ga0070714_100055472 Ga0070714_1000554723 406
1940 3300005445 Ga0070708_100043098 Ga0070708_1000430982 406
1941 3300005455 Ga0070663_100005434 Ga0070663_1000054342 406
1942 3300005455 Ga0070663_100083288 Ga0070663_1000832883 406
1943 3300005456 Ga0070678_100146943 Ga0070678_1001469431 406
1944 3300005458 Ga0070681_10042460 Ga0070681_100424605 406
1945 3300005458 Ga0070681_10212702 Ga0070681_102127021 406
1946 3300005530 Ga0070679_100206005 Ga0070679_1002060052 406
1947 3300005535 Ga0070684_100040713 Ga0070684_1000407134 406
1948 3300005535 Ga0070684_100157478 Ga0070684_1001574782 406
1949 3300005539 Ga0068853_100014456 Ga0068853_1000144566 406
1950 3300005539 Ga0068853_100016544 Ga0068853_1000165444 406
1951 3300005539 Ga0068853_100123466 Ga0068853_1001234662 406
1952 3300005548 Ga0070665_100052425 Ga0070665_1000524252 406
1953 3300005548 Ga0070665_100178559 Ga0070665_1001785592 406
1954 3300005563 Ga0068855_100025903 Ga0068855_1000259033 406
1955 3300005563 Ga0068855_100027404 Ga0068855_1000274042 406
1956 3300005578 Ga0068854_100159820 Ga0068854_1001598202 406
1957 3300005614 Ga0068856_100281841 Ga0068856_1002818412 406
1958 3300005616 Ga0068852_100009344 Ga0068852_1000093446 406
1959 3300005616 Ga0068852_100015291 Ga0068852_1000152918 406
1960 3300005616 Ga0068852_100217465 Ga0068852_1002174652 406
1961 3300005616 Ga0068852_100234016 Ga0068852_1002340162 406
1962 3300005719 Ga0068861_100129684 Ga0068861_1001296842 406
1963 3300005842 Ga0068858_100122486 Ga0068858_1001224862 406
1964 3300005844 Ga0068862_100185231 Ga0068862_1001852311 406
1965 3300005844 Ga0068862_100222708 Ga0068862_1002227082 406
1966 3300005844 Ga0068862_100293704 Ga0068862_1002937042 406
1967 3300005937 Ga0081455_10001796 Ga0081455_100017967 406
1968 3300005937 Ga0081455_10007694 Ga0081455_100076941 406
1969 3300005937 Ga0081455_10056843 Ga0081455_100568432 406
1970 3300005937 Ga0081455_10166935 Ga0081455_101669351 406
1971 3300005981 Ga0081538_10051228 Ga0081538_100512282 406
1972 3300005983 Ga0081540_1000430 Ga0081540_100043044 406
1973 3300005983 Ga0081540_1002120 Ga0081540_10021207 406
1974 3300005983 Ga0081540_1004971 Ga0081540_10049716 406
1975 3300005983 Ga0081540_1030591 Ga0081540_10305913 406
1976 3300005983 Ga0081540_1034270 Ga0081540_10342703 406
1977 3300005983 Ga0081540_1035864 Ga0081540_10358643 406
1978 3300005983 Ga0081540_1059102 Ga0081540_10591022 406
1979 3300005983 Ga0081540_1065898 Ga0081540_10658982 406
1980 3300005985 Ga0081539_10001457 Ga0081539_1000145718 406
1981 3300005985 Ga0081539_10016652 Ga0081539_100166526 406
1982 3300005985 Ga0081539_10044785 Ga0081539_100447851 406
1983 3300006038 Ga0075365_10030380 Ga0075365_100303802 406
1984 3300006038 Ga0075365_10066431 Ga0075365_100664313 406
1985 3300006038 Ga0075365_10142797 Ga0075365_101427972 406
1986 3300006042 Ga0075368_10038842 Ga0075368_100388422 406
1987 3300006195 Ga0075366_10080724 Ga0075366_100807242 406
1988 3300006844 Ga0075428_100056741 Ga0075428_1000567413 406
1989 3300007265 Ga0099794_10016781 Ga0099794_100167813 406
1990 3300009093 Ga0105240_10002078 Ga0105240_1000207825 406
1991 3300009093 Ga0105240_10073858 Ga0105240_100738583 406
1992 3300009093 Ga0105240_10249402 Ga0105240_102494022 406
1993 3300009098 Ga0105245_10143359 Ga0105245_101433592 406
1994 3300009148 Ga0105243_10362515 Ga0105243_103625151 406
1995 3300009174 Ga0105241_10076695 Ga0105241_100766952 406
1996 3300009545 Ga0105237_10047336 Ga0105237_100473363 406
1997 3300009551 Ga0105238_10040037 Ga0105238_100400373 406
1998 3300009551 Ga0105238_10233232 Ga0105238_102332321 406
1999 3300010375 Ga0105239_10009271 Ga0105239_1000927111 406
2000 3300010375 Ga0105239_10049782 Ga0105239_100497823 406
2001 3300010375 Ga0105239_10165128 Ga0105239_101651282 406
2002 3300010375 Ga0105239_10289133 Ga0105239_102891332 406
2003 3300011119 Ga0105246_10003677 Ga0105246_100036776 406
2004 3300013105 Ga0157369_10003343 Ga0157369_100033433 406
2005 3300013105 Ga0157369_10047137 Ga0157369_100471372 406
2006 3300013297 Ga0157378_10203353 Ga0157378_102033532 406
2007 3300013306 Ga0163162_10298978 Ga0163162_102989782 406
2008 3300013307 Ga0157372_10305280 Ga0157372_103052802 406
2009 3300013307 Ga0157372_10337132 Ga0157372_103371322 406
2010 3300013308 Ga0157375_10543501 Ga0157375_105435011 406
2011 3300014325 Ga0163163_10023786 Ga0163163_100237862 406
2012 3300014497 Ga0182008_10109937 Ga0182008_101099371 406
2013 3300014969 Ga0157376_10008383 Ga0157376_100083837 406
2014 3300021320 Ga0214544_1000002 Ga0214544_1000002256 406
2015 3300021321 Ga0214542_1000001 Ga0214542_1000001606 406
2016 3300021324 Ga0214545_1000001 Ga0214545_1000001672 406
2017 3300021327 Ga0214543_1000001 Ga0214543_1000001523 406
2018 3300025230 Ga0209563_100864 Ga0209563_1008643 406
2019 3300025253 Ga0209677_104828 Ga0209677_1048281 406
2020 3300025254 Ga0209148_1000841 Ga0209148_100084110 406
2021 3300025261 Ga0209233_1001871 Ga0209233_10018712 406
2022 3300025272 Ga0209455_1003926 Ga0209455_10039265 406
2023 3300025295 Ga0209564_1003012 Ga0209564_100301214 406
2024 3300025297 Ga0209758_1000164 Ga0209758_100016418 406
2025 3300025297 Ga0209758_1002251 Ga0209758_10022512 406
2026 3300025297 Ga0209758_1002853 Ga0209758_100285313 406
2027 3300025297 Ga0209758_1003241 Ga0209758_100324113 406
2028 3300025302 Ga0207426_1000822 Ga0207426_100082238 406
2029 3300025321 Ga0207656_10027596 Ga0207656_100275962 406
2030 3300025901 Ga0207688_10096000 Ga0207688_100960002 406
2031 3300025904 Ga0207647_10025278 Ga0207647_100252782 406
2032 3300025909 Ga0207705_10035725 Ga0207705_100357253 406
2033 3300025911 Ga0207654_10012820 Ga0207654_100128202 406
2034 3300025912 Ga0207707_10002327 Ga0207707_100023277 406
2035 3300025912 Ga0207707_10035480 Ga0207707_100354805 406
2036 3300025912 Ga0207707_10215459 Ga0207707_102154591 406
2037 3300025913 Ga0207695_10000910 Ga0207695_1000091020 406
2038 3300025913 Ga0207695_10069051 Ga0207695_100690514 406
2039 3300025913 Ga0207695_10073106 Ga0207695_100731064 406
2040 3300025913 Ga0207695_10293540 Ga0207695_102935402 406
2041 3300025914 Ga0207671_10006943 Ga0207671_100069432 406
2042 3300025914 Ga0207671_10025479 Ga0207671_100254793 406
2043 3300025915 Ga0207693_10057257 Ga0207693_100572571 406
2044 3300025916 Ga0207663_10220692 Ga0207663_102206921 406
2045 3300025918 Ga0207662_10101648 Ga0207662_101016482 406
2046 3300025919 Ga0207657_10008747 Ga0207657_100087476 406
2047 3300025919 Ga0207657_10016670 Ga0207657_100166703 406
2048 3300025920 Ga0207649_10044696 Ga0207649_100446963 406
2049 3300025924 Ga0207694_10280143 Ga0207694_102801431 406
2050 3300025927 Ga0207687_10138239 Ga0207687_101382392 406
2051 3300025929 Ga0207664_10027649 Ga0207664_100276492 406
2052 3300025929 Ga0207664_10042081 Ga0207664_100420812 406
2053 3300025935 Ga0207709_10191009 Ga0207709_101910091 406
2054 3300025940 Ga0207691_10110729 Ga0207691_101107292 406
2055 3300025944 Ga0207661_10006099 Ga0207661_1000609910 406
2056 3300025945 Ga0207679_10211546 Ga0207679_102115462 406
2057 3300025949 Ga0207667_10016633 Ga0207667_100166331 406
2058 3300025949 Ga0207667_10060098 Ga0207667_100600982 406
2059 3300025972 Ga0207668_10030484 Ga0207668_100304842 406
2060 3300026035 Ga0207703_10067369 Ga0207703_100673691 406
2061 3300026035 Ga0207703_10282785 Ga0207703_102827851 406
2062 3300026041 Ga0207639_10034004 Ga0207639_100340044 406
2063 3300026041 Ga0207639_10249787 Ga0207639_102497872 406
2064 3300026067 Ga0207678_10007352 Ga0207678_100073528 406
2065 3300026067 Ga0207678_10054731 Ga0207678_100547312 406
2066 3300026067 Ga0207678_10122698 Ga0207678_101226982 406
2067 3300026067 Ga0207678_10232846 Ga0207678_102328462 406
2068 3300026078 Ga0207702_10253604 Ga0207702_102536042 406
2069 3300026089 Ga0207648_10139548 Ga0207648_101395482 406
2070 3300026095 Ga0207676_10090780 Ga0207676_100907802 406
2071 3300026095 Ga0207676_10173041 Ga0207676_101730411 406
2072 3300026116 Ga0207674_10009531 Ga0207674_100095316 406
2073 3300026116 Ga0207674_10322592 Ga0207674_103225922 406
2074 3300026118 Ga0207675_100120126 Ga0207675_1001201262 406
2075 3300026118 Ga0207675_100292939 Ga0207675_1002929391 406
2076 3300026121 Ga0207683_10110859 Ga0207683_101108592 406
2077 3300026121 Ga0207683_10277308 Ga0207683_102773081 406
2078 3300026142 Ga0207698_10015437 Ga0207698_100154373 406
2079 3300026142 Ga0207698_10102070 Ga0207698_101020702 406
2080 3300027357 Ga0209589_1000001 Ga0209589_100000180 406
2081 3300027361 Ga0209489_100001 Ga0209489_10000180 406
2082 3300027363 Ga0209700_100001 Ga0209700_10000180 406
2083 3300027671 Ga0209588_1004305 Ga0209588_10043052 406
2084 3300028379 Ga0268266_10003390 Ga0268266_1000339017 406
2085 3300028379 Ga0268266_10034718 Ga0268266_100347184 406
2086 3300028379 Ga0268266_10143239 Ga0268266_101432392 406
2087 3300028379 Ga0268266_10165099 Ga0268266_101650992 406
2088 3300028381 Ga0268264_10141726 Ga0268264_101417262 406
2089 3300031507 Ga0307509_10093588 Ga0307509_100935882 406
2090 3300033180 Ga0307510_10052336 Ga0307510_100523362 406
2091 3300033180 Ga0307510_10063180 Ga0307510_100631804 406
2092 3300033180 Ga0307510_10064293 Ga0307510_100642933 406
2093 3300033442 Ga0315911_1000006 Ga0315911_100000611 406
2094 3300035113 Ga0373936_0012550 Ga0373936_0012550_1002_2222 406
2095 3300035117 Ga0373953_0060402 Ga0373953_0060402_28_1248 406
2096 3300035118 Ga0373954_0011301 Ga0373954_0011301_1335_2555 406
2097 3300035119 Ga0373956_0023481 Ga0373956_0023481_703_1923 406
2098 3300035120 Ga0373957_0010573 Ga0373957_0010573_1802_3022 406
2099 3300035170 Ga0373943_0059921 Ga0373943_0059921_257_1477 406
2100 3300035172 Ga0373955_0035358 Ga0373955_0035358_1400_2620 406
2101 3300035692 Ga0373935_0000602 Ga0373935_0000602_16357_17577 406
2102 3300035692 Ga0373935_0051822 Ga0373935_0051822_273_1493 406
2103 3300035695 Ga0373927_0000069 Ga0373927_0000069_54305_55525 406
2104 3300035695 Ga0373927_0008315 Ga0373927_0008315_505_1725 406
2105 3300035695 Ga0373927_0009820 Ga0373927_0009820_4298_5518 406
2106 3300035695 Ga0373927_0108626 Ga0373927_0108626_45_1265 406
2107 3300035724 Ga0373933_0009054 Ga0373933_0009054_2052_3272 406
2108 3300035724 Ga0373933_0080933 Ga0373933_0080933_383_1603 406
2109 3300035725 Ga0373947_0000385 Ga0373947_0000385_12917_14137 406
2110 3300035725 Ga0373947_0024081 Ga0373947_0024081_1127_2347 406
2111 3300035725 Ga0373947_0042886 Ga0373947_0042886_1155_2375 406
2112 3300036401 Ga0373937_0038193 Ga0373937_0038193_760_1980 406
2113 3300036401 Ga0373937_0076440 Ga0373937_0076440_731_1951 406
2114 3300037068 Ga0373925_0023950 Ga0373925_0023950_1502_2722 406
2115 3300037068 Ga0373925_0093009 Ga0373925_0093009_136_1356 406
2116 3300037312 Ga0395899_0051385 Ga0395899_0051385_1708_2934 406
2117 3300037418 Ga0395900_0008437 Ga0395900_0008437_9360_10586 406
2118 3300037418 Ga0395900_0019170 Ga0395900_0019170_5728_6948 406
2119 3300037418 Ga0395900_0057396 Ga0395900_0057396_2364_3593 406
2120 3300037418 Ga0395900_0125874 Ga0395900_0125874_583_1812 406
2121 3300037466 Ga0395898_0136444 Ga0395898_0136444_205_1425 406
2122 3300037466 Ga0395898_0142442 Ga0395898_0142442_312_1541 406
2123 3300037853 Ga0436364_0794198 Ga0436364_0794198_250_1470 406
2124 3300038443 Ga0395901_0029033 Ga0395901_0029033_1607_2833 406
2125 3300038443 Ga0395901_0131762 Ga0395901_0131762_731_1960 406
2126 3300038443 Ga0395901_0239417 Ga0395901_0239417_506_1735 406
2127 3300038443 Ga0395901_0240634 Ga0395901_0240634_646_1866 406
2128 3300044684 Ga0466966_0016313 Ga0466966_0016313_2459_3679 406
2129 3300044694 Ga0466963_0035708 Ga0466963_0035708_252_1472 406
2130 3300044694 Ga0466963_0116741 Ga0466963_0116741_155_1375 406
2131 3300045976 Ga0466967_0024787 Ga0466967_0024787_339_1559 406
2132 3300046454 Ga0495592_0047310 Ga0495592_0047310_1012_2232 406
2133 3300046454 Ga0495592_0057851 Ga0495592_0057851_409_1629 406
2134 3300046455 Ga0495603_0000429 Ga0495603_0000429_18573_19793 406
2135 3300046455 Ga0495603_0017980 Ga0495603_0017980_2019_3239 406
2136 3300046455 Ga0495603_0041717 Ga0495603_0041717_704_1924 406
2137 3300046455 Ga0495603_0058221 Ga0495603_0058221_396_1616 406
2138 3300046459 Ga0495629_0000083 Ga0495629_0000083_63241_64461 406
2139 3300046460 Ga0495638_0019634 Ga0495638_0019634_1127_2347 406
2140 3300046460 Ga0495638_0052980 Ga0495638_0052980_663_1886 406
2141 3300046460 Ga0495638_0110496 Ga0495638_0110496_153_1373 406
2142 3300046461 Ga0495641_0062784 Ga0495641_0062784_386_1606 406
2143 3300046462 Ga0495651_0040157 Ga0495651_0040157_905_2125 406
2144 3300046463 Ga0495653_0034425 Ga0495653_0034425_92_1312 406
2145 3300046472 Ga0495580_0000716 Ga0495580_0000716_9711_10931 406
2146 3300046473 Ga0495582_0000094 Ga0495582_0000094_33916_35136 406
2147 3300046475 Ga0495639_0000150 Ga0495639_0000150_15540_16760 406
2148 3300046476 Ga0495662_0000080 Ga0495662_0000080_6730_7950 406
2149 3300046491 Ga0495584_0061875 Ga0495584_0061875_373_1593 406
2150 3300046491 Ga0495584_0092153 Ga0495584_0092153_230_1450 406
2151 3300046499 Ga0495594_0001874 Ga0495594_0001874_1125_2345 406
2152 3300046507 Ga0495606_0002520 Ga0495606_0002520_12297_13517 406
2153 3300046507 Ga0495606_0049185 Ga0495606_0049185_1493_2713 406
2154 3300046511 Ga0495608_0037629 Ga0495608_0037629_1071_2291 406
2155 3300046514 Ga0495618_0026652 Ga0495618_0026652_332_1552 406
2156 3300046514 Ga0495618_0092429 Ga0495618_0092429_24_1244 406
2157 3300046515 Ga0495620_0052979 Ga0495620_0052979_16_1239 406
2158 3300046516 Ga0495628_0064553 Ga0495628_0064553_348_1568 406
2159 3300046516 Ga0495628_0228721 Ga0495628_0228721_131_1351 406
2160 3300046517 Ga0495630_0003796 Ga0495630_0003796_8656_9876 406
2161 3300046520 Ga0495637_0045179 Ga0495637_0045179_420_1640 406
2162 3300046524 Ga0495648_0039534 Ga0495648_0039534_1754_2974 406
2163 3300046525 Ga0495663_0042220 Ga0495663_0042220_141_1361 406
2164 3300046529 Ga0495652_0110898 Ga0495652_0110898_821_2041 406
2165 3300046530 Ga0495654_0044567 Ga0495654_0044567_836_2059 406
2166 3300046531 Ga0495665_0003088 Ga0495665_0003088_4209_5429 406
2167 3300046533 Ga0495640_0025555 Ga0495640_0025555_1059_2279 406
2168 3300046533 Ga0495640_0031230 Ga0495640_0031230_76_1296 406
2169 3300046536 Ga0495587_0017472 Ga0495587_0017472_2135_3355 406
2170 3300046536 Ga0495587_0080594 Ga0495587_0080594_648_1868 406
2171 3300046539 Ga0495621_0031684 Ga0495621_0031684_434_1654 406
2172 3300046543 Ga0495645_0020048 Ga0495645_0020048_2367_3587 406
2173 3300046557 Ga0495622_0001916 Ga0495622_0001916_1497_2717 406
2174 3300046557 Ga0495622_0050528 Ga0495622_0050528_40_1260 406
2175 3300046557 Ga0495622_0068828 Ga0495622_0068828_364_1584 406
2176 3300046616 Ga0495668_0107575 Ga0495668_0107575_65_1285 406
2177 3300046616 Ga0495668_0138146 Ga0495668_0138146_93_1313 406
2178 3300046642 Ga0495634_0002836 Ga0495634_0002836_4341_5561 406
2179 3300046660 Ga0495625_0104872 Ga0495625_0104872_679_1902 406
2180 3300046663 Ga0495635_0001333 Ga0495635_0001333_4753_5973 406
2181 3300046665 Ga0495661_0050951 Ga0495661_0050951_1154_2374 406
2182 3300046674 Ga0495588_0029437 Ga0495588_0029437_618_1838 406
2183 3300046674 Ga0495588_0034106 Ga0495588_0034106_1091_2311 406
2184 3300046675 Ga0495657_0036819 Ga0495657_0036819_306_1526 406
2185 3300046678 Ga0495599_0082341 Ga0495599_0082341_105_1325 406
2186 3300046679 Ga0495623_0007010 Ga0495623_0007010_2454_3674 406
2187 3300046680 Ga0495646_0019582 Ga0495646_0019582_1725_2945 406
2188 3300046680 Ga0495646_0070124 Ga0495646_0070124_589_1809 406
2189 3300046681 Ga0495647_0002127 Ga0495647_0002127_458_1678 406
2190 3300046683 Ga0495658_0001408 Ga0495658_0001408_9833_11053 406
2191 3300046689 Ga0495613_0056346 Ga0495613_0056346_41_1261 406
2192 3300046690 Ga0495624_0000786 Ga0495624_0000786_4516_5736 406
2193 3300046690 Ga0495624_0042731 Ga0495624_0042731_1446_2666 406
2194 3300046691 Ga0495670_0034442 Ga0495670_0034442_1177_2400 406
2195 3300046691 Ga0495670_0104087 Ga0495670_0104087_200_1420 406
2196 3300046809 Ga0495600_0012843 Ga0495600_0012843_1615_2835 406
2197 3300046809 Ga0495600_0159146 Ga0495600_0159146_91_1311 406
2198 3300047315 Ga0495581_0000095 Ga0495581_0000095_10554_11774 406
2199 3300047317 Ga0495604_0024712 Ga0495604_0024712_349_1569 406
2200 3300047317 Ga0495604_0066064 Ga0495604_0066064_782_2002 406
2201 3300047317 Ga0495604_0138526 Ga0495604_0138526_478_1698 406
2202 3300047319 Ga0495674_0001326 Ga0495674_0001326_4346_5566 406
2203 3300047319 Ga0495674_0099667 Ga0495674_0099667_676_1896 406
2204 3300047320 Ga0495672_0029155 Ga0495672_0029155_806_2026 406
2205 3300047471 Ga0495684_0089076 Ga0495684_0089076_385_1605 406
2206 3300047472 Ga0495686_0104291 Ga0495686_0104291_187_1410 406
2207 3300047673 Ga0495593_0000531 Ga0495593_0000531_3399_4619 406
2208 3300048088 Ga0495602_0061680 Ga0495602_0061680_821_2041 406
2209 3300048089 Ga0495614_0008512 Ga0495614_0008512_1500_2720 406
2210 3300048091 Ga0495626_0079765 Ga0495626_0079765_195_1415 406
2211 3300048904 Ga0496101_0112214 Ga0496101_0112214_822_2042 406
2212 3300048905 Ga0496102_0014728 Ga0496102_0014728_4791_6011 406
2213 3300048905 Ga0496102_0056044 Ga0496102_0056044_1582_2802 406
2214 3300048907 Ga0496104_0007294 Ga0496104_0007294_840_2060 406
2215 3300048907 Ga0496104_0020552 Ga0496104_0020552_3081_4301 406
2216 3300048907 Ga0496104_0305797 Ga0496104_0305797_270_1490 406
2217 3300048908 Ga0496105_0003408 Ga0496105_0003408_3805_5025 406
2218 3300048909 Ga0496106_0127378 Ga0496106_0127378_138_1358 406
2219 3300048910 Ga0496107_0053387 Ga0496107_0053387_449_1669 406
2220 3300048910 Ga0496107_0098347 Ga0496107_0098347_676_1896 406
2221 3300048911 Ga0496108_0036356 Ga0496108_0036356_69_1289 406
2222 3300048911 Ga0496108_0160188 Ga0496108_0160188_173_1393 406
2223 3300048911 Ga0496108_0178103 Ga0496108_0178103_416_1636 406
2224 3300048912 Ga0496109_0032449 Ga0496109_0032449_962_2182 406
2225 3300048912 Ga0496109_0154347 Ga0496109_0154347_554_1774 406
2226 3300048913 Ga0496110_0233224 Ga0496110_0233224_260_1480 406
2227 3300048914 Ga0496111_0066009 Ga0496111_0066009_827_2047 406
2228 3300048915 Ga0496112_0000004 Ga0496112_0000004_237456_238676 406
2229 3300048915 Ga0496112_0079666 Ga0496112_0079666_68_1288 406
2230 3300048915 Ga0496112_0104503 Ga0496112_0104503_1547_2767 406
2231 3300048915 Ga0496112_0132785 Ga0496112_0132785_575_1795 406
2232 3300048915 Ga0496112_0207383 Ga0496112_0207383_377_1597 406
2233 3300048916 Ga0496113_0145583 Ga0496113_0145583_73_1293 406
2234 3300048917 Ga0496114_0085349 Ga0496114_0085349_137_1357 406
2235 3300048918 Ga0496115_0096715 Ga0496115_0096715_1163_2383 406
2236 3300048919 Ga0496116_0027209 Ga0496116_0027209_1595_2815 406
2237 3300048919 Ga0496116_0027209 Ga0496116_0027209_2853_4076 406
2238 3300048919 Ga0496116_0045503 Ga0496116_0045503_210_1430 406
2239 3300048920 Ga0496117_0165819 Ga0496117_0165819_35_1258 406
2240 3300048921 Ga0496118_0016895 Ga0496118_0016895_3177_4397 406
2241 3300048921 Ga0496118_0100933 Ga0496118_0100933_523_1746 406
2242 3300048921 Ga0496118_0131137 Ga0496118_0131137_326_1549 406
2243 3300048922 Ga0496119_0020237 Ga0496119_0020237_321_1541 406
2244 3300048922 Ga0496119_0104706 Ga0496119_0104706_243_1466 406
2245 3300048923 Ga0496120_0040496 Ga0496120_0040496_1168_2388 406
2246 3300048924 Ga0496121_0007499 Ga0496121_0007499_2575_3795 406
2247 3300048924 Ga0496121_0026412 Ga0496121_0026412_3878_5098 406
2248 3300048924 Ga0496121_0041760 Ga0496121_0041760_1357_2577 406
2249 3300048924 Ga0496121_0041760 Ga0496121_0041760_2615_3838 406
2250 3300048924 Ga0496121_0081235 Ga0496121_0081235_234_1454 406
2251 3300048924 Ga0496121_0093945 Ga0496121_0093945_626_1876 406
2252 3300048924 Ga0496121_0137266 Ga0496121_0137266_291_1511 406
2253 3300048924 Ga0496121_0156348 Ga0496121_0156348_80_1303 406
2254 3300048925 Ga0496122_0040041 Ga0496122_0040041_2044_3264 406
2255 3300048925 Ga0496122_0068684 Ga0496122_0068684_123_1346 406
2256 3300048925 Ga0496122_0107191 Ga0496122_0107191_240_1463 406
2257 3300048926 Ga0496123_0051156 Ga0496123_0051156_1148_2368 406
2258 3300048928 Ga0496125_0002607 Ga0496125_0002607_3886_5106 406
2259 3300048928 Ga0496125_0005748 Ga0496125_0005748_10887_12107 406
2260 3300048928 Ga0496125_0007108 Ga0496125_0007108_1022_2245 406
2261 3300048928 Ga0496125_0076497 Ga0496125_0076497_1351_2571 406
2262 3300048928 Ga0496125_0076497 Ga0496125_0076497_90_1313 406
2263 3300048929 Ga0496126_0003412 Ga0496126_0003412_11_1240 406
2264 3300048929 Ga0496126_0013528 Ga0496126_0013528_2808_4028 406
2265 3300048929 Ga0496126_0018680 Ga0496126_0018680_3839_5062 406
2266 3300048929 Ga0496126_0025545 Ga0496126_0025545_2612_3832 406
2267 3300048929 Ga0496126_0044721 Ga0496126_0044721_257_1477 406
2268 3300048929 Ga0496126_0055970 Ga0496126_0055970_1883_3103 406
2269 3300048929 Ga0496126_0142588 Ga0496126_0142588_534_1754 406
2270 3300048929 Ga0496126_0151118 Ga0496126_0151118_724_1947 406
2271 3300049569 Ga0501032_0000129 Ga0501032_0000129_49365_50585 406
2272 3300049570 Ga0501033_0025694 Ga0501033_0025694_526_1752 406
2273 3300049573 Ga0501037_0158054 Ga0501037_0158054_37_1263 406
2274 3300049574 Ga0501038_0053911 Ga0501038_0053911_858_2090 406
2275 3300049578 Ga0501042_0016537 Ga0501042_0016537_3626_4846 406
2276 3300049579 Ga0501043_0176288 Ga0501043_0176288_53_1279 406
2277 3300049581 Ga0501047_0236068 Ga0501047_0236068_319_1539 406
2278 3300049581 Ga0501047_0236159 Ga0501047_0236159_35_1261 406
2279 3300049582 Ga0501048_0080046 Ga0501048_0080046_937_2169 406
2280 3300049584 Ga0501068_0000014 Ga0501068_0000014_5507_6727 406
2281 3300049586 Ga0501070_0133927 Ga0501070_0133927_661_1881 406
2282 3300049586 Ga0501070_0222193 Ga0501070_0222193_51_1271 406
2283 3300049741 Ga0501079_0000261 Ga0501079_0000261_1862_3082 406
2284 3300049823 Ga0501044_0061028 Ga0501044_0061028_709_1935 406
2285 3300049823 Ga0501044_0277526 Ga0501044_0277526_52_1272 406
2286 3300050490 nmdc:mga03n38_11031_c1 nmdc:mga03n38_11031_c1_335_1558 406
2287 3300050490 nmdc:mga03n38_70748_c1 nmdc:mga03n38_70748_c1_292_1515 406
2288 3300050492 nmdc:mga0yw44_126840_c1 nmdc:mga0yw44_126840_c1_383_1606 406
2289 3300050492 nmdc:mga0yw44_92434_c1 nmdc:mga0yw44_92434_c1_269_1489 406
2290 3300050493 nmdc:mga0k408_48401_c1 nmdc:mga0k408_48401_c1_1039_2259 406
2291 3300050494 nmdc:mga06z11_29777_c1 nmdc:mga06z11_29777_c1_299_1519 406
2292 3300050516 nmdc:mga0sz30_4529_c2 nmdc:mga0sz30_4529_c2_278_1498 406
2293 3300053078 Ga0495612_0036583 Ga0495612_0036583_92_1312 406
2294 3300053085 Ga0495619_0054846 Ga0495619_0054846_1048_2268 406
2295 3300053085 Ga0495619_0093482 Ga0495619_0093482_653_1873 406
2296 3300053087 Ga0500643_000032 Ga0500643_000032_83068_84288 406
2297 3300053087 Ga0500643_015047 Ga0500643_015047_205_1428 406
2298 3300053094 Ga0500566_0005587 Ga0500566_0005587_2721_3941 406
2299 3300053094 Ga0500566_0005587 Ga0500566_0005587_3985_5205 406
2300 3300053094 Ga0500566_0019862 Ga0500566_0019862_1641_2861 406
2301 3300053096 Ga0500641_0003846 Ga0500641_0003846_1352_2572 406
2302 3300053096 Ga0500641_0060461 Ga0500641_0060461_263_1486 406
2303 3300053098 Ga0500650_0002825 Ga0500650_0002825_3969_5192 406
2304 3300053102 Ga0500554_003367 Ga0500554_003367_198_1418 406
2305 3300053104 Ga0500556_0000004 Ga0500556_0000004_633551_634771 406
2306 3300053104 Ga0500556_0000004 Ga0500556_0000004_634808_636031 406
2307 3300053104 Ga0500556_0016734 Ga0500556_0016734_445_1665 406
2308 3300053108 Ga0500562_007827 Ga0500562_007827_770_1990 406
2309 3300053109 Ga0500569_010111 Ga0500569_010111_130_1350 406
2310 3300053119 Ga0500595_000759 Ga0500595_000759_517_1737 406
2311 3300053119 Ga0500595_004779 Ga0500595_004779_3460_4680 406
2312 3300053122 Ga0500608_001229 Ga0500608_001229_2614_3834 406
2313 3300053122 Ga0500608_001229 Ga0500608_001229_3878_5098 406
2314 3300053123 Ga0500614_003149 Ga0500614_003149_1166_2386 406
2315 3300053130 Ga0500642_0000186 Ga0500642_0000186_10734_11957 406
2316 3300053130 Ga0500642_0000186 Ga0500642_0000186_11995_13215 406
2317 3300053131 Ga0500652_011396 Ga0500652_011396_1841_3064 406
2318 3300053131 Ga0500652_011396 Ga0500652_011396_583_1803 406
2319 3300053136 Ga0500559_0008102 Ga0500559_0008102_2165_3385 406
2320 3300053136 Ga0500559_0008102 Ga0500559_0008102_901_2121 406
2321 3300053138 Ga0500564_032900 Ga0500564_032900_406_1626 406
2322 3300053139 Ga0500568_0001430 Ga0500568_0001430_4147_5367 406
2323 3300053139 Ga0500568_0001430 Ga0500568_0001430_5405_6628 406
2324 3300053142 Ga0500577_0000153 Ga0500577_0000153_9193_10425 406
2325 3300053148 Ga0500590_077293 Ga0500590_077293_61_1281 406
2326 3300053151 Ga0500604_0002499 Ga0500604_0002499_3128_4351 406
2327 3300053151 Ga0500604_0010784 Ga0500604_0010784_215_1435 406
2328 3300053153 Ga0500616_0000014 Ga0500616_0000014_605243_606463 406
2329 3300053153 Ga0500616_0000014 Ga0500616_0000014_606501_607724 406
2330 3300053153 Ga0500616_0000372 Ga0500616_0000372_4143_5363 406
2331 3300053154 Ga0500619_021446 Ga0500619_021446_98_1318 406
2332 3300053154 Ga0500619_031021 Ga0500619_031021_75_1298 406
2333 3300053155 Ga0500620_004101 Ga0500620_004101_224_1444 406
2334 3300053156 Ga0500622_0000513 Ga0500622_0000513_22900_24123 406
2335 3300053156 Ga0500622_0000513 Ga0500622_0000513_24161_25381 406
2336 3300053158 Ga0500627_0057982 Ga0500627_0057982_66_1286 406
2337 3300053160 Ga0500633_0009242 Ga0500633_0009242_205_1425 406
2338 3300053161 Ga0500634_0075667 Ga0500634_0075667_116_1342 406
2339 3300053177 Ga0500636_0000122 Ga0500636_0000122_20495_21715 406
2340 3300053177 Ga0500636_0001016 Ga0500636_0001016_2017_3240 406
2341 3300053177 Ga0500636_0001016 Ga0500636_0001016_759_1979 406
2342 3300053178 Ga0500637_0078172 Ga0500637_0078172_409_1629 406
2343 3300053730 Ga0500645_021765 Ga0500645_021765_293_1516 406
2344 3300053737 Ga0500601_000050 Ga0500601_000050_17289_18509 406
2345 3300054114 Ga0501084_0045232 Ga0501084_0045232_874_2106 406
2346 3300001904 JGI24736J21556_1003744 JGI24736J21556_10037442 407
2347 3300001979 JGI24740J21852_10013130 JGI24740J21852_100131302 407
2348 3300001989 JGI24739J22299_10002406 JGI24739J22299_100024065 407
2349 3300001990 JGI24737J22298_10002958 JGI24737J22298_100029581 407
2350 3300002067 JGI24735J21928_10030063 JGI24735J21928_100300632 407
2351 3300003215 JGI25153J46596_10006696 JGI25153J46596_100066961 407
2352 3300003354 JGI25160J50197_1004453 JGI25160J50197_10044535 407
2353 3300003354 JGI25160J50197_1028395 JGI25160J50197_10283951 407
2354 3300003794 Ga0055531_10007226 Ga0055531_100072266 407
2355 3300005262 Ga0065165_1000348 Ga0065165_100034884 407
2356 3300005262 Ga0065165_1010602 Ga0065165_10106022 407
2357 3300005262 Ga0065165_1039787 Ga0065165_10397871 407
2358 3300005331 Ga0070670_100104274 Ga0070670_1001042742 407
2359 3300005367 Ga0070667_100183437 Ga0070667_1001834371 407
2360 3300005434 Ga0070709_10082645 Ga0070709_100826452 407
2361 3300005435 Ga0070714_100009084 Ga0070714_1000090847 407
2362 3300005436 Ga0070713_100165992 Ga0070713_1001659922 407
2363 3300005437 Ga0070710_10044123 Ga0070710_100441232 407
2364 3300005439 Ga0070711_100010118 Ga0070711_1000101187 407
2365 3300005455 Ga0070663_100100599 Ga0070663_1001005992 407
2366 3300005530 Ga0070679_100104357 Ga0070679_1001043573 407
2367 3300005539 Ga0068853_100005841 Ga0068853_10000584111 407
2368 3300005539 Ga0068853_100062551 Ga0068853_1000625513 407
2369 3300005563 Ga0068855_100007720 Ga0068855_1000077208 407
2370 3300005563 Ga0068855_100120242 Ga0068855_1001202423 407
2371 3300005577 Ga0068857_100031478 Ga0068857_1000314783 407
2372 3300005578 Ga0068854_100031940 Ga0068854_1000319403 407
2373 3300005578 Ga0068854_100044708 Ga0068854_1000447083 407
2374 3300005614 Ga0068856_100006599 Ga0068856_1000065998 407
2375 3300005614 Ga0068856_100020287 Ga0068856_1000202872 407
2376 3300005616 Ga0068852_100043131 Ga0068852_1000431312 407
2377 3300005616 Ga0068852_100049908 Ga0068852_1000499083 407
2378 3300005834 Ga0068851_10003991 Ga0068851_100039917 407
2379 3300005841 Ga0068863_100306665 Ga0068863_1003066652 407
2380 3300005843 Ga0068860_100079139 Ga0068860_1000791393 407
2381 3300005983 Ga0081540_1012797 Ga0081540_10127972 407
2382 3300005983 Ga0081540_1034249 Ga0081540_10342493 407
2383 3300006028 Ga0070717_10149515 Ga0070717_101495152 407
2384 3300006038 Ga0075365_10180367 Ga0075365_101803672 407
2385 3300006042 Ga0075368_10015526 Ga0075368_100155262 407
2386 3300006048 Ga0075363_100056792 Ga0075363_1000567922 407
2387 3300006163 Ga0070715_10000384 Ga0070715_100003847 407
2388 3300006186 Ga0075369_10037855 Ga0075369_100378552 407
2389 3300006195 Ga0075366_10029384 Ga0075366_100293842 407
2390 3300006353 Ga0075370_10075597 Ga0075370_100755972 407
2391 3300006942 Ga0099824_1027442 Ga0099824_10274423 407
2392 3300006944 Ga0099823_1052075 Ga0099823_10520753 407
2393 3300009177 Ga0105248_10132194 Ga0105248_101321942 407
2394 3300009545 Ga0105237_10027425 Ga0105237_100274256 407
2395 3300009545 Ga0105237_10070520 Ga0105237_100705203 407
2396 3300009551 Ga0105238_10029110 Ga0105238_100291102 407
2397 3300009551 Ga0105238_10055590 Ga0105238_100555902 407
2398 3300009551 Ga0105238_10195133 Ga0105238_101951332 407
2399 3300010375 Ga0105239_10005426 Ga0105239_100054268 407
2400 3300010375 Ga0105239_10117803 Ga0105239_101178033 407
2401 3300010375 Ga0105239_10208529 Ga0105239_102085292 407
2402 3300011119 Ga0105246_10194990 Ga0105246_101949901 407
2403 3300014325 Ga0163163_10232078 Ga0163163_102320782 407
2404 3300021441 Ga0213871_10001515 Ga0213871_100015151 407
2405 3300025245 Ga0207425_1006454 Ga0207425_10064542 407
2406 3300025295 Ga0209564_1003264 Ga0209564_100326410 407
2407 3300025295 Ga0209564_1014212 Ga0209564_10142123 407
2408 3300025297 Ga0209758_1000140 Ga0209758_1000140107 407
2409 3300025297 Ga0209758_1001346 Ga0209758_10013462 407
2410 3300025297 Ga0209758_1002397 Ga0209758_10023972 407
2411 3300025299 Ga0209256_1006146 Ga0209256_10061463 407
2412 3300025302 Ga0207426_1002280 Ga0207426_10022807 407
2413 3300025302 Ga0207426_1002722 Ga0207426_10027223 407
2414 3300025302 Ga0207426_1011102 Ga0207426_10111022 407
2415 3300025304 Ga0209257_1002227 Ga0209257_100222719 407
2416 3300025304 Ga0209257_1033673 Ga0209257_10336732 407
2417 3300025315 Ga0207697_10016374 Ga0207697_100163742 407
2418 3300025898 Ga0207692_10000214 Ga0207692_100002146 407
2419 3300025904 Ga0207647_10000712 Ga0207647_100007125 407
2420 3300025906 Ga0207699_10027860 Ga0207699_100278602 407
2421 3300025911 Ga0207654_10002421 Ga0207654_100024215 407
2422 3300025912 Ga0207707_10013921 Ga0207707_100139212 407
2423 3300025913 Ga0207695_10001998 Ga0207695_1000199825 407
2424 3300025914 Ga0207671_10107404 Ga0207671_101074042 407
2425 3300025915 Ga0207693_10024965 Ga0207693_100249653 407
2426 3300025915 Ga0207693_10026683 Ga0207693_100266833 407
2427 3300025916 Ga0207663_10000628 Ga0207663_1000062815 407
2428 3300025921 Ga0207652_10058518 Ga0207652_100585183 407
2429 3300025924 Ga0207694_10000157 Ga0207694_1000015722 407
2430 3300025924 Ga0207694_10109193 Ga0207694_101091932 407
2431 3300025925 Ga0207650_10090519 Ga0207650_100905192 407
2432 3300025928 Ga0207700_10006989 Ga0207700_100069892 407
2433 3300025929 Ga0207664_10227587 Ga0207664_102275871 407
2434 3300025931 Ga0207644_10077073 Ga0207644_100770731 407
2435 3300025949 Ga0207667_10011520 Ga0207667_1001152010 407
2436 3300025981 Ga0207640_10042167 Ga0207640_100421672 407
2437 3300026041 Ga0207639_10044374 Ga0207639_100443742 407
2438 3300026067 Ga0207678_10113616 Ga0207678_101136162 407
2439 3300026078 Ga0207702_10000002 Ga0207702_10000002278 407
2440 3300026078 Ga0207702_10148419 Ga0207702_101484192 407
2441 3300027296 Ga0209389_1000061 Ga0209389_100006138 407
2442 3300027296 Ga0209389_1000201 Ga0209389_100020144 407
2443 3300027357 Ga0209589_1000465 Ga0209589_100046538 407
2444 3300027361 Ga0209489_100006 Ga0209489_10000640 407
2445 3300027361 Ga0209489_100035 Ga0209489_1000357 407
2446 3300027363 Ga0209700_100005 Ga0209700_1000057 407
2447 3300028381 Ga0268264_10000149 Ga0268264_10000149110 407
2448 3300028558 Ga0265326_10002417 Ga0265326_100024175 407
2449 3300028563 Ga0265319_1003112 Ga0265319_10031123 407
2450 3300028573 Ga0265334_10004574 Ga0265334_100045745 407
2451 3300028577 Ga0265318_10002252 Ga0265318_1000225210 407
2452 3300028653 Ga0265323_10000280 Ga0265323_100002806 407
2453 3300028666 Ga0265336_10000434 Ga0265336_1000043426 407
2454 3300028800 Ga0265338_10000776 Ga0265338_1000077648 407
2455 3300029957 Ga0265324_10004764 Ga0265324_100047645 407
2456 3300030521 Ga0307511_10107907 Ga0307511_101079071 407
2457 3300031616 Ga0307508_10009580 Ga0307508_100095802 407
2458 3300031711 Ga0265314_10025825 Ga0265314_100258254 407
2459 3300031730 Ga0307516_10008211 Ga0307516_100082113 407
2460 3300031730 Ga0307516_10147974 Ga0307516_101479742 407
2461 3300033180 Ga0307510_10148559 Ga0307510_101485592 407
2462 3300035695 Ga0373927_0051893 Ga0373927_0051893_575_1798 407
2463 3300035724 Ga0373933_0000445 Ga0373933_0000445_2542_3765 407
2464 3300037471 Ga0395905_0191275 Ga0395905_0191275_366_1589 407
2465 3300039438 Ga0436360_1105678 Ga0436360_1105678_1245_2468 407
2466 3300039447 Ga0436361_0209695 Ga0436361_0209695_109_1332 407
2467 3300039453 Ga0436362_0554704 Ga0436362_0554704_18_1241 407
2468 3300044658 Ga0466972_0000189 Ga0466972_0000189_16857_18080 407
2469 3300044658 Ga0466972_0021981 Ga0466972_0021981_71_1294 407
2470 3300044684 Ga0466966_0000196 Ga0466966_0000196_33341_34564 407
2471 3300044693 Ga0466961_0000239 Ga0466961_0000239_61_1284 407
2472 3300044735 Ga0466968_0003867 Ga0466968_0003867_4155_5378 407
2473 3300045049 Ga0466959_0021923 Ga0466959_0021923_2218_3441 407
2474 3300046462 Ga0495651_0013879 Ga0495651_0013879_1146_2369 407
2475 3300046507 Ga0495606_0085077 Ga0495606_0085077_220_1443 407
2476 3300046517 Ga0495630_0111703 Ga0495630_0111703_61_1284 407
2477 3300046522 Ga0495643_0006299 Ga0495643_0006299_5309_6532 407
2478 3300046524 Ga0495648_0013070 Ga0495648_0013070_2911_4134 407
2479 3300046529 Ga0495652_0031471 Ga0495652_0031471_1697_2920 407
2480 3300046559 Ga0495667_0010501 Ga0495667_0010501_5029_6252 407
2481 3300046675 Ga0495657_0005171 Ga0495657_0005171_1259_2482 407
2482 3300046678 Ga0495599_0077243 Ga0495599_0077243_349_1572 407
2483 3300046678 Ga0495599_0156362 Ga0495599_0156362_133_1356 407
2484 3300046679 Ga0495623_0026676 Ga0495623_0026676_924_2147 407
2485 3300047322 Ga0495680_0008649 Ga0495680_0008649_4428_5651 407
2486 3300047323 Ga0495683_0063682 Ga0495683_0063682_388_1611 407
2487 3300047443 Ga0495687_009315 Ga0495687_009315_4064_5287 407
2488 3300047444 Ga0495675_0091167 Ga0495675_0091167_285_1508 407
2489 3300047471 Ga0495684_0145377 Ga0495684_0145377_515_1738 407
2490 3300048904 Ga0496101_0199879 Ga0496101_0199879_133_1356 407
2491 3300048905 Ga0496102_0023779 Ga0496102_0023779_135_1358 407
2492 3300048909 Ga0496106_0007345 Ga0496106_0007345_3184_4407 407
2493 3300048909 Ga0496106_0145099 Ga0496106_0145099_441_1664 407
2494 3300048912 Ga0496109_0201653 Ga0496109_0201653_39_1262 407
2495 3300048912 Ga0496109_0288186 Ga0496109_0288186_158_1381 407
2496 3300048915 Ga0496112_0101340 Ga0496112_0101340_522_1745 407
2497 3300048916 Ga0496113_0053851 Ga0496113_0053851_390_1613 407
2498 3300048918 Ga0496115_0062305 Ga0496115_0062305_1487_2710 407
2499 3300048921 Ga0496118_0011620 Ga0496118_0011620_1402_2625 407
2500 3300048922 Ga0496119_0079911 Ga0496119_0079911_176_1399 407
2501 3300048924 Ga0496121_0005471 Ga0496121_0005471_178_1401 407
2502 3300048924 Ga0496121_0007715 Ga0496121_0007715_461_1684 407
2503 3300048925 Ga0496122_0096640 Ga0496122_0096640_657_1880 407
2504 3300048927 Ga0496124_0000837 Ga0496124_0000837_8051_9274 407
2505 3300048927 Ga0496124_0043395 Ga0496124_0043395_505_1728 407
2506 3300048927 Ga0496124_0139227 Ga0496124_0139227_38_1261 407
2507 3300048928 Ga0496125_0048277 Ga0496125_0048277_2016_3239 407
2508 3300048929 Ga0496126_0012755 Ga0496126_0012755_230_1453 407
2509 3300048929 Ga0496126_0082690 Ga0496126_0082690_1341_2564 407
2510 3300048929 Ga0496126_0131750 Ga0496126_0131750_659_1909 407
2511 3300050491 nmdc:mga00v17_65415_c1 nmdc:mga00v17_65415_c1_692_1915 407
2512 3300050492 nmdc:mga0yw44_56770_c1 nmdc:mga0yw44_56770_c1_886_2109 407
2513 3300050496 nmdc:mga07m45_25821_c1 nmdc:mga07m45_25821_c1_1084_2307 407
2514 3300050496 nmdc:mga07m45_54286_c1 nmdc:mga07m45_54286_c1_85_1308 407
2515 3300050516 nmdc:mga0sz30_72610_c1 nmdc:mga0sz30_72610_c1_85_1308 407
2516 3300053085 Ga0495619_0064738 Ga0495619_0064738_713_1936 407
2517 3300053091 Ga0500647_0031804 Ga0500647_0031804_968_2191 407
2518 3300053094 Ga0500566_0000009 Ga0500566_0000009_32043_33266 407
2519 3300053094 Ga0500566_0039944 Ga0500566_0039944_37_1260 407
2520 3300053095 Ga0500640_000068 Ga0500640_000068_4288_5511 407
2521 3300053111 Ga0500572_000070 Ga0500572_000070_4263_5486 407
2522 3300053130 Ga0500642_0000173 Ga0500642_0000173_16774_17997 407
2523 3300053150 Ga0500603_000885 Ga0500603_000885_4266_5489 407
2524 3300053150 Ga0500603_023189 Ga0500603_023189_92_1315 407
2525 3300053163 Ga0500639_000545 Ga0500639_000545_14341_15564 407
2526 3300053729 Ga0500625_014344 Ga0500625_014344_2408_3631 407
2527 3300053735 Ga0500596_000198 Ga0500596_000198_7964_9187 407

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13458

Peripla_BP_6

Periplasmic binding protein

25

373

0.96

PF13433

Peripla_BP_5

Periplasmic binding protein domain

26

373

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3i09-assembly2.cif.gz_B crystal structure of a periplasmic binding protein (bma2936) from burkholderia mallei at 1.80 a resolution 0.9783 28 405
3i09-assembly2.cif.gz_B crystal structure of a periplasmic binding protein (bma2936) from burkholderia mallei at 1.80 a resolution 0.9681 28 405
4f06-assembly1.cif.gz_A crystal structure of solute binding protein of abc transporter from rhodopseudomonas palustris haa2 rpb_2270 in complex with p-hydroxybenzoic acid 0.898 29 390
4evr-assembly1.cif.gz_A crystal structure of abc transporter from r. palustris - solute binding protein (rpa0668) in complex with benzoate 0.8975 29 403
3ipc-assembly1.cif.gz_A structure of atu2422-gaba f77a mutant receptor in complex with leucine 0.8921 30 385
ID Description Score Start End Superfamily
3i09B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9844 151 280 3.40.50.2300
3i09B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9693 151 280 3.40.50.2300
3n0wB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.946 30 362 3.40.50.2300
af_A0A0R0JFH4_66_156_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9363 69 133 3.40.50.2300
3i09A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9248 28 362 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A0E4FT91-F1-model_v4 Substrate-binding protein 0.9628 20 366 GO:0006865
AF-A0A6G8TYN6-F1-model_v4 ABC transporter substrate-binding protein 0.9624 21 407 GO:0006865
AF-A0A6G8TYN6-F1-model_v4 ABC transporter substrate-binding protein 0.9575 21 407 GO:0006865
AF-A0A2G8MMU4-F1-model_v4 deleted 0.9547 19 284
AF-A0A4Q3YPE8-F1-model_v4 ABC transporter permease 0.9537 235 407 GO:0006865

Feature Viewer

pLDDT pTM Quality
92.79 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map