F496874

General Info

Members Datasets Scaffolds Average Seq Length
2516 633 2515 141

Family's Representative Sequence

Representative Sequence 3300061734|Ga0530510_0053431|Ga0530510_0053431_808_1296
Length 162
Sequence MPAGTTFKTVVGTGNGKRGTFRLAKKIRAYVKLQIPAGKATPAPPIGPALGQHGVAIMNFCKEYNERTANQAGQIIPVLITVYEDRSFTFVTKTPPAADLLRRAAGVEKGAGDVTESVGRVTRDQVREIAELKMRDLNAIDIDGAMLQIEGTARSMGIDVVG

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
10 3300003383 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM Metagenome Rhizosphere
11 3300003396 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM Metagenome Rhizosphere
12 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
14 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
15 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
16 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
17 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
18 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
19 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
20 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
28 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
31 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
32 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
33 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
34 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
35 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
36 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
37 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
38 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
39 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
40 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
41 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
42 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
43 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
44 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
45 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
46 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
47 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
48 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
49 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
50 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
51 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
52 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
53 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
54 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
55 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
56 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
57 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
58 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
59 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
60 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
61 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
62 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
63 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
64 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
65 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
66 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
67 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
68 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
69 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
70 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
71 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
72 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
73 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
74 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
75 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
76 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
77 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
78 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
79 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
80 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
81 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
82 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
83 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
84 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
85 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
86 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
87 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
88 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
89 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
90 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
91 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
92 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
93 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
94 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
95 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
96 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
97 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
98 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
99 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
100 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
101 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
102 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
103 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
104 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
105 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
106 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
107 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
108 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
109 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
110 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
111 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
112 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
113 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
114 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
115 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
116 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
117 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
118 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
119 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
120 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
121 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
122 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
123 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
124 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
125 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
126 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
127 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
128 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
129 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
130 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
131 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
132 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
133 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
134 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
135 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
136 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
137 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
138 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
139 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
140 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
141 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
142 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
143 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
144 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
145 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
146 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
147 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
148 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
149 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
150 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
151 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
152 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
153 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
154 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
155 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
156 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
157 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
158 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
159 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
160 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
161 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
162 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
163 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
165 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
166 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
167 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
168 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
236 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
237 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
238 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
239 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
240 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
241 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
242 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
243 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
244 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
245 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
246 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
247 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
248 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
249 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
250 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
251 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
252 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
253 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
257 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
258 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
259 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
260 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
261 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
262 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
263 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
264 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
265 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
266 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
267 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
268 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
269 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
270 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
271 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
272 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
273 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
274 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
275 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
276 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
277 3300031635 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
278 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
279 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
280 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
281 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
282 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
283 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
284 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
285 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
286 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
287 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
288 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
289 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
290 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
291 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
292 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
293 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
294 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
295 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
296 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
297 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
298 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
299 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
300 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
301 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
302 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
303 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
304 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
305 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
306 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
307 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
308 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
309 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
310 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
311 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
312 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
313 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
314 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
315 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
316 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
317 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
318 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
319 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
320 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
321 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
322 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
323 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
324 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
325 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
326 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
327 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
328 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
329 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
330 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
331 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
332 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
333 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
334 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
335 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
336 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
337 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
338 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
339 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
340 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
341 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
342 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
343 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
344 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
345 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
346 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
347 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
348 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
349 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
350 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
351 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
352 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
353 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
354 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
355 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
356 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
357 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
358 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
359 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
360 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
361 3300041508 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaT Metatranscriptome Unclassified
362 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
363 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
364 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
365 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
366 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
367 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
368 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
369 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
370 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
371 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
372 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
373 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
374 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
375 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
376 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
377 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
378 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
379 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
380 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
381 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
382 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
383 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
384 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
385 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
386 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
387 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
388 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
389 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
390 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
391 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
392 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
393 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
394 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
395 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
396 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
397 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
398 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
399 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
400 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
401 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
402 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
403 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
404 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
405 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
406 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
407 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
408 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
409 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
410 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
411 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
412 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
413 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
414 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
415 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
416 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
417 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
418 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
419 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
420 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
421 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
422 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
423 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
424 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
425 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
426 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
427 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
428 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
429 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
430 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
431 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
432 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
433 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
434 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
435 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
436 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
437 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
438 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
439 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
440 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
441 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
442 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
443 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
444 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
445 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
446 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
447 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
448 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
449 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
450 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
451 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
452 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
453 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
454 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
455 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
456 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
457 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
458 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
459 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
460 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
461 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
462 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
463 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
464 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
465 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
466 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
467 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
468 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
469 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
470 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
471 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
472 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
473 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
474 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
475 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
476 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
477 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
478 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
479 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
480 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
481 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
482 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
483 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
484 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
485 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
486 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
487 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
488 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
489 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
490 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
491 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
492 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
493 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
494 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
495 3300049525 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F21_B_7_control Metagenome Rhizosphere
496 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
497 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
498 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
499 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
500 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
501 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
502 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
503 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
504 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
505 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
506 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
507 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
508 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
509 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
510 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
511 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
512 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
513 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
514 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
515 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
516 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
517 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
518 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
519 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
520 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
521 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
522 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
523 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
524 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
525 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
526 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
527 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
528 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
529 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
530 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
531 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
532 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
533 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
534 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
535 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
536 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
537 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
538 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
539 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
540 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
541 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
542 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
543 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
544 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
545 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
546 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
547 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
548 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
549 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
550 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
551 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
552 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
553 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
554 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
555 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
556 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
557 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
558 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
559 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
560 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
561 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
562 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
563 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
564 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
565 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
566 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
567 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
568 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
569 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
570 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
571 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
572 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
573 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
574 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
575 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
576 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
577 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
578 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
579 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
580 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
581 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
582 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
583 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
584 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
585 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
586 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
587 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
588 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
589 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
590 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
591 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
592 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
593 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
594 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
595 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
596 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
597 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
598 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
599 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
600 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
601 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
602 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
603 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
604 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
605 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
606 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
607 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
608 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
609 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
610 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
611 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
612 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
613 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
614 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
615 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
616 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
617 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
618 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
619 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
620 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
621 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
622 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
623 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
624 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
625 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
626 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
627 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
628 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
629 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
630 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
631 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
632 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
633 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.49
Metatranscriptomes 8.51
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.4
Nodule 0
Rhizoplane 3.7
Rhizosphere 94.2
Stem 0
Stem Tuber 0
Unclassified 1.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_474354 2162886007 Bacteria 2158
2 JGI24746J21847_1039991 3300001977 Bacteria 652
3 JGI24737J22298_10008231 3300001990 Bacteria 3499
4 JGI24743J22301_10061887 3300001991 Bacteria 772
5 JGI24738J21930_10051332 3300002075 Bacteria 841
6 JGI24751J29686_10013331 3300002459 Bacteria 1696
7 JGI24751J29686_10019965 3300002459 Unclassified 1387
8 JGI25406J46586_10009666 3300003203 Bacteria 4312
9 JGI25406J46586_10073705 3300003203 Unclassified 1064
10 rootH1_10013162 3300003323 Bacteria 2122
11 JGI26129J50193_1000031 3300003349 Bacteria 7957
12 JGI26140J50224_102395 3300003383 Bacteria 679
13 JGI26137J50245_101533 3300003396 Bacteria 710
14 Ga0007409J51694_1050126 3300003575 Bacteria 952
15 Ga0058859_11818835 3300004798 Bacteria 2512
16 Ga0058863_10102249 3300004799 Bacteria 3917
17 Ga0058863_10165012 3300004799 Bacteria 3064
18 Ga0058863_11038963 3300004799 Bacteria 530
19 Ga0058863_11606731 3300004799 Bacteria 591
20 Ga0058863_11613440 3300004799 Bacteria 833
21 Ga0058863_11637961 3300004799 Bacteria 1173
22 Ga0058863_11723643 3300004799 Bacteria 1512
23 Ga0058863_11904893 3300004799 Bacteria 1540
24 Ga0058861_10004363 3300004800 Bacteria 2289
25 Ga0058861_10609693 3300004800 Bacteria 708
26 Ga0058861_11409730 3300004800 Bacteria 1348
27 Ga0058861_11679632 3300004800 Bacteria 1783
28 Ga0058861_11919272 3300004800 Bacteria 1235
29 Ga0058860_10037994 3300004801 Bacteria 2436
30 Ga0058862_10264671 3300004803 Bacteria 4230
31 Ga0058862_10265876 3300004803 Bacteria 3065
32 Ga0058862_12532650 3300004803 Bacteria 1092
33 Ga0058862_12677474 3300004803 Bacteria 933
34 Ga0058862_12702988 3300004803 Bacteria 1857
35 Ga0065704_10006429 3300005289 Bacteria 3110
36 Ga0065704_10246670 3300005289 Bacteria 1000
37 Ga0065704_10344117 3300005289 Bacteria 819
38 Ga0065704_10397834 3300005289 Bacteria 755
39 Ga0065712_10160440 3300005290 Bacteria 1257
40 Ga0065715_10015383 3300005293 Bacteria 2051
41 Ga0065715_10044237 3300005293 Bacteria 1339
42 Ga0065715_10238673 3300005293 Bacteria 1207
43 Ga0065707_10006868 3300005295 Bacteria 3086
44 Ga0065707_10040926 3300005295 Bacteria 998
45 Ga0065707_10101590 3300005295 Bacteria 2847
46 Ga0065707_10298988 3300005295 Bacteria 1008
47 Ga0065707_10320497 3300005295 Bacteria 967
48 Ga0065707_10325605 3300005295 Bacteria 958
49 Ga0070658_10011068 3300005327 Bacteria 7231
50 Ga0070658_10043062 3300005327 Bacteria 3648
51 Ga0070658_10344384 3300005327 Bacteria 1275
52 Ga0070676_10005064 3300005328 Bacteria 6989
53 Ga0070676_10005495 3300005328 Bacteria 6748
54 Ga0070676_10105713 3300005328 Bacteria 1745
55 Ga0070676_10348455 3300005328 Bacteria 1017
56 Ga0070676_10517116 3300005328 Bacteria 850
57 Ga0070683_100131767 3300005329 Bacteria 2366
58 Ga0070683_100201042 3300005329 Bacteria 1892
59 Ga0070683_100203178 3300005329 Bacteria 1882
60 Ga0070683_100388118 3300005329 Bacteria 1331
61 Ga0070683_100388431 3300005329 Bacteria 1330
62 Ga0070683_101239790 3300005329 Bacteria 717
63 Ga0070690_100000871 3300005330 Bacteria 15363
64 Ga0070690_100013884 3300005330 Bacteria 4774
65 Ga0070690_100021175 3300005330 Bacteria 3967
66 Ga0070690_100115224 3300005330 Bacteria 1798
67 Ga0070690_100312104 3300005330 Bacteria 1131
68 Ga0070690_100614201 3300005330 Bacteria 827
69 Ga0070670_100002307 3300005331 Bacteria 15724
70 Ga0070670_100215131 3300005331 Bacteria 1671
71 Ga0070670_100425344 3300005331 Bacteria 1174
72 Ga0070670_100426052 3300005331 Bacteria 1173
73 Ga0070670_100865244 3300005331 Bacteria 818
74 Ga0070677_10005247 3300005333 Bacteria 4265
75 Ga0068869_100024881 3300005334 Bacteria 4151
76 Ga0068869_100287487 3300005334 Bacteria 1324
77 Ga0068869_100312340 3300005334 Bacteria 1272
78 Ga0068869_100507616 3300005334 Bacteria 1007
79 Ga0070666_10004903 3300005335 Bacteria 8178
80 Ga0070666_10076905 3300005335 Bacteria 2278
81 Ga0070666_10284938 3300005335 Bacteria 1175
82 Ga0070666_10466540 3300005335 Bacteria 913
83 Ga0070680_100002219 3300005336 Bacteria 14323
84 Ga0070680_100020531 3300005336 Bacteria 5243
85 Ga0070680_100027839 3300005336 Bacteria 4529
86 Ga0070680_100085310 3300005336 Bacteria 2609
87 Ga0070680_100405975 3300005336 Bacteria 1162
88 Ga0070680_100680553 3300005336 Bacteria 885
89 Ga0070680_100708027 3300005336 Bacteria 867
90 Ga0070680_100973959 3300005336 Bacteria 732
91 Ga0070682_100156508 3300005337 Bacteria 1569
92 Ga0070682_100229560 3300005337 Bacteria 1326
93 Ga0070682_100367295 3300005337 Bacteria 1078
94 Ga0070682_100539642 3300005337 Bacteria 911
95 Ga0068868_100001296 3300005338 Bacteria 17217
96 Ga0068868_100075864 3300005338 Bacteria 2687
97 Ga0068868_100142491 3300005338 Bacteria 1969
98 Ga0068868_102273902 3300005338 Bacteria 517
99 Ga0070660_100012558 3300005339 Bacteria 6052
100 Ga0070660_100168547 3300005339 Bacteria 1768
101 Ga0070660_100207875 3300005339 Bacteria 1589
102 Ga0070660_100401739 3300005339 Bacteria 1133
103 Ga0070660_100430809 3300005339 Bacteria 1093
104 Ga0070660_100625617 3300005339 Bacteria 901
105 Ga0070660_100819284 3300005339 Bacteria 783
106 Ga0070660_100914054 3300005339 Bacteria 740
107 Ga0070689_100001397 3300005340 Bacteria 15384
108 Ga0070689_100041885 3300005340 Bacteria 3515
109 Ga0070689_100213882 3300005340 Bacteria 1579
110 Ga0070689_100270686 3300005340 Bacteria 1406
111 Ga0070689_100724242 3300005340 Bacteria 870
112 Ga0070689_101405163 3300005340 Bacteria 631
113 Ga0070691_10002340 3300005341 Bacteria 8403
114 Ga0070691_10003913 3300005341 Bacteria 6736
115 Ga0070691_10612318 3300005341 Bacteria 644
116 Ga0070687_100062339 3300005343 Bacteria 1974
117 Ga0070687_100110347 3300005343 Bacteria 1556
118 Ga0070687_100119192 3300005343 Bacteria 1507
119 Ga0070687_100251554 3300005343 Bacteria 1098
120 Ga0070687_100460899 3300005343 Bacteria 847
121 Ga0070687_100800701 3300005343 Bacteria 668
122 Ga0070661_100035984 3300005344 Bacteria 3598
123 Ga0070661_100051968 3300005344 Bacteria 2999
124 Ga0070661_100096986 3300005344 Bacteria 2188
125 Ga0070661_100386852 3300005344 Bacteria 1104
126 Ga0070692_10059042 3300005345 Bacteria 2016
127 Ga0070692_10075841 3300005345 Bacteria 1801
128 Ga0070692_10143277 3300005345 Bacteria 1354
129 Ga0070692_10523875 3300005345 Bacteria 772
130 Ga0070692_10531436 3300005345 Bacteria 767
131 Ga0070692_10693802 3300005345 Bacteria 684
132 Ga0070692_11207701 3300005345 Bacteria 539
133 Ga0070668_100044109 3300005347 Bacteria 3420
134 Ga0070668_100544104 3300005347 Bacteria 1010
135 Ga0070668_101335585 3300005347 Bacteria 652
136 Ga0070669_100009006 3300005353 Bacteria 7121
137 Ga0070669_100170439 3300005353 Bacteria 1697
138 Ga0070669_100640141 3300005353 Bacteria 894
139 Ga0070675_100001855 3300005354 Bacteria 15584
140 Ga0070675_100022763 3300005354 Bacteria 5007
141 Ga0070675_100716930 3300005354 Bacteria 911
142 Ga0070675_100725267 3300005354 Bacteria 906
143 Ga0070675_101543809 3300005354 Bacteria 612
144 Ga0070671_100052878 3300005355 Bacteria 3377
145 Ga0070671_100657530 3300005355 Bacteria 908
146 Ga0070674_100002375 3300005356 Bacteria 10401
147 Ga0070674_100003625 3300005356 Bacteria 8692
148 Ga0070674_100034471 3300005356 Bacteria 3381
149 Ga0070674_100048475 3300005356 Bacteria 2916
150 Ga0070674_100140877 3300005356 Bacteria 1809
151 Ga0070674_100170547 3300005356 Bacteria 1659
152 Ga0070674_100568181 3300005356 Bacteria 954
153 Ga0070673_100002764 3300005364 Bacteria 10787
154 Ga0070673_100007015 3300005364 Bacteria 7386
155 Ga0070673_100076409 3300005364 Bacteria 2704
156 Ga0070673_100271750 3300005364 Bacteria 1484
157 Ga0070673_100662003 3300005364 Bacteria 956
158 Ga0070673_100889352 3300005364 Bacteria 825
159 Ga0070673_100947863 3300005364 Bacteria 800
160 Ga0070688_100000703 3300005365 Bacteria 16477
161 Ga0070688_100007379 3300005365 Bacteria 5923
162 Ga0070688_100025590 3300005365 Bacteria 3495
163 Ga0070688_100168634 3300005365 Bacteria 1509
164 Ga0070688_100268382 3300005365 Bacteria 1221
165 Ga0070659_100005802 3300005366 Bacteria 8891
166 Ga0070659_100113012 3300005366 Bacteria 2193
167 Ga0070659_100216530 3300005366 Bacteria 1580
168 Ga0070659_100398212 3300005366 Bacteria 1162
169 Ga0070659_100436535 3300005366 Unclassified 1109
170 Ga0070659_101261180 3300005366 Bacteria 655
171 Ga0070659_101348716 3300005366 Bacteria 633
172 Ga0070667_100027162 3300005367 Bacteria 4763
173 Ga0070667_100075045 3300005367 Bacteria 2886
174 Ga0070667_100183214 3300005367 Bacteria 1853
175 Ga0070667_101198953 3300005367 Bacteria 710
176 Ga0070703_10003131 3300005406 Bacteria 4734
177 Ga0070703_10006982 3300005406 Bacteria 3164
178 Ga0070703_10028909 3300005406 Bacteria 1660
179 Ga0070703_10092385 3300005406 Bacteria 1051
180 Ga0070709_10070551 3300005434 Bacteria 2252
181 Ga0070709_11063067 3300005434 Bacteria 646
182 Ga0070714_100279141 3300005435 Bacteria 1551
183 Ga0070714_100432469 3300005435 Bacteria 1248
184 Ga0070714_100596381 3300005435 Bacteria 1061
185 Ga0070713_100700520 3300005436 Bacteria 967
186 Ga0070710_10146875 3300005437 Bacteria 1451
187 Ga0070710_10570082 3300005437 Bacteria 784
188 Ga0070701_10014432 3300005438 Bacteria 3623
189 Ga0070701_10024455 3300005438 Bacteria 2922
190 Ga0070701_10054367 3300005438 Bacteria 2087
191 Ga0070701_10098230 3300005438 Bacteria 1617
192 Ga0070701_10477776 3300005438 Bacteria 805
193 Ga0070711_100022513 3300005439 Bacteria 4085
194 Ga0070711_100717012 3300005439 Bacteria 843
195 Ga0070711_100927821 3300005439 Bacteria 744
196 Ga0070711_101535653 3300005439 Bacteria 581
197 Ga0070705_100022034 3300005440 Bacteria 3398
198 Ga0070705_100022738 3300005440 Bacteria 3354
199 Ga0070705_100028430 3300005440 Bacteria 3062
200 Ga0070705_100050675 3300005440 Bacteria 2416
201 Ga0070705_100158858 3300005440 Bacteria 1509
202 Ga0070705_100287131 3300005440 Bacteria 1173
203 Ga0070705_100351632 3300005440 Bacteria 1075
204 Ga0070705_100398248 3300005440 Bacteria 1019
205 Ga0070705_100403854 3300005440 Bacteria 1012
206 Ga0070705_100450323 3300005440 Bacteria 965
207 Ga0070705_100883500 3300005440 Bacteria 718
208 Ga0070705_101416555 3300005440 Bacteria 580
209 Ga0070705_101466158 3300005440 Bacteria 571
210 Ga0070700_100003481 3300005441 Bacteria 8123
211 Ga0070700_100006313 3300005441 Bacteria 6329
212 Ga0070700_100036116 3300005441 Bacteria 2995
213 Ga0070700_100093667 3300005441 Bacteria 1965
214 Ga0070700_100231168 3300005441 Bacteria 1316
215 Ga0070700_100231372 3300005441 Bacteria 1315
216 Ga0070700_100490599 3300005441 Bacteria 943
217 Ga0070700_100964233 3300005441 Bacteria 699
218 Ga0070700_101434123 3300005441 Bacteria 585
219 Ga0070694_100006648 3300005444 Bacteria 7024
220 Ga0070694_100040047 3300005444 Bacteria 3122
221 Ga0070694_100077191 3300005444 Bacteria 2308
222 Ga0070694_100127538 3300005444 Bacteria 1834
223 Ga0070694_100179414 3300005444 Bacteria 1565
224 Ga0070694_100211540 3300005444 Bacteria 1450
225 Ga0070694_100256312 3300005444 Bacteria 1325
226 Ga0070694_100363437 3300005444 Bacteria 1124
227 Ga0070694_100522052 3300005444 Bacteria 947
228 Ga0070694_100523292 3300005444 Bacteria 946
229 Ga0070694_100646470 3300005444 Bacteria 856
230 Ga0070694_100695187 3300005444 Bacteria 826
231 Ga0070708_100001270 3300005445 Bacteria 19412
232 Ga0070708_100021693 3300005445 Bacteria 5437
233 Ga0070708_100037985 3300005445 Bacteria 4203
234 Ga0070708_100056616 3300005445 Bacteria 3488
235 Ga0070708_100083016 3300005445 Bacteria 2903
236 Ga0070708_100125279 3300005445 Bacteria 2374
237 Ga0070708_100159532 3300005445 Bacteria 2101
238 Ga0070708_100168245 3300005445 Bacteria 2045
239 Ga0070708_100173962 3300005445 Bacteria 2011
240 Ga0070708_100217828 3300005445 Bacteria 1790
241 Ga0070708_100402628 3300005445 Bacteria 1290
242 Ga0070708_100586755 3300005445 Bacteria 1051
243 Ga0070708_100746053 3300005445 Bacteria 921
244 Ga0070708_100843294 3300005445 Bacteria 861
245 Ga0070708_101241957 3300005445 Bacteria 696
246 Ga0070663_100004558 3300005455 Bacteria 8167
247 Ga0070663_100018881 3300005455 Bacteria 4532
248 Ga0070663_100334424 3300005455 Bacteria 1222
249 Ga0070663_100588966 3300005455 Bacteria 934
250 Ga0070663_101049088 3300005455 Bacteria 711
251 Ga0070678_100002858 3300005456 Bacteria 9559
252 Ga0070678_100007430 3300005456 Bacteria 6500
253 Ga0070678_100182552 3300005456 Bacteria 1719
254 Ga0070662_100005353 3300005457 Bacteria 8200
255 Ga0070662_100192331 3300005457 Bacteria 1614
256 Ga0070662_100214792 3300005457 Bacteria 1532
257 Ga0070662_100763141 3300005457 Bacteria 821
258 Ga0070681_10011126 3300005458 Bacteria 8904
259 Ga0070681_10025568 3300005458 Bacteria 5939
260 Ga0070681_10060384 3300005458 Bacteria 3768
261 Ga0070681_10100334 3300005458 Bacteria 2841
262 Ga0070681_10260961 3300005458 Bacteria 1644
263 Ga0070681_10449407 3300005458 Bacteria 1201
264 Ga0070681_10460029 3300005458 Bacteria 1185
265 Ga0070681_10540221 3300005458 Bacteria 1079
266 Ga0070681_10637121 3300005458 Bacteria 981
267 Ga0070681_11450032 3300005458 Bacteria 611
268 Ga0068867_100003973 3300005459 Bacteria 10399
269 Ga0068867_100015911 3300005459 Bacteria 5340
270 Ga0068867_100022344 3300005459 Bacteria 4523
271 Ga0068867_100059048 3300005459 Bacteria 2843
272 Ga0068867_100339854 3300005459 Bacteria 1250
273 Ga0068867_100944099 3300005459 Bacteria 779
274 Ga0070685_10000863 3300005466 Bacteria 16477
275 Ga0070685_10008064 3300005466 Bacteria 5398
276 Ga0070685_10040074 3300005466 Bacteria 2664
277 Ga0070685_10180205 3300005466 Bacteria 1359
278 Ga0070706_100000140 3300005467 Bacteria 91590
279 Ga0070706_100000168 3300005467 Bacteria 83481
280 Ga0070706_100000995 3300005467 Bacteria 30813
281 Ga0070706_100006254 3300005467 Bacteria 11262
282 Ga0070706_100022267 3300005467 Bacteria 5834
283 Ga0070706_100040516 3300005467 Bacteria 4300
284 Ga0070706_100055018 3300005467 Bacteria 3673
285 Ga0070706_100060528 3300005467 Bacteria 3495
286 Ga0070706_100063730 3300005467 Bacteria 3406
287 Ga0070706_100068520 3300005467 Bacteria 3281
288 Ga0070706_100070785 3300005467 Bacteria 3226
289 Ga0070706_100096579 3300005467 Bacteria 2743
290 Ga0070706_100114135 3300005467 Bacteria 2515
291 Ga0070706_100166575 3300005467 Bacteria 2058
292 Ga0070706_100182525 3300005467 Bacteria 1959
293 Ga0070706_100191090 3300005467 Bacteria 1913
294 Ga0070706_100201956 3300005467 Bacteria 1857
295 Ga0070706_100293234 3300005467 Unclassified 1518
296 Ga0070706_100324926 3300005467 Bacteria 1435
297 Ga0070706_100391149 3300005467 Bacteria 1294
298 Ga0070706_100799926 3300005467 Bacteria 873
299 Ga0070706_101204311 3300005467 Bacteria 696
300 Ga0070706_101321633 3300005467 Bacteria 661
301 Ga0070707_100000111 3300005468 Bacteria 75249
302 Ga0070707_100000283 3300005468 Bacteria 49854
303 Ga0070707_100019471 3300005468 Bacteria 6394
304 Ga0070707_100025730 3300005468 Bacteria 5586
305 Ga0070707_100027689 3300005468 Bacteria 5391
306 Ga0070707_100031756 3300005468 Bacteria 5031
307 Ga0070707_100040587 3300005468 Bacteria 4453
308 Ga0070707_100072623 3300005468 Bacteria 3316
309 Ga0070707_100098692 3300005468 Bacteria 2829
310 Ga0070707_100114696 3300005468 Bacteria 2614
311 Ga0070707_100157645 3300005468 Bacteria 2211
312 Ga0070707_100214265 3300005468 Bacteria 1877
313 Ga0070707_100246368 3300005468 Bacteria 1739
314 Ga0070707_100272168 3300005468 Bacteria 1646
315 Ga0070707_100291996 3300005468 Bacteria 1584
316 Ga0070707_100333236 3300005468 Bacteria 1474
317 Ga0070707_100374859 3300005468 Bacteria 1383
318 Ga0070707_100444174 3300005468 Bacteria 1257
319 Ga0070707_100859019 3300005468 Bacteria 872
320 Ga0070707_100899476 3300005468 Bacteria 850
321 Ga0070707_101566510 3300005468 Bacteria 626
322 Ga0070698_100022150 3300005471 Bacteria 6652
323 Ga0070698_100022198 3300005471 Bacteria 6645
324 Ga0070698_100035981 3300005471 Bacteria 5118
325 Ga0070698_100045715 3300005471 Bacteria 4480
326 Ga0070698_100059300 3300005471 Bacteria 3865
327 Ga0070698_100067967 3300005471 Bacteria 3582
328 Ga0070698_100077918 3300005471 Bacteria 3313
329 Ga0070698_100084781 3300005471 Bacteria 3156
330 Ga0070698_100086621 3300005471 Bacteria 3118
331 Ga0070698_100111220 3300005471 Bacteria 2704
332 Ga0070698_100128772 3300005471 Bacteria 2487
333 Ga0070698_100197206 3300005471 Bacteria 1950
334 Ga0070698_100295485 3300005471 Unclassified 1551
335 Ga0070698_100353388 3300005471 Bacteria 1401
336 Ga0070698_100605385 3300005471 Bacteria 1036
337 Ga0070698_100647726 3300005471 Bacteria 998
338 Ga0070698_100892459 3300005471 Bacteria 834
339 Ga0070698_101040077 3300005471 Bacteria 766
340 Ga0070698_101657970 3300005471 Bacteria 592
341 Ga0070699_100001658 3300005518 Bacteria 20329
342 Ga0070699_100013625 3300005518 Bacteria 7000
343 Ga0070699_100015043 3300005518 Bacteria 6650
344 Ga0070699_100059853 3300005518 Bacteria 3299
345 Ga0070699_100063132 3300005518 Bacteria 3211
346 Ga0070699_100067618 3300005518 Bacteria 3103
347 Ga0070699_100069767 3300005518 Bacteria 3054
348 Ga0070699_100111653 3300005518 Bacteria 2400
349 Ga0070699_100185261 3300005518 Bacteria 1848
350 Ga0070699_100305530 3300005518 Bacteria 1427
351 Ga0070699_100326068 3300005518 Bacteria 1380
352 Ga0070699_100365295 3300005518 Bacteria 1301
353 Ga0070699_100621462 3300005518 Bacteria 986
354 Ga0070699_100760923 3300005518 Bacteria 886
355 Ga0070699_100874816 3300005518 Bacteria 823
356 Ga0070679_100045790 3300005530 Bacteria 4359
357 Ga0070679_100047495 3300005530 Bacteria 4279
358 Ga0070679_100072402 3300005530 Bacteria 3438
359 Ga0070679_100142692 3300005530 Bacteria 2374
360 Ga0070679_100264360 3300005530 Bacteria 1675
361 Ga0070679_100351098 3300005530 Bacteria 1422
362 Ga0070679_100490147 3300005530 Bacteria 1173
363 Ga0070679_100513984 3300005530 Bacteria 1141
364 Ga0070679_101068574 3300005530 Bacteria 752
365 Ga0070679_101165569 3300005530 Bacteria 716
366 Ga0070679_101480971 3300005530 Bacteria 625
367 Ga0070684_100094759 3300005535 Bacteria 2659
368 Ga0070684_100182697 3300005535 Bacteria 1907
369 Ga0070684_100470325 3300005535 Bacteria 1163
370 Ga0070684_100633893 3300005535 Bacteria 994
371 Ga0070684_101285047 3300005535 Bacteria 689
372 Ga0070697_100005254 3300005536 Bacteria 9942
373 Ga0070697_100011655 3300005536 Bacteria 6872
374 Ga0070697_100012567 3300005536 Bacteria 6633
375 Ga0070697_100020949 3300005536 Bacteria 5175
376 Ga0070697_100024867 3300005536 Bacteria 4770
377 Ga0070697_100081282 3300005536 Bacteria 2670
378 Ga0070697_100083729 3300005536 Bacteria 2630
379 Ga0070697_100094150 3300005536 Bacteria 2482
380 Ga0070697_100098142 3300005536 Bacteria 2431
381 Ga0070697_100105328 3300005536 Bacteria 2346
382 Ga0070697_100112069 3300005536 Bacteria 2275
383 Ga0070697_100129008 3300005536 Bacteria 2119
384 Ga0070697_100191338 3300005536 Bacteria 1737
385 Ga0070697_100313169 3300005536 Bacteria 1351
386 Ga0070697_100409951 3300005536 Bacteria 1177
387 Ga0070697_100529230 3300005536 Bacteria 1032
388 Ga0070697_101853254 3300005536 Bacteria 540
389 Ga0068853_100170002 3300005539 Bacteria 1972
390 Ga0068853_100902159 3300005539 Bacteria 849
391 Ga0068853_101354530 3300005539 Unclassified 688
392 Ga0068853_101926528 3300005539 Bacteria 573
393 Ga0070672_100000814 3300005543 Bacteria 18629
394 Ga0070672_100018717 3300005543 Bacteria 5014
395 Ga0070672_100190657 3300005543 Bacteria 1711
396 Ga0070672_100959890 3300005543 Bacteria 757
397 Ga0070686_100001124 3300005544 Bacteria 15369
398 Ga0070686_100004225 3300005544 Bacteria 7906
399 Ga0070686_100051249 3300005544 Bacteria 2627
400 Ga0070686_100117462 3300005544 Bacteria 1821
401 Ga0070686_100138801 3300005544 Bacteria 1689
402 Ga0070686_100245072 3300005544 Bacteria 1306
403 Ga0070686_100305771 3300005544 Bacteria 1181
404 Ga0070686_100457300 3300005544 Bacteria 983
405 Ga0070686_100537293 3300005544 Bacteria 913
406 Ga0070686_100844656 3300005544 Bacteria 741
407 Ga0070695_100023840 3300005545 Bacteria 3767
408 Ga0070695_100039268 3300005545 Bacteria 2991
409 Ga0070695_100061076 3300005545 Bacteria 2444
410 Ga0070695_100080457 3300005545 Bacteria 2153
411 Ga0070695_100219378 3300005545 Bacteria 1369
412 Ga0070695_100281197 3300005545 Bacteria 1223
413 Ga0070695_100350781 3300005545 Bacteria 1105
414 Ga0070695_100418512 3300005545 Bacteria 1020
415 Ga0070696_100005231 3300005546 Bacteria 8672
416 Ga0070696_100022083 3300005546 Bacteria 4321
417 Ga0070696_100026636 3300005546 Bacteria 3933
418 Ga0070696_100036052 3300005546 Bacteria 3408
419 Ga0070696_100036099 3300005546 Bacteria 3406
420 Ga0070696_100087322 3300005546 Bacteria 2215
421 Ga0070696_100145899 3300005546 Bacteria 1733
422 Ga0070696_100150009 3300005546 Bacteria 1710
423 Ga0070696_100157871 3300005546 Bacteria 1669
424 Ga0070696_100163875 3300005546 Bacteria 1639
425 Ga0070696_100173197 3300005546 Bacteria 1596
426 Ga0070696_100243067 3300005546 Bacteria 1359
427 Ga0070696_100511437 3300005546 Bacteria 957
428 Ga0070696_100602247 3300005546 Bacteria 886
429 Ga0070696_100831896 3300005546 Bacteria 762
430 Ga0070696_100846401 3300005546 Bacteria 756
431 Ga0070696_100922407 3300005546 Bacteria 726
432 Ga0070696_101151682 3300005546 Bacteria 654
433 Ga0070696_101611721 3300005546 Bacteria 558
434 Ga0070693_100161188 3300005547 Bacteria 1429
435 Ga0070693_100188757 3300005547 Bacteria 1332
436 Ga0070693_100594937 3300005547 Bacteria 798
437 Ga0070693_100673652 3300005547 Bacteria 755
438 Ga0070693_100913454 3300005547 Bacteria 659
439 Ga0070665_100102985 3300005548 Bacteria 2858
440 Ga0070665_100126155 3300005548 Bacteria 2562
441 Ga0070704_100012558 3300005549 Bacteria 5233
442 Ga0070704_100024831 3300005549 Bacteria 3937
443 Ga0070704_100111143 3300005549 Bacteria 2085
444 Ga0070704_100286681 3300005549 Bacteria 1367
445 Ga0070704_100407437 3300005549 Bacteria 1162
446 Ga0070704_100419539 3300005549 Bacteria 1146
447 Ga0070704_100516118 3300005549 Bacteria 1039
448 Ga0070704_100726529 3300005549 Bacteria 883
449 Ga0070704_101522351 3300005549 Bacteria 616
450 Ga0068855_100184800 3300005563 Bacteria 2355
451 Ga0068855_100285033 3300005563 Bacteria 1833
452 Ga0068855_100838238 3300005563 Bacteria 975
453 Ga0068855_101012716 3300005563 Bacteria 872
454 Ga0068855_101084860 3300005563 Bacteria 838
455 Ga0070664_100064709 3300005564 Bacteria 3119
456 Ga0070664_100076153 3300005564 Bacteria 2882
457 Ga0070664_100163539 3300005564 Bacteria 1970
458 Ga0070664_100212868 3300005564 Bacteria 1728
459 Ga0070664_100554005 3300005564 Bacteria 1063
460 Ga0070664_101572938 3300005564 Bacteria 623
461 Ga0070664_101598147 3300005564 Bacteria 617
462 Ga0068857_100007709 3300005577 Bacteria 9274
463 Ga0068857_100026972 3300005577 Bacteria 5067
464 Ga0068857_100298521 3300005577 Bacteria 1485
465 Ga0068857_100628296 3300005577 Bacteria 1016
466 Ga0068854_100252180 3300005578 Bacteria 1409
467 Ga0068854_100315447 3300005578 Bacteria 1269
468 Ga0068854_100524996 3300005578 Bacteria 1000
469 Ga0068854_100612048 3300005578 Bacteria 931
470 Ga0068854_100885870 3300005578 Bacteria 783
471 Ga0068856_100000152 3300005614 Bacteria 70736
472 Ga0068856_100545358 3300005614 Bacteria 1181
473 Ga0068856_101164077 3300005614 Bacteria 788
474 Ga0070702_100002572 3300005615 Bacteria 7884
475 Ga0070702_100027300 3300005615 Bacteria 3078
476 Ga0070702_100086340 3300005615 Bacteria 1892
477 Ga0070702_100480703 3300005615 Bacteria 908
478 Ga0070702_100821324 3300005615 Bacteria 721
479 Ga0070702_101199358 3300005615 Bacteria 612
480 Ga0068852_100014309 3300005616 Bacteria 6102
481 Ga0068852_100217744 3300005616 Bacteria 1814
482 Ga0068859_100003294 3300005617 Bacteria 16422
483 Ga0068859_100360678 3300005617 Bacteria 1548
484 Ga0068859_100920282 3300005617 Bacteria 959
485 Ga0068859_100932716 3300005617 Bacteria 952
486 Ga0068859_100995002 3300005617 Bacteria 921
487 Ga0068859_101541891 3300005617 Bacteria 734
488 Ga0068864_100063036 3300005618 Bacteria 3213
489 Ga0068864_100118277 3300005618 Bacteria 2366
490 Ga0068864_100436846 3300005618 Bacteria 1250
491 Ga0068864_100647786 3300005618 Bacteria 1028
492 Ga0068866_10459157 3300005718 Bacteria 835
493 Ga0068866_10645562 3300005718 Bacteria 720
494 Ga0068861_100043615 3300005719 Bacteria 3368
495 Ga0068861_100163313 3300005719 Bacteria 1839
496 Ga0068861_100168653 3300005719 Bacteria 1812
497 Ga0068861_100248922 3300005719 Unclassified 1515
498 Ga0068861_100414046 3300005719 Bacteria 1199
499 Ga0068861_100714089 3300005719 Bacteria 933
500 Ga0068861_100977511 3300005719 Bacteria 807
501 Ga0068861_101516818 3300005719 Bacteria 658
502 Ga0068861_101567749 3300005719 Bacteria 648
503 Ga0068861_101697594 3300005719 Bacteria 624
504 Ga0068861_102109153 3300005719 Bacteria 564
505 Ga0068861_102311227 3300005719 Bacteria 540
506 Ga0068851_10026746 3300005834 Bacteria 2838
507 Ga0068851_10117154 3300005834 Bacteria 1428
508 Ga0068851_10420493 3300005834 Bacteria 789
509 Ga0068870_10009812 3300005840 Bacteria 4369
510 Ga0068863_100050779 3300005841 Bacteria 3930
511 Ga0068863_100291287 3300005841 Bacteria 1582
512 Ga0068863_100354211 3300005841 Bacteria 1430
513 Ga0068863_100557092 3300005841 Bacteria 1132
514 Ga0068863_100609818 3300005841 Bacteria 1081
515 Ga0068863_101215630 3300005841 Bacteria 760
516 Ga0068858_100025878 3300005842 Bacteria 5457
517 Ga0068858_100027244 3300005842 Bacteria 5310
518 Ga0068858_100097407 3300005842 Bacteria 2742
519 Ga0068858_100345921 3300005842 Bacteria 1424
520 Ga0068858_100444460 3300005842 Bacteria 1249
521 Ga0068858_102352280 3300005842 Bacteria 527
522 Ga0068860_100024658 3300005843 Bacteria 5808
523 Ga0068860_100219879 3300005843 Bacteria 1844
524 Ga0068860_100255497 3300005843 Bacteria 1707
525 Ga0068860_100357592 3300005843 Bacteria 1438
526 Ga0068860_100363424 3300005843 Bacteria 1426
527 Ga0068860_100446044 3300005843 Bacteria 1286
528 Ga0068860_101902016 3300005843 Bacteria 617
529 Ga0068862_100347393 3300005844 Bacteria 1375
530 Ga0068862_100471727 3300005844 Bacteria 1186
531 Ga0068862_101257738 3300005844 Bacteria 740
532 Ga0068862_101484688 3300005844 Unclassified 683
533 Ga0081455_10005576 3300005937 Bacteria 13767
534 Ga0081455_10008121 3300005937 Bacteria 10953
535 Ga0081455_10056886 3300005937 Bacteria 3318
536 Ga0081455_10196141 3300005937 Bacteria 1516
537 Ga0081455_10923714 3300005937 Bacteria 542
538 Ga0081539_10002087 3300005985 Bacteria 29854
539 Ga0081539_10008949 3300005985 Bacteria 8531
540 Ga0070717_10006773 3300006028 Bacteria 8457
541 Ga0070717_10050855 3300006028 Bacteria 3408
542 Ga0075365_10041075 3300006038 Bacteria 3019
543 Ga0075365_11155775 3300006038 Bacteria 545
544 Ga0075432_10001610 3300006058 Bacteria 7423
545 Ga0075432_10036716 3300006058 Bacteria 1704
546 Ga0075432_10162871 3300006058 Bacteria 863
547 Ga0070715_10011050 3300006163 Bacteria 3238
548 Ga0070715_10062409 3300006163 Bacteria 1639
549 Ga0070715_10410749 3300006163 Bacteria 755
550 Ga0070715_10523934 3300006163 Bacteria 682
551 Ga0070716_100059186 3300006173 Bacteria 2208
552 Ga0070716_100131589 3300006173 Bacteria 1582
553 Ga0070716_100139653 3300006173 Bacteria 1543
554 Ga0070712_100036013 3300006175 Bacteria 3364
555 Ga0070712_100474285 3300006175 Bacteria 1045
556 Ga0075362_10093358 3300006177 Bacteria 1399
557 Ga0097621_100002102 3300006237 Bacteria 13652
558 Ga0097621_100068944 3300006237 Bacteria 2919
559 Ga0097621_100106638 3300006237 Bacteria 2363
560 Ga0097621_100167888 3300006237 Bacteria 1890
561 Ga0097621_100507413 3300006237 Bacteria 1093
562 Ga0068871_100034414 3300006358 Bacteria 4020
563 Ga0068871_100035806 3300006358 Bacteria 3947
564 Ga0068871_100056762 3300006358 Bacteria 3184
565 Ga0068871_100128052 3300006358 Bacteria 2150
566 Ga0068871_102205233 3300006358 Bacteria 525
567 Ga0075428_100003133 3300006844 Bacteria 18066
568 Ga0075428_100012905 3300006844 Bacteria 9294
569 Ga0075428_100022930 3300006844 Bacteria 6910
570 Ga0075428_100254454 3300006844 Bacteria 1892
571 Ga0075428_100269697 3300006844 Bacteria 1831
572 Ga0075428_100361304 3300006844 Bacteria 1557
573 Ga0075428_100701348 3300006844 Bacteria 1078
574 Ga0075430_100000588 3300006846 Bacteria 27574
575 Ga0075430_100002137 3300006846 Bacteria 16361
576 Ga0075430_100021465 3300006846 Bacteria 5489
577 Ga0075430_100040404 3300006846 Bacteria 3948
578 Ga0075430_101051983 3300006846 Bacteria 670
579 Ga0075431_100015841 3300006847 Bacteria 7644
580 Ga0075431_100018122 3300006847 Bacteria 7162
581 Ga0075431_100019518 3300006847 Bacteria 6913
582 Ga0075431_100380083 3300006847 Bacteria 1416
583 Ga0075431_100393143 3300006847 Bacteria 1389
584 Ga0075431_100471139 3300006847 Bacteria 1250
585 Ga0075431_100477433 3300006847 Bacteria 1240
586 Ga0075431_100822307 3300006847 Bacteria 901
587 Ga0075431_101058017 3300006847 Bacteria 777
588 Ga0075431_101152800 3300006847 Bacteria 739
589 Ga0075431_101291309 3300006847 Bacteria 691
590 Ga0075431_102050937 3300006847 Bacteria 527
591 Ga0075433_10002316 3300006852 Bacteria 14498
592 Ga0075433_10019795 3300006852 Bacteria 5616
593 Ga0075433_10087038 3300006852 Bacteria 2759
594 Ga0075433_10137891 3300006852 Bacteria 2168
595 Ga0075433_10192837 3300006852 Bacteria 1812
596 Ga0075433_10241315 3300006852 Bacteria 1604
597 Ga0075433_10626407 3300006852 Bacteria 944
598 Ga0075433_10673180 3300006852 Bacteria 907
599 Ga0075433_11040993 3300006852 Bacteria 712
600 Ga0075433_11336512 3300006852 Bacteria 620
601 Ga0075434_100062207 3300006871 Bacteria 3715
602 Ga0075434_100174205 3300006871 Bacteria 2171
603 Ga0075434_100187465 3300006871 Bacteria 2089
604 Ga0075434_100439876 3300006871 Bacteria 1325
605 Ga0075434_100455620 3300006871 Bacteria 1300
606 Ga0075434_100522270 3300006871 Bacteria 1207
607 Ga0075434_100824425 3300006871 Bacteria 943
608 Ga0075434_101899081 3300006871 Bacteria 601
609 Ga0075434_101899082 3300006871 Bacteria 601
610 Ga0075429_100024069 3300006880 Bacteria 5281
611 Ga0075429_100105220 3300006880 Bacteria 2465
612 Ga0075429_100165826 3300006880 Bacteria 1935
613 Ga0075429_100183916 3300006880 Bacteria 1831
614 Ga0075429_100303480 3300006880 Bacteria 1398
615 Ga0075429_100398876 3300006880 Bacteria 1205
616 Ga0075429_100628809 3300006880 Bacteria 940
617 Ga0075429_100750769 3300006880 Bacteria 855
618 Ga0075429_100905663 3300006880 Bacteria 772
619 Ga0068865_100001497 3300006881 Bacteria 13625
620 Ga0068865_100143096 3300006881 Bacteria 1805
621 Ga0068865_100325716 3300006881 Bacteria 1237
622 Ga0068865_100645142 3300006881 Bacteria 899
623 Ga0068865_100909939 3300006881 Bacteria 766
624 Ga0068865_101269468 3300006881 Bacteria 654
625 Ga0068865_101398398 3300006881 Bacteria 625
626 Ga0075436_100225089 3300006914 Bacteria 1332
627 Ga0075436_100294373 3300006914 Bacteria 1162
628 Ga0075436_100446227 3300006914 Bacteria 942
629 Ga0075436_100880694 3300006914 Bacteria 669
630 Ga0075436_100889375 3300006914 Bacteria 666
631 Ga0075436_100922877 3300006914 Bacteria 653
632 Ga0097620_100003294 3300006931 Bacteria 16422
633 Ga0097620_100360708 3300006931 Bacteria 1548
634 Ga0097620_100920235 3300006931 Bacteria 959
635 Ga0097620_100932632 3300006931 Bacteria 952
636 Ga0097620_100995016 3300006931 Bacteria 921
637 Ga0097620_101541950 3300006931 Bacteria 734
638 Ga0075435_100150024 3300007076 Bacteria 1959
639 Ga0075435_100231623 3300007076 Bacteria 1569
640 Ga0075435_100296879 3300007076 Bacteria 1381
641 Ga0075435_101242742 3300007076 Bacteria 652
642 Ga0075435_101548154 3300007076 Bacteria 581
643 Ga0099794_10009457 3300007265 Bacteria 4099
644 Ga0099795_10112703 3300007788 Bacteria 1079
645 Ga0105251_10066999 3300009011 Bacteria 1678
646 Ga0105244_10232819 3300009036 Bacteria 862
647 Ga0105240_10064917 3300009093 Bacteria 4534
648 Ga0105240_10090594 3300009093 Bacteria 3737
649 Ga0105240_10148104 3300009093 Bacteria 2799
650 Ga0105240_11036766 3300009093 Bacteria 876
651 Ga0111539_10006226 3300009094 Bacteria 15401
652 Ga0111539_10250891 3300009094 Bacteria 2060
653 Ga0111539_10295120 3300009094 Bacteria 1886
654 Ga0111539_10309164 3300009094 Bacteria 1839
655 Ga0111539_10390749 3300009094 Bacteria 1620
656 Ga0111539_11158523 3300009094 Bacteria 898
657 Ga0111539_11297903 3300009094 Bacteria 845
658 Ga0111539_11407654 3300009094 Bacteria 809
659 Ga0111539_11554000 3300009094 Bacteria 767
660 Ga0105245_10014061 3300009098 Bacteria 6972
661 Ga0105245_10220019 3300009098 Bacteria 1832
662 Ga0105245_10340589 3300009098 Bacteria 1483
663 Ga0105245_10432290 3300009098 Bacteria 1321
664 Ga0105245_10573958 3300009098 Bacteria 1152
665 Ga0105245_10584585 3300009098 Bacteria 1142
666 Ga0105245_10698274 3300009098 Bacteria 1048
667 Ga0105245_11008286 3300009098 Bacteria 877
668 Ga0105245_11234931 3300009098 Bacteria 795
669 Ga0105245_11399253 3300009098 Bacteria 749
670 Ga0105245_11533842 3300009098 Bacteria 717
671 Ga0105247_10315987 3300009101 Bacteria 1088
672 Ga0105247_10432455 3300009101 Bacteria 945
673 Ga0105247_11553129 3300009101 Bacteria 542
674 Ga0105247_11636609 3300009101 Bacteria 530
675 Ga0114129_10041863 3300009147 Bacteria 6449
676 Ga0114129_10049814 3300009147 Bacteria 5885
677 Ga0114129_10068233 3300009147 Bacteria 4958
678 Ga0114129_10094080 3300009147 Bacteria 4151
679 Ga0114129_10095663 3300009147 Bacteria 4113
680 Ga0114129_10179724 3300009147 Bacteria 2880
681 Ga0114129_10181666 3300009147 Bacteria 2862
682 Ga0114129_10293075 3300009147 Bacteria 2171
683 Ga0114129_10349108 3300009147 Bacteria 1960
684 Ga0114129_10414344 3300009147 Bacteria 1773
685 Ga0114129_10429027 3300009147 Bacteria 1737
686 Ga0114129_10485874 3300009147 Bacteria 1615
687 Ga0114129_10497985 3300009147 Bacteria 1592
688 Ga0114129_10562579 3300009147 Bacteria 1481
689 Ga0114129_10887329 3300009147 Bacteria 1131
690 Ga0114129_11025262 3300009147 Bacteria 1038
691 Ga0114129_11574178 3300009147 Bacteria 805
692 Ga0114129_11891780 3300009147 Bacteria 724
693 Ga0114129_12175656 3300009147 Bacteria 668
694 Ga0105243_10031684 3300009148 Bacteria 4078
695 Ga0105243_10104801 3300009148 Bacteria 2355
696 Ga0105243_10295641 3300009148 Bacteria 1465
697 Ga0105243_10422348 3300009148 Bacteria 1244
698 Ga0105243_10432124 3300009148 Bacteria 1231
699 Ga0105243_10442039 3300009148 Bacteria 1218
700 Ga0105243_10490865 3300009148 Unclassified 1161
701 Ga0105243_10890771 3300009148 Bacteria 884
702 Ga0105243_10973445 3300009148 Bacteria 849
703 Ga0105243_11412680 3300009148 Bacteria 717
704 Ga0105243_11906794 3300009148 Bacteria 627
705 Ga0105241_10193869 3300009174 Bacteria 1693
706 Ga0105241_10243861 3300009174 Bacteria 1520
707 Ga0105241_10340328 3300009174 Bacteria 1299
708 Ga0105241_11458897 3300009174 Bacteria 657
709 Ga0105241_11962050 3300009174 Bacteria 575
710 Ga0105242_10009998 3300009176 Bacteria 7265
711 Ga0105242_10010482 3300009176 Bacteria 7114
712 Ga0105242_10245777 3300009176 Bacteria 1610
713 Ga0105242_10499044 3300009176 Bacteria 1157
714 Ga0105242_10805022 3300009176 Bacteria 930
715 Ga0105242_11037281 3300009176 Bacteria 830
716 Ga0105242_11097813 3300009176 Bacteria 809
717 Ga0105242_11324758 3300009176 Bacteria 745
718 Ga0105248_10003907 3300009177 Bacteria 16480
719 Ga0105248_10085442 3300009177 Bacteria 3550
720 Ga0105248_10812014 3300009177 Bacteria 1056
721 Ga0105237_10000098 3300009545 Bacteria 121026
722 Ga0105237_10070414 3300009545 Bacteria 3494
723 Ga0105237_10373750 3300009545 Bacteria 1430
724 Ga0105237_10479206 3300009545 Bacteria 1250
725 Ga0105237_10480283 3300009545 Bacteria 1249
726 Ga0105237_10713533 3300009545 Bacteria 1009
727 Ga0105237_11443976 3300009545 Bacteria 694
728 Ga0105238_10082559 3300009551 Bacteria 3203
729 Ga0105238_10245623 3300009551 Bacteria 1768
730 Ga0105238_10418322 3300009551 Bacteria 1335
731 Ga0105238_10781251 3300009551 Bacteria 970
732 Ga0105238_11251296 3300009551 Bacteria 767
733 Ga0105249_10019204 3300009553 Bacteria 6095
734 Ga0105249_10040796 3300009553 Bacteria 4217
735 Ga0105249_10041294 3300009553 Bacteria 4193
736 Ga0105249_10155332 3300009553 Bacteria 2206
737 Ga0105249_10158745 3300009553 Bacteria 2184
738 Ga0105249_10324804 3300009553 Bacteria 1551
739 Ga0105249_10691270 3300009553 Bacteria 1080
740 Ga0105249_10778011 3300009553 Bacteria 1020
741 Ga0105249_11304932 3300009553 Bacteria 797
742 Ga0105249_11817602 3300009553 Bacteria 682
743 Ga0105249_12629947 3300009553 Bacteria 575
744 Ga0105249_12814706 3300009553 Bacteria 558
745 Ga0105239_10077653 3300010375 Bacteria 3654
746 Ga0105239_10096633 3300010375 Bacteria 3263
747 Ga0105239_10115240 3300010375 Bacteria 2981
748 Ga0105239_10336214 3300010375 Bacteria 1704
749 Ga0105239_11118544 3300010375 Bacteria 907
750 Ga0105239_11394479 3300010375 Bacteria 809
751 Ga0105239_12080710 3300010375 Bacteria 659
752 Ga0105246_10010030 3300011119 Bacteria 5845
753 Ga0105246_10041027 3300011119 Bacteria 3127
754 Ga0105246_10142341 3300011119 Bacteria 1805
755 Ga0105246_10338561 3300011119 Bacteria 1229
756 Ga0105246_10367397 3300011119 Bacteria 1184
757 Ga0105246_11013118 3300011119 Bacteria 753
758 Ga0105246_11667139 3300011119 Bacteria 605
759 Ga0157373_10260023 3300013100 Bacteria 1228
760 Ga0157373_10305854 3300013100 Bacteria 1129
761 Ga0157371_10077523 3300013102 Bacteria 2353
762 Ga0157371_10091156 3300013102 Bacteria 2159
763 Ga0157371_10214504 3300013102 Bacteria 1382
764 Ga0157371_10273902 3300013102 Bacteria 1218
765 Ga0157370_10177592 3300013104 Bacteria 1979
766 Ga0157370_10555983 3300013104 Bacteria 1052
767 Ga0157369_10116026 3300013105 Bacteria 2843
768 Ga0157369_11379244 3300013105 Bacteria 718
769 Ga0157369_12126948 3300013105 Bacteria 569
770 Ga0157374_10003807 3300013296 Bacteria 12679
771 Ga0157374_10022085 3300013296 Bacteria 5672
772 Ga0157374_10063069 3300013296 Bacteria 3476
773 Ga0157374_10169202 3300013296 Bacteria 2131
774 Ga0157374_10318044 3300013296 Bacteria 1542
775 Ga0157374_11596528 3300013296 Bacteria 676
776 Ga0157378_10009800 3300013297 Bacteria 8351
777 Ga0157378_10012024 3300013297 Bacteria 7576
778 Ga0157378_10015276 3300013297 Bacteria 6724
779 Ga0157378_10115443 3300013297 Bacteria 2467
780 Ga0157378_10446809 3300013297 Bacteria 1282
781 Ga0157378_11885371 3300013297 Bacteria 647
782 Ga0163162_10088800 3300013306 Bacteria 3170
783 Ga0163162_10404229 3300013306 Bacteria 1498
784 Ga0163162_10405633 3300013306 Bacteria 1496
785 Ga0163162_11118711 3300013306 Bacteria 893
786 Ga0163162_12425167 3300013306 Bacteria 603
787 Ga0157372_10201229 3300013307 Bacteria 2307
788 Ga0157372_10513444 3300013307 Bacteria 1397
789 Ga0157372_10544893 3300013307 Bacteria 1352
790 Ga0157372_11122319 3300013307 Bacteria 909
791 Ga0157372_12233444 3300013307 Bacteria 629
792 Ga0157372_12473555 3300013307 Bacteria 596
793 Ga0157372_12559456 3300013307 Bacteria 586
794 Ga0157375_10005218 3300013308 Bacteria 11273
795 Ga0157375_10182940 3300013308 Bacteria 2248
796 Ga0157375_10191311 3300013308 Bacteria 2201
797 Ga0157375_10206957 3300013308 Bacteria 2119
798 Ga0157375_11107477 3300013308 Bacteria 927
799 Ga0157375_11393380 3300013308 Bacteria 826
800 Ga0157375_13464759 3300013308 Bacteria 525
801 Ga0163163_10045938 3300014325 Bacteria 4288
802 Ga0163163_10083913 3300014325 Bacteria 3192
803 Ga0163163_10398758 3300014325 Bacteria 1434
804 Ga0163163_10961492 3300014325 Bacteria 917
805 Ga0163163_11257827 3300014325 Bacteria 802
806 Ga0163163_12580993 3300014325 Bacteria 566
807 Ga0157380_10012801 3300014326 Bacteria 6096
808 Ga0157380_10017794 3300014326 Bacteria 5265
809 Ga0157380_10067299 3300014326 Bacteria 2884
810 Ga0157380_10247850 3300014326 Bacteria 1610
811 Ga0157380_10396287 3300014326 Bacteria 1308
812 Ga0182008_10292696 3300014497 Bacteria 850
813 Ga0157377_10010666 3300014745 Bacteria 4555
814 Ga0157377_10036627 3300014745 Bacteria 2700
815 Ga0157377_10080795 3300014745 Bacteria 1900
816 Ga0157377_10109224 3300014745 Bacteria 1660
817 Ga0157377_10250980 3300014745 Bacteria 1147
818 Ga0157377_10343700 3300014745 Bacteria 999
819 Ga0157377_10356555 3300014745 Bacteria 983
820 Ga0157379_10147692 3300014968 Bacteria 2120
821 Ga0157379_10255160 3300014968 Bacteria 1593
822 Ga0157379_10390209 3300014968 Bacteria 1278
823 Ga0157379_10600740 3300014968 Bacteria 1027
824 Ga0157379_10805752 3300014968 Bacteria 887
825 Ga0157379_11425588 3300014968 Bacteria 672
826 Ga0157379_11447112 3300014968 Bacteria 667
827 Ga0157379_11767007 3300014968 Bacteria 607
828 Ga0157379_11901775 3300014968 Bacteria 586
829 Ga0157376_10001600 3300014969 Bacteria 14982
830 Ga0157376_10001658 3300014969 Bacteria 14789
831 Ga0157376_10009134 3300014969 Bacteria 7188
832 Ga0157376_10348948 3300014969 Bacteria 1416
833 Ga0157376_10354067 3300014969 Bacteria 1406
834 Ga0157376_10705859 3300014969 Bacteria 1014
835 Ga0157376_10744630 3300014969 Bacteria 989
836 Ga0157376_11158000 3300014969 Bacteria 800
837 Ga0182006_1115909 3300015261 Bacteria 936
838 Ga0182005_1155686 3300015265 Bacteria 667
839 Ga0163161_10318172 3300017792 Bacteria 1229
840 Ga0163161_10576326 3300017792 Bacteria 925
841 Ga0197907_10029214 3300020069 Bacteria 7558
842 Ga0197907_10105904 3300020069 Bacteria 3716
843 Ga0197907_10232807 3300020069 Bacteria 3363
844 Ga0197907_10423327 3300020069 Bacteria 8039
845 Ga0197907_10495234 3300020069 Bacteria 3927
846 Ga0197907_10731140 3300020069 Bacteria 1582
847 Ga0197907_11186427 3300020069 Bacteria 1021
848 Ga0197907_11192626 3300020069 Bacteria 1867
849 Ga0197907_11249689 3300020069 Bacteria 1003
850 Ga0197907_11472800 3300020069 Bacteria 1812
851 Ga0206356_10181064 3300020070 Bacteria 582
852 Ga0206356_10228368 3300020070 Bacteria 1541
853 Ga0206356_10462065 3300020070 Bacteria 6237
854 Ga0206356_10579236 3300020070 Bacteria 1806
855 Ga0206356_10923812 3300020070 Bacteria 1917
856 Ga0206356_11037950 3300020070 Bacteria 1934
857 Ga0206356_11084074 3300020070 Bacteria 1514
858 Ga0206356_11233718 3300020070 Bacteria 799
859 Ga0206356_11354161 3300020070 Bacteria 839
860 Ga0206356_11756300 3300020070 Bacteria 3259
861 Ga0206356_11776225 3300020070 Bacteria 764
862 Ga0206356_11785593 3300020070 Bacteria 861
863 Ga0206349_1135626 3300020075 Bacteria 1646
864 Ga0206349_1227347 3300020075 Bacteria 2157
865 Ga0206349_1457425 3300020075 Bacteria 871
866 Ga0206349_1484624 3300020075 Bacteria 1698
867 Ga0206349_1509634 3300020075 Bacteria 1144
868 Ga0206349_1547337 3300020075 Bacteria 1765
869 Ga0206349_1956745 3300020075 Bacteria 2167
870 Ga0206355_1059106 3300020076 Bacteria 772
871 Ga0206355_1126656 3300020076 Bacteria 7571
872 Ga0206355_1204451 3300020076 Bacteria 1592
873 Ga0206355_1228183 3300020076 Bacteria 2047
874 Ga0206355_1397941 3300020076 Bacteria 798
875 Ga0206355_1424628 3300020076 Bacteria 1311
876 Ga0206355_1619390 3300020076 Bacteria 1440
877 Ga0206355_1649746 3300020076 Bacteria 3309
878 Ga0206355_1697341 3300020076 Bacteria 738
879 Ga0206351_10104184 3300020077 Bacteria 2973
880 Ga0206351_10240216 3300020077 Bacteria 925
881 Ga0206351_10270062 3300020077 Bacteria 2188
882 Ga0206351_10293265 3300020077 Bacteria 4231
883 Ga0206351_10424091 3300020077 Bacteria 513
884 Ga0206351_10486635 3300020077 Bacteria 689
885 Ga0206351_10748140 3300020077 Bacteria 881
886 Ga0206351_10945886 3300020077 Bacteria 1626
887 Ga0206351_10946680 3300020077 Bacteria 1119
888 Ga0206351_10961155 3300020077 Bacteria 869
889 Ga0206352_10036494 3300020078 Bacteria 7122
890 Ga0206352_10098864 3300020078 Bacteria 10133
891 Ga0206352_10236499 3300020078 Bacteria 963
892 Ga0206352_10247071 3300020078 Bacteria 3581
893 Ga0206352_10464430 3300020078 Bacteria 1080
894 Ga0206352_10737257 3300020078 Bacteria 528
895 Ga0206352_10878229 3300020078 Bacteria 2673
896 Ga0206352_10974552 3300020078 Bacteria 976
897 Ga0206352_11068968 3300020078 Bacteria 1181
898 Ga0206352_11079348 3300020078 Bacteria 1866
899 Ga0206352_11196914 3300020078 Bacteria 908
900 Ga0206352_11358661 3300020078 Bacteria 955
901 Ga0206350_10135750 3300020080 Bacteria 8772
902 Ga0206350_10393876 3300020080 Bacteria 2969
903 Ga0206350_10435996 3300020080 Bacteria 3016
904 Ga0206350_10470390 3300020080 Bacteria 936
905 Ga0206350_10778320 3300020080 Bacteria 3944
906 Ga0206350_10807924 3300020080 Bacteria 9631
907 Ga0206350_10844455 3300020080 Bacteria 2230
908 Ga0206350_10982794 3300020080 Bacteria 2271
909 Ga0206350_11120877 3300020080 Bacteria 4231
910 Ga0206350_11128874 3300020080 Bacteria 1205
911 Ga0206350_11400909 3300020080 Bacteria 1681
912 Ga0206350_11423239 3300020080 Bacteria 2405
913 Ga0206350_11661224 3300020080 Bacteria 4274
914 Ga0206354_10083900 3300020081 Bacteria 7552
915 Ga0206354_10085906 3300020081 Bacteria 1922
916 Ga0206354_10326820 3300020081 Bacteria 1441
917 Ga0206354_10662061 3300020081 Bacteria 4064
918 Ga0206354_10842494 3300020081 Bacteria 930
919 Ga0206354_10904125 3300020081 Bacteria 2693
920 Ga0206354_11101861 3300020081 Bacteria 3294
921 Ga0206354_11376218 3300020081 Bacteria 1504
922 Ga0206353_10140992 3300020082 Bacteria 822
923 Ga0206353_10270052 3300020082 Bacteria 7653
924 Ga0206353_10478352 3300020082 Bacteria 964
925 Ga0206353_10771970 3300020082 Bacteria 1601
926 Ga0206353_10790861 3300020082 Bacteria 953
927 Ga0206353_11451431 3300020082 Bacteria 2976
928 Ga0206353_11680741 3300020082 Bacteria 2612
929 Ga0206353_11847314 3300020082 Bacteria 699
930 Ga0154015_1078441 3300020610 Bacteria 3394
931 Ga0154015_1169410 3300020610 Bacteria 953
932 Ga0213873_10047578 3300021358 Bacteria 1125
933 Ga0213873_10166647 3300021358 Bacteria 670
934 Ga0213874_10000323 3300021377 Bacteria 9496
935 Ga0213874_10006070 3300021377 Bacteria 2842
936 Ga0213874_10324850 3300021377 Bacteria 584
937 Ga0213875_10012755 3300021388 Bacteria 4139
938 Ga0213875_10018595 3300021388 Bacteria 3349
939 Ga0213875_10023804 3300021388 Bacteria 2923
940 Ga0213875_10031998 3300021388 Bacteria 2486
941 Ga0224712_10000464 3300022467 Bacteria 8141
942 Ga0224712_10004473 3300022467 Bacteria 3777
943 Ga0224712_10004886 3300022467 Bacteria 3671
944 Ga0224712_10005022 3300022467 Bacteria 3637
945 Ga0224712_10006776 3300022467 Bacteria 3293
946 Ga0224712_10008083 3300022467 Bacteria 3095
947 Ga0224712_10008119 3300022467 Bacteria 3092
948 Ga0224712_10009432 3300022467 Bacteria 2941
949 Ga0224712_10010011 3300022467 Bacteria 2881
950 Ga0224712_10012791 3300022467 Bacteria 2653
951 Ga0224712_10103090 3300022467 Bacteria 1213
952 Ga0224712_10194212 3300022467 Bacteria 920
953 Ga0224712_10229916 3300022467 Bacteria 851
954 Ga0224712_10328926 3300022467 Bacteria 719
955 Ga0207697_10376602 3300025315 Bacteria 630
956 Ga0207656_10084626 3300025321 Bacteria 1431
957 Ga0207656_10201733 3300025321 Bacteria 961
958 Ga0207653_10067529 3300025885 Bacteria 1217
959 Ga0207653_10131704 3300025885 Bacteria 908
960 Ga0207653_10158351 3300025885 Bacteria 837
961 Ga0207682_10131512 3300025893 Bacteria 1117
962 Ga0207692_10156747 3300025898 Bacteria 1309
963 Ga0207692_10475520 3300025898 Bacteria 790
964 Ga0207642_10085841 3300025899 Bacteria 1541
965 Ga0207710_10197400 3300025900 Bacteria 993
966 Ga0207688_10006416 3300025901 Bacteria 6406
967 Ga0207688_10046109 3300025901 Bacteria 2433
968 Ga0207688_10110432 3300025901 Bacteria 1596
969 Ga0207680_10010129 3300025903 Bacteria 4705
970 Ga0207680_10037770 3300025903 Bacteria 2790
971 Ga0207647_10022808 3300025904 Bacteria 4152
972 Ga0207647_10044754 3300025904 Bacteria 2764
973 Ga0207647_10259300 3300025904 Bacteria 996
974 Ga0207699_10000269 3300025906 Bacteria 28596
975 Ga0207699_10974032 3300025906 Bacteria 627
976 Ga0207645_10002565 3300025907 Bacteria 14177
977 Ga0207645_10006914 3300025907 Bacteria 8087
978 Ga0207645_10090612 3300025907 Bacteria 1966
979 Ga0207645_10241565 3300025907 Bacteria 1193
980 Ga0207643_10025530 3300025908 Bacteria 3266
981 Ga0207643_10142998 3300025908 Bacteria 1430
982 Ga0207705_10009886 3300025909 Bacteria 6947
983 Ga0207705_10033725 3300025909 Bacteria 3657
984 Ga0207705_10147662 3300025909 Bacteria 1760
985 Ga0207684_10000113 3300025910 Bacteria 150344
986 Ga0207684_10001422 3300025910 Bacteria 25935
987 Ga0207684_10005489 3300025910 Bacteria 11682
988 Ga0207684_10007582 3300025910 Bacteria 9750
989 Ga0207684_10009118 3300025910 Bacteria 8788
990 Ga0207684_10023984 3300025910 Bacteria 5205
991 Ga0207684_10041213 3300025910 Bacteria 3916
992 Ga0207684_10083263 3300025910 Bacteria 2724
993 Ga0207684_10116383 3300025910 Bacteria 2290
994 Ga0207684_10117351 3300025910 Bacteria 2280
995 Ga0207684_10137650 3300025910 Bacteria 2098
996 Ga0207684_10193359 3300025910 Bacteria 1755
997 Ga0207684_10429254 3300025910 Bacteria 1135
998 Ga0207684_10450584 3300025910 Bacteria 1105
999 Ga0207684_10500693 3300025910 Bacteria 1041
1000 Ga0207684_10644361 3300025910 Bacteria 903
1001 Ga0207684_10660313 3300025910 Bacteria 890
1002 Ga0207684_10868241 3300025910 Bacteria 760
1003 Ga0207654_10409248 3300025911 Bacteria 944
1004 Ga0207654_10527531 3300025911 Bacteria 837
1005 Ga0207707_10003270 3300025912 Bacteria 14394
1006 Ga0207707_10037372 3300025912 Bacteria 4244
1007 Ga0207707_10188579 3300025912 Bacteria 1799
1008 Ga0207707_10215340 3300025912 Bacteria 1672
1009 Ga0207707_10277469 3300025912 Bacteria 1452
1010 Ga0207707_10382437 3300025912 Bacteria 1210
1011 Ga0207707_10441426 3300025912 Bacteria 1114
1012 Ga0207707_10616414 3300025912 Bacteria 917
1013 Ga0207707_11209747 3300025912 Bacteria 611
1014 Ga0207695_10277689 3300025913 Bacteria 1569
1015 Ga0207695_10369800 3300025913 Bacteria 1320
1016 Ga0207671_10001979 3300025914 Bacteria 22598
1017 Ga0207671_10026911 3300025914 Bacteria 4303
1018 Ga0207671_10268711 3300025914 Bacteria 1343
1019 Ga0207671_10736696 3300025914 Unclassified 783
1020 Ga0207693_10226817 3300025915 Bacteria 1467
1021 Ga0207693_10398560 3300025915 Bacteria 1076
1022 Ga0207693_10729921 3300025915 Bacteria 766
1023 Ga0207663_10107637 3300025916 Bacteria 1886
1024 Ga0207663_10108313 3300025916 Bacteria 1881
1025 Ga0207663_10248014 3300025916 Bacteria 1309
1026 Ga0207660_10000002 3300025917 Bacteria 883566
1027 Ga0207660_10009536 3300025917 Bacteria 6284
1028 Ga0207660_10053734 3300025917 Bacteria 2872
1029 Ga0207660_10389228 3300025917 Bacteria 1121
1030 Ga0207660_10797542 3300025917 Bacteria 771
1031 Ga0207660_11072715 3300025917 Bacteria 657
1032 Ga0207662_10060129 3300025918 Bacteria 2278
1033 Ga0207662_10072041 3300025918 Bacteria 2093
1034 Ga0207662_10109621 3300025918 Bacteria 1720
1035 Ga0207662_10115459 3300025918 Bacteria 1678
1036 Ga0207662_10210422 3300025918 Bacteria 1262
1037 Ga0207662_10236528 3300025918 Bacteria 1194
1038 Ga0207662_10257100 3300025918 Bacteria 1148
1039 Ga0207662_10304106 3300025918 Bacteria 1061
1040 Ga0207657_10010969 3300025919 Bacteria 9012
1041 Ga0207657_10150992 3300025919 Bacteria 1892
1042 Ga0207657_10166107 3300025919 Bacteria 1790
1043 Ga0207657_10316729 3300025919 Bacteria 1234
1044 Ga0207657_10394246 3300025919 Bacteria 1089
1045 Ga0207657_10997487 3300025919 Bacteria 643
1046 Ga0207657_11005196 3300025919 Bacteria 640
1047 Ga0207657_11055538 3300025919 Bacteria 622
1048 Ga0207657_11209231 3300025919 Bacteria 574
1049 Ga0207649_10004596 3300025920 Bacteria 7479
1050 Ga0207649_10058499 3300025920 Bacteria 2414
1051 Ga0207649_10166307 3300025920 Bacteria 1532
1052 Ga0207649_10816113 3300025920 Bacteria 729
1053 Ga0207652_10030410 3300025921 Bacteria 4523
1054 Ga0207652_10073748 3300025921 Bacteria 2970
1055 Ga0207652_10187711 3300025921 Bacteria 1859
1056 Ga0207652_10201147 3300025921 Bacteria 1792
1057 Ga0207652_10287783 3300025921 Bacteria 1483
1058 Ga0207652_10707519 3300025921 Bacteria 898
1059 Ga0207652_11001933 3300025921 Bacteria 734
1060 Ga0207652_11412572 3300025921 Bacteria 599
1061 Ga0207646_10000163 3300025922 Bacteria 90731
1062 Ga0207646_10000786 3300025922 Bacteria 41153
1063 Ga0207646_10001781 3300025922 Bacteria 26103
1064 Ga0207646_10004216 3300025922 Bacteria 15739
1065 Ga0207646_10007018 3300025922 Bacteria 11537
1066 Ga0207646_10009625 3300025922 Bacteria 9534
1067 Ga0207646_10018744 3300025922 Bacteria 6450
1068 Ga0207646_10032894 3300025922 Bacteria 4690
1069 Ga0207646_10067322 3300025922 Bacteria 3197
1070 Ga0207646_10086088 3300025922 Bacteria 2811
1071 Ga0207646_10101533 3300025922 Bacteria 2579
1072 Ga0207646_10153826 3300025922 Bacteria 2074
1073 Ga0207646_10187082 3300025922 Bacteria 1870
1074 Ga0207646_10210668 3300025922 Bacteria 1755
1075 Ga0207646_10413382 3300025922 Bacteria 1218
1076 Ga0207646_11381839 3300025922 Bacteria 613
1077 Ga0207681_10066557 3300025923 Bacteria 2494
1078 Ga0207681_10209283 3300025923 Bacteria 1502
1079 Ga0207681_11488010 3300025923 Bacteria 568
1080 Ga0207694_10210828 3300025924 Bacteria 1582
1081 Ga0207650_10029357 3300025925 Bacteria 3953
1082 Ga0207650_10075372 3300025925 Bacteria 2546
1083 Ga0207650_10244284 3300025925 Bacteria 1451
1084 Ga0207659_10000959 3300025926 Bacteria 17245
1085 Ga0207659_10003367 3300025926 Bacteria 9583
1086 Ga0207659_10255671 3300025926 Bacteria 1423
1087 Ga0207659_10317565 3300025926 Bacteria 1284
1088 Ga0207659_10597063 3300025926 Bacteria 941
1089 Ga0207659_11022496 3300025926 Bacteria 711
1090 Ga0207687_10024076 3300025927 Bacteria 4064
1091 Ga0207687_10046120 3300025927 Bacteria 3016
1092 Ga0207687_10205866 3300025927 Bacteria 1541
1093 Ga0207687_10502900 3300025927 Bacteria 1012
1094 Ga0207687_10533196 3300025927 Bacteria 983
1095 Ga0207687_10651287 3300025927 Bacteria 891
1096 Ga0207687_11205069 3300025927 Bacteria 651
1097 Ga0207687_11329612 3300025927 Bacteria 618
1098 Ga0207700_10402690 3300025928 Unclassified 1199
1099 Ga0207700_11083385 3300025928 Bacteria 716
1100 Ga0207664_10565687 3300025929 Bacteria 1020
1101 Ga0207664_11338838 3300025929 Bacteria 636
1102 Ga0207664_11709689 3300025929 Bacteria 551
1103 Ga0207644_10021914 3300025931 Bacteria 4358
1104 Ga0207644_10522583 3300025931 Bacteria 981
1105 Ga0207644_10565490 3300025931 Bacteria 942
1106 Ga0207644_10969212 3300025931 Bacteria 713
1107 Ga0207690_10011728 3300025932 Bacteria 5241
1108 Ga0207690_10050244 3300025932 Bacteria 2783
1109 Ga0207690_10149522 3300025932 Bacteria 1730
1110 Ga0207690_10157476 3300025932 Bacteria 1690
1111 Ga0207690_10313627 3300025932 Bacteria 1231
1112 Ga0207706_10003528 3300025933 Bacteria 14934
1113 Ga0207706_10046490 3300025933 Bacteria 3842
1114 Ga0207706_10243834 3300025933 Bacteria 1571
1115 Ga0207706_10294773 3300025933 Bacteria 1414
1116 Ga0207706_10763179 3300025933 Bacteria 823
1117 Ga0207686_10011479 3300025934 Bacteria 4854
1118 Ga0207686_10098160 3300025934 Bacteria 1950
1119 Ga0207686_10448356 3300025934 Bacteria 992
1120 Ga0207686_11475520 3300025934 Bacteria 560
1121 Ga0207709_10002980 3300025935 Bacteria 10315
1122 Ga0207709_10215331 3300025935 Bacteria 1381
1123 Ga0207709_10299193 3300025935 Bacteria 1196
1124 Ga0207670_10000946 3300025936 Bacteria 15304
1125 Ga0207670_10012034 3300025936 Bacteria 5043
1126 Ga0207670_10489426 3300025936 Bacteria 997
1127 Ga0207670_10562005 3300025936 Bacteria 933
1128 Ga0207669_10001939 3300025937 Bacteria 8773
1129 Ga0207669_10005197 3300025937 Bacteria 5815
1130 Ga0207669_10022441 3300025937 Bacteria 3353
1131 Ga0207669_10230879 3300025937 Bacteria 1365
1132 Ga0207669_10253356 3300025937 Bacteria 1312
1133 Ga0207669_10696374 3300025937 Bacteria 835
1134 Ga0207669_11751074 3300025937 Bacteria 531
1135 Ga0207669_11844925 3300025937 Bacteria 517
1136 Ga0207704_10005205 3300025938 Bacteria 5989
1137 Ga0207704_10017148 3300025938 Bacteria 3746
1138 Ga0207704_10180606 3300025938 Bacteria 1524
1139 Ga0207704_10271451 3300025938 Bacteria 1284
1140 Ga0207704_11246572 3300025938 Bacteria 635
1141 Ga0207665_10066622 3300025939 Bacteria 2451
1142 Ga0207665_10142336 3300025939 Bacteria 1711
1143 Ga0207665_10805755 3300025939 Bacteria 742
1144 Ga0207691_10002993 3300025940 Bacteria 16486
1145 Ga0207691_10018208 3300025940 Bacteria 6653
1146 Ga0207691_10022326 3300025940 Bacteria 5968
1147 Ga0207691_10144307 3300025940 Bacteria 2096
1148 Ga0207691_10552376 3300025940 Bacteria 976
1149 Ga0207691_11148513 3300025940 Bacteria 645
1150 Ga0207711_10044629 3300025941 Bacteria 3785
1151 Ga0207711_10501500 3300025941 Bacteria 1131
1152 Ga0207689_10033353 3300025942 Bacteria 4279
1153 Ga0207689_10131038 3300025942 Bacteria 2064
1154 Ga0207689_10151466 3300025942 Bacteria 1912
1155 Ga0207689_11459423 3300025942 Bacteria 572
1156 Ga0207661_10113272 3300025944 Bacteria 2298
1157 Ga0207661_10228414 3300025944 Bacteria 1647
1158 Ga0207661_10409415 3300025944 Bacteria 1231
1159 Ga0207661_10484215 3300025944 Bacteria 1130
1160 Ga0207661_10661401 3300025944 Bacteria 960
1161 Ga0207661_10866912 3300025944 Bacteria 831
1162 Ga0207679_10006605 3300025945 Bacteria 7335
1163 Ga0207679_10009203 3300025945 Bacteria 6315
1164 Ga0207679_10137763 3300025945 Bacteria 1968
1165 Ga0207679_10271664 3300025945 Bacteria 1450
1166 Ga0207679_10332354 3300025945 Bacteria 1319
1167 Ga0207667_10249234 3300025949 Bacteria 1817
1168 Ga0207667_10625382 3300025949 Bacteria 1084
1169 Ga0207667_10794966 3300025949 Bacteria 943
1170 Ga0207667_11757560 3300025949 Bacteria 585
1171 Ga0207651_10001504 3300025960 Bacteria 10623
1172 Ga0207651_10002331 3300025960 Bacteria 9049
1173 Ga0207651_10136422 3300025960 Bacteria 1888
1174 Ga0207651_10422511 3300025960 Bacteria 1138
1175 Ga0207651_10653204 3300025960 Bacteria 923
1176 Ga0207651_10748904 3300025960 Bacteria 863
1177 Ga0207651_10952852 3300025960 Bacteria 766
1178 Ga0207712_10026693 3300025961 Bacteria 3851
1179 Ga0207712_10069325 3300025961 Bacteria 2530
1180 Ga0207712_10071941 3300025961 Bacteria 2489
1181 Ga0207712_10113838 3300025961 Bacteria 2034
1182 Ga0207712_10220602 3300025961 Bacteria 1516
1183 Ga0207712_10575921 3300025961 Bacteria 971
1184 Ga0207712_11307812 3300025961 Bacteria 648
1185 Ga0207712_11474761 3300025961 Bacteria 609
1186 Ga0207668_10006853 3300025972 Bacteria 6757
1187 Ga0207668_10086012 3300025972 Bacteria 2296
1188 Ga0207668_10535986 3300025972 Unclassified 1012
1189 Ga0207668_10750786 3300025972 Bacteria 861
1190 Ga0207668_11311482 3300025972 Bacteria 652
1191 Ga0207640_10298160 3300025981 Bacteria 1274
1192 Ga0207640_10591028 3300025981 Bacteria 938
1193 Ga0207640_10802476 3300025981 Bacteria 816
1194 Ga0207640_10842576 3300025981 Bacteria 797
1195 Ga0207640_10953054 3300025981 Bacteria 752
1196 Ga0207640_11197914 3300025981 Bacteria 675
1197 Ga0207658_10033052 3300025986 Bacteria 3687
1198 Ga0207658_10147526 3300025986 Bacteria 1912
1199 Ga0207658_10376347 3300025986 Bacteria 1243
1200 Ga0207677_10006853 3300026023 Bacteria 6259
1201 Ga0207677_11183519 3300026023 Bacteria 699
1202 Ga0207703_10065297 3300026035 Bacteria 2990
1203 Ga0207703_10115216 3300026035 Bacteria 2299
1204 Ga0207703_10539952 3300026035 Bacteria 1098
1205 Ga0207703_10968050 3300026035 Bacteria 816
1206 Ga0207703_11327218 3300026035 Bacteria 692
1207 Ga0207639_10259301 3300026041 Bacteria 1520
1208 Ga0207639_10546435 3300026041 Bacteria 1063
1209 Ga0207639_11002631 3300026041 Bacteria 782
1210 Ga0207678_10017028 3300026067 Bacteria 6382
1211 Ga0207678_10035455 3300026067 Bacteria 4343
1212 Ga0207678_10151895 3300026067 Unclassified 1977
1213 Ga0207678_10471209 3300026067 Bacteria 1093
1214 Ga0207678_10615646 3300026067 Bacteria 952
1215 Ga0207708_10007092 3300026075 Bacteria 8279
1216 Ga0207708_10007880 3300026075 Bacteria 7891
1217 Ga0207708_10017492 3300026075 Bacteria 5396
1218 Ga0207708_10044205 3300026075 Bacteria 3394
1219 Ga0207708_10186229 3300026075 Bacteria 1650
1220 Ga0207708_10398729 3300026075 Bacteria 1137
1221 Ga0207708_10686818 3300026075 Bacteria 874
1222 Ga0207708_10982804 3300026075 Bacteria 733
1223 Ga0207708_11192262 3300026075 Bacteria 665
1224 Ga0207708_11582217 3300026075 Bacteria 576
1225 Ga0207702_10318909 3300026078 Bacteria 1480
1226 Ga0207702_10618619 3300026078 Bacteria 1064
1227 Ga0207702_10966310 3300026078 Bacteria 845
1228 Ga0207702_11467404 3300026078 Bacteria 676
1229 Ga0207641_10233683 3300026088 Bacteria 1710
1230 Ga0207641_10361815 3300026088 Bacteria 1385
1231 Ga0207641_10927792 3300026088 Bacteria 865
1232 Ga0207648_10004173 3300026089 Bacteria 14934
1233 Ga0207648_10013852 3300026089 Bacteria 7480
1234 Ga0207648_10066110 3300026089 Bacteria 3153
1235 Ga0207648_10073622 3300026089 Bacteria 2977
1236 Ga0207648_10329425 3300026089 Bacteria 1373
1237 Ga0207648_10371456 3300026089 Bacteria 1292
1238 Ga0207648_11055755 3300026089 Bacteria 761
1239 Ga0207648_12169163 3300026089 Bacteria 516
1240 Ga0207676_10046514 3300026095 Bacteria 3358
1241 Ga0207676_10354332 3300026095 Bacteria 1358
1242 Ga0207676_10642262 3300026095 Bacteria 1023
1243 Ga0207676_12448250 3300026095 Bacteria 519
1244 Ga0207674_10008751 3300026116 Bacteria 11654
1245 Ga0207674_10048176 3300026116 Bacteria 4363
1246 Ga0207674_10096522 3300026116 Bacteria 2941
1247 Ga0207674_10098887 3300026116 Bacteria 2901
1248 Ga0207674_10393022 3300026116 Bacteria 1340
1249 Ga0207674_10463863 3300026116 Bacteria 1224
1250 Ga0207675_100022225 3300026118 Bacteria 5906
1251 Ga0207675_100075534 3300026118 Bacteria 3155
1252 Ga0207675_100105707 3300026118 Bacteria 2653
1253 Ga0207675_100181315 3300026118 Bacteria 2016
1254 Ga0207675_100397749 3300026118 Bacteria 1357
1255 Ga0207675_100425750 3300026118 Bacteria 1312
1256 Ga0207675_100476808 3300026118 Bacteria 1239
1257 Ga0207675_100587189 3300026118 Bacteria 1116
1258 Ga0207675_101329237 3300026118 Bacteria 739
1259 Ga0207675_101446025 3300026118 Bacteria 708
1260 Ga0207675_101619039 3300026118 Bacteria 668
1261 Ga0207683_10002751 3300026121 Bacteria 15358
1262 Ga0207683_10004052 3300026121 Bacteria 12663
1263 Ga0207683_10053461 3300026121 Bacteria 3541
1264 Ga0207683_10084306 3300026121 Bacteria 2824
1265 Ga0207698_10020697 3300026142 Bacteria 4534
1266 Ga0207698_11143324 3300026142 Bacteria 792
1267 Ga0207698_11450924 3300026142 Bacteria 701
1268 Ga0207698_11859205 3300026142 Bacteria 617
1269 Ga0209969_1000041 3300027360 Bacteria 14920
1270 Ga0209969_1054507 3300027360 Bacteria 629
1271 Ga0209967_1005501 3300027364 Bacteria 1701
1272 Ga0209967_1019473 3300027364 Bacteria 986
1273 Ga0209967_1049013 3300027364 Bacteria 648
1274 Ga0209981_1001622 3300027378 Bacteria 2847
1275 Ga0209981_1024346 3300027378 Bacteria 874
1276 Ga0209996_1001007 3300027395 Bacteria 3347
1277 Ga0209984_1000059 3300027424 Bacteria 11414
1278 Ga0209984_1014298 3300027424 Bacteria 1047
1279 Ga0210000_1000070 3300027462 Bacteria 14961
1280 Ga0209995_1000072 3300027471 Bacteria 16055
1281 Ga0209995_1011868 3300027471 Bacteria 1418
1282 Ga0209968_1000094 3300027526 Bacteria 16055
1283 Ga0209968_1005468 3300027526 Bacteria 1911
1284 Ga0209968_1008151 3300027526 Bacteria 1595
1285 Ga0209968_1020292 3300027526 Bacteria 1073
1286 Ga0209999_1003664 3300027543 Bacteria 2750
1287 Ga0209999_1019270 3300027543 Bacteria 1250
1288 Ga0209982_1000629 3300027552 Bacteria 4440
1289 Ga0209970_1001695 3300027614 Bacteria 3827
1290 Ga0209970_1023608 3300027614 Bacteria 1047
1291 Ga0209970_1052717 3300027614 Bacteria 738
1292 Ga0210002_1000082 3300027617 Bacteria 14912
1293 Ga0210002_1031643 3300027617 Bacteria 880
1294 Ga0209983_1002619 3300027665 Bacteria 3911
1295 Ga0209983_1008964 3300027665 Bacteria 2044
1296 Ga0209983_1034140 3300027665 Bacteria 1089
1297 Ga0209971_1000999 3300027682 Bacteria 7261
1298 Ga0209971_1007494 3300027682 Bacteria 2590
1299 Ga0209971_1017856 3300027682 Bacteria 1683
1300 Ga0209966_1000334 3300027695 Bacteria 14934
1301 Ga0209966_1020552 3300027695 Bacteria 1280
1302 Ga0209966_1028426 3300027695 Bacteria 1123
1303 Ga0209966_1031182 3300027695 Bacteria 1080
1304 Ga0209998_10000411 3300027717 Bacteria 12233
1305 Ga0209998_10001858 3300027717 Bacteria 5000
1306 Ga0209998_10050205 3300027717 Bacteria 964
1307 Ga0209998_10090073 3300027717 Bacteria 751
1308 Ga0209998_10111835 3300027717 Bacteria 683
1309 Ga0209974_10000363 3300027876 Bacteria 14934
1310 Ga0209974_10000952 3300027876 Bacteria 10135
1311 Ga0209974_10001975 3300027876 Bacteria 7482
1312 Ga0209974_10016162 3300027876 Bacteria 2478
1313 Ga0209974_10022885 3300027876 Bacteria 2068
1314 Ga0207428_10000452 3300027907 Bacteria 49793
1315 Ga0207428_10021619 3300027907 Bacteria 5445
1316 Ga0207428_10109844 3300027907 Bacteria 2124
1317 Ga0207428_10349869 3300027907 Bacteria 1087
1318 Ga0268266_10243006 3300028379 Bacteria 1662
1319 Ga0268266_10479656 3300028379 Bacteria 1185
1320 Ga0268266_11235182 3300028379 Bacteria 722
1321 Ga0268266_12149352 3300028379 Bacteria 531
1322 Ga0268265_10038809 3300028380 Bacteria 3505
1323 Ga0268265_10196719 3300028380 Bacteria 1745
1324 Ga0268265_10271302 3300028380 Bacteria 1513
1325 Ga0268265_10878676 3300028380 Bacteria 879
1326 Ga0268265_10973135 3300028380 Bacteria 837
1327 Ga0268265_11473254 3300028380 Bacteria 684
1328 Ga0268264_10116398 3300028381 Bacteria 2349
1329 Ga0268264_10252114 3300028381 Bacteria 1640
1330 Ga0268264_10274106 3300028381 Bacteria 1577
1331 Ga0268264_10275065 3300028381 Bacteria 1575
1332 Ga0268264_10336368 3300028381 Bacteria 1433
1333 Ga0268264_10461073 3300028381 Bacteria 1233
1334 Ga0268264_10505867 3300028381 Bacteria 1179
1335 Ga0268264_10553590 3300028381 Bacteria 1128
1336 Ga0268264_11278625 3300028381 Bacteria 744
1337 Ga0268264_12144911 3300028381 Bacteria 567
1338 Ga0265326_10049936 3300028558 Bacteria 1185
1339 Ga0265326_10058863 3300028558 Bacteria 1087
1340 Ga0265326_10180855 3300028558 Bacteria 604
1341 Ga0265319_1001755 3300028563 Bacteria 12460
1342 Ga0265319_1007116 3300028563 Bacteria 5073
1343 Ga0265319_1007448 3300028563 Bacteria 4923
1344 Ga0265319_1019640 3300028563 Bacteria 2518
1345 Ga0265319_1052184 3300028563 Bacteria 1347
1346 Ga0265319_1069661 3300028563 Bacteria 1129
1347 Ga0265334_10011259 3300028573 Bacteria 3769
1348 Ga0265334_10048055 3300028573 Bacteria 1644
1349 Ga0265318_10012106 3300028577 Bacteria 3682
1350 Ga0265318_10019472 3300028577 Bacteria 2752
1351 Ga0265318_10025769 3300028577 Bacteria 2318
1352 Ga0265318_10030690 3300028577 Bacteria 2089
1353 Ga0265323_10030524 3300028653 Bacteria 2006
1354 Ga0265323_10076276 3300028653 Bacteria 1138
1355 Ga0265322_10094626 3300028654 Bacteria 849
1356 Ga0265336_10021509 3300028666 Bacteria 2061
1357 Ga0265336_10108651 3300028666 Bacteria 826
1358 Ga0265336_10115692 3300028666 Bacteria 799
1359 Ga0265338_10026020 3300028800 Bacteria 5916
1360 Ga0265338_10117371 3300028800 Bacteria 2129
1361 Ga0265338_10197962 3300028800 Bacteria 1517
1362 Ga0265324_10005334 3300029957 Bacteria 5573
1363 Ga0265330_10053790 3300031235 Bacteria 1761
1364 Ga0265330_10076091 3300031235 Bacteria 1449
1365 Ga0265330_10250656 3300031235 Bacteria 746
1366 Ga0265332_10013796 3300031238 Bacteria 3577
1367 Ga0265332_10073251 3300031238 Bacteria 1458
1368 Ga0265332_10094047 3300031238 Bacteria 1266
1369 Ga0265328_10019691 3300031239 Bacteria 2590
1370 Ga0265320_10008259 3300031240 Bacteria 6381
1371 Ga0265320_10011941 3300031240 Bacteria 5084
1372 Ga0265320_10067252 3300031240 Bacteria 1696
1373 Ga0265325_10024545 3300031241 Bacteria 3279
1374 Ga0265325_10027854 3300031241 Bacteria 3051
1375 Ga0265329_10051933 3300031242 Bacteria 1304
1376 Ga0265340_10003110 3300031247 Bacteria 9407
1377 Ga0265340_10010244 3300031247 Bacteria 5017
1378 Ga0265340_10197804 3300031247 Bacteria 905
1379 Ga0265339_10044965 3300031249 Bacteria 2432
1380 Ga0265339_10083540 3300031249 Bacteria 1684
1381 Ga0265331_10062662 3300031250 Bacteria 1753
1382 Ga0265331_10076601 3300031250 Bacteria 1559
1383 Ga0265331_10115665 3300031250 Bacteria 1228
1384 Ga0265316_10018483 3300031344 Bacteria 5988
1385 Ga0265316_10098766 3300031344 Bacteria 2221
1386 Ga0265316_10105975 3300031344 Bacteria 2132
1387 Ga0265316_10244477 3300031344 Bacteria 1319
1388 Ga0265316_10835155 3300031344 Bacteria 645
1389 Ga0265316_10885403 3300031344 Bacteria 624
1390 Ga0307408_100033832 3300031548 Bacteria 3574
1391 Ga0307408_100115027 3300031548 Bacteria 2074
1392 Ga0307408_100308243 3300031548 Bacteria 1329
1393 Ga0307408_100435750 3300031548 Bacteria 1134
1394 Ga0307408_100453713 3300031548 Bacteria 1113
1395 Ga0307408_100635946 3300031548 Bacteria 952
1396 Ga0265313_10048936 3300031595 Bacteria 2037
1397 Ga0310115_100204 3300031635 Bacteria 4399
1398 Ga0316575_10086352 3300031665 Bacteria 1268
1399 Ga0316575_10312469 3300031665 Bacteria 666
1400 Ga0316579_10001474 3300031691 Bacteria 8550
1401 Ga0316579_10019327 3300031691 Bacteria 3010
1402 Ga0316579_10025642 3300031691 Bacteria 2664
1403 Ga0316579_10177488 3300031691 Bacteria 1030
1404 Ga0316579_10313491 3300031691 Bacteria 758
1405 Ga0265314_10026275 3300031711 Bacteria 4376
1406 Ga0265314_10043762 3300031711 Bacteria 3179
1407 Ga0265314_10087526 3300031711 Bacteria 2036
1408 Ga0265342_10018951 3300031712 Bacteria 4445
1409 Ga0265342_10040348 3300031712 Bacteria 2831
1410 Ga0265342_10287442 3300031712 Bacteria 869
1411 Ga0265342_10287728 3300031712 Unclassified 868
1412 Ga0265342_10479952 3300031712 Bacteria 636
1413 Ga0316576_10014675 3300031727 Bacteria 5238
1414 Ga0316576_10028970 3300031727 Unclassified 3908
1415 Ga0316576_10075025 3300031727 Bacteria 2501
1416 Ga0316576_10271290 3300031727 Unclassified 1272
1417 Ga0316576_10318979 3300031727 Bacteria 1159
1418 Ga0316576_10376445 3300031727 Bacteria 1054
1419 Ga0316578_10002669 3300031728 Bacteria 7925
1420 Ga0316578_10031668 3300031728 Bacteria 3015
1421 Ga0316578_10094474 3300031728 Bacteria 1788
1422 Ga0316578_10110555 3300031728 Bacteria 1650
1423 Ga0316578_10354009 3300031728 Unclassified 874
1424 Ga0316578_10476765 3300031728 Bacteria 736
1425 Ga0316578_10659500 3300031728 Bacteria 611
1426 Ga0307405_10145648 3300031731 Bacteria 1658
1427 Ga0307405_10283131 3300031731 Bacteria 1249
1428 Ga0307405_10560731 3300031731 Bacteria 926
1429 Ga0307405_11706390 3300031731 Bacteria 558
1430 Ga0316577_10023710 3300031733 Bacteria 3407
1431 Ga0316577_10030298 3300031733 Bacteria 3020
1432 Ga0316577_10059138 3300031733 Bacteria 2139
1433 Ga0316577_10098313 3300031733 Bacteria 1640
1434 Ga0316577_10241868 3300031733 Bacteria 1021
1435 Ga0316577_10334870 3300031733 Bacteria 858
1436 Ga0316577_10660637 3300031733 Bacteria 594
1437 Ga0307413_10116787 3300031824 Bacteria 1798
1438 Ga0307413_10462120 3300031824 Bacteria 1010
1439 Ga0307410_10058624 3300031852 Bacteria 2625
1440 Ga0307410_10229815 3300031852 Bacteria 1432
1441 Ga0307410_10524380 3300031852 Bacteria 978
1442 Ga0307410_10871678 3300031852 Bacteria 770
1443 Ga0307410_11140866 3300031852 Bacteria 677
1444 Ga0307410_11166677 3300031852 Bacteria 670
1445 Ga0307406_10044253 3300031901 Bacteria 2789
1446 Ga0307406_10617461 3300031901 Bacteria 896
1447 Ga0307406_11075663 3300031901 Bacteria 693
1448 Ga0307407_10199236 3300031903 Bacteria 1341
1449 Ga0307407_10205397 3300031903 Bacteria 1323
1450 Ga0307407_10214763 3300031903 Bacteria 1297
1451 Ga0307407_11179910 3300031903 Bacteria 597
1452 Ga0307412_10024485 3300031911 Bacteria 3726
1453 Ga0307412_10388017 3300031911 Bacteria 1133
1454 Ga0307412_11248937 3300031911 Bacteria 667
1455 Ga0307409_100033375 3300031995 Bacteria 3745
1456 Ga0307409_100101880 3300031995 Bacteria 2384
1457 Ga0307409_100174251 3300031995 Bacteria 1897
1458 Ga0307409_100450748 3300031995 Bacteria 1242
1459 Ga0307409_100507328 3300031995 Bacteria 1176
1460 Ga0307409_101282975 3300031995 Bacteria 757
1461 Ga0307416_100042187 3300032002 Bacteria 3559
1462 Ga0307416_100270030 3300032002 Bacteria 1669
1463 Ga0307416_100283927 3300032002 Bacteria 1634
1464 Ga0307416_100454910 3300032002 Bacteria 1334
1465 Ga0307416_101044979 3300032002 Bacteria 921
1466 Ga0307416_101217700 3300032002 Bacteria 858
1467 Ga0307416_101467063 3300032002 Bacteria 788
1468 Ga0307416_101581882 3300032002 Bacteria 761
1469 Ga0307416_102654512 3300032002 Bacteria 598
1470 Ga0307414_10109835 3300032004 Bacteria 2096
1471 Ga0307414_11401602 3300032004 Bacteria 649
1472 Ga0307411_10039950 3300032005 Bacteria 2972
1473 Ga0307411_10618404 3300032005 Bacteria 934
1474 Ga0307415_100010815 3300032126 Bacteria 5186
1475 Ga0307415_100049313 3300032126 Bacteria 2846
1476 Ga0307415_100103376 3300032126 Bacteria 2096
1477 Ga0307415_100181481 3300032126 Bacteria 1652
1478 Ga0307415_100198773 3300032126 Bacteria 1589
1479 Ga0307415_100216378 3300032126 Bacteria 1532
1480 Ga0307415_100300850 3300032126 Bacteria 1329
1481 Ga0307415_101004216 3300032126 Bacteria 776
1482 Ga0307415_101062635 3300032126 Bacteria 756
1483 Ga0307415_101471388 3300032126 Bacteria 651
1484 Ga0307415_102046631 3300032126 Unclassified 558
1485 Ga0316583_10019741 3300032133 Bacteria 2416
1486 Ga0316585_10003166 3300032137 Bacteria 4493
1487 Ga0316585_10047767 3300032137 Bacteria 1371
1488 Ga0316580_10003514 3300032139 Bacteria 4456
1489 Ga0316580_10021626 3300032139 Bacteria 1983
1490 Ga0316593_10000912 3300032168 Bacteria 6049
1491 Ga0316593_10001396 3300032168 Bacteria 5300
1492 Ga0316593_10003348 3300032168 Bacteria 3963
1493 Ga0316593_10006353 3300032168 Unclassified 3182
1494 Ga0316593_10011938 3300032168 Bacteria 2539
1495 Ga0316593_10020812 3300032168 Bacteria 2045
1496 Ga0316593_10026803 3300032168 Bacteria 1845
1497 Ga0316593_10027431 3300032168 Bacteria 1827
1498 Ga0316593_10039065 3300032168 Bacteria 1573
1499 Ga0316593_10039887 3300032168 Bacteria 1559
1500 Ga0316593_10065898 3300032168 Bacteria 1246
1501 Ga0316593_10069482 3300032168 Unclassified 1216
1502 Ga0316593_10089232 3300032168 Bacteria 1084
1503 Ga0316593_10093658 3300032168 Bacteria 1059
1504 Ga0316593_10133368 3300032168 Unclassified 897
1505 Ga0316593_10230694 3300032168 Bacteria 689
1506 Ga0316593_10249992 3300032168 Bacteria 663
1507 Ga0316592_1001323 3300033524 Bacteria 3955
1508 Ga0316592_1001732 3300033524 Unclassified 3624
1509 Ga0316592_1003404 3300033524 Bacteria 2864
1510 Ga0316592_1042650 3300033524 Bacteria 1006
1511 Ga0316592_1124432 3300033524 Bacteria 600
1512 Ga0316588_1100748 3300033528 Unclassified 723
1513 Ga0316587_1079347 3300033529 Bacteria 619
1514 Ga0316596_1000776 3300033541 Bacteria 5870
1515 Ga0316596_1001519 3300033541 Bacteria 4714
1516 Ga0316596_1007478 3300033541 Bacteria 2582
1517 Ga0316596_1008157 3300033541 Bacteria 2491
1518 Ga0316596_1021648 3300033541 Bacteria 1640
1519 Ga0316596_1060878 3300033541 Bacteria 1007
1520 Ga0316596_1063711 3300033541 Unclassified 984
1521 Ga0316596_1124564 3300033541 Bacteria 702
1522 Ga0316596_1127195 3300033541 Bacteria 695
1523 Ga0316596_1146181 3300033541 Bacteria 648
1524 Ga0316596_1189007 3300033541 Unclassified 571
1525 Ga0373948_0078786 3300034817 Bacteria 749
1526 Ga0373950_0038565 3300034818 Bacteria 908
1527 Ga0373958_0080139 3300034819 Bacteria 738
1528 Ga0373929_0137949 3300035085 Bacteria 645
1529 Ga0373934_0026705 3300035086 Bacteria 2240
1530 Ga0373940_0120018 3300035088 Bacteria 815
1531 Ga0373940_0196384 3300035088 Bacteria 662
1532 Ga0373949_0034958 3300035090 Bacteria 1214
1533 Ga0373952_0005183 3300035092 Bacteria 2377
1534 Ga0373952_0241700 3300035092 Bacteria 544
1535 Ga0373923_0040704 3300035111 Bacteria 1914
1536 Ga0373932_0113887 3300035112 Bacteria 895
1537 Ga0373932_0120697 3300035112 Bacteria 874
1538 Ga0373936_0418471 3300035113 Bacteria 617
1539 Ga0373939_0213270 3300035114 Bacteria 736
1540 Ga0373941_0039797 3300035115 Bacteria 1447
1541 Ga0373941_0127926 3300035115 Bacteria 912
1542 Ga0373945_0242244 3300035116 Bacteria 759
1543 Ga0373945_0244126 3300035116 Bacteria 757
1544 Ga0373945_0316931 3300035116 Bacteria 671
1545 Ga0373945_0515176 3300035116 Bacteria 534
1546 Ga0373953_0327853 3300035117 Bacteria 670
1547 Ga0373954_0001697 3300035118 Bacteria 9037
1548 Ga0373954_0048593 3300035118 Bacteria 1988
1549 Ga0373956_0009275 3300035119 Bacteria 3997
1550 Ga0373957_0055618 3300035120 Bacteria 1522
1551 Ga0373957_0242446 3300035120 Bacteria 757
1552 Ga0373957_0468260 3300035120 Bacteria 547
1553 Ga0373943_0053792 3300035170 Bacteria 1989
1554 Ga0373943_0087467 3300035170 Bacteria 1608
1555 Ga0373943_0327519 3300035170 Bacteria 874
1556 Ga0373943_0459150 3300035170 Bacteria 741
1557 Ga0373946_0479833 3300035171 Bacteria 636
1558 Ga0373955_0189309 3300035172 Bacteria 1223
1559 Ga0373955_0720331 3300035172 Bacteria 613
1560 Ga0373942_0012163 3300035207 Bacteria 2051
1561 Ga0373961_0071157 3300035241 Bacteria 1076
1562 Ga0316574_0030223 3300035398 Unclassified 3279
1563 Ga0316574_0054328 3300035398 Bacteria 2501
1564 Ga0316574_0134302 3300035398 Bacteria 1593
1565 Ga0316574_0377655 3300035398 Bacteria 894
1566 Ga0316574_0407936 3300035398 Bacteria 855
1567 Ga0316574_0446103 3300035398 Bacteria 811
1568 Ga0316574_0623333 3300035398 Bacteria 665
1569 Ga0373924_0143804 3300035410 Bacteria 1041
1570 Ga0373931_0026647 3300035691 Bacteria 2944
1571 Ga0373931_0058522 3300035691 Bacteria 2070
1572 Ga0373931_0089547 3300035691 Bacteria 1712
1573 Ga0373931_0213349 3300035691 Bacteria 1159
1574 Ga0373931_0325976 3300035691 Bacteria 955
1575 Ga0373931_0339063 3300035691 Bacteria 938
1576 Ga0373931_0588402 3300035691 Bacteria 726
1577 Ga0373935_0104542 3300035692 Bacteria 1872
1578 Ga0373935_0229012 3300035692 Bacteria 1293
1579 Ga0373935_0349216 3300035692 Bacteria 1054
1580 Ga0373935_0363419 3300035692 Bacteria 1034
1581 Ga0373927_0001683 3300035695 Bacteria 16527
1582 Ga0373927_0158881 3300035695 Bacteria 1481
1583 Ga0373927_0432505 3300035695 Bacteria 869
1584 Ga0373927_0592833 3300035695 Bacteria 733
1585 Ga0373927_0992345 3300035695 Bacteria 554
1586 Ga0373933_0017917 3300035724 Bacteria 3976
1587 Ga0373933_0173257 3300035724 Bacteria 1374
1588 Ga0373933_0505639 3300035724 Bacteria 792
1589 Ga0373947_0060365 3300035725 Bacteria 2302
1590 Ga0373947_0100250 3300035725 Bacteria 1819
1591 Ga0373947_0141737 3300035725 Bacteria 1542
1592 Ga0373947_0431456 3300035725 Bacteria 891
1593 Ga0373937_0125158 3300036401 Bacteria 2397
1594 Ga0373937_0215450 3300036401 Bacteria 1807
1595 Ga0373937_0491542 3300036401 Bacteria 1166
1596 Ga0373937_0586653 3300036401 Bacteria 1058
1597 Ga0373937_0707269 3300036401 Bacteria 954
1598 Ga0373937_1019716 3300036401 Bacteria 776
1599 Ga0373937_1283788 3300036401 Bacteria 680
1600 Ga0373937_1492418 3300036401 Bacteria 623
1601 Ga0316582_0006765 3300036647 Bacteria 6051
1602 Ga0316582_0029353 3300036647 Unclassified 3341
1603 Ga0316582_0036138 3300036647 Bacteria 3055
1604 Ga0316582_0061687 3300036647 Bacteria 2405
1605 Ga0316582_0136156 3300036647 Bacteria 1653
1606 Ga0316582_0447332 3300036647 Bacteria 891
1607 Ga0316582_0826185 3300036647 Bacteria 635
1608 Ga0316582_1009400 3300036647 Bacteria 568
1609 Ga0316584_0002909 3300036712 Bacteria 10997
1610 Ga0316584_0020382 3300036712 Bacteria 4807
1611 Ga0316584_0033381 3300036712 Bacteria 3812
1612 Ga0316584_0049899 3300036712 Bacteria 3128
1613 Ga0316584_0056919 3300036712 Bacteria 2927
1614 Ga0316584_0100393 3300036712 Bacteria 2167
1615 Ga0316584_0284892 3300036712 Unclassified 1200
1616 Ga0316584_1094194 3300036712 Bacteria 529
1617 Ga0373925_0032173 3300037068 Bacteria 3859
1618 Ga0373925_0290874 3300037068 Bacteria 1317
1619 Ga0373925_1375536 3300037068 Bacteria 578
1620 Ga0395900_0279869 3300037418 Bacteria 1660
1621 Ga0395900_0990944 3300037418 Bacteria 761
1622 Ga0395898_0009210 3300037466 Bacteria 10387
1623 Ga0395898_0551091 3300037466 Bacteria 1095
1624 Ga0395905_0002045 3300037471 Bacteria 23056
1625 Ga0395905_1662049 3300037471 Bacteria 544
1626 Ga0316581_0003479 3300037588 Bacteria 3920
1627 Ga0316581_0027213 3300037588 Bacteria 1709
1628 Ga0316581_0052521 3300037588 Bacteria 1249
1629 Ga0436364_0059242 3300037853 Bacteria 23558
1630 Ga0436364_0080211 3300037853 Bacteria 5130
1631 Ga0436364_0132128 3300037853 Bacteria 3889
1632 Ga0436364_0414111 3300037853 Bacteria 547
1633 Ga0436364_0908399 3300037853 Bacteria 987
1634 Ga0436364_1329972 3300037853 Bacteria 3086
1635 Ga0436364_1420369 3300037853 Bacteria 570
1636 Ga0395901_0492179 3300038443 Bacteria 1249
1637 Ga0395901_0800629 3300038443 Bacteria 931
1638 Ga0400484_25283 3300038725 Bacteria 22222
1639 Ga0242420_083354 3300038996 Bacteria 663
1640 Ga0400489_27808 3300039093 Bacteria 2158
1641 Ga0400489_64154 3300039093 Bacteria 127676
1642 Ga0400489_70192 3300039093 Unclassified 1713
1643 Ga0400489_78199 3300039093 Bacteria 2993
1644 Ga0400489_95071 3300039093 Unclassified 2759
1645 Ga0436365_0518373 3300039437 Bacteria 19903
1646 Ga0436365_0988567 3300039437 Bacteria 6262
1647 Ga0436365_1816100 3300039437 Bacteria 1069
1648 Ga0436365_1839802 3300039437 Bacteria 1373
1649 Ga0436361_1097269 3300039447 Bacteria 948
1650 Ga0436363_0189181 3300039450 Bacteria 626
1651 Ga0436363_0355319 3300039450 Bacteria 511
1652 Ga0436363_0914349 3300039450 Bacteria 31901
1653 Ga0436363_1468593 3300039450 Bacteria 802
1654 Ga0436363_1633672 3300039450 Bacteria 3418
1655 Ga0436362_0376138 3300039453 Bacteria 1428
1656 Ga0436362_0611503 3300039453 Unclassified 1056
1657 Ga0436362_1256068 3300039453 Bacteria 5446
1658 Ga0439438_029210 3300041405 Bacteria 1477
1659 Ga0439447_014554 3300041407 Bacteria 2203
1660 Ga0439461_0017818 3300041410 Bacteria 1384
1661 Ga0439466_0033391 3300041411 Bacteria 1748
1662 Ga0439465_0080045 3300041413 Bacteria 1107
1663 Ga0439465_0240903 3300041413 Bacteria 667
1664 Ga0451798_0113321 3300041458 Bacteria 721
1665 Ga0451798_0575567 3300041458 Bacteria 655
1666 Ga0451807_0774648 3300041486 Bacteria 582
1667 Ga0451837_0907061 3300041494 Bacteria 509
1668 Ga0451841_0292560 3300041498 Bacteria 621
1669 Ga0451849_0248137 3300041505 Bacteria 1634
1670 Ga0451849_1069921 3300041505 Bacteria 562
1671 Ga0451852_17107 3300041508 Bacteria 626
1672 Ga0451843_0695654 3300041509 Bacteria 532
1673 Ga0451843_1408726 3300041509 Bacteria 702
1674 Ga0451855_1829449 3300041511 Bacteria 3227
1675 Ga0451853_0705191 3300041512 Bacteria 823
1676 Ga0451853_2322621 3300041512 Bacteria 1368
1677 Ga0439431_0063538 3300041997 Bacteria 975
1678 Ga0439433_0029421 3300041999 Bacteria 1253
1679 Ga0439441_005370 3300042001 Bacteria 1989
1680 Ga0439441_028003 3300042001 Unclassified 1078
1681 Ga0439441_041823 3300042001 Bacteria 921
1682 Ga0439443_012523 3300042003 Bacteria 1256
1683 Ga0439443_017463 3300042003 Bacteria 1104
1684 Ga0439449_0203611 3300042007 Bacteria 741
1685 Ga0439450_027347 3300042008 Bacteria 1263
1686 Ga0439452_033829 3300042010 Bacteria 1238
1687 Ga0439454_016349 3300042011 Bacteria 1048
1688 Ga0439455_0110176 3300042012 Unclassified 765
1689 Ga0439455_0178183 3300042012 Bacteria 612
1690 Ga0439455_0236079 3300042012 Bacteria 534
1691 Ga0439456_019413 3300042013 Bacteria 1430
1692 Ga0439462_0024059 3300042015 Bacteria 1598
1693 Ga0450912_002280 3300042116 Bacteria 1276
1694 Ga0450915_011205 3300042119 Bacteria 634
1695 Ga0450920_003948 3300042122 Bacteria 2588
1696 Ga0450920_020434 3300042122 Bacteria 1276
1697 Ga0450920_143765 3300042122 Bacteria 505
1698 Ga0450923_076195 3300042125 Bacteria 749
1699 Ga0450888_012106 3300042126 Bacteria 1018
1700 Ga0450890_058179 3300042127 Bacteria 601
1701 Ga0450900_005646 3300042136 Bacteria 1487
1702 Ga0450904_024334 3300042139 Bacteria 621
1703 Ga0450905_040426 3300042142 Bacteria 740
1704 Ga0450910_002124 3300042147 Bacteria 2586
1705 Ga0439446_0001343 3300042156 Bacteria 5544
1706 Ga0439434_0012597 3300042435 Bacteria 2503
1707 Ga0439434_0020922 3300042435 Bacteria 1965
1708 Ga0439444_0004804 3300042437 Bacteria 1979
1709 Ga0439464_0038445 3300042439 Bacteria 1359
1710 Ga0439460_0116528 3300042461 Bacteria 871
1711 Ga0439460_0257355 3300042461 Bacteria 604
1712 Ga0451577_0060452 3300042876 Bacteria 3378
1713 Ga0451577_1034688 3300042876 Bacteria 737
1714 Ga0451577_1093579 3300042876 Bacteria 714
1715 Ga0451577_1206953 3300042876 Bacteria 675
1716 Ga0466969_0036716 3300044656 Bacteria 2474
1717 Ga0466969_0117587 3300044656 Bacteria 1239
1718 Ga0466972_0011031 3300044658 Bacteria 4536
1719 Ga0466972_0019729 3300044658 Bacteria 3371
1720 Ga0466972_0095775 3300044658 Bacteria 1406
1721 Ga0453683_0018052 3300044673 Bacteria 4531
1722 Ga0453683_0081399 3300044673 Unclassified 2028
1723 Ga0453683_0084212 3300044673 Bacteria 1992
1724 Ga0453683_0110847 3300044673 Bacteria 1726
1725 Ga0453683_0128288 3300044673 Bacteria 1598
1726 Ga0453683_0130392 3300044673 Bacteria 1584
1727 Ga0453683_0301682 3300044673 Bacteria 1025
1728 Ga0466965_0013220 3300044683 Bacteria 3892
1729 Ga0466966_0003798 3300044684 Bacteria 9961
1730 Ga0466966_0067466 3300044684 Bacteria 2247
1731 Ga0466961_0008523 3300044693 Bacteria 6531
1732 Ga0466963_0377158 3300044694 Bacteria 1000
1733 Ga0466963_0835039 3300044694 Bacteria 650
1734 Ga0453684_0000042 3300044712 Bacteria 682980
1735 Ga0453684_0020308 3300044712 Bacteria 10029
1736 Ga0453684_0098380 3300044712 Bacteria 3587
1737 Ga0453684_0296601 3300044712 Bacteria 1839
1738 Ga0453684_1330471 3300044712 Bacteria 748
1739 Ga0453684_2029289 3300044712 Bacteria 579
1740 Ga0466971_0099790 3300044719 Bacteria 1333
1741 Ga0466968_0080379 3300044735 Bacteria 1431
1742 Ga0466968_0554090 3300044735 Bacteria 577
1743 Ga0466970_0025436 3300044765 Bacteria 3099
1744 Ga0466970_0068701 3300044765 Bacteria 1904
1745 Ga0466970_0356072 3300044765 Bacteria 831
1746 Ga0466957_0015985 3300044842 Bacteria 4385
1747 Ga0466960_0052329 3300044901 Bacteria 1975
1748 Ga0466959_0055926 3300045049 Bacteria 2879
1749 Ga0466959_0073654 3300045049 Bacteria 2470
1750 Ga0466959_0100693 3300045049 Bacteria 2068
1751 Ga0451576_0001192 3300045051 Bacteria 46524
1752 Ga0451576_0003208 3300045051 Bacteria 22810
1753 Ga0451576_0040408 3300045051 Bacteria 4937
1754 Ga0451576_0068762 3300045051 Bacteria 3685
1755 Ga0451576_0081209 3300045051 Bacteria 3372
1756 Ga0451576_0403823 3300045051 Bacteria 1433
1757 Ga0451576_1733028 3300045051 Bacteria 647
1758 Ga0451576_1893323 3300045051 Bacteria 615
1759 Ga0466958_0004601 3300045836 Bacteria 7306
1760 Ga0466958_0399077 3300045836 Bacteria 888
1761 Ga0466967_0180409 3300045976 Bacteria 1991
1762 Ga0466967_0486205 3300045976 Bacteria 1210
1763 Ga0466967_0684173 3300045976 Bacteria 1015
1764 Ga0466967_1056743 3300045976 Bacteria 809
1765 Ga0466967_1754022 3300045976 Bacteria 618
1766 Ga0466967_2311117 3300045976 Bacteria 533
1767 Ga0495592_0090929 3300046454 Bacteria 2189
1768 Ga0495592_0219709 3300046454 Bacteria 1271
1769 Ga0495592_0539505 3300046454 Bacteria 719
1770 Ga0495603_0407337 3300046455 Bacteria 779
1771 Ga0495603_0616152 3300046455 Bacteria 621
1772 Ga0495591_058996 3300046458 Bacteria 1025
1773 Ga0495591_161310 3300046458 Bacteria 537
1774 Ga0495629_0105533 3300046459 Bacteria 1965
1775 Ga0495641_0323258 3300046461 Bacteria 696
1776 Ga0495641_0358828 3300046461 Bacteria 659
1777 Ga0495651_0174499 3300046462 Bacteria 1527
1778 Ga0495651_0716457 3300046462 Bacteria 623
1779 Ga0495653_0056575 3300046463 Bacteria 2989
1780 Ga0495653_0354943 3300046463 Bacteria 942
1781 Ga0495580_0200125 3300046472 Bacteria 1376
1782 Ga0495580_0444191 3300046472 Bacteria 871
1783 Ga0495582_0053122 3300046473 Bacteria 2235
1784 Ga0495582_0577449 3300046473 Bacteria 650
1785 Ga0495582_0836029 3300046473 Bacteria 533
1786 Ga0495639_0421004 3300046475 Bacteria 676
1787 Ga0495639_0474171 3300046475 Bacteria 637
1788 Ga0495662_0249964 3300046476 Bacteria 873
1789 Ga0495664_0041524 3300046477 Bacteria 2722
1790 Ga0495664_0183913 3300046477 Bacteria 1267
1791 Ga0495664_0274917 3300046477 Bacteria 1018
1792 Ga0495664_0627221 3300046477 Bacteria 638
1793 Ga0495584_0038570 3300046491 Bacteria 2414
1794 Ga0495594_0039040 3300046499 Bacteria 2594
1795 Ga0495594_0088963 3300046499 Bacteria 1729
1796 Ga0495594_0144175 3300046499 Bacteria 1351
1797 Ga0495596_0058586 3300046500 Bacteria 1502
1798 Ga0495596_0309755 3300046500 Bacteria 614
1799 Ga0495583_0082229 3300046506 Bacteria 1398
1800 Ga0495608_0059612 3300046511 Bacteria 2514
1801 Ga0495608_0123307 3300046511 Bacteria 1661
1802 Ga0495618_0033150 3300046514 Bacteria 3238
1803 Ga0495628_0057506 3300046516 Bacteria 3059
1804 Ga0495628_0170268 3300046516 Bacteria 1652
1805 Ga0495628_0452371 3300046516 Bacteria 932
1806 Ga0495630_0318694 3300046517 Bacteria 1188
1807 Ga0495630_0712514 3300046517 Bacteria 768
1808 Ga0495630_0748761 3300046517 Bacteria 747
1809 Ga0495666_0076246 3300046526 Bacteria 1589
1810 Ga0495652_0114458 3300046529 Bacteria 2164
1811 Ga0495640_0033412 3300046533 Bacteria 3654
1812 Ga0495640_0678750 3300046533 Bacteria 619
1813 Ga0495586_0134792 3300046535 Bacteria 1384
1814 Ga0495586_0168011 3300046535 Bacteria 1239
1815 Ga0495587_0230779 3300046536 Bacteria 1043
1816 Ga0495587_0456742 3300046536 Bacteria 707
1817 Ga0495609_0416283 3300046538 Bacteria 537
1818 Ga0495645_0161887 3300046543 Bacteria 1547
1819 Ga0495667_0025824 3300046559 Bacteria 3957
1820 Ga0495667_0128013 3300046559 Bacteria 1638
1821 Ga0495667_0162824 3300046559 Bacteria 1435
1822 Ga0495656_0150430 3300046615 Bacteria 1124
1823 Ga0495634_0077060 3300046642 Bacteria 2187
1824 Ga0495634_0095577 3300046642 Bacteria 1925
1825 Ga0495634_0188525 3300046642 Bacteria 1288
1826 Ga0495611_0229519 3300046648 Bacteria 863
1827 Ga0495635_0013387 3300046663 Bacteria 5741
1828 Ga0495635_0157527 3300046663 Bacteria 1545
1829 Ga0495635_0247646 3300046663 Bacteria 1202
1830 Ga0495588_0046679 3300046674 Bacteria 2222
1831 Ga0495588_0565561 3300046674 Bacteria 596
1832 Ga0495657_0046387 3300046675 Bacteria 2942
1833 Ga0495657_0060841 3300046675 Bacteria 2500
1834 Ga0495657_0126032 3300046675 Bacteria 1608
1835 Ga0495657_0292430 3300046675 Bacteria 973
1836 Ga0495599_0171862 3300046678 Bacteria 1337
1837 Ga0495599_0496087 3300046678 Bacteria 719
1838 Ga0495647_0159116 3300046681 Bacteria 972
1839 Ga0495647_0600541 3300046681 Bacteria 517
1840 Ga0495658_0138762 3300046683 Bacteria 1485
1841 Ga0495658_0313168 3300046683 Bacteria 994
1842 Ga0495613_0554554 3300046689 Bacteria 769
1843 Ga0495624_0183355 3300046690 Bacteria 1275
1844 Ga0495624_0284224 3300046690 Bacteria 999
1845 Ga0495624_0658121 3300046690 Bacteria 623
1846 Ga0495624_0665236 3300046690 Bacteria 619
1847 Ga0495671_0206635 3300046692 Bacteria 952
1848 Ga0495671_0449758 3300046692 Bacteria 616
1849 Ga0495589_0199799 3300046794 Bacteria 944
1850 Ga0495600_0040836 3300046809 Bacteria 3023
1851 Ga0495600_0553748 3300046809 Bacteria 702
1852 Ga0495660_0183705 3300046810 Bacteria 1010
1853 Ga0495660_0320380 3300046810 Bacteria 697
1854 Ga0495581_0020518 3300047315 Bacteria 3834
1855 Ga0495581_0212185 3300047315 Bacteria 1132
1856 Ga0495604_0581003 3300047317 Bacteria 720
1857 Ga0495604_0646788 3300047317 Bacteria 675
1858 Ga0495636_0062684 3300047318 Bacteria 1574
1859 Ga0495636_0197220 3300047318 Bacteria 918
1860 Ga0495674_0056520 3300047319 Bacteria 3436
1861 Ga0495674_0068064 3300047319 Bacteria 3083
1862 Ga0495674_0146979 3300047319 Bacteria 1978
1863 Ga0495674_0374683 3300047319 Bacteria 1152
1864 Ga0495674_0980742 3300047319 Bacteria 649
1865 Ga0495672_0350525 3300047320 Bacteria 686
1866 Ga0495676_0041359 3300047321 Bacteria 3795
1867 Ga0495676_0325777 3300047321 Bacteria 1031
1868 Ga0495676_1091282 3300047321 Bacteria 508
1869 Ga0495680_0522356 3300047322 Bacteria 803
1870 Ga0495677_0153014 3300047445 Bacteria 889
1871 Ga0495684_0127096 3300047471 Bacteria 1917
1872 Ga0495593_0074003 3300047673 Bacteria 1767
1873 Ga0495602_0167575 3300048088 Bacteria 1708
1874 Ga0495602_1081457 3300048088 Bacteria 526
1875 Ga0495614_0195479 3300048089 Bacteria 914
1876 Ga0496100_0050650 3300048903 Bacteria 2692
1877 Ga0496100_0292949 3300048903 Bacteria 1216
1878 Ga0496100_0473097 3300048903 Bacteria 963
1879 Ga0496100_0619878 3300048903 Bacteria 841
1880 Ga0496100_0680096 3300048903 Bacteria 802
1881 Ga0496101_0104276 3300048904 Bacteria 2126
1882 Ga0496101_0151181 3300048904 Bacteria 1776
1883 Ga0496101_0842977 3300048904 Bacteria 722
1884 Ga0496101_1178944 3300048904 Bacteria 600
1885 Ga0496102_0030213 3300048905 Bacteria 4849
1886 Ga0496102_0178611 3300048905 Bacteria 1999
1887 Ga0496102_0221210 3300048905 Bacteria 1785
1888 Ga0496102_0270862 3300048905 Bacteria 1601
1889 Ga0496102_0546275 3300048905 Bacteria 1081
1890 Ga0496102_0724028 3300048905 Bacteria 918
1891 Ga0496102_1121548 3300048905 Bacteria 706
1892 Ga0496103_0011651 3300048906 Bacteria 5215
1893 Ga0496103_0119333 3300048906 Bacteria 1679
1894 Ga0496103_0136694 3300048906 Bacteria 1566
1895 Ga0496103_0631776 3300048906 Bacteria 681
1896 Ga0496104_0022038 3300048907 Bacteria 5854
1897 Ga0496104_0048572 3300048907 Bacteria 4000
1898 Ga0496104_0056307 3300048907 Bacteria 3717
1899 Ga0496104_0100791 3300048907 Bacteria 2764
1900 Ga0496104_0173708 3300048907 Bacteria 2065
1901 Ga0496104_0257888 3300048907 Bacteria 1656
1902 Ga0496104_1212455 3300048907 Bacteria 658
1903 Ga0496104_1358730 3300048907 Bacteria 614
1904 Ga0496105_0079537 3300048908 Bacteria 2707
1905 Ga0496105_0090866 3300048908 Bacteria 2522
1906 Ga0496105_0120210 3300048908 Bacteria 2167
1907 Ga0496105_0354207 3300048908 Bacteria 1172
1908 Ga0496106_0102301 3300048909 Bacteria 2222
1909 Ga0496106_0282897 3300048909 Bacteria 1329
1910 Ga0496106_0296134 3300048909 Bacteria 1297
1911 Ga0496106_0297927 3300048909 Bacteria 1293
1912 Ga0496107_0043952 3300048910 Bacteria 3211
1913 Ga0496107_0057366 3300048910 Bacteria 2815
1914 Ga0496107_0160065 3300048910 Bacteria 1668
1915 Ga0496107_0262058 3300048910 Bacteria 1286
1916 Ga0496107_0376008 3300048910 Bacteria 1057
1917 Ga0496107_1098106 3300048910 Bacteria 575
1918 Ga0496108_0000261 3300048911 Bacteria 45470
1919 Ga0496108_0005881 3300048911 Bacteria 9945
1920 Ga0496108_0021720 3300048911 Bacteria 5277
1921 Ga0496108_0022348 3300048911 Bacteria 5200
1922 Ga0496108_0133733 3300048911 Bacteria 2132
1923 Ga0496108_0191948 3300048911 Bacteria 1770
1924 Ga0496108_0273827 3300048911 Bacteria 1469
1925 Ga0496108_0763867 3300048911 Bacteria 835
1926 Ga0496109_0007365 3300048912 Bacteria 9312
1927 Ga0496109_0025197 3300048912 Bacteria 5298
1928 Ga0496109_0069348 3300048912 Bacteria 3233
1929 Ga0496109_0122176 3300048912 Bacteria 2426
1930 Ga0496109_0148659 3300048912 Bacteria 2193
1931 Ga0496109_0153122 3300048912 Bacteria 2159
1932 Ga0496109_1768200 3300048912 Bacteria 551
1933 Ga0496110_0011469 3300048913 Bacteria 7254
1934 Ga0496110_0032222 3300048913 Bacteria 4525
1935 Ga0496110_0121133 3300048913 Bacteria 2357
1936 Ga0496110_0138624 3300048913 Bacteria 2199
1937 Ga0496110_0241584 3300048913 Bacteria 1643
1938 Ga0496110_0347870 3300048913 Bacteria 1350
1939 Ga0496110_0853397 3300048913 Bacteria 816
1940 Ga0496110_1189459 3300048913 Bacteria 671
1941 Ga0496111_0031782 3300048914 Bacteria 3761
1942 Ga0496111_0345099 3300048914 Bacteria 1102
1943 Ga0496111_0515172 3300048914 Bacteria 880
1944 Ga0496111_1262184 3300048914 Bacteria 522
1945 Ga0496112_0002202 3300048915 Bacteria 15531
1946 Ga0496112_0002921 3300048915 Bacteria 13922
1947 Ga0496112_0047852 3300048915 Bacteria 4195
1948 Ga0496112_0295204 3300048915 Bacteria 1567
1949 Ga0496112_0806021 3300048915 Bacteria 864
1950 Ga0496112_1486953 3300048915 Bacteria 591
1951 Ga0496113_0010238 3300048916 Bacteria 6192
1952 Ga0496113_0069231 3300048916 Bacteria 2680
1953 Ga0496113_0144594 3300048916 Bacteria 1872
1954 Ga0496113_0158285 3300048916 Bacteria 1790
1955 Ga0496114_0004035 3300048917 Bacteria 11338
1956 Ga0496114_0165095 3300048917 Bacteria 1927
1957 Ga0496114_0165646 3300048917 Bacteria 1924
1958 Ga0496114_0182212 3300048917 Bacteria 1835
1959 Ga0496114_0186173 3300048917 Bacteria 1815
1960 Ga0496114_0245393 3300048917 Bacteria 1575
1961 Ga0496114_0373011 3300048917 Bacteria 1263
1962 Ga0496114_1354510 3300048917 Bacteria 599
1963 Ga0496114_1580369 3300048917 Bacteria 544
1964 Ga0496114_1767903 3300048917 Bacteria 506
1965 Ga0496115_0342373 3300048918 Bacteria 1220
1966 Ga0501306_028260 3300049127 Bacteria 821
1967 Ga0501308_000545 3300049128 Bacteria 2510
1968 Ga0501308_075966 3300049128 Bacteria 528
1969 Ga0501304_000239 3300049160 Bacteria 2475
1970 Ga0501304_019113 3300049160 Unclassified 666
1971 Ga0501307_003860 3300049162 Bacteria 1497
1972 Ga0501290_001023 3300049513 Bacteria 4000
1973 Ga0501291_006529 3300049514 Bacteria 1557
1974 Ga0501292_000099 3300049515 Bacteria 15440
1975 Ga0501293_000919 3300049516 Bacteria 2210
1976 Ga0501295_000301 3300049518 Bacteria 4716
1977 Ga0501296_001093 3300049519 Bacteria 2713
1978 Ga0501297_000031 3300049520 Bacteria 13902
1979 Ga0501297_023251 3300049520 Bacteria 787
1980 Ga0501298_000270 3300049521 Bacteria 6753
1981 Ga0501299_000277 3300049522 Bacteria 5864
1982 Ga0501300_001419 3300049523 Bacteria 3586
1983 Ga0501301_000218 3300049524 Bacteria 3268
1984 Ga0501302_000534 3300049525 Bacteria 2022
1985 Ga0501303_001485 3300049526 Bacteria 1755
1986 Ga0501315_000285 3300049531 Bacteria 3262
1987 Ga0501315_091408 3300049531 Bacteria 528
1988 Ga0501317_096406 3300049533 Bacteria 529
1989 Ga0501317_099967 3300049533 Bacteria 522
1990 Ga0501320_040267 3300049536 Bacteria 610
1991 Ga0501321_066499 3300049537 Unclassified 554
1992 Ga0501335_017429 3300049551 Bacteria 746
1993 Ga0501031_0012970 3300049568 Bacteria 5439
1994 Ga0501031_0046603 3300049568 Bacteria 2827
1995 Ga0501031_0176070 3300049568 Bacteria 1397
1996 Ga0501031_0216581 3300049568 Bacteria 1247
1997 Ga0501031_0244799 3300049568 Bacteria 1165
1998 Ga0501031_0257348 3300049568 Bacteria 1134
1999 Ga0501031_0346230 3300049568 Bacteria 962
2000 Ga0501031_0380993 3300049568 Bacteria 912
2001 Ga0501031_0420186 3300049568 Bacteria 864
2002 Ga0501031_0432745 3300049568 Bacteria 850
2003 Ga0501031_0728362 3300049568 Bacteria 636
2004 Ga0501032_0164124 3300049569 Bacteria 1458
2005 Ga0501032_0175877 3300049569 Bacteria 1402
2006 Ga0501032_0212202 3300049569 Bacteria 1262
2007 Ga0501032_0362056 3300049569 Bacteria 934
2008 Ga0501033_0259519 3300049570 Bacteria 1230
2009 Ga0501033_0800101 3300049570 Bacteria 637
2010 Ga0501034_0043527 3300049571 Bacteria 4544
2011 Ga0501034_0121015 3300049571 Bacteria 2604
2012 Ga0501034_0267917 3300049571 Bacteria 1650
2013 Ga0501034_0665260 3300049571 Bacteria 942
2014 Ga0501036_0013129 3300049572 Bacteria 6880
2015 Ga0501036_0086948 3300049572 Bacteria 2642
2016 Ga0501036_0092146 3300049572 Bacteria 2560
2017 Ga0501036_0103065 3300049572 Bacteria 2414
2018 Ga0501036_0165028 3300049572 Bacteria 1867
2019 Ga0501036_0180675 3300049572 Bacteria 1776
2020 Ga0501036_0303960 3300049572 Bacteria 1334
2021 Ga0501036_0326165 3300049572 Bacteria 1283
2022 Ga0501036_0419709 3300049572 Bacteria 1115
2023 Ga0501036_0514388 3300049572 Bacteria 996
2024 Ga0501036_1243201 3300049572 Bacteria 606
2025 Ga0501036_1348411 3300049572 Bacteria 579
2026 Ga0501037_0012100 3300049573 Bacteria 6355
2027 Ga0501037_0033284 3300049573 Bacteria 3807
2028 Ga0501037_0037277 3300049573 Bacteria 3584
2029 Ga0501037_0057660 3300049573 Bacteria 2835
2030 Ga0501037_0076034 3300049573 Bacteria 2438
2031 Ga0501037_0407609 3300049573 Bacteria 932
2032 Ga0501038_0028249 3300049574 Bacteria 4984
2033 Ga0501038_0059905 3300049574 Bacteria 3259
2034 Ga0501038_0107808 3300049574 Bacteria 2311
2035 Ga0501038_0356921 3300049574 Bacteria 1137
2036 Ga0501038_0406338 3300049574 Bacteria 1053
2037 Ga0501038_1076902 3300049574 Bacteria 588
2038 Ga0501038_1186369 3300049574 Bacteria 555
2039 Ga0501039_0001156 3300049575 Bacteria 19441
2040 Ga0501039_0001269 3300049575 Bacteria 18465
2041 Ga0501039_0027633 3300049575 Bacteria 4363
2042 Ga0501039_0054948 3300049575 Bacteria 3083
2043 Ga0501039_0069732 3300049575 Bacteria 2730
2044 Ga0501039_0088972 3300049575 Bacteria 2405
2045 Ga0501039_0440602 3300049575 Bacteria 1023
2046 Ga0501039_0502303 3300049575 Bacteria 952
2047 Ga0501039_0565604 3300049575 Bacteria 892
2048 Ga0501039_0744017 3300049575 Bacteria 766
2049 Ga0501039_0747493 3300049575 Bacteria 764
2050 Ga0501039_0830298 3300049575 Bacteria 720
2051 Ga0501040_0011743 3300049576 Bacteria 5728
2052 Ga0501040_0102211 3300049576 Bacteria 2000
2053 Ga0501040_0154328 3300049576 Bacteria 1621
2054 Ga0501040_0170598 3300049576 Bacteria 1540
2055 Ga0501040_0219591 3300049576 Bacteria 1352
2056 Ga0501040_0279363 3300049576 Bacteria 1193
2057 Ga0501040_0368868 3300049576 Bacteria 1029
2058 Ga0501040_0613113 3300049576 Bacteria 786
2059 Ga0501040_0794172 3300049576 Bacteria 685
2060 Ga0501040_0950798 3300049576 Bacteria 623
2061 Ga0501041_0020309 3300049577 Bacteria 3970
2062 Ga0501041_0028950 3300049577 Bacteria 3342
2063 Ga0501041_0035434 3300049577 Bacteria 3023
2064 Ga0501041_0085809 3300049577 Bacteria 1941
2065 Ga0501041_0110607 3300049577 Bacteria 1704
2066 Ga0501041_0113853 3300049577 Bacteria 1679
2067 Ga0501041_0183725 3300049577 Bacteria 1309
2068 Ga0501041_0224518 3300049577 Bacteria 1179
2069 Ga0501041_0319377 3300049577 Bacteria 980
2070 Ga0501041_0358086 3300049577 Bacteria 922
2071 Ga0501041_0387903 3300049577 Bacteria 884
2072 Ga0501041_0464684 3300049577 Bacteria 804
2073 Ga0501041_0472934 3300049577 Bacteria 796
2074 Ga0501041_0683583 3300049577 Bacteria 656
2075 Ga0501041_0693544 3300049577 Bacteria 651
2076 Ga0501042_0006704 3300049578 Bacteria 7504
2077 Ga0501042_0010707 3300049578 Bacteria 6163
2078 Ga0501042_0033891 3300049578 Bacteria 3621
2079 Ga0501042_0035221 3300049578 Bacteria 3551
2080 Ga0501042_0074548 3300049578 Bacteria 2428
2081 Ga0501042_0184689 3300049578 Bacteria 1504
2082 Ga0501042_0258251 3300049578 Bacteria 1258
2083 Ga0501042_0404942 3300049578 Bacteria 988
2084 Ga0501042_0486472 3300049578 Bacteria 896
2085 Ga0501042_0805952 3300049578 Bacteria 683
2086 Ga0501043_0280043 3300049579 Bacteria 1278
2087 Ga0501043_0552920 3300049579 Bacteria 855
2088 Ga0501043_0596935 3300049579 Bacteria 816
2089 Ga0501043_0669332 3300049579 Bacteria 761
2090 Ga0501043_0770615 3300049579 Bacteria 698
2091 Ga0501043_0771995 3300049579 Bacteria 697
2092 Ga0501043_1195552 3300049579 Bacteria 534
2093 Ga0501046_0001060 3300049580 Bacteria 26935
2094 Ga0501046_0027516 3300049580 Bacteria 4637
2095 Ga0501046_0036571 3300049580 Bacteria 3950
2096 Ga0501046_0079419 3300049580 Bacteria 2536
2097 Ga0501046_0082775 3300049580 Bacteria 2478
2098 Ga0501046_0141320 3300049580 Bacteria 1822
2099 Ga0501046_0288368 3300049580 Bacteria 1201
2100 Ga0501046_0525603 3300049580 Bacteria 845
2101 Ga0501048_0012332 3300049582 Bacteria 6359
2102 Ga0501048_0037285 3300049582 Bacteria 3491
2103 Ga0501048_0167248 3300049582 Bacteria 1557
2104 Ga0501048_0180521 3300049582 Bacteria 1496
2105 Ga0501048_0188112 3300049582 Bacteria 1463
2106 Ga0501048_0240732 3300049582 Bacteria 1284
2107 Ga0501048_0301739 3300049582 Bacteria 1139
2108 Ga0501048_0326417 3300049582 Bacteria 1093
2109 Ga0501048_0381893 3300049582 Bacteria 1006
2110 Ga0501048_0445183 3300049582 Bacteria 927
2111 Ga0501048_0652735 3300049582 Bacteria 755
2112 Ga0501067_0036095 3300049583 Bacteria 2745
2113 Ga0501067_0092480 3300049583 Bacteria 1679
2114 Ga0501067_0095832 3300049583 Bacteria 1648
2115 Ga0501067_0103968 3300049583 Bacteria 1578
2116 Ga0501067_0106334 3300049583 Bacteria 1559
2117 Ga0501067_0143099 3300049583 Bacteria 1332
2118 Ga0501067_0278900 3300049583 Bacteria 931
2119 Ga0501068_0013746 3300049584 Bacteria 4612
2120 Ga0501068_0021694 3300049584 Bacteria 3753
2121 Ga0501068_0078593 3300049584 Bacteria 2022
2122 Ga0501068_0092238 3300049584 Bacteria 1870
2123 Ga0501068_0231192 3300049584 Bacteria 1176
2124 Ga0501068_0261188 3300049584 Bacteria 1105
2125 Ga0501068_0274153 3300049584 Bacteria 1077
2126 Ga0501068_0294098 3300049584 Bacteria 1039
2127 Ga0501068_0305772 3300049584 Bacteria 1018
2128 Ga0501069_0022378 3300049585 Bacteria 3438
2129 Ga0501069_0613485 3300049585 Bacteria 653
2130 Ga0501069_0784856 3300049585 Bacteria 577
2131 Ga0501070_0100767 3300049586 Bacteria 2389
2132 Ga0501070_0410262 3300049586 Bacteria 1095
2133 Ga0501070_0410693 3300049586 Bacteria 1094
2134 Ga0501070_0587434 3300049586 Bacteria 889
2135 Ga0501070_0766039 3300049586 Bacteria 760
2136 Ga0501070_0810526 3300049586 Bacteria 735
2137 Ga0501070_0984384 3300049586 Bacteria 655
2138 Ga0501071_0016406 3300049587 Bacteria 5092
2139 Ga0501071_0019308 3300049587 Bacteria 4730
2140 Ga0501071_0042660 3300049587 Bacteria 3251
2141 Ga0501071_0078903 3300049587 Bacteria 2407
2142 Ga0501071_0208663 3300049587 Bacteria 1469
2143 Ga0501071_0221866 3300049587 Bacteria 1423
2144 Ga0501071_0240195 3300049587 Bacteria 1366
2145 Ga0501071_0274585 3300049587 Bacteria 1275
2146 Ga0501071_0287414 3300049587 Bacteria 1245
2147 Ga0501071_0363701 3300049587 Bacteria 1102
2148 Ga0501071_0430608 3300049587 Bacteria 1009
2149 Ga0501071_0446992 3300049587 Bacteria 989
2150 Ga0501071_0609940 3300049587 Bacteria 839
2151 Ga0501071_0716660 3300049587 Bacteria 770
2152 Ga0501071_0920827 3300049587 Bacteria 675
2153 Ga0501071_1044291 3300049587 Bacteria 631
2154 Ga0501072_0028655 3300049588 Bacteria 4347
2155 Ga0501072_0055181 3300049588 Bacteria 3132
2156 Ga0501072_0089964 3300049588 Bacteria 2437
2157 Ga0501072_0144868 3300049588 Bacteria 1894
2158 Ga0501072_0170627 3300049588 Bacteria 1736
2159 Ga0501072_0344542 3300049588 Bacteria 1183
2160 Ga0501072_0453734 3300049588 Bacteria 1015
2161 Ga0501072_0472597 3300049588 Bacteria 992
2162 Ga0501072_0828247 3300049588 Bacteria 724
2163 Ga0501072_1174194 3300049588 Bacteria 596
2164 Ga0501072_1272129 3300049588 Bacteria 571
2165 Ga0501073_0037162 3300049589 Bacteria 3459
2166 Ga0501073_0078522 3300049589 Bacteria 2297
2167 Ga0501073_0145584 3300049589 Bacteria 1642
2168 Ga0501073_0247527 3300049589 Bacteria 1231
2169 Ga0501073_0526782 3300049589 Bacteria 817
2170 Ga0501073_0964913 3300049589 Bacteria 587
2171 Ga0501074_0074160 3300049590 Bacteria 2443
2172 Ga0501074_0097267 3300049590 Bacteria 2107
2173 Ga0501074_0114081 3300049590 Bacteria 1933
2174 Ga0501074_0281912 3300049590 Bacteria 1181
2175 Ga0501074_0341162 3300049590 Bacteria 1063
2176 Ga0501074_0396766 3300049590 Bacteria 978
2177 Ga0501074_0651850 3300049590 Bacteria 744
2178 Ga0501074_0697313 3300049590 Bacteria 717
2179 Ga0501075_0007600 3300049591 Bacteria 7522
2180 Ga0501075_0037524 3300049591 Bacteria 3620
2181 Ga0501075_0041418 3300049591 Bacteria 3451
2182 Ga0501075_0049327 3300049591 Bacteria 3164
2183 Ga0501075_0056252 3300049591 Bacteria 2961
2184 Ga0501075_0074678 3300049591 Bacteria 2564
2185 Ga0501075_0077513 3300049591 Bacteria 2515
2186 Ga0501075_0216692 3300049591 Bacteria 1460
2187 Ga0501075_0452286 3300049591 Bacteria 979
2188 Ga0501075_0949574 3300049591 Bacteria 653
2189 Ga0501075_1001473 3300049591 Bacteria 635
2190 Ga0501076_0024555 3300049592 Bacteria 4660
2191 Ga0501076_0059029 3300049592 Bacteria 3051
2192 Ga0501076_0066166 3300049592 Bacteria 2884
2193 Ga0501076_0105295 3300049592 Bacteria 2276
2194 Ga0501076_0136338 3300049592 Bacteria 1992
2195 Ga0501076_0171941 3300049592 Bacteria 1766
2196 Ga0501076_0295655 3300049592 Bacteria 1327
2197 Ga0501076_0303367 3300049592 Bacteria 1309
2198 Ga0501076_0324150 3300049592 Bacteria 1263
2199 Ga0501076_0597903 3300049592 Bacteria 910
2200 Ga0501076_0791185 3300049592 Bacteria 783
2201 Ga0501076_1332593 3300049592 Bacteria 590
2202 Ga0501076_1376110 3300049592 Bacteria 580
2203 Ga0501077_0050366 3300049593 Bacteria 2647
2204 Ga0501077_0058278 3300049593 Bacteria 2451
2205 Ga0501077_0069941 3300049593 Bacteria 2225
2206 Ga0501077_0094922 3300049593 Bacteria 1891
2207 Ga0501077_0133044 3300049593 Bacteria 1577
2208 Ga0501077_0164307 3300049593 Bacteria 1410
2209 Ga0501077_0351142 3300049593 Bacteria 941
2210 Ga0501077_0429515 3300049593 Bacteria 845
2211 Ga0501077_0520223 3300049593 Bacteria 763
2212 Ga0501077_0657080 3300049593 Bacteria 673
2213 Ga0501077_0717440 3300049593 Bacteria 643
2214 Ga0501198_000368 3300049649 Bacteria 5651
2215 Ga0501199_000395 3300049650 Bacteria 3904
2216 Ga0501201_004108 3300049651 Bacteria 1343
2217 Ga0501202_002581 3300049652 Bacteria 3054
2218 Ga0501207_001334 3300049654 Bacteria 3067
2219 Ga0501208_014950 3300049655 Bacteria 1184
2220 Ga0501209_000539 3300049656 Bacteria 4659
2221 Ga0501211_000905 3300049658 Bacteria 3099
2222 Ga0501216_004848 3300049660 Bacteria 2010
2223 Ga0501228_000274 3300049666 Bacteria 3137
2224 Ga0501230_000123 3300049667 Bacteria 5948
2225 Ga0501236_007457 3300049670 Bacteria 1367
2226 Ga0501239_000263 3300049672 Bacteria 3792
2227 Ga0501239_009315 3300049672 Bacteria 1065
2228 Ga0501240_077477 3300049673 Bacteria 611
2229 Ga0501247_003028 3300049677 Bacteria 1783
2230 Ga0501249_001485 3300049679 Bacteria 4825
2231 Ga0501251_000814 3300049681 Bacteria 2844
2232 Ga0501252_001556 3300049682 Bacteria 2141
2233 Ga0501253_000056 3300049683 Bacteria 7735
2234 Ga0501257_028635 3300049686 Bacteria 1336
2235 Ga0501257_103830 3300049686 Bacteria 748
2236 Ga0501259_025443 3300049688 Bacteria 1084
2237 Ga0501260_000467 3300049689 Bacteria 3167
2238 Ga0501261_000363 3300049690 Bacteria 6080
2239 Ga0501219_003226 3300049703 Bacteria 1190
2240 Ga0501221_001134 3300049704 Bacteria 4391
2241 Ga0501225_0002251 3300049705 Bacteria 5967
2242 Ga0501229_000082 3300049706 Bacteria 9579
2243 Ga0501234_000289 3300049707 Bacteria 7356
2244 Ga0501245_038539 3300049708 Bacteria 814
2245 Ga0501079_0019241 3300049741 Bacteria 5215
2246 Ga0501079_0033531 3300049741 Bacteria 3950
2247 Ga0501079_0050830 3300049741 Bacteria 3198
2248 Ga0501079_0060533 3300049741 Bacteria 2921
2249 Ga0501079_0074271 3300049741 Bacteria 2628
2250 Ga0501079_0116813 3300049741 Bacteria 2074
2251 Ga0501079_0146251 3300049741 Bacteria 1842
2252 Ga0501079_0150311 3300049741 Bacteria 1815
2253 Ga0501079_0187932 3300049741 Bacteria 1612
2254 Ga0501079_0202480 3300049741 Bacteria 1551
2255 Ga0501079_0667119 3300049741 Bacteria 819
2256 Ga0501079_0930768 3300049741 Bacteria 684
2257 Ga0501079_0965285 3300049741 Bacteria 671
2258 Ga0501079_1110153 3300049741 Bacteria 623
2259 Ga0501080_0035459 3300049742 Bacteria 4656
2260 Ga0501080_0090497 3300049742 Bacteria 2842
2261 Ga0501080_0097121 3300049742 Bacteria 2735
2262 Ga0501080_0118564 3300049742 Bacteria 2454
2263 Ga0501080_0248500 3300049742 Bacteria 1622
2264 Ga0501080_0259376 3300049742 Bacteria 1584
2265 Ga0501080_0286173 3300049742 Bacteria 1497
2266 Ga0501080_0579870 3300049742 Bacteria 997
2267 Ga0501080_0593035 3300049742 Bacteria 984
2268 Ga0501080_0923551 3300049742 Bacteria 760
2269 Ga0501080_1317018 3300049742 Bacteria 618
2270 Ga0501081_0006759 3300049743 Bacteria 7457
2271 Ga0501081_0022316 3300049743 Bacteria 4234
2272 Ga0501081_0025332 3300049743 Bacteria 3990
2273 Ga0501081_0026245 3300049743 Bacteria 3926
2274 Ga0501081_0089075 3300049743 Bacteria 2168
2275 Ga0501081_0353952 3300049743 Bacteria 1082
2276 Ga0501081_0578732 3300049743 Bacteria 840
2277 Ga0501081_0970532 3300049743 Bacteria 642
2278 Ga0501083_0026775 3300049744 Bacteria 3984
2279 Ga0501083_0091209 3300049744 Bacteria 2012
2280 Ga0501083_0116790 3300049744 Bacteria 1751
2281 Ga0501083_0341467 3300049744 Bacteria 974
2282 Ga0501083_0356589 3300049744 Bacteria 951
2283 Ga0501083_0554030 3300049744 Bacteria 748
2284 Ga0501232_011861 3300049757 Bacteria 1006
2285 Ga0501241_012043 3300049758 Bacteria 1571
2286 Ga0501264_003563 3300049761 Bacteria 1415
2287 Ga0501265_004230 3300049762 Bacteria 1634
2288 Ga0501266_001760 3300049763 Bacteria 2746
2289 Ga0501266_002235 3300049763 Bacteria 2445
2290 Ga0501268_000911 3300049765 Bacteria 3466
2291 Ga0501271_000172 3300049768 Bacteria 5420
2292 Ga0501272_002436 3300049769 Bacteria 1841
2293 Ga0501273_001201 3300049770 Bacteria 2400
2294 Ga0501274_000707 3300049771 Bacteria 2429
2295 Ga0501275_000572 3300049772 Bacteria 4092
2296 Ga0501276_002427 3300049773 Bacteria 1313
2297 Ga0501279_001069 3300049775 Bacteria 3615
2298 Ga0501280_000659 3300049776 Bacteria 7698
2299 Ga0501281_01603 3300049777 Bacteria 1755
2300 Ga0501282_005079 3300049778 Bacteria 1406
2301 Ga0501283_000955 3300049779 Bacteria 3826
2302 Ga0501035_0024598 3300049822 Bacteria 5522
2303 Ga0501035_0026873 3300049822 Bacteria 5263
2304 Ga0501035_0049860 3300049822 Bacteria 3752
2305 Ga0501035_0078408 3300049822 Bacteria 2918
2306 Ga0501035_0157690 3300049822 Bacteria 1966
2307 Ga0501035_0220120 3300049822 Bacteria 1621
2308 Ga0501035_0403284 3300049822 Bacteria 1137
2309 Ga0501035_0456002 3300049822 Bacteria 1057
2310 Ga0501035_1176545 3300049822 Bacteria 596
2311 Ga0501044_0225905 3300049823 Bacteria 1822
2312 Ga0501044_1081626 3300049823 Unclassified 672
2313 Ga0501044_1338417 3300049823 Bacteria 582
2314 Ga0501045_0055520 3300049824 Bacteria 2896
2315 Ga0501045_0062422 3300049824 Bacteria 2734
2316 Ga0501045_0074014 3300049824 Bacteria 2509
2317 Ga0501045_0091753 3300049824 Bacteria 2245
2318 Ga0501045_0093478 3300049824 Bacteria 2224
2319 Ga0501045_0096174 3300049824 Bacteria 2191
2320 Ga0501045_0103098 3300049824 Bacteria 2112
2321 Ga0501045_0136819 3300049824 Bacteria 1821
2322 Ga0501045_0366369 3300049824 Bacteria 1072
2323 Ga0501045_0428600 3300049824 Bacteria 984
2324 Ga0501045_0489511 3300049824 Bacteria 913
2325 Ga0501045_1397389 3300049824 Bacteria 508
2326 Ga0501212_003040 3300049851 Bacteria 2074
2327 Ga0501226_000129 3300049853 Bacteria 14953
2328 nmdc:mga03683_115832_c1 3300050489 Bacteria 698
2329 nmdc:mga0yw44_163107_c1 3300050492 Bacteria 1140
2330 nmdc:mga0yw44_629176_c1 3300050492 Bacteria 729
2331 nmdc:mga05p37_100835_c1 3300050507 Bacteria 3556
2332 nmdc:mga05p37_117232_c1 3300050507 Bacteria 3272
2333 nmdc:mga05p37_190879_c1 3300050507 Bacteria 2487
2334 nmdc:mga05p37_25219_c1 3300050507 Bacteria 7231
2335 nmdc:mga05p37_260629_c2 3300050507 Bacteria 1423
2336 nmdc:mga05p37_26424_c1 3300050507 Bacteria 7061
2337 nmdc:mga05p37_265854_c1 3300050507 Bacteria 2051
2338 nmdc:mga05p37_343133_c1 3300050507 Bacteria 1760
2339 nmdc:mga05p37_38754_c1 3300050507 Bacteria 5848
2340 nmdc:mga05p37_405790_c1 3300050507 Bacteria 1590
2341 nmdc:mga05p37_486765_c1 3300050507 Bacteria 1419
2342 nmdc:mga05p37_521066_c1 3300050507 Bacteria 1360
2343 nmdc:mga05p37_524571_c1 3300050507 Bacteria 1354
2344 nmdc:mga05p37_765014_c1 3300050507 Bacteria 1062
2345 nmdc:mga05p37_777671_c1 3300050507 Bacteria 1051
2346 nmdc:mga05p37_950203_c1 3300050507 Bacteria 920
2347 nmdc:mga09592_116447_c1 3300050508 Bacteria 2294
2348 nmdc:mga09592_140683_c1 3300050508 Bacteria 2080
2349 nmdc:mga09592_22191_c1 3300050508 Bacteria 5239
2350 nmdc:mga09592_3324_c1 3300050508 Bacteria 13016
2351 nmdc:mga09592_371838_c1 3300050508 Bacteria 1236
2352 nmdc:mga0qj67_1014_c1 3300050509 Bacteria 19375
2353 nmdc:mga0qj67_46647_c1 3300050509 Bacteria 3421
2354 nmdc:mga0qj67_630_c1 3300050509 Bacteria 24211
2355 nmdc:mga0qj67_6401_c1 3300050509 Bacteria 8652
2356 nmdc:mga06r32_11036_c1 3300050510 Bacteria 8132
2357 nmdc:mga06r32_14923_c1 3300050510 Bacteria 7052
2358 nmdc:mga06r32_329099_c1 3300050510 Bacteria 1513
2359 nmdc:mga06r32_354161_c1 3300050510 Bacteria 1452
2360 nmdc:mga06r32_367487_c1 3300050510 Bacteria 1422
2361 nmdc:mga06r32_623783_c1 3300050510 Bacteria 1048
2362 nmdc:mga06r32_8250_c1 3300050510 Bacteria 9379
2363 nmdc:mga08y16_15882_c1 3300050511 Bacteria 7915
2364 nmdc:mga08y16_175752_c1 3300050511 Bacteria 2223
2365 nmdc:mga08y16_19538_c1 3300050511 Bacteria 7145
2366 nmdc:mga08y16_282257_c1 3300050511 Bacteria 1713
2367 nmdc:mga08y16_65151_c1 3300050511 Bacteria 3804
2368 nmdc:mga08y16_974389_c1 3300050511 Bacteria 829
2369 nmdc:mga0n895_1601856_c1 3300050512 Bacteria 615
2370 nmdc:mga0n895_20924_c1 3300050512 Bacteria 6110
2371 nmdc:mga0n895_220821_c1 3300050512 Bacteria 1924
2372 nmdc:mga0n895_347639_c1 3300050512 Bacteria 1502
2373 nmdc:mga0n895_37549_c1 3300050512 Bacteria 4687
2374 nmdc:mga0n895_808597_c1 3300050512 Bacteria 927
2375 nmdc:mga0n895_903334_c1 3300050512 Bacteria 869
2376 nmdc:mga0n895_92986_c1 3300050512 Bacteria 3019
2377 nmdc:mga0rr50_178102_c1 3300050513 Bacteria 1737
2378 nmdc:mga0rr50_260439_c1 3300050513 Bacteria 1443
2379 nmdc:mga0rr50_381365_c1 3300050513 Bacteria 1189
2380 nmdc:mga0rr50_613998_c1 3300050513 Bacteria 927
2381 nmdc:mga0rr50_625424_c1 3300050513 Bacteria 918
2382 nmdc:mga08x19_1256887_c1 3300050514 Bacteria 525
2383 nmdc:mga08x19_138256_c1 3300050514 Bacteria 1644
2384 nmdc:mga08x19_235695_c1 3300050514 Bacteria 1260
2385 nmdc:mga08x19_424313_c1 3300050514 Bacteria 934
2386 nmdc:mga08x19_523140_c1 3300050514 Bacteria 838
2387 nmdc:mga08x19_913854_c1 3300050514 Bacteria 623
2388 nmdc:mga08x19_985976_c1 3300050514 Bacteria 599
2389 nmdc:mga0a205_200877_c2 3300050515 Bacteria 1446
2390 nmdc:mga0a205_23945_c1 3300050515 Bacteria 5796
2391 nmdc:mga0a205_24162_c1 3300050515 Bacteria 5773
2392 nmdc:mga0a205_2463_c1 3300050515 Bacteria 16328
2393 nmdc:mga0a205_50440_c1 3300050515 Bacteria 4018
2394 nmdc:mga0a205_545205_c1 3300050515 Bacteria 1015
2395 nmdc:mga0a205_554928_c1 3300050515 Bacteria 1004
2396 nmdc:mga0a205_62566_c1 3300050515 Bacteria 3596
2397 nmdc:mga0a205_83564_c1 3300050515 Bacteria 3084
2398 nmdc:mga0a205_836668_c1 3300050515 Bacteria 768
2399 nmdc:mga0a205_957545_c1 3300050515 Bacteria 703
2400 nmdc:mga0a205_972558_c1 3300050515 Bacteria 696
2401 Ga0495601_0005585 3300053077 Bacteria 7334
2402 Ga0495601_0017386 3300053077 Bacteria 4364
2403 Ga0495601_0022243 3300053077 Bacteria 3891
2404 Ga0495601_0063259 3300053077 Bacteria 2352
2405 Ga0495601_0310902 3300053077 Bacteria 1026
2406 Ga0495601_0410332 3300053077 Bacteria 878
2407 Ga0495612_0002481 3300053078 Bacteria 7603
2408 Ga0495612_0038924 3300053078 Bacteria 1933
2409 Ga0495612_0139462 3300053078 Bacteria 1051
2410 Ga0495612_0168937 3300053078 Bacteria 957
2411 Ga0495595_0014483 3300053084 Bacteria 3347
2412 Ga0495595_0028287 3300053084 Bacteria 2504
2413 Ga0495595_0210050 3300053084 Bacteria 970
2414 Ga0495595_0391131 3300053084 Bacteria 704
2415 Ga0495619_0004548 3300053085 Bacteria 8858
2416 Ga0495619_0040283 3300053085 Bacteria 3054
2417 Ga0495619_0042943 3300053085 Bacteria 2962
2418 Ga0495619_0157294 3300053085 Bacteria 1569
2419 Ga0495619_0185762 3300053085 Bacteria 1438
2420 Ga0495619_0626001 3300053085 Bacteria 735
2421 Ga0500556_0000138 3300053104 Bacteria 60796
2422 Ga0500624_002715 3300053157 Bacteria 2353
2423 Ga0500637_0045088 3300053178 Bacteria 2500
2424 Ga0500599_000007 3300053736 Bacteria 77262
2425 Ga0501084_0029119 3300054114 Bacteria 4618
2426 Ga0501084_0037447 3300054114 Bacteria 4052
2427 Ga0501084_0039544 3300054114 Bacteria 3945
2428 Ga0501084_0046030 3300054114 Bacteria 3653
2429 Ga0501084_0050245 3300054114 Bacteria 3490
2430 Ga0501084_0126336 3300054114 Bacteria 2152
2431 Ga0501084_0210828 3300054114 Bacteria 1639
2432 Ga0501084_0255592 3300054114 Bacteria 1479
2433 Ga0501084_0328148 3300054114 Bacteria 1292
2434 Ga0501084_0344337 3300054114 Bacteria 1259
2435 Ga0501084_0349008 3300054114 Bacteria 1250
2436 Ga0501084_0369071 3300054114 Bacteria 1213
2437 Ga0501084_0382155 3300054114 Bacteria 1190
2438 Ga0501084_0492744 3300054114 Bacteria 1036
2439 Ga0501084_0522911 3300054114 Bacteria 1003
2440 Ga0501084_0616465 3300054114 Bacteria 916
2441 Ga0501084_1117089 3300054114 Bacteria 662
2442 Ga0501084_1157782 3300054114 Bacteria 649
2443 Ga0590075_010862 3300059424 Bacteria 2196
2444 Ga0590075_021280 3300059424 Bacteria 1617
2445 Ga0590075_116918 3300059424 Bacteria 697
2446 Ga0590077_102813 3300059426 Bacteria 669
2447 Ga0587066_089322 3300059490 Bacteria 681
2448 Ga0587073_0032691 3300059492 Bacteria 1085
2449 Ga0587073_0063111 3300059492 Bacteria 875
2450 Ga0587077_025514 3300059493 Bacteria 1085
2451 Ga0587077_062203 3300059493 Bacteria 812
2452 Ga0587080_077874 3300059503 Bacteria 675
2453 Ga0587082_013659 3300059504 Bacteria 1227
2454 Ga0587082_103352 3300059504 Unclassified 624
2455 Ga0587083_0016895 3300059505 Bacteria 1297
2456 Ga0587085_093235 3300059506 Bacteria 625
2457 Ga0587085_163265 3300059506 Unclassified 522
2458 Ga0587086_048315 3300059507 Unclassified 679
2459 Ga0587088_180406 3300059508 Bacteria 529
2460 Ga0587088_208858 3300059508 Bacteria 502
2461 Ga0587089_109700 3300059509 Bacteria 508
2462 Ga0587092_069526 3300059512 Bacteria 675
2463 Ga0587094_074758 3300059513 Bacteria 617
2464 Ga0587106_021680 3300059605 Bacteria 959
2465 Ga0587099_033797 3300059622 Bacteria 631
2466 Ga0587099_050038 3300059622 Bacteria 556
2467 Ga0587101_129979 3300059623 Bacteria 529
2468 Ga0587109_028251 3300059624 Bacteria 1049
2469 Ga0587109_032284 3300059624 Bacteria 1000
2470 Ga0587109_090174 3300059624 Bacteria 691
2471 Ga0587117_075674 3300059627 Bacteria 604
2472 Ga0587128_131274 3300059630 Bacteria 554
2473 Ga0587130_045768 3300059631 Unclassified 538
2474 Ga0587062_044819 3300059639 Unclassified 730
2475 Ga0587067_017299 3300059640 Bacteria 1195
2476 Ga0587067_029086 3300059640 Bacteria 1008
2477 Ga0587067_042609 3300059640 Bacteria 888
2478 Ga0587068_106105 3300059641 Bacteria 595
2479 Ga0587075_021557 3300059644 Bacteria 961
2480 Ga0587075_068584 3300059644 Unclassified 654
2481 Ga0587076_110413 3300059645 Bacteria 625
2482 Ga0587078_003548 3300059646 Bacteria 1589
2483 Ga0587079_166309 3300059647 Bacteria 581
2484 Ga0587111_0086686 3300060346 Bacteria 758
2485 Ga0501082_0036718 3300060353 Bacteria 4221
2486 Ga0501082_0046985 3300060353 Bacteria 3720
2487 Ga0501082_0057277 3300060353 Bacteria 3358
2488 Ga0501082_0075898 3300060353 Bacteria 2896
2489 Ga0501082_0177278 3300060353 Bacteria 1853
2490 Ga0501082_0208907 3300060353 Bacteria 1698
2491 Ga0501082_0319552 3300060353 Bacteria 1352
2492 Ga0501082_0363132 3300060353 Bacteria 1263
2493 Ga0501082_0405906 3300060353 Bacteria 1189
2494 Ga0501082_0688065 3300060353 Bacteria 895
2495 Ga0501082_1017907 3300060353 Bacteria 724
2496 Ga0501082_1281614 3300060353 Bacteria 640
2497 Ga0501082_1353857 3300060353 Bacteria 622
2498 Ga0466962_0005839 3300061719 Bacteria 5915
2499 Ga0530510_0009759 3300061734 Bacteria 6736
2500 Ga0530510_0011210 3300061734 Bacteria 6290
2501 Ga0530510_0015703 3300061734 Bacteria 5352
2502 Ga0530510_0053431 3300061734 Bacteria 2919
2503 Ga0530510_0054013 3300061734 Bacteria 2903
2504 Ga0530510_0062704 3300061734 Bacteria 2691
2505 Ga0530510_0093204 3300061734 Bacteria 2199
2506 Ga0530510_0097919 3300061734 Bacteria 2145
2507 Ga0530510_0295279 3300061734 Bacteria 1212
2508 Ga0530510_0421061 3300061734 Bacteria 1008
2509 Ga0530510_0457339 3300061734 Bacteria 965
2510 Ga0530510_0514600 3300061734 Bacteria 908
2511 Ga0530510_0602309 3300061734 Bacteria 836
2512 Ga0530510_0821506 3300061734 Bacteria 709
2513 Ga0530510_0898370 3300061734 Bacteria 677
2514 Ga0530510_0931005 3300061734 Bacteria 664
2515 Ga0530510_1244471 3300061734 Bacteria 571

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049742 Ga0501080_1317018 Ga0501080_1317018_44_472 115
2 3300060353 Ga0501082_1353857 Ga0501082_1353857_88_516 115
3 3300059508 Ga0587088_180406 Ga0587088_180406_89_514 120
4 3300060346 Ga0587111_0086686 Ga0587111_0086686_90_515 120
5 3300009545 Ga0105237_11443976 Ga0105237_114439762 123
6 3300010375 Ga0105239_10077653 Ga0105239_100776533 123
7 3300035724 Ga0373933_0505639 Ga0373933_0505639_53_475 123
8 3300039093 Ga0400489_70192 Ga0400489_70192_535_960 123
9 3300035692 Ga0373935_0363419 Ga0373935_0363419_504_926 124
10 3300036401 Ga0373937_0491542 Ga0373937_0491542_603_1025 124
11 3300037853 Ga0436364_0908399 Ga0436364_0908399_114_536 125
12 3300025916 Ga0207663_10108313 Ga0207663_101083136 130
13 3300004800 Ga0058861_11679632 Ga0058861_116796323 131
14 3300005329 Ga0070683_100131767 Ga0070683_1001317672 131
15 3300005458 Ga0070681_10540221 Ga0070681_105402211 131
16 3300005535 Ga0070684_100094759 Ga0070684_1000947592 131
17 3300006058 Ga0075432_10162871 Ga0075432_101628712 131
18 3300020077 Ga0206351_10424091 Ga0206351_104240911 131
19 3300020082 Ga0206353_10140992 Ga0206353_101409921 131
20 3300025912 Ga0207707_10382437 Ga0207707_103824372 131
21 3300025944 Ga0207661_10113272 Ga0207661_101132723 131
22 3300035116 Ga0373945_0515176 Ga0373945_0515176_16_411 131
23 3300042122 Ga0450920_020434 Ga0450920_020434_342_737 131
24 3300045976 Ga0466967_2311117 Ga0466967_2311117_16_411 131
25 3300049572 Ga0501036_0326165 Ga0501036_0326165_764_1189 131
26 3300049578 Ga0501042_0486472 Ga0501042_0486472_234_659 131
27 3300049587 Ga0501071_0240195 Ga0501071_0240195_687_1112 131
28 3300049590 Ga0501074_0651850 Ga0501074_0651850_304_699 131
29 3300049592 Ga0501076_0791185 Ga0501076_0791185_140_535 131
30 3300049593 Ga0501077_0717440 Ga0501077_0717440_53_478 131
31 3300049822 Ga0501035_1176545 Ga0501035_1176545_67_462 131
32 3300005467 Ga0070706_101204311 Ga0070706_1012043112 132
33 3300049741 Ga0501079_0202480 Ga0501079_0202480_572_997 132
34 3300009093 Ga0105240_10148104 Ga0105240_101481042 133
35 3300014326 Ga0157380_10247850 Ga0157380_102478502 133
36 3300049531 Ga0501315_091408 Ga0501315_091408_115_516 133
37 3300049586 Ga0501070_0766039 Ga0501070_0766039_150_551 133
38 3300049742 Ga0501080_0923551 Ga0501080_0923551_198_599 133
39 3300054114 Ga0501084_1157782 Ga0501084_1157782_160_561 133
40 3300060353 Ga0501082_0363132 Ga0501082_0363132_484_885 133
41 3300005530 Ga0070679_101165569 Ga0070679_1011655692 134
42 3300044658 Ga0466972_0011031 Ga0466972_0011031_2313_2717 134
43 3300044683 Ga0466965_0013220 Ga0466965_0013220_2360_2764 134
44 3300044735 Ga0466968_0080379 Ga0466968_0080379_369_773 134
45 3300044901 Ga0466960_0052329 Ga0466960_0052329_857_1261 134
46 3300046472 Ga0495580_0200125 Ga0495580_0200125_11_415 134
47 3300049520 Ga0501297_023251 Ga0501297_023251_23_427 134
48 3300049572 Ga0501036_1243201 Ga0501036_1243201_10_414 134
49 3300005467 Ga0070706_100000168 Ga0070706_10000016875 135
50 3300005468 Ga0070707_100000283 Ga0070707_1000002837 135
51 3300005536 Ga0070697_100005254 Ga0070697_1000052545 135
52 3300025910 Ga0207684_10000113 Ga0207684_100001136 135
53 3300025922 Ga0207646_10032894 Ga0207646_100328942 135
54 3300059490 Ga0587066_089322 Ga0587066_089322_69_494 135
55 3300039093 Ga0400489_78199 Ga0400489_78199_1231_1650 139
56 3300061734 Ga0530510_0097919 Ga0530510_0097919_681_1100 139
57 3300004799 Ga0058863_11613440 Ga0058863_116134401 140
58 3300004799 Ga0058863_11904893 Ga0058863_119048932 140
59 3300004803 Ga0058862_12677474 Ga0058862_126774742 140
60 3300005327 Ga0070658_10011068 Ga0070658_100110682 140
61 3300005327 Ga0070658_10043062 Ga0070658_100430624 140
62 3300005328 Ga0070676_10005495 Ga0070676_100054951 140
63 3300005329 Ga0070683_100201042 Ga0070683_1002010422 140
64 3300005331 Ga0070670_100002307 Ga0070670_1000023075 140
65 3300005335 Ga0070666_10004903 Ga0070666_100049035 140
66 3300005336 Ga0070680_100973959 Ga0070680_1009739591 140
67 3300005337 Ga0070682_100367295 Ga0070682_1003672952 140
68 3300005338 Ga0068868_100075864 Ga0068868_1000758642 140
69 3300005338 Ga0068868_102273902 Ga0068868_1022739021 140
70 3300005339 Ga0070660_100168547 Ga0070660_1001685471 140
71 3300005339 Ga0070660_100207875 Ga0070660_1002078752 140
72 3300005339 Ga0070660_100430809 Ga0070660_1004308092 140
73 3300005340 Ga0070689_100270686 Ga0070689_1002706862 140
74 3300005344 Ga0070661_100035984 Ga0070661_1000359842 140
75 3300005345 Ga0070692_10059042 Ga0070692_100590421 140
76 3300005347 Ga0070668_100544104 Ga0070668_1005441042 140
77 3300005354 Ga0070675_100001855 Ga0070675_1000018558 140
78 3300005355 Ga0070671_100052878 Ga0070671_1000528782 140
79 3300005356 Ga0070674_100002375 Ga0070674_1000023756 140
80 3300005364 Ga0070673_100002764 Ga0070673_1000027645 140
81 3300005366 Ga0070659_100216530 Ga0070659_1002165302 140
82 3300005366 Ga0070659_101348716 Ga0070659_1013487161 140
83 3300005367 Ga0070667_100027162 Ga0070667_1000271625 140
84 3300005406 Ga0070703_10006982 Ga0070703_100069823 140
85 3300005435 Ga0070714_100279141 Ga0070714_1002791412 140
86 3300005435 Ga0070714_100432469 Ga0070714_1004324692 140
87 3300005435 Ga0070714_100596381 Ga0070714_1005963812 140
88 3300005437 Ga0070710_10146875 Ga0070710_101468752 140
89 3300005438 Ga0070701_10054367 Ga0070701_100543675 140
90 3300005439 Ga0070711_101535653 Ga0070711_1015356531 140
91 3300005440 Ga0070705_100050675 Ga0070705_1000506753 140
92 3300005440 Ga0070705_100450323 Ga0070705_1004503232 140
93 3300005441 Ga0070700_100231168 Ga0070700_1002311681 140
94 3300005441 Ga0070700_100231372 Ga0070700_1002313722 140
95 3300005444 Ga0070694_100040047 Ga0070694_1000400475 140
96 3300005444 Ga0070694_100211540 Ga0070694_1002115402 140
97 3300005445 Ga0070708_100001270 Ga0070708_10000127017 140
98 3300005445 Ga0070708_100159532 Ga0070708_1001595323 140
99 3300005445 Ga0070708_100173962 Ga0070708_1001739625 140
100 3300005445 Ga0070708_100402628 Ga0070708_1004026282 140
101 3300005456 Ga0070678_100002858 Ga0070678_1000028585 140
102 3300005457 Ga0070662_100214792 Ga0070662_1002147922 140
103 3300005458 Ga0070681_10260961 Ga0070681_102609611 140
104 3300005458 Ga0070681_10449407 Ga0070681_104494072 140
105 3300005458 Ga0070681_10460029 Ga0070681_104600292 140
106 3300005459 Ga0068867_100022344 Ga0068867_1000223444 140
107 3300005467 Ga0070706_100000995 Ga0070706_1000009953 140
108 3300005467 Ga0070706_100006254 Ga0070706_10000625410 140
109 3300005467 Ga0070706_100055018 Ga0070706_1000550181 140
110 3300005467 Ga0070706_100068520 Ga0070706_1000685201 140
111 3300005467 Ga0070706_100096579 Ga0070706_1000965796 140
112 3300005467 Ga0070706_100114135 Ga0070706_1001141352 140
113 3300005467 Ga0070706_100293234 Ga0070706_1002932342 140
114 3300005468 Ga0070707_100019471 Ga0070707_1000194717 140
115 3300005468 Ga0070707_100025730 Ga0070707_1000257306 140
116 3300005468 Ga0070707_100040587 Ga0070707_1000405876 140
117 3300005468 Ga0070707_100098692 Ga0070707_1000986926 140
118 3300005468 Ga0070707_100157645 Ga0070707_1001576452 140
119 3300005468 Ga0070707_100246368 Ga0070707_1002463682 140
120 3300005471 Ga0070698_100022198 Ga0070698_1000221986 140
121 3300005471 Ga0070698_100045715 Ga0070698_1000457155 140
122 3300005471 Ga0070698_100111220 Ga0070698_1001112203 140
123 3300005471 Ga0070698_100295485 Ga0070698_1002954852 140
124 3300005471 Ga0070698_100605385 Ga0070698_1006053852 140
125 3300005518 Ga0070699_100001658 Ga0070699_10000165818 140
126 3300005518 Ga0070699_100015043 Ga0070699_1000150436 140
127 3300005518 Ga0070699_100059853 Ga0070699_1000598534 140
128 3300005518 Ga0070699_100621462 Ga0070699_1006214622 140
129 3300005530 Ga0070679_100513984 Ga0070679_1005139842 140
130 3300005530 Ga0070679_101068574 Ga0070679_1010685742 140
131 3300005530 Ga0070679_101480971 Ga0070679_1014809711 140
132 3300005536 Ga0070697_100011655 Ga0070697_1000116551 140
133 3300005536 Ga0070697_100083729 Ga0070697_1000837293 140
134 3300005536 Ga0070697_100112069 Ga0070697_1001120691 140
135 3300005539 Ga0068853_100170002 Ga0068853_1001700022 140
136 3300005539 Ga0068853_100902159 Ga0068853_1009021592 140
137 3300005543 Ga0070672_100000814 Ga0070672_10000081414 140
138 3300005544 Ga0070686_100844656 Ga0070686_1008446561 140
139 3300005545 Ga0070695_100061076 Ga0070695_1000610762 140
140 3300005545 Ga0070695_100350781 Ga0070695_1003507812 140
141 3300005546 Ga0070696_100026636 Ga0070696_1000266362 140
142 3300005546 Ga0070696_100150009 Ga0070696_1001500093 140
143 3300005546 Ga0070696_100157871 Ga0070696_1001578712 140
144 3300005547 Ga0070693_100594937 Ga0070693_1005949371 140
145 3300005547 Ga0070693_100673652 Ga0070693_1006736522 140
146 3300005549 Ga0070704_100024831 Ga0070704_1000248315 140
147 3300005549 Ga0070704_100516118 Ga0070704_1005161182 140
148 3300005563 Ga0068855_100184800 Ga0068855_1001848002 140
149 3300005563 Ga0068855_100838238 Ga0068855_1008382382 140
150 3300005578 Ga0068854_100885870 Ga0068854_1008858702 140
151 3300005614 Ga0068856_100000152 Ga0068856_1000001525 140
152 3300005615 Ga0070702_100821324 Ga0070702_1008213241 140
153 3300005616 Ga0068852_100217744 Ga0068852_1002177442 140
154 3300005617 Ga0068859_100360678 Ga0068859_1003606783 140
155 3300005719 Ga0068861_100414046 Ga0068861_1004140463 140
156 3300005719 Ga0068861_102109153 Ga0068861_1021091531 140
157 3300005834 Ga0068851_10117154 Ga0068851_101171542 140
158 3300005834 Ga0068851_10420493 Ga0068851_104204932 140
159 3300005843 Ga0068860_100219879 Ga0068860_1002198791 140
160 3300005844 Ga0068862_100471727 Ga0068862_1004717272 140
161 3300005937 Ga0081455_10056886 Ga0081455_100568861 140
162 3300005937 Ga0081455_10923714 Ga0081455_109237141 140
163 3300006028 Ga0070717_10006773 Ga0070717_100067735 140
164 3300006028 Ga0070717_10050855 Ga0070717_100508556 140
165 3300006058 Ga0075432_10036716 Ga0075432_100367162 140
166 3300006175 Ga0070712_100474285 Ga0070712_1004742852 140
167 3300006237 Ga0097621_100167888 Ga0097621_1001678883 140
168 3300006358 Ga0068871_100056762 Ga0068871_1000567625 140
169 3300006844 Ga0075428_100012905 Ga0075428_1000129055 140
170 3300006844 Ga0075428_100361304 Ga0075428_1003613042 140
171 3300006844 Ga0075428_100701348 Ga0075428_1007013482 140
172 3300006846 Ga0075430_100002137 Ga0075430_1000021379 140
173 3300006847 Ga0075431_100015841 Ga0075431_1000158419 140
174 3300006847 Ga0075431_100471139 Ga0075431_1004711391 140
175 3300006847 Ga0075431_101152800 Ga0075431_1011528001 140
176 3300006852 Ga0075433_10192837 Ga0075433_101928374 140
177 3300006852 Ga0075433_11040993 Ga0075433_110409931 140
178 3300006871 Ga0075434_100439876 Ga0075434_1004398762 140
179 3300006871 Ga0075434_100455620 Ga0075434_1004556202 140
180 3300006880 Ga0075429_100105220 Ga0075429_1001052206 140
181 3300006880 Ga0075429_100303480 Ga0075429_1003034803 140
182 3300006881 Ga0068865_100645142 Ga0068865_1006451422 140
183 3300006881 Ga0068865_101398398 Ga0068865_1013983981 140
184 3300006914 Ga0075436_100225089 Ga0075436_1002250892 140
185 3300006931 Ga0097620_100360708 Ga0097620_1003607083 140
186 3300009093 Ga0105240_10064917 Ga0105240_100649174 140
187 3300009093 Ga0105240_11036766 Ga0105240_110367662 140
188 3300009094 Ga0111539_10006226 Ga0111539_100062269 140
189 3300009094 Ga0111539_10250891 Ga0111539_102508912 140
190 3300009094 Ga0111539_10295120 Ga0111539_102951202 140
191 3300009098 Ga0105245_10573958 Ga0105245_105739582 140
192 3300009098 Ga0105245_10698274 Ga0105245_106982741 140
193 3300009098 Ga0105245_11533842 Ga0105245_115338421 140
194 3300009147 Ga0114129_10429027 Ga0114129_104290272 140
195 3300009147 Ga0114129_11574178 Ga0114129_115741781 140
196 3300009147 Ga0114129_12175656 Ga0114129_121756561 140
197 3300009148 Ga0105243_11906794 Ga0105243_119067941 140
198 3300009174 Ga0105241_10340328 Ga0105241_103403282 140
199 3300009176 Ga0105242_10499044 Ga0105242_104990442 140
200 3300009176 Ga0105242_11097813 Ga0105242_110978132 140
201 3300009551 Ga0105238_10082559 Ga0105238_100825594 140
202 3300009551 Ga0105238_11251296 Ga0105238_112512961 140
203 3300009553 Ga0105249_10155332 Ga0105249_101553322 140
204 3300009553 Ga0105249_10691270 Ga0105249_106912702 140
205 3300010375 Ga0105239_11118544 Ga0105239_111185441 140
206 3300010375 Ga0105239_11394479 Ga0105239_113944791 140
207 3300011119 Ga0105246_10142341 Ga0105246_101423412 140
208 3300011119 Ga0105246_10338561 Ga0105246_103385612 140
209 3300013100 Ga0157373_10260023 Ga0157373_102600232 140
210 3300013102 Ga0157371_10214504 Ga0157371_102145042 140
211 3300013104 Ga0157370_10177592 Ga0157370_101775923 140
212 3300013105 Ga0157369_12126948 Ga0157369_121269481 140
213 3300013296 Ga0157374_10022085 Ga0157374_100220854 140
214 3300013297 Ga0157378_10012024 Ga0157378_100120244 140
215 3300013306 Ga0163162_10404229 Ga0163162_104042293 140
216 3300013306 Ga0163162_11118711 Ga0163162_111187111 140
217 3300013307 Ga0157372_12473555 Ga0157372_124735551 140
218 3300013307 Ga0157372_12559456 Ga0157372_125594561 140
219 3300013308 Ga0157375_10005218 Ga0157375_100052185 140
220 3300014325 Ga0163163_10398758 Ga0163163_103987582 140
221 3300014745 Ga0157377_10080795 Ga0157377_100807952 140
222 3300014745 Ga0157377_10343700 Ga0157377_103437002 140
223 3300014745 Ga0157377_10356555 Ga0157377_103565552 140
224 3300014968 Ga0157379_10390209 Ga0157379_103902092 140
225 3300014969 Ga0157376_10009134 Ga0157376_100091344 140
226 3300015261 Ga0182006_1115909 Ga0182006_11159092 140
227 3300020069 Ga0197907_10423327 Ga0197907_104233277 140
228 3300020069 Ga0197907_10731140 Ga0197907_107311402 140
229 3300020070 Ga0206356_11037950 Ga0206356_110379502 140
230 3300020070 Ga0206356_11084074 Ga0206356_110840741 140
231 3300020070 Ga0206356_11233718 Ga0206356_112337182 140
232 3300020070 Ga0206356_11785593 Ga0206356_117855931 140
233 3300020075 Ga0206349_1135626 Ga0206349_11356262 140
234 3300020076 Ga0206355_1649746 Ga0206355_16497465 140
235 3300020076 Ga0206355_1697341 Ga0206355_16973412 140
236 3300020077 Ga0206351_10104184 Ga0206351_101041841 140
237 3300020077 Ga0206351_10945886 Ga0206351_109458861 140
238 3300020078 Ga0206352_10098864 Ga0206352_100988645 140
239 3300020078 Ga0206352_10236499 Ga0206352_102364992 140
240 3300020078 Ga0206352_10974552 Ga0206352_109745522 140
241 3300020080 Ga0206350_10135750 Ga0206350_101357507 140
242 3300020080 Ga0206350_10393876 Ga0206350_103938765 140
243 3300020080 Ga0206350_10470390 Ga0206350_104703901 140
244 3300020080 Ga0206350_10807924 Ga0206350_108079247 140
245 3300020080 Ga0206350_10982794 Ga0206350_109827945 140
246 3300020081 Ga0206354_10842494 Ga0206354_108424942 140
247 3300020081 Ga0206354_11101861 Ga0206354_111018612 140
248 3300020082 Ga0206353_10478352 Ga0206353_104783522 140
249 3300020082 Ga0206353_10771970 Ga0206353_107719702 140
250 3300020082 Ga0206353_11451431 Ga0206353_114514315 140
251 3300021358 Ga0213873_10047578 Ga0213873_100475782 140
252 3300021358 Ga0213873_10166647 Ga0213873_101666472 140
253 3300021377 Ga0213874_10000323 Ga0213874_100003236 140
254 3300021377 Ga0213874_10006070 Ga0213874_100060702 140
255 3300021377 Ga0213874_10324850 Ga0213874_103248501 140
256 3300021388 Ga0213875_10012755 Ga0213875_100127555 140
257 3300021388 Ga0213875_10023804 Ga0213875_100238043 140
258 3300022467 Ga0224712_10000464 Ga0224712_100004645 140
259 3300022467 Ga0224712_10010011 Ga0224712_100100115 140
260 3300022467 Ga0224712_10103090 Ga0224712_101030902 140
261 3300025321 Ga0207656_10084626 Ga0207656_100846262 140
262 3300025885 Ga0207653_10067529 Ga0207653_100675292 140
263 3300025898 Ga0207692_10156747 Ga0207692_101567472 140
264 3300025901 Ga0207688_10110432 Ga0207688_101104322 140
265 3300025903 Ga0207680_10010129 Ga0207680_100101293 140
266 3300025904 Ga0207647_10259300 Ga0207647_102593001 140
267 3300025907 Ga0207645_10006914 Ga0207645_100069145 140
268 3300025908 Ga0207643_10142998 Ga0207643_101429982 140
269 3300025909 Ga0207705_10009886 Ga0207705_100098867 140
270 3300025909 Ga0207705_10033725 Ga0207705_100337252 140
271 3300025910 Ga0207684_10001422 Ga0207684_1000142220 140
272 3300025910 Ga0207684_10005489 Ga0207684_100054894 140
273 3300025910 Ga0207684_10007582 Ga0207684_100075825 140
274 3300025910 Ga0207684_10009118 Ga0207684_100091189 140
275 3300025910 Ga0207684_10660313 Ga0207684_106603131 140
276 3300025911 Ga0207654_10527531 Ga0207654_105275312 140
277 3300025912 Ga0207707_10188579 Ga0207707_101885792 140
278 3300025912 Ga0207707_10215340 Ga0207707_102153401 140
279 3300025912 Ga0207707_10277469 Ga0207707_102774693 140
280 3300025912 Ga0207707_10441426 Ga0207707_104414262 140
281 3300025913 Ga0207695_10369800 Ga0207695_103698002 140
282 3300025915 Ga0207693_10398560 Ga0207693_103985602 140
283 3300025917 Ga0207660_10797542 Ga0207660_107975421 140
284 3300025919 Ga0207657_10166107 Ga0207657_101661071 140
285 3300025919 Ga0207657_10316729 Ga0207657_103167292 140
286 3300025919 Ga0207657_11055538 Ga0207657_110555381 140
287 3300025920 Ga0207649_10166307 Ga0207649_101663072 140
288 3300025921 Ga0207652_11001933 Ga0207652_110019331 140
289 3300025922 Ga0207646_10000786 Ga0207646_1000078632 140
290 3300025922 Ga0207646_10001781 Ga0207646_1000178122 140
291 3300025922 Ga0207646_10007018 Ga0207646_100070186 140
292 3300025922 Ga0207646_10009625 Ga0207646_100096255 140
293 3300025922 Ga0207646_10101533 Ga0207646_101015331 140
294 3300025922 Ga0207646_10210668 Ga0207646_102106682 140
295 3300025924 Ga0207694_10210828 Ga0207694_102108283 140
296 3300025925 Ga0207650_10075372 Ga0207650_100753722 140
297 3300025926 Ga0207659_10003367 Ga0207659_100033676 140
298 3300025926 Ga0207659_10255671 Ga0207659_102556712 140
299 3300025927 Ga0207687_10533196 Ga0207687_105331961 140
300 3300025927 Ga0207687_11205069 Ga0207687_112050691 140
301 3300025927 Ga0207687_11329612 Ga0207687_113296122 140
302 3300025928 Ga0207700_10402690 Ga0207700_104026902 140
303 3300025929 Ga0207664_10565687 Ga0207664_105656871 140
304 3300025929 Ga0207664_11709689 Ga0207664_117096891 140
305 3300025931 Ga0207644_10021914 Ga0207644_100219143 140
306 3300025932 Ga0207690_10149522 Ga0207690_101495221 140
307 3300025932 Ga0207690_10157476 Ga0207690_101574762 140
308 3300025933 Ga0207706_10243834 Ga0207706_102438343 140
309 3300025938 Ga0207704_10017148 Ga0207704_100171486 140
310 3300025938 Ga0207704_11246572 Ga0207704_112465721 140
311 3300025940 Ga0207691_10002993 Ga0207691_100029935 140
312 3300025944 Ga0207661_10228414 Ga0207661_102284144 140
313 3300025944 Ga0207661_10484215 Ga0207661_104842152 140
314 3300025945 Ga0207679_10137763 Ga0207679_101377631 140
315 3300025949 Ga0207667_10249234 Ga0207667_102492343 140
316 3300025949 Ga0207667_10625382 Ga0207667_106253822 140
317 3300025949 Ga0207667_11757560 Ga0207667_117575601 140
318 3300025960 Ga0207651_10002331 Ga0207651_100023315 140
319 3300025960 Ga0207651_10952852 Ga0207651_109528522 140
320 3300025961 Ga0207712_10026693 Ga0207712_1002669310 140
321 3300025961 Ga0207712_11307812 Ga0207712_113078121 140
322 3300025972 Ga0207668_10086012 Ga0207668_100860123 140
323 3300025981 Ga0207640_11197914 Ga0207640_111979141 140
324 3300025986 Ga0207658_10033052 Ga0207658_100330524 140
325 3300026035 Ga0207703_11327218 Ga0207703_113272182 140
326 3300026041 Ga0207639_10546435 Ga0207639_105464352 140
327 3300026041 Ga0207639_11002631 Ga0207639_110026311 140
328 3300026075 Ga0207708_10186229 Ga0207708_101862291 140
329 3300026089 Ga0207648_10371456 Ga0207648_103714562 140
330 3300026118 Ga0207675_101329237 Ga0207675_1013292371 140
331 3300026121 Ga0207683_10002751 Ga0207683_100027514 140
332 3300026121 Ga0207683_10084306 Ga0207683_100843064 140
333 3300026142 Ga0207698_11143324 Ga0207698_111433241 140
334 3300026142 Ga0207698_11859205 Ga0207698_118592051 140
335 3300027526 Ga0209968_1005468 Ga0209968_10054686 140
336 3300027876 Ga0209974_10016162 Ga0209974_100161622 140
337 3300027907 Ga0207428_10021619 Ga0207428_100216193 140
338 3300027907 Ga0207428_10109844 Ga0207428_101098441 140
339 3300027907 Ga0207428_10349869 Ga0207428_103498692 140
340 3300028379 Ga0268266_10479656 Ga0268266_104796561 140
341 3300028380 Ga0268265_10196719 Ga0268265_101967192 140
342 3300028380 Ga0268265_10271302 Ga0268265_102713022 140
343 3300028381 Ga0268264_10116398 Ga0268264_101163986 140
344 3300028381 Ga0268264_12144911 Ga0268264_121449111 140
345 3300031548 Ga0307408_100635946 Ga0307408_1006359462 140
346 3300031665 Ga0316575_10312469 Ga0316575_103124691 140
347 3300031691 Ga0316579_10019327 Ga0316579_100193272 140
348 3300031691 Ga0316579_10177488 Ga0316579_101774881 140
349 3300031728 Ga0316578_10659500 Ga0316578_106595002 140
350 3300031733 Ga0316577_10030298 Ga0316577_100302983 140
351 3300031733 Ga0316577_10098313 Ga0316577_100983132 140
352 3300031733 Ga0316577_10241868 Ga0316577_102418682 140
353 3300031824 Ga0307413_10462120 Ga0307413_104621202 140
354 3300031852 Ga0307410_10871678 Ga0307410_108716781 140
355 3300031903 Ga0307407_10199236 Ga0307407_101992362 140
356 3300031903 Ga0307407_10214763 Ga0307407_102147633 140
357 3300031995 Ga0307409_100101880 Ga0307409_1001018803 140
358 3300031995 Ga0307409_100507328 Ga0307409_1005073281 140
359 3300032002 Ga0307416_100454910 Ga0307416_1004549102 140
360 3300032126 Ga0307415_100181481 Ga0307415_1001814811 140
361 3300032126 Ga0307415_101004216 Ga0307415_1010042162 140
362 3300032168 Ga0316593_10003348 Ga0316593_100033484 140
363 3300032168 Ga0316593_10011938 Ga0316593_100119383 140
364 3300032168 Ga0316593_10020812 Ga0316593_100208122 140
365 3300032168 Ga0316593_10026803 Ga0316593_100268033 140
366 3300032168 Ga0316593_10027431 Ga0316593_100274314 140
367 3300032168 Ga0316593_10039065 Ga0316593_100390652 140
368 3300032168 Ga0316593_10039887 Ga0316593_100398872 140
369 3300032168 Ga0316593_10089232 Ga0316593_100892322 140
370 3300032168 Ga0316593_10133368 Ga0316593_101333682 140
371 3300032168 Ga0316593_10230694 Ga0316593_102306942 140
372 3300032168 Ga0316593_10249992 Ga0316593_102499922 140
373 3300033524 Ga0316592_1042650 Ga0316592_10426502 140
374 3300033541 Ga0316596_1000776 Ga0316596_10007765 140
375 3300033541 Ga0316596_1008157 Ga0316596_10081572 140
376 3300033541 Ga0316596_1021648 Ga0316596_10216483 140
377 3300033541 Ga0316596_1063711 Ga0316596_10637112 140
378 3300033541 Ga0316596_1124564 Ga0316596_11245642 140
379 3300033541 Ga0316596_1127195 Ga0316596_11271952 140
380 3300033541 Ga0316596_1146181 Ga0316596_11461812 140
381 3300035085 Ga0373929_0137949 Ga0373929_0137949_189_611 140
382 3300035170 Ga0373943_0053792 Ga0373943_0053792_226_648 140
383 3300035170 Ga0373943_0327519 Ga0373943_0327519_341_763 140
384 3300035691 Ga0373931_0588402 Ga0373931_0588402_105_527 140
385 3300035692 Ga0373935_0104542 Ga0373935_0104542_1187_1609 140
386 3300035692 Ga0373935_0349216 Ga0373935_0349216_443_865 140
387 3300035695 Ga0373927_0432505 Ga0373927_0432505_193_615 140
388 3300035695 Ga0373927_0992345 Ga0373927_0992345_16_438 140
389 3300035724 Ga0373933_0017917 Ga0373933_0017917_2009_2431 140
390 3300035725 Ga0373947_0431456 Ga0373947_0431456_437_859 140
391 3300036401 Ga0373937_1019716 Ga0373937_1019716_273_695 140
392 3300036401 Ga0373937_1283788 Ga0373937_1283788_78_500 140
393 3300036647 Ga0316582_0447332 Ga0316582_0447332_302_724 140
394 3300037068 Ga0373925_0290874 Ga0373925_0290874_836_1258 140
395 3300037418 Ga0395900_0279869 Ga0395900_0279869_835_1257 140
396 3300037418 Ga0395900_0990944 Ga0395900_0990944_11_433 140
397 3300037466 Ga0395898_0009210 Ga0395898_0009210_7375_7797 140
398 3300037466 Ga0395898_0551091 Ga0395898_0551091_530_952 140
399 3300037853 Ga0436364_0059242 Ga0436364_0059242_19836_20258 140
400 3300037853 Ga0436364_0080211 Ga0436364_0080211_2239_2661 140
401 3300037853 Ga0436364_0414111 Ga0436364_0414111_90_512 140
402 3300037853 Ga0436364_1420369 Ga0436364_1420369_23_445 140
403 3300039093 Ga0400489_27808 Ga0400489_27808_1208_1630 140
404 3300039093 Ga0400489_64154 Ga0400489_64154_35143_35565 140
405 3300039093 Ga0400489_95071 Ga0400489_95071_2132_2554 140
406 3300039437 Ga0436365_0988567 Ga0436365_0988567_3073_3495 140
407 3300039437 Ga0436365_1816100 Ga0436365_1816100_504_926 140
408 3300039447 Ga0436361_1097269 Ga0436361_1097269_365_787 140
409 3300039450 Ga0436363_0189181 Ga0436363_0189181_169_591 140
410 3300039450 Ga0436363_0914349 Ga0436363_0914349_29882_30304 140
411 3300039450 Ga0436363_1468593 Ga0436363_1468593_48_470 140
412 3300039450 Ga0436363_1633672 Ga0436363_1633672_2450_2872 140
413 3300039453 Ga0436362_0376138 Ga0436362_0376138_959_1381 140
414 3300039453 Ga0436362_1256068 Ga0436362_1256068_767_1189 140
415 3300042012 Ga0439455_0178183 Ga0439455_0178183_45_467 140
416 3300042012 Ga0439455_0236079 Ga0439455_0236079_70_492 140
417 3300042142 Ga0450905_040426 Ga0450905_040426_282_704 140
418 3300044656 Ga0466969_0036716 Ga0466969_0036716_2015_2437 140
419 3300044656 Ga0466969_0117587 Ga0466969_0117587_581_1003 140
420 3300044658 Ga0466972_0019729 Ga0466972_0019729_2325_2747 140
421 3300044658 Ga0466972_0095775 Ga0466972_0095775_916_1338 140
422 3300044673 Ga0453683_0081399 Ga0453683_0081399_1177_1599 140
423 3300044684 Ga0466966_0003798 Ga0466966_0003798_2606_3028 140
424 3300044684 Ga0466966_0067466 Ga0466966_0067466_1388_1810 140
425 3300044693 Ga0466961_0008523 Ga0466961_0008523_4388_4810 140
426 3300044712 Ga0453684_0000042 Ga0453684_0000042_247347_247769 140
427 3300044712 Ga0453684_0020308 Ga0453684_0020308_8226_8657 140
428 3300044719 Ga0466971_0099790 Ga0466971_0099790_846_1268 140
429 3300044765 Ga0466970_0025436 Ga0466970_0025436_871_1293 140
430 3300044765 Ga0466970_0068701 Ga0466970_0068701_1374_1796 140
431 3300044765 Ga0466970_0356072 Ga0466970_0356072_314_736 140
432 3300044842 Ga0466957_0015985 Ga0466957_0015985_1814_2236 140
433 3300045049 Ga0466959_0055926 Ga0466959_0055926_891_1313 140
434 3300045049 Ga0466959_0073654 Ga0466959_0073654_23_445 140
435 3300045049 Ga0466959_0100693 Ga0466959_0100693_609_1031 140
436 3300045051 Ga0451576_0081209 Ga0451576_0081209_2130_2552 140
437 3300045836 Ga0466958_0004601 Ga0466958_0004601_2953_3375 140
438 3300045976 Ga0466967_0684173 Ga0466967_0684173_484_906 140
439 3300046454 Ga0495592_0539505 Ga0495592_0539505_15_437 140
440 3300046461 Ga0495641_0323258 Ga0495641_0323258_227_649 140
441 3300046463 Ga0495653_0354943 Ga0495653_0354943_148_570 140
442 3300046472 Ga0495580_0444191 Ga0495580_0444191_96_518 140
443 3300046473 Ga0495582_0577449 Ga0495582_0577449_212_634 140
444 3300046477 Ga0495664_0183913 Ga0495664_0183913_161_583 140
445 3300046477 Ga0495664_0627221 Ga0495664_0627221_143_565 140
446 3300046516 Ga0495628_0170268 Ga0495628_0170268_353_775 140
447 3300046533 Ga0495640_0678750 Ga0495640_0678750_176_598 140
448 3300046535 Ga0495586_0134792 Ga0495586_0134792_559_981 140
449 3300046675 Ga0495657_0292430 Ga0495657_0292430_416_838 140
450 3300046690 Ga0495624_0665236 Ga0495624_0665236_107_529 140
451 3300046692 Ga0495671_0206635 Ga0495671_0206635_470_892 140
452 3300047319 Ga0495674_0056520 Ga0495674_0056520_1337_1759 140
453 3300047319 Ga0495674_0068064 Ga0495674_0068064_2342_2764 140
454 3300047320 Ga0495672_0350525 Ga0495672_0350525_47_469 140
455 3300048903 Ga0496100_0292949 Ga0496100_0292949_597_1019 140
456 3300048903 Ga0496100_0473097 Ga0496100_0473097_503_925 140
457 3300048905 Ga0496102_0030213 Ga0496102_0030213_693_1115 140
458 3300048905 Ga0496102_0178611 Ga0496102_0178611_289_711 140
459 3300048905 Ga0496102_0221210 Ga0496102_0221210_461_883 140
460 3300048906 Ga0496103_0011651 Ga0496103_0011651_1204_1626 140
461 3300048906 Ga0496103_0119333 Ga0496103_0119333_992_1414 140
462 3300048907 Ga0496104_0022038 Ga0496104_0022038_422_844 140
463 3300048907 Ga0496104_0056307 Ga0496104_0056307_643_1065 140
464 3300048908 Ga0496105_0090866 Ga0496105_0090866_762_1184 140
465 3300048909 Ga0496106_0102301 Ga0496106_0102301_720_1142 140
466 3300048910 Ga0496107_0057366 Ga0496107_0057366_1152_1574 140
467 3300048910 Ga0496107_1098106 Ga0496107_1098106_110_532 140
468 3300048911 Ga0496108_0005881 Ga0496108_0005881_4381_4803 140
469 3300048911 Ga0496108_0022348 Ga0496108_0022348_4500_4922 140
470 3300048912 Ga0496109_0007365 Ga0496109_0007365_3311_3733 140
471 3300048912 Ga0496109_0025197 Ga0496109_0025197_3615_4037 140
472 3300048913 Ga0496110_0121133 Ga0496110_0121133_29_451 140
473 3300048913 Ga0496110_0241584 Ga0496110_0241584_1132_1554 140
474 3300048914 Ga0496111_0515172 Ga0496111_0515172_300_722 140
475 3300048915 Ga0496112_0002921 Ga0496112_0002921_7000_7422 140
476 3300048915 Ga0496112_1486953 Ga0496112_1486953_77_499 140
477 3300048916 Ga0496113_0010238 Ga0496113_0010238_4862_5284 140
478 3300048916 Ga0496113_0158285 Ga0496113_0158285_1065_1487 140
479 3300048917 Ga0496114_0004035 Ga0496114_0004035_9537_9959 140
480 3300048917 Ga0496114_0182212 Ga0496114_0182212_452_874 140
481 3300048917 Ga0496114_1354510 Ga0496114_1354510_25_447 140
482 3300048918 Ga0496115_0342373 Ga0496115_0342373_521_943 140
483 3300049568 Ga0501031_0012970 Ga0501031_0012970_4127_4549 140
484 3300049568 Ga0501031_0046603 Ga0501031_0046603_1040_1462 140
485 3300049568 Ga0501031_0176070 Ga0501031_0176070_70_492 140
486 3300049568 Ga0501031_0380993 Ga0501031_0380993_366_788 140
487 3300049568 Ga0501031_0728362 Ga0501031_0728362_105_527 140
488 3300049569 Ga0501032_0175877 Ga0501032_0175877_726_1148 140
489 3300049571 Ga0501034_0121015 Ga0501034_0121015_1534_1956 140
490 3300049571 Ga0501034_0665260 Ga0501034_0665260_407_829 140
491 3300049572 Ga0501036_0013129 Ga0501036_0013129_1601_2023 140
492 3300049572 Ga0501036_0086948 Ga0501036_0086948_706_1128 140
493 3300049572 Ga0501036_0092146 Ga0501036_0092146_631_1053 140
494 3300049572 Ga0501036_0514388 Ga0501036_0514388_403_825 140
495 3300049573 Ga0501037_0012100 Ga0501037_0012100_5884_6306 140
496 3300049573 Ga0501037_0033284 Ga0501037_0033284_1109_1531 140
497 3300049573 Ga0501037_0037277 Ga0501037_0037277_884_1306 140
498 3300049573 Ga0501037_0076034 Ga0501037_0076034_1870_2292 140
499 3300049574 Ga0501038_0028249 Ga0501038_0028249_3879_4301 140
500 3300049574 Ga0501038_0059905 Ga0501038_0059905_928_1350 140
501 3300049575 Ga0501039_0001156 Ga0501039_0001156_13339_13761 140
502 3300049575 Ga0501039_0001269 Ga0501039_0001269_4700_5122 140
503 3300049575 Ga0501039_0069732 Ga0501039_0069732_1041_1463 140
504 3300049575 Ga0501039_0088972 Ga0501039_0088972_1224_1646 140
505 3300049575 Ga0501039_0744017 Ga0501039_0744017_315_737 140
506 3300049576 Ga0501040_0011743 Ga0501040_0011743_4007_4429 140
507 3300049576 Ga0501040_0279363 Ga0501040_0279363_124_546 140
508 3300049576 Ga0501040_0950798 Ga0501040_0950798_104_526 140
509 3300049577 Ga0501041_0020309 Ga0501041_0020309_1210_1632 140
510 3300049577 Ga0501041_0085809 Ga0501041_0085809_366_788 140
511 3300049577 Ga0501041_0472934 Ga0501041_0472934_23_445 140
512 3300049577 Ga0501041_0683583 Ga0501041_0683583_27_449 140
513 3300049577 Ga0501041_0693544 Ga0501041_0693544_20_442 140
514 3300049578 Ga0501042_0006704 Ga0501042_0006704_5606_6028 140
515 3300049578 Ga0501042_0010707 Ga0501042_0010707_1643_2065 140
516 3300049578 Ga0501042_0035221 Ga0501042_0035221_1458_1880 140
517 3300049578 Ga0501042_0074548 Ga0501042_0074548_1092_1514 140
518 3300049579 Ga0501043_0280043 Ga0501043_0280043_236_658 140
519 3300049579 Ga0501043_0596935 Ga0501043_0596935_354_776 140
520 3300049579 Ga0501043_0771995 Ga0501043_0771995_55_477 140
521 3300049580 Ga0501046_0001060 Ga0501046_0001060_25468_25890 140
522 3300049580 Ga0501046_0001060 Ga0501046_0001060_9167_9589 140
523 3300049580 Ga0501046_0027516 Ga0501046_0027516_2623_3045 140
524 3300049580 Ga0501046_0036571 Ga0501046_0036571_926_1348 140
525 3300049580 Ga0501046_0525603 Ga0501046_0525603_289_711 140
526 3300049582 Ga0501048_0012332 Ga0501048_0012332_2346_2768 140
527 3300049582 Ga0501048_0381893 Ga0501048_0381893_91_513 140
528 3300049583 Ga0501067_0103968 Ga0501067_0103968_234_656 140
529 3300049583 Ga0501067_0143099 Ga0501067_0143099_88_510 140
530 3300049584 Ga0501068_0013746 Ga0501068_0013746_1814_2236 140
531 3300049585 Ga0501069_0022378 Ga0501069_0022378_1854_2276 140
532 3300049585 Ga0501069_0784856 Ga0501069_0784856_42_464 140
533 3300049586 Ga0501070_0100767 Ga0501070_0100767_1054_1476 140
534 3300049586 Ga0501070_0810526 Ga0501070_0810526_53_475 140
535 3300049587 Ga0501071_0016406 Ga0501071_0016406_999_1421 140
536 3300049587 Ga0501071_0609940 Ga0501071_0609940_376_798 140
537 3300049588 Ga0501072_0453734 Ga0501072_0453734_513_935 140
538 3300049588 Ga0501072_1174194 Ga0501072_1174194_30_452 140
539 3300049589 Ga0501073_0078522 Ga0501073_0078522_1031_1453 140
540 3300049589 Ga0501073_0964913 Ga0501073_0964913_102_524 140
541 3300049590 Ga0501074_0074160 Ga0501074_0074160_895_1317 140
542 3300049591 Ga0501075_0041418 Ga0501075_0041418_2397_2819 140
543 3300049591 Ga0501075_0074678 Ga0501075_0074678_216_638 140
544 3300049591 Ga0501075_1001473 Ga0501075_1001473_24_446 140
545 3300049592 Ga0501076_0059029 Ga0501076_0059029_1448_1870 140
546 3300049592 Ga0501076_0324150 Ga0501076_0324150_722_1144 140
547 3300049592 Ga0501076_1332593 Ga0501076_1332593_154_576 140
548 3300049592 Ga0501076_1376110 Ga0501076_1376110_20_442 140
549 3300049593 Ga0501077_0050366 Ga0501077_0050366_1521_1943 140
550 3300049593 Ga0501077_0058278 Ga0501077_0058278_762_1184 140
551 3300049593 Ga0501077_0164307 Ga0501077_0164307_339_761 140
552 3300049741 Ga0501079_0050830 Ga0501079_0050830_1295_1717 140
553 3300049741 Ga0501079_0074271 Ga0501079_0074271_813_1235 140
554 3300049741 Ga0501079_0116813 Ga0501079_0116813_986_1408 140
555 3300049741 Ga0501079_1110153 Ga0501079_1110153_186_608 140
556 3300049742 Ga0501080_0090497 Ga0501080_0090497_1974_2396 140
557 3300049743 Ga0501081_0026245 Ga0501081_0026245_2449_2871 140
558 3300049743 Ga0501081_0970532 Ga0501081_0970532_192_614 140
559 3300049744 Ga0501083_0026775 Ga0501083_0026775_2560_2982 140
560 3300049822 Ga0501035_0024598 Ga0501035_0024598_1108_1530 140
561 3300049822 Ga0501035_0026873 Ga0501035_0026873_3928_4350 140
562 3300049822 Ga0501035_0049860 Ga0501035_0049860_944_1366 140
563 3300049822 Ga0501035_0078408 Ga0501035_0078408_1674_2096 140
564 3300049823 Ga0501044_0225905 Ga0501044_0225905_1385_1807 140
565 3300049824 Ga0501045_0103098 Ga0501045_0103098_1300_1722 140
566 3300049824 Ga0501045_0428600 Ga0501045_0428600_29_451 140
567 3300050507 nmdc:mga05p37_100835_c1 nmdc:mga05p37_100835_c1_3107_3529 140
568 3300050507 nmdc:mga05p37_405790_c1 nmdc:mga05p37_405790_c1_1115_1537 140
569 3300050507 nmdc:mga05p37_765014_c1 nmdc:mga05p37_765014_c1_23_445 140
570 3300050508 nmdc:mga09592_140683_c1 nmdc:mga09592_140683_c1_28_450 140
571 3300050509 nmdc:mga0qj67_630_c1 nmdc:mga0qj67_630_c1_13349_13771 140
572 3300050510 nmdc:mga06r32_354161_c1 nmdc:mga06r32_354161_c1_802_1224 140
573 3300050510 nmdc:mga06r32_8250_c1 nmdc:mga06r32_8250_c1_736_1158 140
574 3300050511 nmdc:mga08y16_15882_c1 nmdc:mga08y16_15882_c1_3607_4029 140
575 3300050511 nmdc:mga08y16_175752_c1 nmdc:mga08y16_175752_c1_1309_1731 140
576 3300050511 nmdc:mga08y16_282257_c1 nmdc:mga08y16_282257_c1_990_1412 140
577 3300050512 nmdc:mga0n895_808597_c1 nmdc:mga0n895_808597_c1_111_533 140
578 3300050514 nmdc:mga08x19_424313_c1 nmdc:mga08x19_424313_c1_198_620 140
579 3300050514 nmdc:mga08x19_985976_c1 nmdc:mga08x19_985976_c1_156_578 140
580 3300050515 nmdc:mga0a205_50440_c1 nmdc:mga0a205_50440_c1_2369_2791 140
581 3300050515 nmdc:mga0a205_554928_c1 nmdc:mga0a205_554928_c1_177_599 140
582 3300053078 Ga0495612_0002481 Ga0495612_0002481_5937_6359 140
583 3300053078 Ga0495612_0139462 Ga0495612_0139462_105_527 140
584 3300053078 Ga0495612_0168937 Ga0495612_0168937_133_555 140
585 3300053085 Ga0495619_0040283 Ga0495619_0040283_1696_2118 140
586 3300054114 Ga0501084_0029119 Ga0501084_0029119_2114_2536 140
587 3300054114 Ga0501084_0255592 Ga0501084_0255592_892_1314 140
588 3300059647 Ga0587079_166309 Ga0587079_166309_116_538 140
589 3300060353 Ga0501082_0208907 Ga0501082_0208907_988_1410 140
590 3300060353 Ga0501082_0405906 Ga0501082_0405906_697_1119 140
591 3300060353 Ga0501082_1017907 Ga0501082_1017907_186_608 140
592 3300061719 Ga0466962_0005839 Ga0466962_0005839_3466_3888 140
593 3300061734 Ga0530510_0009759 Ga0530510_0009759_1249_1671 140
594 3300061734 Ga0530510_0053431 Ga0530510_0053431_808_1296 140
595 3300061734 Ga0530510_0821506 Ga0530510_0821506_111_533 140
596 2162886007 SwRhRL2b_contig_474354 SwRhRL2b_0892.00000080 141
597 3300001977 JGI24746J21847_1039991 JGI24746J21847_10399912 141
598 3300001990 JGI24737J22298_10008231 JGI24737J22298_100082314 141
599 3300001991 JGI24743J22301_10061887 JGI24743J22301_100618871 141
600 3300002075 JGI24738J21930_10051332 JGI24738J21930_100513322 141
601 3300002459 JGI24751J29686_10013331 JGI24751J29686_100133311 141
602 3300002459 JGI24751J29686_10019965 JGI24751J29686_100199651 141
603 3300003203 JGI25406J46586_10009666 JGI25406J46586_100096664 141
604 3300003203 JGI25406J46586_10073705 JGI25406J46586_100737052 141
605 3300003323 rootH1_10013162 rootH1_100131622 141
606 3300003349 JGI26129J50193_1000031 JGI26129J50193_10000314 141
607 3300003383 JGI26140J50224_102395 JGI26140J50224_1023951 141
608 3300003396 JGI26137J50245_101533 JGI26137J50245_1015331 141
609 3300003575 Ga0007409J51694_1050126 Ga0007409J51694_10501262 141
610 3300004798 Ga0058859_11818835 Ga0058859_118188352 141
611 3300004799 Ga0058863_10102249 Ga0058863_101022495 141
612 3300004799 Ga0058863_10165012 Ga0058863_101650124 141
613 3300004799 Ga0058863_11038963 Ga0058863_110389631 141
614 3300004799 Ga0058863_11606731 Ga0058863_116067311 141
615 3300004799 Ga0058863_11637961 Ga0058863_116379612 141
616 3300004799 Ga0058863_11723643 Ga0058863_117236432 141
617 3300004800 Ga0058861_10004363 Ga0058861_100043633 141
618 3300004800 Ga0058861_10609693 Ga0058861_106096931 141
619 3300004800 Ga0058861_11409730 Ga0058861_114097302 141
620 3300004800 Ga0058861_11919272 Ga0058861_119192722 141
621 3300004801 Ga0058860_10037994 Ga0058860_100379943 141
622 3300004803 Ga0058862_10264671 Ga0058862_102646715 141
623 3300004803 Ga0058862_10265876 Ga0058862_102658764 141
624 3300004803 Ga0058862_12532650 Ga0058862_125326502 141
625 3300004803 Ga0058862_12702988 Ga0058862_127029882 141
626 3300005289 Ga0065704_10006429 Ga0065704_100064293 141
627 3300005289 Ga0065704_10246670 Ga0065704_102466702 141
628 3300005289 Ga0065704_10344117 Ga0065704_103441172 141
629 3300005289 Ga0065704_10397834 Ga0065704_103978341 141
630 3300005290 Ga0065712_10160440 Ga0065712_101604402 141
631 3300005293 Ga0065715_10015383 Ga0065715_100153834 141
632 3300005293 Ga0065715_10044237 Ga0065715_100442372 141
633 3300005293 Ga0065715_10238673 Ga0065715_102386732 141
634 3300005295 Ga0065707_10006868 Ga0065707_100068685 141
635 3300005295 Ga0065707_10040926 Ga0065707_100409262 141
636 3300005295 Ga0065707_10101590 Ga0065707_101015903 141
637 3300005295 Ga0065707_10298988 Ga0065707_102989882 141
638 3300005295 Ga0065707_10320497 Ga0065707_103204972 141
639 3300005295 Ga0065707_10325605 Ga0065707_103256052 141
640 3300005327 Ga0070658_10344384 Ga0070658_103443842 141
641 3300005328 Ga0070676_10005064 Ga0070676_100050644 141
642 3300005328 Ga0070676_10105713 Ga0070676_101057133 141
643 3300005328 Ga0070676_10348455 Ga0070676_103484552 141
644 3300005328 Ga0070676_10517116 Ga0070676_105171162 141
645 3300005329 Ga0070683_100203178 Ga0070683_1002031782 141
646 3300005329 Ga0070683_100388118 Ga0070683_1003881182 141
647 3300005329 Ga0070683_100388431 Ga0070683_1003884312 141
648 3300005329 Ga0070683_101239790 Ga0070683_1012397901 141
649 3300005330 Ga0070690_100000871 Ga0070690_1000008715 141
650 3300005330 Ga0070690_100013884 Ga0070690_1000138843 141
651 3300005330 Ga0070690_100021175 Ga0070690_1000211756 141
652 3300005330 Ga0070690_100115224 Ga0070690_1001152242 141
653 3300005330 Ga0070690_100312104 Ga0070690_1003121042 141
654 3300005330 Ga0070690_100614201 Ga0070690_1006142012 141
655 3300005331 Ga0070670_100215131 Ga0070670_1002151312 141
656 3300005331 Ga0070670_100425344 Ga0070670_1004253442 141
657 3300005331 Ga0070670_100426052 Ga0070670_1004260522 141
658 3300005331 Ga0070670_100865244 Ga0070670_1008652441 141
659 3300005333 Ga0070677_10005247 Ga0070677_100052471 141
660 3300005334 Ga0068869_100024881 Ga0068869_1000248814 141
661 3300005334 Ga0068869_100287487 Ga0068869_1002874872 141
662 3300005334 Ga0068869_100312340 Ga0068869_1003123402 141
663 3300005334 Ga0068869_100507616 Ga0068869_1005076162 141
664 3300005335 Ga0070666_10076905 Ga0070666_100769053 141
665 3300005335 Ga0070666_10284938 Ga0070666_102849382 141
666 3300005335 Ga0070666_10466540 Ga0070666_104665402 141
667 3300005336 Ga0070680_100002219 Ga0070680_1000022198 141
668 3300005336 Ga0070680_100020531 Ga0070680_1000205316 141
669 3300005336 Ga0070680_100027839 Ga0070680_1000278397 141
670 3300005336 Ga0070680_100085310 Ga0070680_1000853102 141
671 3300005336 Ga0070680_100405975 Ga0070680_1004059752 141
672 3300005336 Ga0070680_100680553 Ga0070680_1006805532 141
673 3300005336 Ga0070680_100708027 Ga0070680_1007080271 141
674 3300005337 Ga0070682_100156508 Ga0070682_1001565082 141
675 3300005337 Ga0070682_100229560 Ga0070682_1002295602 141
676 3300005337 Ga0070682_100539642 Ga0070682_1005396422 141
677 3300005338 Ga0068868_100001296 Ga0068868_1000012966 141
678 3300005338 Ga0068868_100142491 Ga0068868_1001424913 141
679 3300005339 Ga0070660_100012558 Ga0070660_1000125584 141
680 3300005339 Ga0070660_100401739 Ga0070660_1004017391 141
681 3300005339 Ga0070660_100625617 Ga0070660_1006256171 141
682 3300005339 Ga0070660_100819284 Ga0070660_1008192842 141
683 3300005339 Ga0070660_100914054 Ga0070660_1009140542 141
684 3300005340 Ga0070689_100001397 Ga0070689_1000013978 141
685 3300005340 Ga0070689_100041885 Ga0070689_1000418853 141
686 3300005340 Ga0070689_100213882 Ga0070689_1002138822 141
687 3300005340 Ga0070689_100724242 Ga0070689_1007242421 141
688 3300005340 Ga0070689_101405163 Ga0070689_1014051631 141
689 3300005341 Ga0070691_10002340 Ga0070691_100023405 141
690 3300005341 Ga0070691_10003913 Ga0070691_100039134 141
691 3300005341 Ga0070691_10612318 Ga0070691_106123181 141
692 3300005343 Ga0070687_100062339 Ga0070687_1000623391 141
693 3300005343 Ga0070687_100110347 Ga0070687_1001103472 141
694 3300005343 Ga0070687_100119192 Ga0070687_1001191923 141
695 3300005343 Ga0070687_100251554 Ga0070687_1002515541 141
696 3300005343 Ga0070687_100460899 Ga0070687_1004608992 141
697 3300005343 Ga0070687_100800701 Ga0070687_1008007011 141
698 3300005344 Ga0070661_100051968 Ga0070661_1000519683 141
699 3300005344 Ga0070661_100096986 Ga0070661_1000969862 141
700 3300005344 Ga0070661_100386852 Ga0070661_1003868522 141
701 3300005345 Ga0070692_10075841 Ga0070692_100758413 141
702 3300005345 Ga0070692_10143277 Ga0070692_101432772 141
703 3300005345 Ga0070692_10523875 Ga0070692_105238751 141
704 3300005345 Ga0070692_10531436 Ga0070692_105314361 141
705 3300005345 Ga0070692_10693802 Ga0070692_106938021 141
706 3300005345 Ga0070692_11207701 Ga0070692_112077011 141
707 3300005347 Ga0070668_100044109 Ga0070668_1000441092 141
708 3300005347 Ga0070668_101335585 Ga0070668_1013355851 141
709 3300005353 Ga0070669_100009006 Ga0070669_1000090064 141
710 3300005353 Ga0070669_100170439 Ga0070669_1001704392 141
711 3300005353 Ga0070669_100640141 Ga0070669_1006401412 141
712 3300005354 Ga0070675_100022763 Ga0070675_1000227635 141
713 3300005354 Ga0070675_100716930 Ga0070675_1007169302 141
714 3300005354 Ga0070675_100725267 Ga0070675_1007252672 141
715 3300005354 Ga0070675_101543809 Ga0070675_1015438092 141
716 3300005355 Ga0070671_100657530 Ga0070671_1006575302 141
717 3300005356 Ga0070674_100003625 Ga0070674_1000036255 141
718 3300005356 Ga0070674_100034471 Ga0070674_1000344715 141
719 3300005356 Ga0070674_100048475 Ga0070674_1000484755 141
720 3300005356 Ga0070674_100140877 Ga0070674_1001408772 141
721 3300005356 Ga0070674_100170547 Ga0070674_1001705472 141
722 3300005356 Ga0070674_100568181 Ga0070674_1005681812 141
723 3300005364 Ga0070673_100007015 Ga0070673_1000070155 141
724 3300005364 Ga0070673_100076409 Ga0070673_1000764092 141
725 3300005364 Ga0070673_100271750 Ga0070673_1002717503 141
726 3300005364 Ga0070673_100662003 Ga0070673_1006620032 141
727 3300005364 Ga0070673_100889352 Ga0070673_1008893521 141
728 3300005364 Ga0070673_100947863 Ga0070673_1009478631 141
729 3300005365 Ga0070688_100000703 Ga0070688_1000007038 141
730 3300005365 Ga0070688_100007379 Ga0070688_1000073797 141
731 3300005365 Ga0070688_100025590 Ga0070688_1000255902 141
732 3300005365 Ga0070688_100168634 Ga0070688_1001686342 141
733 3300005365 Ga0070688_100268382 Ga0070688_1002683822 141
734 3300005366 Ga0070659_100005802 Ga0070659_1000058025 141
735 3300005366 Ga0070659_100113012 Ga0070659_1001130123 141
736 3300005366 Ga0070659_100398212 Ga0070659_1003982122 141
737 3300005366 Ga0070659_100436535 Ga0070659_1004365351 141
738 3300005366 Ga0070659_101261180 Ga0070659_1012611801 141
739 3300005367 Ga0070667_100075045 Ga0070667_1000750453 141
740 3300005367 Ga0070667_100183214 Ga0070667_1001832142 141
741 3300005367 Ga0070667_101198953 Ga0070667_1011989531 141
742 3300005406 Ga0070703_10003131 Ga0070703_100031315 141
743 3300005406 Ga0070703_10028909 Ga0070703_100289092 141
744 3300005406 Ga0070703_10092385 Ga0070703_100923852 141
745 3300005434 Ga0070709_10070551 Ga0070709_100705512 141
746 3300005434 Ga0070709_11063067 Ga0070709_110630671 141
747 3300005436 Ga0070713_100700520 Ga0070713_1007005201 141
748 3300005437 Ga0070710_10570082 Ga0070710_105700821 141
749 3300005438 Ga0070701_10014432 Ga0070701_100144323 141
750 3300005438 Ga0070701_10024455 Ga0070701_100244555 141
751 3300005438 Ga0070701_10098230 Ga0070701_100982302 141
752 3300005438 Ga0070701_10477776 Ga0070701_104777761 141
753 3300005439 Ga0070711_100022513 Ga0070711_1000225134 141
754 3300005439 Ga0070711_100717012 Ga0070711_1007170121 141
755 3300005439 Ga0070711_100927821 Ga0070711_1009278212 141
756 3300005440 Ga0070705_100022034 Ga0070705_1000220345 141
757 3300005440 Ga0070705_100022738 Ga0070705_1000227384 141
758 3300005440 Ga0070705_100028430 Ga0070705_1000284305 141
759 3300005440 Ga0070705_100158858 Ga0070705_1001588582 141
760 3300005440 Ga0070705_100287131 Ga0070705_1002871311 141
761 3300005440 Ga0070705_100351632 Ga0070705_1003516322 141
762 3300005440 Ga0070705_100398248 Ga0070705_1003982481 141
763 3300005440 Ga0070705_100403854 Ga0070705_1004038542 141
764 3300005440 Ga0070705_100883500 Ga0070705_1008835002 141
765 3300005440 Ga0070705_101416555 Ga0070705_1014165551 141
766 3300005440 Ga0070705_101466158 Ga0070705_1014661581 141
767 3300005441 Ga0070700_100003481 Ga0070700_1000034815 141
768 3300005441 Ga0070700_100006313 Ga0070700_1000063132 141
769 3300005441 Ga0070700_100036116 Ga0070700_1000361163 141
770 3300005441 Ga0070700_100093667 Ga0070700_1000936672 141
771 3300005441 Ga0070700_100490599 Ga0070700_1004905991 141
772 3300005441 Ga0070700_100964233 Ga0070700_1009642332 141
773 3300005441 Ga0070700_101434123 Ga0070700_1014341231 141
774 3300005444 Ga0070694_100006648 Ga0070694_1000066487 141
775 3300005444 Ga0070694_100077191 Ga0070694_1000771915 141
776 3300005444 Ga0070694_100127538 Ga0070694_1001275382 141
777 3300005444 Ga0070694_100179414 Ga0070694_1001794142 141
778 3300005444 Ga0070694_100256312 Ga0070694_1002563122 141
779 3300005444 Ga0070694_100363437 Ga0070694_1003634372 141
780 3300005444 Ga0070694_100522052 Ga0070694_1005220522 141
781 3300005444 Ga0070694_100523292 Ga0070694_1005232922 141
782 3300005444 Ga0070694_100646470 Ga0070694_1006464702 141
783 3300005444 Ga0070694_100695187 Ga0070694_1006951872 141
784 3300005445 Ga0070708_100021693 Ga0070708_1000216935 141
785 3300005445 Ga0070708_100037985 Ga0070708_1000379858 141
786 3300005445 Ga0070708_100056616 Ga0070708_1000566162 141
787 3300005445 Ga0070708_100083016 Ga0070708_1000830162 141
788 3300005445 Ga0070708_100125279 Ga0070708_1001252792 141
789 3300005445 Ga0070708_100168245 Ga0070708_1001682456 141
790 3300005445 Ga0070708_100217828 Ga0070708_1002178283 141
791 3300005445 Ga0070708_100586755 Ga0070708_1005867552 141
792 3300005445 Ga0070708_100746053 Ga0070708_1007460532 141
793 3300005445 Ga0070708_100843294 Ga0070708_1008432942 141
794 3300005445 Ga0070708_101241957 Ga0070708_1012419571 141
795 3300005455 Ga0070663_100004558 Ga0070663_1000045586 141
796 3300005455 Ga0070663_100018881 Ga0070663_1000188812 141
797 3300005455 Ga0070663_100334424 Ga0070663_1003344242 141
798 3300005455 Ga0070663_100588966 Ga0070663_1005889661 141
799 3300005455 Ga0070663_101049088 Ga0070663_1010490882 141
800 3300005456 Ga0070678_100007430 Ga0070678_1000074302 141
801 3300005456 Ga0070678_100182552 Ga0070678_1001825522 141
802 3300005457 Ga0070662_100005353 Ga0070662_1000053535 141
803 3300005457 Ga0070662_100192331 Ga0070662_1001923312 141
804 3300005457 Ga0070662_100763141 Ga0070662_1007631411 141
805 3300005458 Ga0070681_10011126 Ga0070681_100111267 141
806 3300005458 Ga0070681_10025568 Ga0070681_100255684 141
807 3300005458 Ga0070681_10060384 Ga0070681_100603846 141
808 3300005458 Ga0070681_10100334 Ga0070681_101003345 141
809 3300005458 Ga0070681_10637121 Ga0070681_106371211 141
810 3300005458 Ga0070681_11450032 Ga0070681_114500321 141
811 3300005459 Ga0068867_100003973 Ga0068867_1000039735 141
812 3300005459 Ga0068867_100015911 Ga0068867_1000159112 141
813 3300005459 Ga0068867_100059048 Ga0068867_1000590483 141
814 3300005459 Ga0068867_100339854 Ga0068867_1003398542 141
815 3300005459 Ga0068867_100944099 Ga0068867_1009440992 141
816 3300005466 Ga0070685_10000863 Ga0070685_100008636 141
817 3300005466 Ga0070685_10008064 Ga0070685_100080644 141
818 3300005466 Ga0070685_10040074 Ga0070685_100400741 141
819 3300005466 Ga0070685_10180205 Ga0070685_101802052 141
820 3300005467 Ga0070706_100000140 Ga0070706_1000001401 141
821 3300005467 Ga0070706_100022267 Ga0070706_1000222676 141
822 3300005467 Ga0070706_100040516 Ga0070706_1000405166 141
823 3300005467 Ga0070706_100060528 Ga0070706_1000605283 141
824 3300005467 Ga0070706_100063730 Ga0070706_1000637303 141
825 3300005467 Ga0070706_100070785 Ga0070706_1000707854 141
826 3300005467 Ga0070706_100166575 Ga0070706_1001665753 141
827 3300005467 Ga0070706_100182525 Ga0070706_1001825251 141
828 3300005467 Ga0070706_100191090 Ga0070706_1001910903 141
829 3300005467 Ga0070706_100201956 Ga0070706_1002019564 141
830 3300005467 Ga0070706_100324926 Ga0070706_1003249262 141
831 3300005467 Ga0070706_100391149 Ga0070706_1003911492 141
832 3300005467 Ga0070706_100799926 Ga0070706_1007999261 141
833 3300005467 Ga0070706_101321633 Ga0070706_1013216331 141
834 3300005468 Ga0070707_100000111 Ga0070707_1000001115 141
835 3300005468 Ga0070707_100027689 Ga0070707_1000276895 141
836 3300005468 Ga0070707_100031756 Ga0070707_1000317565 141
837 3300005468 Ga0070707_100072623 Ga0070707_1000726233 141
838 3300005468 Ga0070707_100114696 Ga0070707_1001146963 141
839 3300005468 Ga0070707_100214265 Ga0070707_1002142653 141
840 3300005468 Ga0070707_100272168 Ga0070707_1002721682 141
841 3300005468 Ga0070707_100291996 Ga0070707_1002919961 141
842 3300005468 Ga0070707_100333236 Ga0070707_1003332362 141
843 3300005468 Ga0070707_100374859 Ga0070707_1003748592 141
844 3300005468 Ga0070707_100444174 Ga0070707_1004441742 141
845 3300005468 Ga0070707_100859019 Ga0070707_1008590192 141
846 3300005468 Ga0070707_100899476 Ga0070707_1008994762 141
847 3300005468 Ga0070707_101566510 Ga0070707_1015665101 141
848 3300005471 Ga0070698_100022150 Ga0070698_1000221504 141
849 3300005471 Ga0070698_100035981 Ga0070698_1000359816 141
850 3300005471 Ga0070698_100059300 Ga0070698_1000593001 141
851 3300005471 Ga0070698_100067967 Ga0070698_1000679674 141
852 3300005471 Ga0070698_100077918 Ga0070698_1000779183 141
853 3300005471 Ga0070698_100084781 Ga0070698_1000847815 141
854 3300005471 Ga0070698_100086621 Ga0070698_1000866212 141
855 3300005471 Ga0070698_100128772 Ga0070698_1001287722 141
856 3300005471 Ga0070698_100197206 Ga0070698_1001972063 141
857 3300005471 Ga0070698_100353388 Ga0070698_1003533882 141
858 3300005471 Ga0070698_100647726 Ga0070698_1006477262 141
859 3300005471 Ga0070698_100892459 Ga0070698_1008924591 141
860 3300005471 Ga0070698_101040077 Ga0070698_1010400771 141
861 3300005471 Ga0070698_101657970 Ga0070698_1016579701 141
862 3300005518 Ga0070699_100013625 Ga0070699_1000136254 141
863 3300005518 Ga0070699_100063132 Ga0070699_1000631322 141
864 3300005518 Ga0070699_100067618 Ga0070699_1000676181 141
865 3300005518 Ga0070699_100069767 Ga0070699_1000697671 141
866 3300005518 Ga0070699_100111653 Ga0070699_1001116533 141
867 3300005518 Ga0070699_100185261 Ga0070699_1001852612 141
868 3300005518 Ga0070699_100305530 Ga0070699_1003055302 141
869 3300005518 Ga0070699_100326068 Ga0070699_1003260682 141
870 3300005518 Ga0070699_100365295 Ga0070699_1003652952 141
871 3300005518 Ga0070699_100760923 Ga0070699_1007609231 141
872 3300005518 Ga0070699_100874816 Ga0070699_1008748162 141
873 3300005530 Ga0070679_100045790 Ga0070679_1000457901 141
874 3300005530 Ga0070679_100047495 Ga0070679_1000474955 141
875 3300005530 Ga0070679_100072402 Ga0070679_1000724026 141
876 3300005530 Ga0070679_100142692 Ga0070679_1001426922 141
877 3300005530 Ga0070679_100264360 Ga0070679_1002643602 141
878 3300005530 Ga0070679_100351098 Ga0070679_1003510982 141
879 3300005530 Ga0070679_100490147 Ga0070679_1004901472 141
880 3300005535 Ga0070684_100182697 Ga0070684_1001826975 141
881 3300005535 Ga0070684_100470325 Ga0070684_1004703252 141
882 3300005535 Ga0070684_100633893 Ga0070684_1006338932 141
883 3300005535 Ga0070684_101285047 Ga0070684_1012850471 141
884 3300005536 Ga0070697_100012567 Ga0070697_1000125675 141
885 3300005536 Ga0070697_100020949 Ga0070697_1000209494 141
886 3300005536 Ga0070697_100024867 Ga0070697_1000248675 141
887 3300005536 Ga0070697_100081282 Ga0070697_1000812822 141
888 3300005536 Ga0070697_100094150 Ga0070697_1000941503 141
889 3300005536 Ga0070697_100098142 Ga0070697_1000981423 141
890 3300005536 Ga0070697_100105328 Ga0070697_1001053286 141
891 3300005536 Ga0070697_100129008 Ga0070697_1001290083 141
892 3300005536 Ga0070697_100191338 Ga0070697_1001913385 141
893 3300005536 Ga0070697_100313169 Ga0070697_1003131692 141
894 3300005536 Ga0070697_100409951 Ga0070697_1004099512 141
895 3300005536 Ga0070697_100529230 Ga0070697_1005292302 141
896 3300005536 Ga0070697_101853254 Ga0070697_1018532541 141
897 3300005539 Ga0068853_101354530 Ga0068853_1013545301 141
898 3300005539 Ga0068853_101926528 Ga0068853_1019265281 141
899 3300005543 Ga0070672_100018717 Ga0070672_1000187172 141
900 3300005543 Ga0070672_100190657 Ga0070672_1001906574 141
901 3300005543 Ga0070672_100959890 Ga0070672_1009598902 141
902 3300005544 Ga0070686_100001124 Ga0070686_1000011248 141
903 3300005544 Ga0070686_100004225 Ga0070686_1000042255 141
904 3300005544 Ga0070686_100051249 Ga0070686_1000512493 141
905 3300005544 Ga0070686_100117462 Ga0070686_1001174621 141
906 3300005544 Ga0070686_100138801 Ga0070686_1001388013 141
907 3300005544 Ga0070686_100245072 Ga0070686_1002450722 141
908 3300005544 Ga0070686_100305771 Ga0070686_1003057712 141
909 3300005544 Ga0070686_100457300 Ga0070686_1004573002 141
910 3300005544 Ga0070686_100537293 Ga0070686_1005372931 141
911 3300005545 Ga0070695_100023840 Ga0070695_1000238405 141
912 3300005545 Ga0070695_100039268 Ga0070695_1000392686 141
913 3300005545 Ga0070695_100080457 Ga0070695_1000804575 141
914 3300005545 Ga0070695_100219378 Ga0070695_1002193782 141
915 3300005545 Ga0070695_100281197 Ga0070695_1002811972 141
916 3300005545 Ga0070695_100418512 Ga0070695_1004185122 141
917 3300005546 Ga0070696_100005231 Ga0070696_1000052318 141
918 3300005546 Ga0070696_100022083 Ga0070696_1000220835 141
919 3300005546 Ga0070696_100036052 Ga0070696_1000360522 141
920 3300005546 Ga0070696_100036099 Ga0070696_1000360992 141
921 3300005546 Ga0070696_100087322 Ga0070696_1000873223 141
922 3300005546 Ga0070696_100145899 Ga0070696_1001458992 141
923 3300005546 Ga0070696_100163875 Ga0070696_1001638752 141
924 3300005546 Ga0070696_100173197 Ga0070696_1001731972 141
925 3300005546 Ga0070696_100243067 Ga0070696_1002430672 141
926 3300005546 Ga0070696_100511437 Ga0070696_1005114372 141
927 3300005546 Ga0070696_100602247 Ga0070696_1006022472 141
928 3300005546 Ga0070696_100831896 Ga0070696_1008318962 141
929 3300005546 Ga0070696_100846401 Ga0070696_1008464011 141
930 3300005546 Ga0070696_100922407 Ga0070696_1009224071 141
931 3300005546 Ga0070696_101151682 Ga0070696_1011516822 141
932 3300005546 Ga0070696_101611721 Ga0070696_1016117211 141
933 3300005547 Ga0070693_100161188 Ga0070693_1001611882 141
934 3300005547 Ga0070693_100188757 Ga0070693_1001887572 141
935 3300005547 Ga0070693_100913454 Ga0070693_1009134541 141
936 3300005548 Ga0070665_100102985 Ga0070665_1001029852 141
937 3300005548 Ga0070665_100126155 Ga0070665_1001261554 141
938 3300005549 Ga0070704_100012558 Ga0070704_1000125584 141
939 3300005549 Ga0070704_100111143 Ga0070704_1001111432 141
940 3300005549 Ga0070704_100286681 Ga0070704_1002866811 141
941 3300005549 Ga0070704_100407437 Ga0070704_1004074371 141
942 3300005549 Ga0070704_100419539 Ga0070704_1004195392 141
943 3300005549 Ga0070704_100726529 Ga0070704_1007265291 141
944 3300005549 Ga0070704_101522351 Ga0070704_1015223511 141
945 3300005563 Ga0068855_100285033 Ga0068855_1002850332 141
946 3300005563 Ga0068855_101012716 Ga0068855_1010127162 141
947 3300005563 Ga0068855_101084860 Ga0068855_1010848602 141
948 3300005564 Ga0070664_100064709 Ga0070664_1000647093 141
949 3300005564 Ga0070664_100076153 Ga0070664_1000761536 141
950 3300005564 Ga0070664_100163539 Ga0070664_1001635393 141
951 3300005564 Ga0070664_100212868 Ga0070664_1002128682 141
952 3300005564 Ga0070664_100554005 Ga0070664_1005540051 141
953 3300005564 Ga0070664_101572938 Ga0070664_1015729381 141
954 3300005564 Ga0070664_101598147 Ga0070664_1015981472 141
955 3300005577 Ga0068857_100007709 Ga0068857_1000077095 141
956 3300005577 Ga0068857_100026972 Ga0068857_1000269723 141
957 3300005577 Ga0068857_100298521 Ga0068857_1002985214 141
958 3300005577 Ga0068857_100628296 Ga0068857_1006282961 141
959 3300005578 Ga0068854_100252180 Ga0068854_1002521802 141
960 3300005578 Ga0068854_100315447 Ga0068854_1003154472 141
961 3300005578 Ga0068854_100524996 Ga0068854_1005249962 141
962 3300005578 Ga0068854_100612048 Ga0068854_1006120481 141
963 3300005614 Ga0068856_100545358 Ga0068856_1005453582 141
964 3300005614 Ga0068856_101164077 Ga0068856_1011640772 141
965 3300005615 Ga0070702_100002572 Ga0070702_10000257212 141
966 3300005615 Ga0070702_100027300 Ga0070702_1000273005 141
967 3300005615 Ga0070702_100086340 Ga0070702_1000863402 141
968 3300005615 Ga0070702_100480703 Ga0070702_1004807032 141
969 3300005615 Ga0070702_101199358 Ga0070702_1011993582 141
970 3300005616 Ga0068852_100014309 Ga0068852_1000143092 141
971 3300005617 Ga0068859_100003294 Ga0068859_1000032947 141
972 3300005617 Ga0068859_100920282 Ga0068859_1009202822 141
973 3300005617 Ga0068859_100932716 Ga0068859_1009327162 141
974 3300005617 Ga0068859_100995002 Ga0068859_1009950022 141
975 3300005617 Ga0068859_101541891 Ga0068859_1015418912 141
976 3300005618 Ga0068864_100063036 Ga0068864_1000630365 141
977 3300005618 Ga0068864_100118277 Ga0068864_1001182772 141
978 3300005618 Ga0068864_100436846 Ga0068864_1004368462 141
979 3300005618 Ga0068864_100647786 Ga0068864_1006477862 141
980 3300005718 Ga0068866_10459157 Ga0068866_104591572 141
981 3300005718 Ga0068866_10645562 Ga0068866_106455621 141
982 3300005719 Ga0068861_100043615 Ga0068861_1000436156 141
983 3300005719 Ga0068861_100163313 Ga0068861_1001633132 141
984 3300005719 Ga0068861_100168653 Ga0068861_1001686532 141
985 3300005719 Ga0068861_100248922 Ga0068861_1002489222 141
986 3300005719 Ga0068861_100714089 Ga0068861_1007140892 141
987 3300005719 Ga0068861_100977511 Ga0068861_1009775112 141
988 3300005719 Ga0068861_101516818 Ga0068861_1015168181 141
989 3300005719 Ga0068861_101567749 Ga0068861_1015677491 141
990 3300005719 Ga0068861_101697594 Ga0068861_1016975941 141
991 3300005719 Ga0068861_102311227 Ga0068861_1023112271 141
992 3300005834 Ga0068851_10026746 Ga0068851_100267462 141
993 3300005840 Ga0068870_10009812 Ga0068870_100098126 141
994 3300005841 Ga0068863_100050779 Ga0068863_1000507792 141
995 3300005841 Ga0068863_100291287 Ga0068863_1002912875 141
996 3300005841 Ga0068863_100354211 Ga0068863_1003542112 141
997 3300005841 Ga0068863_100557092 Ga0068863_1005570922 141
998 3300005841 Ga0068863_100609818 Ga0068863_1006098182 141
999 3300005841 Ga0068863_101215630 Ga0068863_1012156302 141
1000 3300005842 Ga0068858_100025878 Ga0068858_1000258787 141
1001 3300005842 Ga0068858_100027244 Ga0068858_1000272446 141
1002 3300005842 Ga0068858_100097407 Ga0068858_1000974073 141
1003 3300005842 Ga0068858_100345921 Ga0068858_1003459213 141
1004 3300005842 Ga0068858_100444460 Ga0068858_1004444602 141
1005 3300005842 Ga0068858_102352280 Ga0068858_1023522801 141
1006 3300005843 Ga0068860_100024658 Ga0068860_1000246587 141
1007 3300005843 Ga0068860_100255497 Ga0068860_1002554971 141
1008 3300005843 Ga0068860_100357592 Ga0068860_1003575922 141
1009 3300005843 Ga0068860_100363424 Ga0068860_1003634242 141
1010 3300005843 Ga0068860_100446044 Ga0068860_1004460442 141
1011 3300005843 Ga0068860_101902016 Ga0068860_1019020161 141
1012 3300005844 Ga0068862_100347393 Ga0068862_1003473933 141
1013 3300005844 Ga0068862_101257738 Ga0068862_1012577382 141
1014 3300005844 Ga0068862_101484688 Ga0068862_1014846881 141
1015 3300005937 Ga0081455_10005576 Ga0081455_100055766 141
1016 3300005937 Ga0081455_10008121 Ga0081455_100081217 141
1017 3300005937 Ga0081455_10196141 Ga0081455_101961414 141
1018 3300005985 Ga0081539_10002087 Ga0081539_1000208721 141
1019 3300005985 Ga0081539_10008949 Ga0081539_100089497 141
1020 3300006038 Ga0075365_10041075 Ga0075365_100410756 141
1021 3300006038 Ga0075365_11155775 Ga0075365_111557751 141
1022 3300006058 Ga0075432_10001610 Ga0075432_100016102 141
1023 3300006163 Ga0070715_10011050 Ga0070715_100110504 141
1024 3300006163 Ga0070715_10062409 Ga0070715_100624092 141
1025 3300006163 Ga0070715_10410749 Ga0070715_104107492 141
1026 3300006163 Ga0070715_10523934 Ga0070715_105239342 141
1027 3300006173 Ga0070716_100059186 Ga0070716_1000591866 141
1028 3300006173 Ga0070716_100131589 Ga0070716_1001315893 141
1029 3300006173 Ga0070716_100139653 Ga0070716_1001396533 141
1030 3300006175 Ga0070712_100036013 Ga0070712_1000360135 141
1031 3300006177 Ga0075362_10093358 Ga0075362_100933581 141
1032 3300006237 Ga0097621_100002102 Ga0097621_10000210211 141
1033 3300006237 Ga0097621_100068944 Ga0097621_1000689442 141
1034 3300006237 Ga0097621_100106638 Ga0097621_1001066383 141
1035 3300006237 Ga0097621_100507413 Ga0097621_1005074131 141
1036 3300006358 Ga0068871_100034414 Ga0068871_1000344146 141
1037 3300006358 Ga0068871_100035806 Ga0068871_1000358066 141
1038 3300006358 Ga0068871_100128052 Ga0068871_1001280523 141
1039 3300006358 Ga0068871_102205233 Ga0068871_1022052331 141
1040 3300006844 Ga0075428_100003133 Ga0075428_10000313311 141
1041 3300006844 Ga0075428_100022930 Ga0075428_1000229303 141
1042 3300006844 Ga0075428_100254454 Ga0075428_1002544542 141
1043 3300006844 Ga0075428_100269697 Ga0075428_1002696972 141
1044 3300006846 Ga0075430_100000588 Ga0075430_10000058812 141
1045 3300006846 Ga0075430_100021465 Ga0075430_1000214656 141
1046 3300006846 Ga0075430_100040404 Ga0075430_1000404044 141
1047 3300006846 Ga0075430_101051983 Ga0075430_1010519831 141
1048 3300006847 Ga0075431_100018122 Ga0075431_1000181225 141
1049 3300006847 Ga0075431_100019518 Ga0075431_1000195184 141
1050 3300006847 Ga0075431_100380083 Ga0075431_1003800834 141
1051 3300006847 Ga0075431_100393143 Ga0075431_1003931432 141
1052 3300006847 Ga0075431_100477433 Ga0075431_1004774332 141
1053 3300006847 Ga0075431_100822307 Ga0075431_1008223072 141
1054 3300006847 Ga0075431_101058017 Ga0075431_1010580172 141
1055 3300006847 Ga0075431_101291309 Ga0075431_1012913092 141
1056 3300006847 Ga0075431_102050937 Ga0075431_1020509371 141
1057 3300006852 Ga0075433_10002316 Ga0075433_1000231614 141
1058 3300006852 Ga0075433_10019795 Ga0075433_100197956 141
1059 3300006852 Ga0075433_10087038 Ga0075433_100870384 141
1060 3300006852 Ga0075433_10137891 Ga0075433_101378916 141
1061 3300006852 Ga0075433_10241315 Ga0075433_102413152 141
1062 3300006852 Ga0075433_10626407 Ga0075433_106264072 141
1063 3300006852 Ga0075433_10673180 Ga0075433_106731802 141
1064 3300006852 Ga0075433_11336512 Ga0075433_113365122 141
1065 3300006871 Ga0075434_100062207 Ga0075434_1000622076 141
1066 3300006871 Ga0075434_100174205 Ga0075434_1001742053 141
1067 3300006871 Ga0075434_100187465 Ga0075434_1001874652 141
1068 3300006871 Ga0075434_100522270 Ga0075434_1005222701 141
1069 3300006871 Ga0075434_100824425 Ga0075434_1008244251 141
1070 3300006871 Ga0075434_101899081 Ga0075434_1018990812 141
1071 3300006871 Ga0075434_101899082 Ga0075434_1018990822 141
1072 3300006880 Ga0075429_100024069 Ga0075429_1000240695 141
1073 3300006880 Ga0075429_100165826 Ga0075429_1001658262 141
1074 3300006880 Ga0075429_100183916 Ga0075429_1001839166 141
1075 3300006880 Ga0075429_100398876 Ga0075429_1003988762 141
1076 3300006880 Ga0075429_100628809 Ga0075429_1006288092 141
1077 3300006880 Ga0075429_100750769 Ga0075429_1007507692 141
1078 3300006880 Ga0075429_100905663 Ga0075429_1009056632 141
1079 3300006881 Ga0068865_100001497 Ga0068865_1000014976 141
1080 3300006881 Ga0068865_100143096 Ga0068865_1001430963 141
1081 3300006881 Ga0068865_100325716 Ga0068865_1003257162 141
1082 3300006881 Ga0068865_100909939 Ga0068865_1009099392 141
1083 3300006881 Ga0068865_101269468 Ga0068865_1012694682 141
1084 3300006914 Ga0075436_100294373 Ga0075436_1002943733 141
1085 3300006914 Ga0075436_100446227 Ga0075436_1004462272 141
1086 3300006914 Ga0075436_100880694 Ga0075436_1008806942 141
1087 3300006914 Ga0075436_100889375 Ga0075436_1008893751 141
1088 3300006914 Ga0075436_100922877 Ga0075436_1009228771 141
1089 3300006931 Ga0097620_100003294 Ga0097620_1000032947 141
1090 3300006931 Ga0097620_100920235 Ga0097620_1009202352 141
1091 3300006931 Ga0097620_100932632 Ga0097620_1009326322 141
1092 3300006931 Ga0097620_100995016 Ga0097620_1009950162 141
1093 3300006931 Ga0097620_101541950 Ga0097620_1015419502 141
1094 3300007076 Ga0075435_100150024 Ga0075435_1001500243 141
1095 3300007076 Ga0075435_100231623 Ga0075435_1002316232 141
1096 3300007076 Ga0075435_100296879 Ga0075435_1002968793 141
1097 3300007076 Ga0075435_101242742 Ga0075435_1012427421 141
1098 3300007076 Ga0075435_101548154 Ga0075435_1015481542 141
1099 3300007265 Ga0099794_10009457 Ga0099794_100094579 141
1100 3300007788 Ga0099795_10112703 Ga0099795_101127032 141
1101 3300009011 Ga0105251_10066999 Ga0105251_100669992 141
1102 3300009036 Ga0105244_10232819 Ga0105244_102328192 141
1103 3300009093 Ga0105240_10090594 Ga0105240_100905943 141
1104 3300009094 Ga0111539_10309164 Ga0111539_103091644 141
1105 3300009094 Ga0111539_10390749 Ga0111539_103907492 141
1106 3300009094 Ga0111539_11158523 Ga0111539_111585232 141
1107 3300009094 Ga0111539_11297903 Ga0111539_112979032 141
1108 3300009094 Ga0111539_11407654 Ga0111539_114076541 141
1109 3300009094 Ga0111539_11554000 Ga0111539_115540002 141
1110 3300009098 Ga0105245_10014061 Ga0105245_100140614 141
1111 3300009098 Ga0105245_10220019 Ga0105245_102200192 141
1112 3300009098 Ga0105245_10340589 Ga0105245_103405892 141
1113 3300009098 Ga0105245_10432290 Ga0105245_104322901 141
1114 3300009098 Ga0105245_10584585 Ga0105245_105845852 141
1115 3300009098 Ga0105245_11008286 Ga0105245_110082862 141
1116 3300009098 Ga0105245_11234931 Ga0105245_112349312 141
1117 3300009098 Ga0105245_11399253 Ga0105245_113992531 141
1118 3300009101 Ga0105247_10315987 Ga0105247_103159872 141
1119 3300009101 Ga0105247_10432455 Ga0105247_104324551 141
1120 3300009101 Ga0105247_11553129 Ga0105247_115531291 141
1121 3300009101 Ga0105247_11636609 Ga0105247_116366091 141
1122 3300009147 Ga0114129_10041863 Ga0114129_100418632 141
1123 3300009147 Ga0114129_10049814 Ga0114129_100498144 141
1124 3300009147 Ga0114129_10068233 Ga0114129_100682334 141
1125 3300009147 Ga0114129_10094080 Ga0114129_100940804 141
1126 3300009147 Ga0114129_10095663 Ga0114129_100956632 141
1127 3300009147 Ga0114129_10179724 Ga0114129_101797243 141
1128 3300009147 Ga0114129_10181666 Ga0114129_101816666 141
1129 3300009147 Ga0114129_10293075 Ga0114129_102930752 141
1130 3300009147 Ga0114129_10349108 Ga0114129_103491083 141
1131 3300009147 Ga0114129_10414344 Ga0114129_104143442 141
1132 3300009147 Ga0114129_10485874 Ga0114129_104858742 141
1133 3300009147 Ga0114129_10497985 Ga0114129_104979852 141
1134 3300009147 Ga0114129_10562579 Ga0114129_105625792 141
1135 3300009147 Ga0114129_10887329 Ga0114129_108873292 141
1136 3300009147 Ga0114129_11025262 Ga0114129_110252621 141
1137 3300009147 Ga0114129_11891780 Ga0114129_118917801 141
1138 3300009148 Ga0105243_10031684 Ga0105243_100316846 141
1139 3300009148 Ga0105243_10104801 Ga0105243_101048013 141
1140 3300009148 Ga0105243_10295641 Ga0105243_102956412 141
1141 3300009148 Ga0105243_10422348 Ga0105243_104223482 141
1142 3300009148 Ga0105243_10432124 Ga0105243_104321242 141
1143 3300009148 Ga0105243_10442039 Ga0105243_104420392 141
1144 3300009148 Ga0105243_10490865 Ga0105243_104908652 141
1145 3300009148 Ga0105243_10890771 Ga0105243_108907712 141
1146 3300009148 Ga0105243_10973445 Ga0105243_109734452 141
1147 3300009148 Ga0105243_11412680 Ga0105243_114126801 141
1148 3300009174 Ga0105241_10193869 Ga0105241_101938692 141
1149 3300009174 Ga0105241_10243861 Ga0105241_102438612 141
1150 3300009174 Ga0105241_11458897 Ga0105241_114588972 141
1151 3300009174 Ga0105241_11962050 Ga0105241_119620502 141
1152 3300009176 Ga0105242_10009998 Ga0105242_100099986 141
1153 3300009176 Ga0105242_10010482 Ga0105242_100104824 141
1154 3300009176 Ga0105242_10245777 Ga0105242_102457772 141
1155 3300009176 Ga0105242_10805022 Ga0105242_108050222 141
1156 3300009176 Ga0105242_11037281 Ga0105242_110372812 141
1157 3300009176 Ga0105242_11324758 Ga0105242_113247582 141
1158 3300009177 Ga0105248_10003907 Ga0105248_100039075 141
1159 3300009177 Ga0105248_10085442 Ga0105248_100854421 141
1160 3300009177 Ga0105248_10812014 Ga0105248_108120142 141
1161 3300009545 Ga0105237_10000098 Ga0105237_1000009810 141
1162 3300009545 Ga0105237_10070414 Ga0105237_100704144 141
1163 3300009545 Ga0105237_10373750 Ga0105237_103737502 141
1164 3300009545 Ga0105237_10479206 Ga0105237_104792062 141
1165 3300009545 Ga0105237_10480283 Ga0105237_104802831 141
1166 3300009545 Ga0105237_10713533 Ga0105237_107135332 141
1167 3300009551 Ga0105238_10245623 Ga0105238_102456232 141
1168 3300009551 Ga0105238_10418322 Ga0105238_104183222 141
1169 3300009551 Ga0105238_10781251 Ga0105238_107812512 141
1170 3300009553 Ga0105249_10019204 Ga0105249_100192045 141
1171 3300009553 Ga0105249_10040796 Ga0105249_100407965 141
1172 3300009553 Ga0105249_10041294 Ga0105249_100412946 141
1173 3300009553 Ga0105249_10158745 Ga0105249_101587453 141
1174 3300009553 Ga0105249_10324804 Ga0105249_103248041 141
1175 3300009553 Ga0105249_10778011 Ga0105249_107780111 141
1176 3300009553 Ga0105249_11304932 Ga0105249_113049322 141
1177 3300009553 Ga0105249_11817602 Ga0105249_118176022 141
1178 3300009553 Ga0105249_12629947 Ga0105249_126299471 141
1179 3300009553 Ga0105249_12814706 Ga0105249_128147061 141
1180 3300010375 Ga0105239_10096633 Ga0105239_100966332 141
1181 3300010375 Ga0105239_10115240 Ga0105239_101152402 141
1182 3300010375 Ga0105239_10336214 Ga0105239_103362142 141
1183 3300010375 Ga0105239_12080710 Ga0105239_120807101 141
1184 3300011119 Ga0105246_10010030 Ga0105246_100100302 141
1185 3300011119 Ga0105246_10041027 Ga0105246_100410275 141
1186 3300011119 Ga0105246_10367397 Ga0105246_103673972 141
1187 3300011119 Ga0105246_11013118 Ga0105246_110131182 141
1188 3300011119 Ga0105246_11667139 Ga0105246_116671391 141
1189 3300013100 Ga0157373_10305854 Ga0157373_103058542 141
1190 3300013102 Ga0157371_10077523 Ga0157371_100775233 141
1191 3300013102 Ga0157371_10091156 Ga0157371_100911563 141
1192 3300013102 Ga0157371_10273902 Ga0157371_102739022 141
1193 3300013104 Ga0157370_10555983 Ga0157370_105559832 141
1194 3300013105 Ga0157369_10116026 Ga0157369_101160264 141
1195 3300013105 Ga0157369_11379244 Ga0157369_113792441 141
1196 3300013296 Ga0157374_10003807 Ga0157374_100038077 141
1197 3300013296 Ga0157374_10063069 Ga0157374_100630691 141
1198 3300013296 Ga0157374_10169202 Ga0157374_101692026 141
1199 3300013296 Ga0157374_10318044 Ga0157374_103180444 141
1200 3300013296 Ga0157374_11596528 Ga0157374_115965281 141
1201 3300013297 Ga0157378_10009800 Ga0157378_100098006 141
1202 3300013297 Ga0157378_10015276 Ga0157378_100152766 141
1203 3300013297 Ga0157378_10115443 Ga0157378_101154432 141
1204 3300013297 Ga0157378_10446809 Ga0157378_104468092 141
1205 3300013297 Ga0157378_11885371 Ga0157378_118853711 141
1206 3300013306 Ga0163162_10088800 Ga0163162_100888002 141
1207 3300013306 Ga0163162_10405633 Ga0163162_104056332 141
1208 3300013306 Ga0163162_12425167 Ga0163162_124251671 141
1209 3300013307 Ga0157372_10201229 Ga0157372_102012291 141
1210 3300013307 Ga0157372_10513444 Ga0157372_105134442 141
1211 3300013307 Ga0157372_10544893 Ga0157372_105448932 141
1212 3300013307 Ga0157372_11122319 Ga0157372_111223192 141
1213 3300013307 Ga0157372_12233444 Ga0157372_122334442 141
1214 3300013308 Ga0157375_10182940 Ga0157375_101829402 141
1215 3300013308 Ga0157375_10191311 Ga0157375_101913113 141
1216 3300013308 Ga0157375_10206957 Ga0157375_102069576 141
1217 3300013308 Ga0157375_11107477 Ga0157375_111074772 141
1218 3300013308 Ga0157375_11393380 Ga0157375_113933802 141
1219 3300013308 Ga0157375_13464759 Ga0157375_134647591 141
1220 3300014325 Ga0163163_10045938 Ga0163163_100459386 141
1221 3300014325 Ga0163163_10083913 Ga0163163_100839134 141
1222 3300014325 Ga0163163_10961492 Ga0163163_109614922 141
1223 3300014325 Ga0163163_11257827 Ga0163163_112578272 141
1224 3300014325 Ga0163163_12580993 Ga0163163_125809931 141
1225 3300014326 Ga0157380_10012801 Ga0157380_100128015 141
1226 3300014326 Ga0157380_10017794 Ga0157380_100177942 141
1227 3300014326 Ga0157380_10067299 Ga0157380_100672993 141
1228 3300014326 Ga0157380_10396287 Ga0157380_103962872 141
1229 3300014497 Ga0182008_10292696 Ga0182008_102926961 141
1230 3300014745 Ga0157377_10010666 Ga0157377_100106664 141
1231 3300014745 Ga0157377_10036627 Ga0157377_100366272 141
1232 3300014745 Ga0157377_10109224 Ga0157377_101092242 141
1233 3300014745 Ga0157377_10250980 Ga0157377_102509802 141
1234 3300014968 Ga0157379_10147692 Ga0157379_101476922 141
1235 3300014968 Ga0157379_10255160 Ga0157379_102551602 141
1236 3300014968 Ga0157379_10600740 Ga0157379_106007401 141
1237 3300014968 Ga0157379_10805752 Ga0157379_108057521 141
1238 3300014968 Ga0157379_11425588 Ga0157379_114255882 141
1239 3300014968 Ga0157379_11447112 Ga0157379_114471121 141
1240 3300014968 Ga0157379_11767007 Ga0157379_117670071 141
1241 3300014968 Ga0157379_11901775 Ga0157379_119017751 141
1242 3300014969 Ga0157376_10001600 Ga0157376_100016006 141
1243 3300014969 Ga0157376_10001658 Ga0157376_100016584 141
1244 3300014969 Ga0157376_10348948 Ga0157376_103489482 141
1245 3300014969 Ga0157376_10354067 Ga0157376_103540673 141
1246 3300014969 Ga0157376_10705859 Ga0157376_107058592 141
1247 3300014969 Ga0157376_10744630 Ga0157376_107446302 141
1248 3300014969 Ga0157376_11158000 Ga0157376_111580002 141
1249 3300015265 Ga0182005_1155686 Ga0182005_11556861 141
1250 3300017792 Ga0163161_10318172 Ga0163161_103181722 141
1251 3300017792 Ga0163161_10576326 Ga0163161_105763262 141
1252 3300020069 Ga0197907_10029214 Ga0197907_100292146 141
1253 3300020069 Ga0197907_10105904 Ga0197907_101059046 141
1254 3300020069 Ga0197907_10232807 Ga0197907_102328073 141
1255 3300020069 Ga0197907_10495234 Ga0197907_104952344 141
1256 3300020069 Ga0197907_11186427 Ga0197907_111864272 141
1257 3300020069 Ga0197907_11192626 Ga0197907_111926263 141
1258 3300020069 Ga0197907_11249689 Ga0197907_112496892 141
1259 3300020069 Ga0197907_11472800 Ga0197907_114728004 141
1260 3300020070 Ga0206356_10181064 Ga0206356_101810641 141
1261 3300020070 Ga0206356_10228368 Ga0206356_102283681 141
1262 3300020070 Ga0206356_10462065 Ga0206356_104620657 141
1263 3300020070 Ga0206356_10579236 Ga0206356_105792362 141
1264 3300020070 Ga0206356_10923812 Ga0206356_109238122 141
1265 3300020070 Ga0206356_11354161 Ga0206356_113541611 141
1266 3300020070 Ga0206356_11756300 Ga0206356_117563004 141
1267 3300020070 Ga0206356_11776225 Ga0206356_117762252 141
1268 3300020075 Ga0206349_1227347 Ga0206349_12273472 141
1269 3300020075 Ga0206349_1457425 Ga0206349_14574252 141
1270 3300020075 Ga0206349_1484624 Ga0206349_14846242 141
1271 3300020075 Ga0206349_1509634 Ga0206349_15096342 141
1272 3300020075 Ga0206349_1547337 Ga0206349_15473371 141
1273 3300020075 Ga0206349_1956745 Ga0206349_19567453 141
1274 3300020076 Ga0206355_1059106 Ga0206355_10591062 141
1275 3300020076 Ga0206355_1126656 Ga0206355_11266562 141
1276 3300020076 Ga0206355_1204451 Ga0206355_12044511 141
1277 3300020076 Ga0206355_1228183 Ga0206355_12281832 141
1278 3300020076 Ga0206355_1397941 Ga0206355_13979411 141
1279 3300020076 Ga0206355_1424628 Ga0206355_14246282 141
1280 3300020076 Ga0206355_1619390 Ga0206355_16193903 141
1281 3300020077 Ga0206351_10240216 Ga0206351_102402162 141
1282 3300020077 Ga0206351_10270062 Ga0206351_102700623 141
1283 3300020077 Ga0206351_10293265 Ga0206351_102932655 141
1284 3300020077 Ga0206351_10486635 Ga0206351_104866351 141
1285 3300020077 Ga0206351_10748140 Ga0206351_107481402 141
1286 3300020077 Ga0206351_10946680 Ga0206351_109466802 141
1287 3300020077 Ga0206351_10961155 Ga0206351_109611552 141
1288 3300020078 Ga0206352_10036494 Ga0206352_100364946 141
1289 3300020078 Ga0206352_10247071 Ga0206352_102470714 141
1290 3300020078 Ga0206352_10464430 Ga0206352_104644302 141
1291 3300020078 Ga0206352_10737257 Ga0206352_107372571 141
1292 3300020078 Ga0206352_10878229 Ga0206352_108782293 141
1293 3300020078 Ga0206352_11068968 Ga0206352_110689681 141
1294 3300020078 Ga0206352_11079348 Ga0206352_110793483 141
1295 3300020078 Ga0206352_11196914 Ga0206352_111969142 141
1296 3300020078 Ga0206352_11358661 Ga0206352_113586612 141
1297 3300020080 Ga0206350_10435996 Ga0206350_104359963 141
1298 3300020080 Ga0206350_10778320 Ga0206350_107783202 141
1299 3300020080 Ga0206350_10844455 Ga0206350_108444552 141
1300 3300020080 Ga0206350_11120877 Ga0206350_111208775 141
1301 3300020080 Ga0206350_11128874 Ga0206350_111288741 141
1302 3300020080 Ga0206350_11400909 Ga0206350_114009092 141
1303 3300020080 Ga0206350_11423239 Ga0206350_114232392 141
1304 3300020080 Ga0206350_11661224 Ga0206350_116612245 141
1305 3300020081 Ga0206354_10083900 Ga0206354_100839005 141
1306 3300020081 Ga0206354_10085906 Ga0206354_100859061 141
1307 3300020081 Ga0206354_10326820 Ga0206354_103268202 141
1308 3300020081 Ga0206354_10662061 Ga0206354_106620614 141
1309 3300020081 Ga0206354_10904125 Ga0206354_109041252 141
1310 3300020081 Ga0206354_11376218 Ga0206354_113762181 141
1311 3300020082 Ga0206353_10270052 Ga0206353_102700526 141
1312 3300020082 Ga0206353_10790861 Ga0206353_107908612 141
1313 3300020082 Ga0206353_11680741 Ga0206353_116807413 141
1314 3300020082 Ga0206353_11847314 Ga0206353_118473142 141
1315 3300020610 Ga0154015_1078441 Ga0154015_10784413 141
1316 3300020610 Ga0154015_1169410 Ga0154015_11694101 141
1317 3300021388 Ga0213875_10018595 Ga0213875_100185952 141
1318 3300021388 Ga0213875_10031998 Ga0213875_100319981 141
1319 3300022467 Ga0224712_10004473 Ga0224712_100044733 141
1320 3300022467 Ga0224712_10004886 Ga0224712_100048863 141
1321 3300022467 Ga0224712_10005022 Ga0224712_100050224 141
1322 3300022467 Ga0224712_10006776 Ga0224712_100067764 141
1323 3300022467 Ga0224712_10008083 Ga0224712_100080834 141
1324 3300022467 Ga0224712_10008119 Ga0224712_100081193 141
1325 3300022467 Ga0224712_10009432 Ga0224712_100094324 141
1326 3300022467 Ga0224712_10012791 Ga0224712_100127915 141
1327 3300022467 Ga0224712_10194212 Ga0224712_101942121 141
1328 3300022467 Ga0224712_10229916 Ga0224712_102299162 141
1329 3300022467 Ga0224712_10328926 Ga0224712_103289261 141
1330 3300025315 Ga0207697_10376602 Ga0207697_103766021 141
1331 3300025321 Ga0207656_10201733 Ga0207656_102017332 141
1332 3300025885 Ga0207653_10131704 Ga0207653_101317042 141
1333 3300025885 Ga0207653_10158351 Ga0207653_101583512 141
1334 3300025893 Ga0207682_10131512 Ga0207682_101315121 141
1335 3300025898 Ga0207692_10475520 Ga0207692_104755201 141
1336 3300025899 Ga0207642_10085841 Ga0207642_100858411 141
1337 3300025900 Ga0207710_10197400 Ga0207710_101974001 141
1338 3300025901 Ga0207688_10006416 Ga0207688_100064166 141
1339 3300025901 Ga0207688_10046109 Ga0207688_100461093 141
1340 3300025903 Ga0207680_10037770 Ga0207680_100377703 141
1341 3300025904 Ga0207647_10022808 Ga0207647_100228087 141
1342 3300025904 Ga0207647_10044754 Ga0207647_100447543 141
1343 3300025906 Ga0207699_10000269 Ga0207699_1000026911 141
1344 3300025906 Ga0207699_10974032 Ga0207699_109740321 141
1345 3300025907 Ga0207645_10002565 Ga0207645_100025658 141
1346 3300025907 Ga0207645_10090612 Ga0207645_100906122 141
1347 3300025907 Ga0207645_10241565 Ga0207645_102415652 141
1348 3300025908 Ga0207643_10025530 Ga0207643_100255306 141
1349 3300025909 Ga0207705_10147662 Ga0207705_101476622 141
1350 3300025910 Ga0207684_10023984 Ga0207684_100239846 141
1351 3300025910 Ga0207684_10041213 Ga0207684_100412132 141
1352 3300025910 Ga0207684_10083263 Ga0207684_100832632 141
1353 3300025910 Ga0207684_10116383 Ga0207684_101163836 141
1354 3300025910 Ga0207684_10117351 Ga0207684_101173514 141
1355 3300025910 Ga0207684_10137650 Ga0207684_101376501 141
1356 3300025910 Ga0207684_10193359 Ga0207684_101933593 141
1357 3300025910 Ga0207684_10429254 Ga0207684_104292542 141
1358 3300025910 Ga0207684_10450584 Ga0207684_104505842 141
1359 3300025910 Ga0207684_10500693 Ga0207684_105006932 141
1360 3300025910 Ga0207684_10644361 Ga0207684_106443611 141
1361 3300025910 Ga0207684_10868241 Ga0207684_108682412 141
1362 3300025911 Ga0207654_10409248 Ga0207654_104092483 141
1363 3300025912 Ga0207707_10003270 Ga0207707_100032705 141
1364 3300025912 Ga0207707_10037372 Ga0207707_100373723 141
1365 3300025912 Ga0207707_10616414 Ga0207707_106164142 141
1366 3300025912 Ga0207707_11209747 Ga0207707_112097471 141
1367 3300025913 Ga0207695_10277689 Ga0207695_102776892 141
1368 3300025914 Ga0207671_10001979 Ga0207671_1000197925 141
1369 3300025914 Ga0207671_10026911 Ga0207671_1002691110 141
1370 3300025914 Ga0207671_10268711 Ga0207671_102687112 141
1371 3300025914 Ga0207671_10736696 Ga0207671_107366962 141
1372 3300025915 Ga0207693_10226817 Ga0207693_102268172 141
1373 3300025915 Ga0207693_10729921 Ga0207693_107299212 141
1374 3300025916 Ga0207663_10107637 Ga0207663_101076371 141
1375 3300025916 Ga0207663_10248014 Ga0207663_102480142 141
1376 3300025917 Ga0207660_10000002 Ga0207660_10000002370 141
1377 3300025917 Ga0207660_10009536 Ga0207660_1000953611 141
1378 3300025917 Ga0207660_10053734 Ga0207660_100537346 141
1379 3300025917 Ga0207660_10389228 Ga0207660_103892282 141
1380 3300025917 Ga0207660_11072715 Ga0207660_110727152 141
1381 3300025918 Ga0207662_10060129 Ga0207662_100601293 141
1382 3300025918 Ga0207662_10072041 Ga0207662_100720412 141
1383 3300025918 Ga0207662_10109621 Ga0207662_101096212 141
1384 3300025918 Ga0207662_10115459 Ga0207662_101154592 141
1385 3300025918 Ga0207662_10210422 Ga0207662_102104222 141
1386 3300025918 Ga0207662_10236528 Ga0207662_102365282 141
1387 3300025918 Ga0207662_10257100 Ga0207662_102571002 141
1388 3300025918 Ga0207662_10304106 Ga0207662_103041062 141
1389 3300025919 Ga0207657_10010969 Ga0207657_100109695 141
1390 3300025919 Ga0207657_10150992 Ga0207657_101509923 141
1391 3300025919 Ga0207657_10394246 Ga0207657_103942462 141
1392 3300025919 Ga0207657_10997487 Ga0207657_109974871 141
1393 3300025919 Ga0207657_11005196 Ga0207657_110051961 141
1394 3300025919 Ga0207657_11209231 Ga0207657_112092311 141
1395 3300025920 Ga0207649_10004596 Ga0207649_100045962 141
1396 3300025920 Ga0207649_10058499 Ga0207649_100584992 141
1397 3300025920 Ga0207649_10816113 Ga0207649_108161132 141
1398 3300025921 Ga0207652_10030410 Ga0207652_100304104 141
1399 3300025921 Ga0207652_10073748 Ga0207652_100737484 141
1400 3300025921 Ga0207652_10187711 Ga0207652_101877111 141
1401 3300025921 Ga0207652_10201147 Ga0207652_102011474 141
1402 3300025921 Ga0207652_10287783 Ga0207652_102877832 141
1403 3300025921 Ga0207652_10707519 Ga0207652_107075192 141
1404 3300025921 Ga0207652_11412572 Ga0207652_114125721 141
1405 3300025922 Ga0207646_10000163 Ga0207646_100001636 141
1406 3300025922 Ga0207646_10004216 Ga0207646_100042166 141
1407 3300025922 Ga0207646_10018744 Ga0207646_100187445 141
1408 3300025922 Ga0207646_10067322 Ga0207646_100673226 141
1409 3300025922 Ga0207646_10086088 Ga0207646_100860884 141
1410 3300025922 Ga0207646_10153826 Ga0207646_101538263 141
1411 3300025922 Ga0207646_10187082 Ga0207646_101870823 141
1412 3300025922 Ga0207646_10413382 Ga0207646_104133822 141
1413 3300025922 Ga0207646_11381839 Ga0207646_113818391 141
1414 3300025923 Ga0207681_10066557 Ga0207681_100665576 141
1415 3300025923 Ga0207681_10209283 Ga0207681_102092831 141
1416 3300025923 Ga0207681_11488010 Ga0207681_114880101 141
1417 3300025925 Ga0207650_10029357 Ga0207650_100293574 141
1418 3300025925 Ga0207650_10244284 Ga0207650_102442842 141
1419 3300025926 Ga0207659_10000959 Ga0207659_100009594 141
1420 3300025926 Ga0207659_10317565 Ga0207659_103175652 141
1421 3300025926 Ga0207659_10597063 Ga0207659_105970632 141
1422 3300025926 Ga0207659_11022496 Ga0207659_110224962 141
1423 3300025927 Ga0207687_10024076 Ga0207687_100240762 141
1424 3300025927 Ga0207687_10046120 Ga0207687_100461204 141
1425 3300025927 Ga0207687_10205866 Ga0207687_102058664 141
1426 3300025927 Ga0207687_10502900 Ga0207687_105029002 141
1427 3300025927 Ga0207687_10651287 Ga0207687_106512872 141
1428 3300025928 Ga0207700_11083385 Ga0207700_110833851 141
1429 3300025929 Ga0207664_11338838 Ga0207664_113388381 141
1430 3300025931 Ga0207644_10522583 Ga0207644_105225832 141
1431 3300025931 Ga0207644_10565490 Ga0207644_105654902 141
1432 3300025931 Ga0207644_10969212 Ga0207644_109692122 141
1433 3300025932 Ga0207690_10011728 Ga0207690_100117284 141
1434 3300025932 Ga0207690_10050244 Ga0207690_100502442 141
1435 3300025932 Ga0207690_10313627 Ga0207690_103136272 141
1436 3300025933 Ga0207706_10003528 Ga0207706_100035289 141
1437 3300025933 Ga0207706_10046490 Ga0207706_100464902 141
1438 3300025933 Ga0207706_10294773 Ga0207706_102947732 141
1439 3300025933 Ga0207706_10763179 Ga0207706_107631791 141
1440 3300025934 Ga0207686_10011479 Ga0207686_100114794 141
1441 3300025934 Ga0207686_10098160 Ga0207686_100981602 141
1442 3300025934 Ga0207686_10448356 Ga0207686_104483561 141
1443 3300025934 Ga0207686_11475520 Ga0207686_114755202 141
1444 3300025935 Ga0207709_10002980 Ga0207709_100029804 141
1445 3300025935 Ga0207709_10215331 Ga0207709_102153313 141
1446 3300025935 Ga0207709_10299193 Ga0207709_102991932 141
1447 3300025936 Ga0207670_10000946 Ga0207670_100009468 141
1448 3300025936 Ga0207670_10012034 Ga0207670_100120343 141
1449 3300025936 Ga0207670_10489426 Ga0207670_104894262 141
1450 3300025936 Ga0207670_10562005 Ga0207670_105620052 141
1451 3300025937 Ga0207669_10001939 Ga0207669_100019396 141
1452 3300025937 Ga0207669_10005197 Ga0207669_100051974 141
1453 3300025937 Ga0207669_10022441 Ga0207669_100224415 141
1454 3300025937 Ga0207669_10230879 Ga0207669_102308792 141
1455 3300025937 Ga0207669_10253356 Ga0207669_102533562 141
1456 3300025937 Ga0207669_10696374 Ga0207669_106963741 141
1457 3300025937 Ga0207669_11751074 Ga0207669_117510741 141
1458 3300025937 Ga0207669_11844925 Ga0207669_118449251 141
1459 3300025938 Ga0207704_10005205 Ga0207704_100052052 141
1460 3300025938 Ga0207704_10180606 Ga0207704_101806062 141
1461 3300025938 Ga0207704_10271451 Ga0207704_102714511 141
1462 3300025939 Ga0207665_10066622 Ga0207665_100666226 141
1463 3300025939 Ga0207665_10142336 Ga0207665_101423362 141
1464 3300025939 Ga0207665_10805755 Ga0207665_108057551 141
1465 3300025940 Ga0207691_10018208 Ga0207691_100182086 141
1466 3300025940 Ga0207691_10022326 Ga0207691_100223266 141
1467 3300025940 Ga0207691_10144307 Ga0207691_101443072 141
1468 3300025940 Ga0207691_10552376 Ga0207691_105523762 141
1469 3300025940 Ga0207691_11148513 Ga0207691_111485131 141
1470 3300025941 Ga0207711_10044629 Ga0207711_100446294 141
1471 3300025941 Ga0207711_10501500 Ga0207711_105015002 141
1472 3300025942 Ga0207689_10033353 Ga0207689_100333534 141
1473 3300025942 Ga0207689_10131038 Ga0207689_101310382 141
1474 3300025942 Ga0207689_10151466 Ga0207689_101514662 141
1475 3300025942 Ga0207689_11459423 Ga0207689_114594231 141
1476 3300025944 Ga0207661_10409415 Ga0207661_104094152 141
1477 3300025944 Ga0207661_10661401 Ga0207661_106614012 141
1478 3300025944 Ga0207661_10866912 Ga0207661_108669122 141
1479 3300025945 Ga0207679_10006605 Ga0207679_100066056 141
1480 3300025945 Ga0207679_10009203 Ga0207679_100092032 141
1481 3300025945 Ga0207679_10271664 Ga0207679_102716642 141
1482 3300025945 Ga0207679_10332354 Ga0207679_103323542 141
1483 3300025949 Ga0207667_10794966 Ga0207667_107949662 141
1484 3300025960 Ga0207651_10001504 Ga0207651_100015043 141
1485 3300025960 Ga0207651_10136422 Ga0207651_101364222 141
1486 3300025960 Ga0207651_10422511 Ga0207651_104225111 141
1487 3300025960 Ga0207651_10653204 Ga0207651_106532041 141
1488 3300025960 Ga0207651_10748904 Ga0207651_107489042 141
1489 3300025961 Ga0207712_10069325 Ga0207712_100693253 141
1490 3300025961 Ga0207712_10071941 Ga0207712_100719412 141
1491 3300025961 Ga0207712_10113838 Ga0207712_101138382 141
1492 3300025961 Ga0207712_10220602 Ga0207712_102206022 141
1493 3300025961 Ga0207712_10575921 Ga0207712_105759212 141
1494 3300025961 Ga0207712_11474761 Ga0207712_114747611 141
1495 3300025972 Ga0207668_10006853 Ga0207668_100068534 141
1496 3300025972 Ga0207668_10535986 Ga0207668_105359862 141
1497 3300025972 Ga0207668_10750786 Ga0207668_107507862 141
1498 3300025972 Ga0207668_11311482 Ga0207668_113114822 141
1499 3300025981 Ga0207640_10298160 Ga0207640_102981602 141
1500 3300025981 Ga0207640_10591028 Ga0207640_105910282 141
1501 3300025981 Ga0207640_10802476 Ga0207640_108024762 141
1502 3300025981 Ga0207640_10842576 Ga0207640_108425762 141
1503 3300025981 Ga0207640_10953054 Ga0207640_109530542 141
1504 3300025986 Ga0207658_10147526 Ga0207658_101475262 141
1505 3300025986 Ga0207658_10376347 Ga0207658_103763472 141
1506 3300026023 Ga0207677_10006853 Ga0207677_100068534 141
1507 3300026023 Ga0207677_11183519 Ga0207677_111835191 141
1508 3300026035 Ga0207703_10065297 Ga0207703_100652975 141
1509 3300026035 Ga0207703_10115216 Ga0207703_101152163 141
1510 3300026035 Ga0207703_10539952 Ga0207703_105399522 141
1511 3300026035 Ga0207703_10968050 Ga0207703_109680502 141
1512 3300026041 Ga0207639_10259301 Ga0207639_102593011 141
1513 3300026067 Ga0207678_10017028 Ga0207678_100170286 141
1514 3300026067 Ga0207678_10035455 Ga0207678_1003545510 141
1515 3300026067 Ga0207678_10151895 Ga0207678_101518952 141
1516 3300026067 Ga0207678_10471209 Ga0207678_104712092 141
1517 3300026067 Ga0207678_10615646 Ga0207678_106156461 141
1518 3300026075 Ga0207708_10007092 Ga0207708_100070925 141
1519 3300026075 Ga0207708_10007880 Ga0207708_100078806 141
1520 3300026075 Ga0207708_10017492 Ga0207708_100174925 141
1521 3300026075 Ga0207708_10044205 Ga0207708_100442055 141
1522 3300026075 Ga0207708_10398729 Ga0207708_103987292 141
1523 3300026075 Ga0207708_10686818 Ga0207708_106868182 141
1524 3300026075 Ga0207708_10982804 Ga0207708_109828041 141
1525 3300026075 Ga0207708_11192262 Ga0207708_111922621 141
1526 3300026075 Ga0207708_11582217 Ga0207708_115822171 141
1527 3300026078 Ga0207702_10318909 Ga0207702_103189092 141
1528 3300026078 Ga0207702_10618619 Ga0207702_106186192 141
1529 3300026078 Ga0207702_10966310 Ga0207702_109663102 141
1530 3300026078 Ga0207702_11467404 Ga0207702_114674042 141
1531 3300026088 Ga0207641_10233683 Ga0207641_102336832 141
1532 3300026088 Ga0207641_10361815 Ga0207641_103618152 141
1533 3300026088 Ga0207641_10927792 Ga0207641_109277921 141
1534 3300026089 Ga0207648_10004173 Ga0207648_100041736 141
1535 3300026089 Ga0207648_10013852 Ga0207648_100138522 141
1536 3300026089 Ga0207648_10066110 Ga0207648_100661102 141
1537 3300026089 Ga0207648_10073622 Ga0207648_100736225 141
1538 3300026089 Ga0207648_10329425 Ga0207648_103294252 141
1539 3300026089 Ga0207648_11055755 Ga0207648_110557552 141
1540 3300026089 Ga0207648_12169163 Ga0207648_121691631 141
1541 3300026095 Ga0207676_10046514 Ga0207676_100465142 141
1542 3300026095 Ga0207676_10354332 Ga0207676_103543322 141
1543 3300026095 Ga0207676_10642262 Ga0207676_106422622 141
1544 3300026095 Ga0207676_12448250 Ga0207676_124482501 141
1545 3300026116 Ga0207674_10008751 Ga0207674_100087519 141
1546 3300026116 Ga0207674_10048176 Ga0207674_100481764 141
1547 3300026116 Ga0207674_10096522 Ga0207674_100965225 141
1548 3300026116 Ga0207674_10098887 Ga0207674_100988873 141
1549 3300026116 Ga0207674_10393022 Ga0207674_103930222 141
1550 3300026116 Ga0207674_10463863 Ga0207674_104638632 141
1551 3300026118 Ga0207675_100022225 Ga0207675_1000222253 141
1552 3300026118 Ga0207675_100075534 Ga0207675_1000755344 141
1553 3300026118 Ga0207675_100105707 Ga0207675_1001057072 141
1554 3300026118 Ga0207675_100181315 Ga0207675_1001813152 141
1555 3300026118 Ga0207675_100397749 Ga0207675_1003977492 141
1556 3300026118 Ga0207675_100425750 Ga0207675_1004257502 141
1557 3300026118 Ga0207675_100476808 Ga0207675_1004768082 141
1558 3300026118 Ga0207675_100587189 Ga0207675_1005871892 141
1559 3300026118 Ga0207675_101446025 Ga0207675_1014460251 141
1560 3300026118 Ga0207675_101619039 Ga0207675_1016190391 141
1561 3300026121 Ga0207683_10004052 Ga0207683_100040527 141
1562 3300026121 Ga0207683_10053461 Ga0207683_100534615 141
1563 3300026142 Ga0207698_10020697 Ga0207698_100206975 141
1564 3300026142 Ga0207698_11450924 Ga0207698_114509242 141
1565 3300027360 Ga0209969_1000041 Ga0209969_10000415 141
1566 3300027360 Ga0209969_1054507 Ga0209969_10545072 141
1567 3300027364 Ga0209967_1005501 Ga0209967_10055012 141
1568 3300027364 Ga0209967_1019473 Ga0209967_10194732 141
1569 3300027364 Ga0209967_1049013 Ga0209967_10490131 141
1570 3300027378 Ga0209981_1001622 Ga0209981_10016223 141
1571 3300027378 Ga0209981_1024346 Ga0209981_10243462 141
1572 3300027395 Ga0209996_1001007 Ga0209996_10010075 141
1573 3300027424 Ga0209984_1000059 Ga0209984_10000595 141
1574 3300027424 Ga0209984_1014298 Ga0209984_10142981 141
1575 3300027462 Ga0210000_1000070 Ga0210000_10000706 141
1576 3300027471 Ga0209995_1000072 Ga0209995_10000726 141
1577 3300027471 Ga0209995_1011868 Ga0209995_10118683 141
1578 3300027526 Ga0209968_1000094 Ga0209968_10000946 141
1579 3300027526 Ga0209968_1008151 Ga0209968_10081512 141
1580 3300027526 Ga0209968_1020292 Ga0209968_10202923 141
1581 3300027543 Ga0209999_1003664 Ga0209999_10036646 141
1582 3300027543 Ga0209999_1019270 Ga0209999_10192702 141
1583 3300027552 Ga0209982_1000629 Ga0209982_10006296 141
1584 3300027614 Ga0209970_1001695 Ga0209970_10016956 141
1585 3300027614 Ga0209970_1023608 Ga0209970_10236082 141
1586 3300027614 Ga0209970_1052717 Ga0209970_10527172 141
1587 3300027617 Ga0210002_1000082 Ga0210002_10000829 141
1588 3300027617 Ga0210002_1031643 Ga0210002_10316432 141
1589 3300027665 Ga0209983_1002619 Ga0209983_10026194 141
1590 3300027665 Ga0209983_1008964 Ga0209983_10089642 141
1591 3300027665 Ga0209983_1034140 Ga0209983_10341402 141
1592 3300027682 Ga0209971_1000999 Ga0209971_10009996 141
1593 3300027682 Ga0209971_1007494 Ga0209971_10074946 141
1594 3300027682 Ga0209971_1017856 Ga0209971_10178562 141
1595 3300027695 Ga0209966_1000334 Ga0209966_10003349 141
1596 3300027695 Ga0209966_1020552 Ga0209966_10205522 141
1597 3300027695 Ga0209966_1028426 Ga0209966_10284261 141
1598 3300027695 Ga0209966_1031182 Ga0209966_10311822 141
1599 3300027717 Ga0209998_10000411 Ga0209998_100004117 141
1600 3300027717 Ga0209998_10001858 Ga0209998_100018584 141
1601 3300027717 Ga0209998_10050205 Ga0209998_100502052 141
1602 3300027717 Ga0209998_10090073 Ga0209998_100900731 141
1603 3300027717 Ga0209998_10111835 Ga0209998_101118351 141
1604 3300027876 Ga0209974_10000363 Ga0209974_100003636 141
1605 3300027876 Ga0209974_10000952 Ga0209974_100009526 141
1606 3300027876 Ga0209974_10001975 Ga0209974_100019756 141
1607 3300027876 Ga0209974_10022885 Ga0209974_100228852 141
1608 3300027907 Ga0207428_10000452 Ga0207428_1000045241 141
1609 3300028379 Ga0268266_10243006 Ga0268266_102430063 141
1610 3300028379 Ga0268266_11235182 Ga0268266_112351821 141
1611 3300028379 Ga0268266_12149352 Ga0268266_121493521 141
1612 3300028380 Ga0268265_10038809 Ga0268265_100388094 141
1613 3300028380 Ga0268265_10878676 Ga0268265_108786761 141
1614 3300028380 Ga0268265_10973135 Ga0268265_109731352 141
1615 3300028380 Ga0268265_11473254 Ga0268265_114732541 141
1616 3300028381 Ga0268264_10252114 Ga0268264_102521144 141
1617 3300028381 Ga0268264_10274106 Ga0268264_102741061 141
1618 3300028381 Ga0268264_10275065 Ga0268264_102750652 141
1619 3300028381 Ga0268264_10336368 Ga0268264_103363682 141
1620 3300028381 Ga0268264_10461073 Ga0268264_104610732 141
1621 3300028381 Ga0268264_10505867 Ga0268264_105058672 141
1622 3300028381 Ga0268264_10553590 Ga0268264_105535902 141
1623 3300028381 Ga0268264_11278625 Ga0268264_112786251 141
1624 3300028558 Ga0265326_10049936 Ga0265326_100499362 141
1625 3300028558 Ga0265326_10058863 Ga0265326_100588632 141
1626 3300028558 Ga0265326_10180855 Ga0265326_101808552 141
1627 3300028563 Ga0265319_1001755 Ga0265319_10017556 141
1628 3300028563 Ga0265319_1007116 Ga0265319_10071164 141
1629 3300028563 Ga0265319_1007448 Ga0265319_10074481 141
1630 3300028563 Ga0265319_1019640 Ga0265319_10196406 141
1631 3300028563 Ga0265319_1052184 Ga0265319_10521842 141
1632 3300028563 Ga0265319_1069661 Ga0265319_10696611 141
1633 3300028573 Ga0265334_10011259 Ga0265334_100112596 141
1634 3300028573 Ga0265334_10048055 Ga0265334_100480551 141
1635 3300028577 Ga0265318_10012106 Ga0265318_100121066 141
1636 3300028577 Ga0265318_10019472 Ga0265318_100194722 141
1637 3300028577 Ga0265318_10025769 Ga0265318_100257692 141
1638 3300028577 Ga0265318_10030690 Ga0265318_100306906 141
1639 3300028653 Ga0265323_10030524 Ga0265323_100305243 141
1640 3300028653 Ga0265323_10076276 Ga0265323_100762762 141
1641 3300028654 Ga0265322_10094626 Ga0265322_100946262 141
1642 3300028666 Ga0265336_10021509 Ga0265336_100215092 141
1643 3300028666 Ga0265336_10108651 Ga0265336_101086512 141
1644 3300028666 Ga0265336_10115692 Ga0265336_101156921 141
1645 3300028800 Ga0265338_10026020 Ga0265338_100260207 141
1646 3300028800 Ga0265338_10117371 Ga0265338_101173713 141
1647 3300028800 Ga0265338_10197962 Ga0265338_101979622 141
1648 3300029957 Ga0265324_10005334 Ga0265324_100053345 141
1649 3300031235 Ga0265330_10053790 Ga0265330_100537902 141
1650 3300031235 Ga0265330_10076091 Ga0265330_100760912 141
1651 3300031235 Ga0265330_10250656 Ga0265330_102506561 141
1652 3300031238 Ga0265332_10013796 Ga0265332_100137963 141
1653 3300031238 Ga0265332_10073251 Ga0265332_100732513 141
1654 3300031238 Ga0265332_10094047 Ga0265332_100940472 141
1655 3300031239 Ga0265328_10019691 Ga0265328_100196912 141
1656 3300031240 Ga0265320_10008259 Ga0265320_100082596 141
1657 3300031240 Ga0265320_10011941 Ga0265320_100119415 141
1658 3300031240 Ga0265320_10067252 Ga0265320_100672522 141
1659 3300031241 Ga0265325_10024545 Ga0265325_100245456 141
1660 3300031241 Ga0265325_10027854 Ga0265325_100278543 141
1661 3300031242 Ga0265329_10051933 Ga0265329_100519332 141
1662 3300031247 Ga0265340_10003110 Ga0265340_100031106 141
1663 3300031247 Ga0265340_10010244 Ga0265340_100102445 141
1664 3300031247 Ga0265340_10197804 Ga0265340_101978042 141
1665 3300031249 Ga0265339_10044965 Ga0265339_100449652 141
1666 3300031249 Ga0265339_10083540 Ga0265339_100835406 141
1667 3300031250 Ga0265331_10062662 Ga0265331_100626622 141
1668 3300031250 Ga0265331_10076601 Ga0265331_100766012 141
1669 3300031250 Ga0265331_10115665 Ga0265331_101156652 141
1670 3300031344 Ga0265316_10018483 Ga0265316_100184834 141
1671 3300031344 Ga0265316_10098766 Ga0265316_100987662 141
1672 3300031344 Ga0265316_10105975 Ga0265316_101059756 141
1673 3300031344 Ga0265316_10244477 Ga0265316_102444772 141
1674 3300031344 Ga0265316_10835155 Ga0265316_108351552 141
1675 3300031344 Ga0265316_10885403 Ga0265316_108854031 141
1676 3300031548 Ga0307408_100033832 Ga0307408_1000338324 141
1677 3300031548 Ga0307408_100115027 Ga0307408_1001150272 141
1678 3300031548 Ga0307408_100308243 Ga0307408_1003082433 141
1679 3300031548 Ga0307408_100435750 Ga0307408_1004357502 141
1680 3300031548 Ga0307408_100453713 Ga0307408_1004537132 141
1681 3300031595 Ga0265313_10048936 Ga0265313_100489366 141
1682 3300031635 Ga0310115_100204 Ga0310115_1002044 141
1683 3300031665 Ga0316575_10086352 Ga0316575_100863522 141
1684 3300031691 Ga0316579_10001474 Ga0316579_100014748 141
1685 3300031691 Ga0316579_10025642 Ga0316579_100256422 141
1686 3300031691 Ga0316579_10313491 Ga0316579_103134911 141
1687 3300031711 Ga0265314_10026275 Ga0265314_100262753 141
1688 3300031711 Ga0265314_10043762 Ga0265314_100437626 141
1689 3300031711 Ga0265314_10087526 Ga0265314_100875262 141
1690 3300031712 Ga0265342_10018951 Ga0265342_100189516 141
1691 3300031712 Ga0265342_10040348 Ga0265342_100403482 141
1692 3300031712 Ga0265342_10287442 Ga0265342_102874422 141
1693 3300031712 Ga0265342_10287728 Ga0265342_102877281 141
1694 3300031712 Ga0265342_10479952 Ga0265342_104799521 141
1695 3300031727 Ga0316576_10014675 Ga0316576_100146756 141
1696 3300031727 Ga0316576_10028970 Ga0316576_100289702 141
1697 3300031727 Ga0316576_10075025 Ga0316576_100750251 141
1698 3300031727 Ga0316576_10271290 Ga0316576_102712902 141
1699 3300031727 Ga0316576_10318979 Ga0316576_103189792 141
1700 3300031727 Ga0316576_10376445 Ga0316576_103764452 141
1701 3300031728 Ga0316578_10002669 Ga0316578_100026698 141
1702 3300031728 Ga0316578_10031668 Ga0316578_100316685 141
1703 3300031728 Ga0316578_10094474 Ga0316578_100944742 141
1704 3300031728 Ga0316578_10110555 Ga0316578_101105551 141
1705 3300031728 Ga0316578_10354009 Ga0316578_103540091 141
1706 3300031728 Ga0316578_10476765 Ga0316578_104767651 141
1707 3300031731 Ga0307405_10145648 Ga0307405_101456482 141
1708 3300031731 Ga0307405_10283131 Ga0307405_102831312 141
1709 3300031731 Ga0307405_10560731 Ga0307405_105607311 141
1710 3300031731 Ga0307405_11706390 Ga0307405_117063901 141
1711 3300031733 Ga0316577_10023710 Ga0316577_100237103 141
1712 3300031733 Ga0316577_10059138 Ga0316577_100591383 141
1713 3300031733 Ga0316577_10334870 Ga0316577_103348702 141
1714 3300031733 Ga0316577_10660637 Ga0316577_106606372 141
1715 3300031824 Ga0307413_10116787 Ga0307413_101167872 141
1716 3300031852 Ga0307410_10058624 Ga0307410_100586242 141
1717 3300031852 Ga0307410_10229815 Ga0307410_102298152 141
1718 3300031852 Ga0307410_10524380 Ga0307410_105243802 141
1719 3300031852 Ga0307410_11140866 Ga0307410_111408662 141
1720 3300031852 Ga0307410_11166677 Ga0307410_111666772 141
1721 3300031901 Ga0307406_10044253 Ga0307406_100442533 141
1722 3300031901 Ga0307406_10617461 Ga0307406_106174612 141
1723 3300031901 Ga0307406_11075663 Ga0307406_110756631 141
1724 3300031903 Ga0307407_10205397 Ga0307407_102053972 141
1725 3300031903 Ga0307407_11179910 Ga0307407_111799101 141
1726 3300031911 Ga0307412_10024485 Ga0307412_100244852 141
1727 3300031911 Ga0307412_10388017 Ga0307412_103880171 141
1728 3300031911 Ga0307412_11248937 Ga0307412_112489371 141
1729 3300031995 Ga0307409_100033375 Ga0307409_1000333752 141
1730 3300031995 Ga0307409_100174251 Ga0307409_1001742512 141
1731 3300031995 Ga0307409_100450748 Ga0307409_1004507482 141
1732 3300031995 Ga0307409_101282975 Ga0307409_1012829752 141
1733 3300032002 Ga0307416_100042187 Ga0307416_1000421876 141
1734 3300032002 Ga0307416_100270030 Ga0307416_1002700301 141
1735 3300032002 Ga0307416_100283927 Ga0307416_1002839272 141
1736 3300032002 Ga0307416_101044979 Ga0307416_1010449792 141
1737 3300032002 Ga0307416_101217700 Ga0307416_1012177002 141
1738 3300032002 Ga0307416_101467063 Ga0307416_1014670632 141
1739 3300032002 Ga0307416_101581882 Ga0307416_1015818821 141
1740 3300032002 Ga0307416_102654512 Ga0307416_1026545121 141
1741 3300032004 Ga0307414_10109835 Ga0307414_101098353 141
1742 3300032004 Ga0307414_11401602 Ga0307414_114016021 141
1743 3300032005 Ga0307411_10039950 Ga0307411_100399503 141
1744 3300032005 Ga0307411_10618404 Ga0307411_106184042 141
1745 3300032126 Ga0307415_100010815 Ga0307415_1000108153 141
1746 3300032126 Ga0307415_100049313 Ga0307415_1000493133 141
1747 3300032126 Ga0307415_100103376 Ga0307415_1001033762 141
1748 3300032126 Ga0307415_100198773 Ga0307415_1001987735 141
1749 3300032126 Ga0307415_100216378 Ga0307415_1002163782 141
1750 3300032126 Ga0307415_100300850 Ga0307415_1003008502 141
1751 3300032126 Ga0307415_101062635 Ga0307415_1010626351 141
1752 3300032126 Ga0307415_101471388 Ga0307415_1014713882 141
1753 3300032126 Ga0307415_102046631 Ga0307415_1020466311 141
1754 3300032133 Ga0316583_10019741 Ga0316583_100197412 141
1755 3300032137 Ga0316585_10003166 Ga0316585_100031663 141
1756 3300032137 Ga0316585_10047767 Ga0316585_100477672 141
1757 3300032139 Ga0316580_10003514 Ga0316580_100035144 141
1758 3300032139 Ga0316580_10021626 Ga0316580_100216262 141
1759 3300032168 Ga0316593_10000912 Ga0316593_100009127 141
1760 3300032168 Ga0316593_10001396 Ga0316593_100013966 141
1761 3300032168 Ga0316593_10006353 Ga0316593_100063535 141
1762 3300032168 Ga0316593_10065898 Ga0316593_100658982 141
1763 3300032168 Ga0316593_10069482 Ga0316593_100694822 141
1764 3300032168 Ga0316593_10093658 Ga0316593_100936582 141
1765 3300033524 Ga0316592_1001323 Ga0316592_10013232 141
1766 3300033524 Ga0316592_1001732 Ga0316592_10017322 141
1767 3300033524 Ga0316592_1003404 Ga0316592_10034044 141
1768 3300033524 Ga0316592_1124432 Ga0316592_11244321 141
1769 3300033528 Ga0316588_1100748 Ga0316588_11007481 141
1770 3300033529 Ga0316587_1079347 Ga0316587_10793471 141
1771 3300033541 Ga0316596_1001519 Ga0316596_10015195 141
1772 3300033541 Ga0316596_1007478 Ga0316596_10074782 141
1773 3300033541 Ga0316596_1060878 Ga0316596_10608781 141
1774 3300033541 Ga0316596_1189007 Ga0316596_11890071 141
1775 3300034817 Ga0373948_0078786 Ga0373948_0078786_60_485 141
1776 3300034818 Ga0373950_0038565 Ga0373950_0038565_324_749 141
1777 3300034819 Ga0373958_0080139 Ga0373958_0080139_41_466 141
1778 3300035086 Ga0373934_0026705 Ga0373934_0026705_1353_1778 141
1779 3300035088 Ga0373940_0120018 Ga0373940_0120018_370_795 141
1780 3300035088 Ga0373940_0196384 Ga0373940_0196384_98_523 141
1781 3300035090 Ga0373949_0034958 Ga0373949_0034958_74_499 141
1782 3300035092 Ga0373952_0005183 Ga0373952_0005183_1538_1963 141
1783 3300035092 Ga0373952_0241700 Ga0373952_0241700_74_499 141
1784 3300035111 Ga0373923_0040704 Ga0373923_0040704_1002_1427 141
1785 3300035112 Ga0373932_0113887 Ga0373932_0113887_233_658 141
1786 3300035112 Ga0373932_0120697 Ga0373932_0120697_308_733 141
1787 3300035113 Ga0373936_0418471 Ga0373936_0418471_20_445 141
1788 3300035114 Ga0373939_0213270 Ga0373939_0213270_14_439 141
1789 3300035115 Ga0373941_0039797 Ga0373941_0039797_810_1235 141
1790 3300035115 Ga0373941_0127926 Ga0373941_0127926_400_825 141
1791 3300035116 Ga0373945_0242244 Ga0373945_0242244_139_564 141
1792 3300035116 Ga0373945_0244126 Ga0373945_0244126_269_694 141
1793 3300035116 Ga0373945_0316931 Ga0373945_0316931_40_465 141
1794 3300035117 Ga0373953_0327853 Ga0373953_0327853_136_561 141
1795 3300035118 Ga0373954_0001697 Ga0373954_0001697_313_738 141
1796 3300035118 Ga0373954_0048593 Ga0373954_0048593_362_787 141
1797 3300035119 Ga0373956_0009275 Ga0373956_0009275_2117_2542 141
1798 3300035120 Ga0373957_0055618 Ga0373957_0055618_915_1340 141
1799 3300035120 Ga0373957_0242446 Ga0373957_0242446_145_570 141
1800 3300035120 Ga0373957_0468260 Ga0373957_0468260_92_517 141
1801 3300035170 Ga0373943_0087467 Ga0373943_0087467_388_813 141
1802 3300035170 Ga0373943_0459150 Ga0373943_0459150_25_474 141
1803 3300035171 Ga0373946_0479833 Ga0373946_0479833_75_500 141
1804 3300035172 Ga0373955_0189309 Ga0373955_0189309_322_747 141
1805 3300035172 Ga0373955_0720331 Ga0373955_0720331_10_435 141
1806 3300035207 Ga0373942_0012163 Ga0373942_0012163_595_1020 141
1807 3300035241 Ga0373961_0071157 Ga0373961_0071157_460_885 141
1808 3300035398 Ga0316574_0030223 Ga0316574_0030223_2216_2641 141
1809 3300035398 Ga0316574_0054328 Ga0316574_0054328_1175_1600 141
1810 3300035398 Ga0316574_0134302 Ga0316574_0134302_77_502 141
1811 3300035398 Ga0316574_0377655 Ga0316574_0377655_214_639 141
1812 3300035398 Ga0316574_0407936 Ga0316574_0407936_237_662 141
1813 3300035398 Ga0316574_0446103 Ga0316574_0446103_187_612 141
1814 3300035398 Ga0316574_0623333 Ga0316574_0623333_216_641 141
1815 3300035410 Ga0373924_0143804 Ga0373924_0143804_177_602 141
1816 3300035691 Ga0373931_0026647 Ga0373931_0026647_1322_1747 141
1817 3300035691 Ga0373931_0058522 Ga0373931_0058522_646_1071 141
1818 3300035691 Ga0373931_0089547 Ga0373931_0089547_573_998 141
1819 3300035691 Ga0373931_0213349 Ga0373931_0213349_583_1008 141
1820 3300035691 Ga0373931_0325976 Ga0373931_0325976_41_466 141
1821 3300035691 Ga0373931_0339063 Ga0373931_0339063_388_813 141
1822 3300035692 Ga0373935_0229012 Ga0373935_0229012_412_837 141
1823 3300035695 Ga0373927_0001683 Ga0373927_0001683_1889_2314 141
1824 3300035695 Ga0373927_0158881 Ga0373927_0158881_392_817 141
1825 3300035695 Ga0373927_0592833 Ga0373927_0592833_212_637 141
1826 3300035724 Ga0373933_0173257 Ga0373933_0173257_613_1038 141
1827 3300035725 Ga0373947_0060365 Ga0373947_0060365_428_853 141
1828 3300035725 Ga0373947_0100250 Ga0373947_0100250_140_565 141
1829 3300035725 Ga0373947_0141737 Ga0373947_0141737_677_1126 141
1830 3300036401 Ga0373937_0125158 Ga0373937_0125158_1484_1909 141
1831 3300036401 Ga0373937_0215450 Ga0373937_0215450_72_497 141
1832 3300036401 Ga0373937_0586653 Ga0373937_0586653_588_1013 141
1833 3300036401 Ga0373937_0707269 Ga0373937_0707269_178_603 141
1834 3300036401 Ga0373937_1492418 Ga0373937_1492418_47_472 141
1835 3300036647 Ga0316582_0006765 Ga0316582_0006765_1869_2294 141
1836 3300036647 Ga0316582_0029353 Ga0316582_0029353_1573_1998 141
1837 3300036647 Ga0316582_0036138 Ga0316582_0036138_1012_1446 141
1838 3300036647 Ga0316582_0061687 Ga0316582_0061687_380_805 141
1839 3300036647 Ga0316582_0136156 Ga0316582_0136156_955_1380 141
1840 3300036647 Ga0316582_0826185 Ga0316582_0826185_120_545 141
1841 3300036647 Ga0316582_1009400 Ga0316582_1009400_130_555 141
1842 3300036712 Ga0316584_0002909 Ga0316584_0002909_8616_9041 141
1843 3300036712 Ga0316584_0020382 Ga0316584_0020382_605_1090 141
1844 3300036712 Ga0316584_0033381 Ga0316584_0033381_1278_1703 141
1845 3300036712 Ga0316584_0049899 Ga0316584_0049899_958_1383 141
1846 3300036712 Ga0316584_0056919 Ga0316584_0056919_447_872 141
1847 3300036712 Ga0316584_0100393 Ga0316584_0100393_1583_2017 141
1848 3300036712 Ga0316584_0284892 Ga0316584_0284892_719_1144 141
1849 3300036712 Ga0316584_1094194 Ga0316584_1094194_74_499 141
1850 3300037068 Ga0373925_0032173 Ga0373925_0032173_2457_2882 141
1851 3300037068 Ga0373925_1375536 Ga0373925_1375536_36_461 141
1852 3300037471 Ga0395905_0002045 Ga0395905_0002045_5256_5681 141
1853 3300037471 Ga0395905_1662049 Ga0395905_1662049_91_516 141
1854 3300037588 Ga0316581_0003479 Ga0316581_0003479_1941_2375 141
1855 3300037588 Ga0316581_0027213 Ga0316581_0027213_473_898 141
1856 3300037588 Ga0316581_0052521 Ga0316581_0052521_335_760 141
1857 3300037853 Ga0436364_0132128 Ga0436364_0132128_2094_2519 141
1858 3300037853 Ga0436364_1329972 Ga0436364_1329972_2253_2678 141
1859 3300038443 Ga0395901_0492179 Ga0395901_0492179_750_1181 141
1860 3300038443 Ga0395901_0800629 Ga0395901_0800629_363_788 141
1861 3300038725 Ga0400484_25283 Ga0400484_25283_16564_16989 141
1862 3300038996 Ga0242420_083354 Ga0242420_083354_21_446 141
1863 3300039437 Ga0436365_0518373 Ga0436365_0518373_9633_10058 141
1864 3300039437 Ga0436365_1839802 Ga0436365_1839802_936_1361 141
1865 3300039450 Ga0436363_0355319 Ga0436363_0355319_25_450 141
1866 3300039453 Ga0436362_0611503 Ga0436362_0611503_551_976 141
1867 3300041405 Ga0439438_029210 Ga0439438_029210_660_1085 141
1868 3300041407 Ga0439447_014554 Ga0439447_014554_851_1276 141
1869 3300041410 Ga0439461_0017818 Ga0439461_0017818_735_1160 141
1870 3300041411 Ga0439466_0033391 Ga0439466_0033391_365_790 141
1871 3300041413 Ga0439465_0080045 Ga0439465_0080045_281_706 141
1872 3300041413 Ga0439465_0240903 Ga0439465_0240903_101_526 141
1873 3300041458 Ga0451798_0113321 Ga0451798_0113321_252_698 141
1874 3300041458 Ga0451798_0575567 Ga0451798_0575567_44_469 141
1875 3300041486 Ga0451807_0774648 Ga0451807_0774648_110_535 141
1876 3300041494 Ga0451837_0907061 Ga0451837_0907061_69_494 141
1877 3300041498 Ga0451841_0292560 Ga0451841_0292560_175_600 141
1878 3300041505 Ga0451849_0248137 Ga0451849_0248137_711_1136 141
1879 3300041505 Ga0451849_1069921 Ga0451849_1069921_84_509 141
1880 3300041508 Ga0451852_17107 Ga0451852_17107_127_552 141
1881 3300041509 Ga0451843_0695654 Ga0451843_0695654_63_488 141
1882 3300041509 Ga0451843_1408726 Ga0451843_1408726_187_612 141
1883 3300041511 Ga0451855_1829449 Ga0451855_1829449_378_827 141
1884 3300041512 Ga0451853_0705191 Ga0451853_0705191_106_531 141
1885 3300041512 Ga0451853_2322621 Ga0451853_2322621_421_846 141
1886 3300041997 Ga0439431_0063538 Ga0439431_0063538_15_440 141
1887 3300041999 Ga0439433_0029421 Ga0439433_0029421_463_888 141
1888 3300042001 Ga0439441_005370 Ga0439441_005370_1201_1629 141
1889 3300042001 Ga0439441_028003 Ga0439441_028003_204_629 141
1890 3300042001 Ga0439441_041823 Ga0439441_041823_53_478 141
1891 3300042003 Ga0439443_012523 Ga0439443_012523_651_1082 141
1892 3300042003 Ga0439443_017463 Ga0439443_017463_238_663 141
1893 3300042007 Ga0439449_0203611 Ga0439449_0203611_110_535 141
1894 3300042008 Ga0439450_027347 Ga0439450_027347_800_1225 141
1895 3300042010 Ga0439452_033829 Ga0439452_033829_25_450 141
1896 3300042011 Ga0439454_016349 Ga0439454_016349_165_590 141
1897 3300042012 Ga0439455_0110176 Ga0439455_0110176_247_672 141
1898 3300042013 Ga0439456_019413 Ga0439456_019413_26_451 141
1899 3300042015 Ga0439462_0024059 Ga0439462_0024059_366_791 141
1900 3300042116 Ga0450912_002280 Ga0450912_002280_552_977 141
1901 3300042119 Ga0450915_011205 Ga0450915_011205_141_566 141
1902 3300042122 Ga0450920_003948 Ga0450920_003948_336_761 141
1903 3300042122 Ga0450920_143765 Ga0450920_143765_28_453 141
1904 3300042125 Ga0450923_076195 Ga0450923_076195_311_736 141
1905 3300042126 Ga0450888_012106 Ga0450888_012106_558_983 141
1906 3300042127 Ga0450890_058179 Ga0450890_058179_75_500 141
1907 3300042136 Ga0450900_005646 Ga0450900_005646_990_1415 141
1908 3300042139 Ga0450904_024334 Ga0450904_024334_53_478 141
1909 3300042147 Ga0450910_002124 Ga0450910_002124_1828_2253 141
1910 3300042156 Ga0439446_0001343 Ga0439446_0001343_3948_4373 141
1911 3300042435 Ga0439434_0012597 Ga0439434_0012597_936_1361 141
1912 3300042435 Ga0439434_0020922 Ga0439434_0020922_81_506 141
1913 3300042437 Ga0439444_0004804 Ga0439444_0004804_1508_1933 141
1914 3300042439 Ga0439464_0038445 Ga0439464_0038445_176_601 141
1915 3300042461 Ga0439460_0116528 Ga0439460_0116528_81_506 141
1916 3300042461 Ga0439460_0257355 Ga0439460_0257355_47_475 141
1917 3300042876 Ga0451577_0060452 Ga0451577_0060452_846_1271 141
1918 3300042876 Ga0451577_1034688 Ga0451577_1034688_58_483 141
1919 3300042876 Ga0451577_1093579 Ga0451577_1093579_199_624 141
1920 3300042876 Ga0451577_1206953 Ga0451577_1206953_92_517 141
1921 3300044673 Ga0453683_0018052 Ga0453683_0018052_2050_2475 141
1922 3300044673 Ga0453683_0084212 Ga0453683_0084212_789_1217 141
1923 3300044673 Ga0453683_0110847 Ga0453683_0110847_85_519 141
1924 3300044673 Ga0453683_0128288 Ga0453683_0128288_475_900 141
1925 3300044673 Ga0453683_0130392 Ga0453683_0130392_504_929 141
1926 3300044673 Ga0453683_0301682 Ga0453683_0301682_70_495 141
1927 3300044694 Ga0466963_0377158 Ga0466963_0377158_320_745 141
1928 3300044694 Ga0466963_0835039 Ga0466963_0835039_67_492 141
1929 3300044712 Ga0453684_0098380 Ga0453684_0098380_1178_1603 141
1930 3300044712 Ga0453684_0296601 Ga0453684_0296601_564_989 141
1931 3300044712 Ga0453684_1330471 Ga0453684_1330471_55_480 141
1932 3300044712 Ga0453684_2029289 Ga0453684_2029289_60_485 141
1933 3300044735 Ga0466968_0554090 Ga0466968_0554090_129_554 141
1934 3300045051 Ga0451576_0001192 Ga0451576_0001192_44583_45017 141
1935 3300045051 Ga0451576_0003208 Ga0451576_0003208_1330_1764 141
1936 3300045051 Ga0451576_0040408 Ga0451576_0040408_1888_2313 141
1937 3300045051 Ga0451576_0068762 Ga0451576_0068762_1833_2258 141
1938 3300045051 Ga0451576_0403823 Ga0451576_0403823_560_985 141
1939 3300045051 Ga0451576_1733028 Ga0451576_1733028_60_488 141
1940 3300045051 Ga0451576_1893323 Ga0451576_1893323_149_574 141
1941 3300045836 Ga0466958_0399077 Ga0466958_0399077_154_579 141
1942 3300045976 Ga0466967_0180409 Ga0466967_0180409_1048_1473 141
1943 3300045976 Ga0466967_0486205 Ga0466967_0486205_122_547 141
1944 3300045976 Ga0466967_1056743 Ga0466967_1056743_318_743 141
1945 3300045976 Ga0466967_1754022 Ga0466967_1754022_161_586 141
1946 3300046454 Ga0495592_0090929 Ga0495592_0090929_738_1163 141
1947 3300046454 Ga0495592_0219709 Ga0495592_0219709_625_1050 141
1948 3300046455 Ga0495603_0407337 Ga0495603_0407337_303_728 141
1949 3300046455 Ga0495603_0616152 Ga0495603_0616152_40_465 141
1950 3300046458 Ga0495591_058996 Ga0495591_058996_435_860 141
1951 3300046458 Ga0495591_161310 Ga0495591_161310_71_496 141
1952 3300046459 Ga0495629_0105533 Ga0495629_0105533_160_585 141
1953 3300046461 Ga0495641_0358828 Ga0495641_0358828_111_536 141
1954 3300046462 Ga0495651_0174499 Ga0495651_0174499_569_994 141
1955 3300046462 Ga0495651_0716457 Ga0495651_0716457_149_574 141
1956 3300046463 Ga0495653_0056575 Ga0495653_0056575_1370_1795 141
1957 3300046473 Ga0495582_0053122 Ga0495582_0053122_563_988 141
1958 3300046473 Ga0495582_0836029 Ga0495582_0836029_71_496 141
1959 3300046475 Ga0495639_0421004 Ga0495639_0421004_59_484 141
1960 3300046475 Ga0495639_0474171 Ga0495639_0474171_97_546 141
1961 3300046476 Ga0495662_0249964 Ga0495662_0249964_268_693 141
1962 3300046477 Ga0495664_0041524 Ga0495664_0041524_650_1075 141
1963 3300046477 Ga0495664_0274917 Ga0495664_0274917_371_796 141
1964 3300046491 Ga0495584_0038570 Ga0495584_0038570_1313_1744 141
1965 3300046499 Ga0495594_0039040 Ga0495594_0039040_1775_2200 141
1966 3300046499 Ga0495594_0088963 Ga0495594_0088963_453_878 141
1967 3300046499 Ga0495594_0144175 Ga0495594_0144175_64_489 141
1968 3300046500 Ga0495596_0058586 Ga0495596_0058586_613_1038 141
1969 3300046500 Ga0495596_0309755 Ga0495596_0309755_31_456 141
1970 3300046506 Ga0495583_0082229 Ga0495583_0082229_125_550 141
1971 3300046511 Ga0495608_0059612 Ga0495608_0059612_375_800 141
1972 3300046511 Ga0495608_0123307 Ga0495608_0123307_40_465 141
1973 3300046514 Ga0495618_0033150 Ga0495618_0033150_1035_1460 141
1974 3300046516 Ga0495628_0057506 Ga0495628_0057506_1371_1796 141
1975 3300046516 Ga0495628_0452371 Ga0495628_0452371_66_491 141
1976 3300046517 Ga0495630_0318694 Ga0495630_0318694_329_754 141
1977 3300046517 Ga0495630_0712514 Ga0495630_0712514_297_722 141
1978 3300046517 Ga0495630_0748761 Ga0495630_0748761_31_456 141
1979 3300046526 Ga0495666_0076246 Ga0495666_0076246_1052_1501 141
1980 3300046529 Ga0495652_0114458 Ga0495652_0114458_666_1091 141
1981 3300046533 Ga0495640_0033412 Ga0495640_0033412_1771_2196 141
1982 3300046535 Ga0495586_0168011 Ga0495586_0168011_129_554 141
1983 3300046536 Ga0495587_0230779 Ga0495587_0230779_473_898 141
1984 3300046536 Ga0495587_0456742 Ga0495587_0456742_55_480 141
1985 3300046538 Ga0495609_0416283 Ga0495609_0416283_22_447 141
1986 3300046543 Ga0495645_0161887 Ga0495645_0161887_55_480 141
1987 3300046559 Ga0495667_0025824 Ga0495667_0025824_1239_1664 141
1988 3300046559 Ga0495667_0128013 Ga0495667_0128013_804_1229 141
1989 3300046559 Ga0495667_0162824 Ga0495667_0162824_518_943 141
1990 3300046615 Ga0495656_0150430 Ga0495656_0150430_445_870 141
1991 3300046642 Ga0495634_0077060 Ga0495634_0077060_706_1131 141
1992 3300046642 Ga0495634_0095577 Ga0495634_0095577_811_1236 141
1993 3300046642 Ga0495634_0188525 Ga0495634_0188525_570_995 141
1994 3300046648 Ga0495611_0229519 Ga0495611_0229519_286_717 141
1995 3300046663 Ga0495635_0013387 Ga0495635_0013387_1017_1442 141
1996 3300046663 Ga0495635_0157527 Ga0495635_0157527_717_1142 141
1997 3300046663 Ga0495635_0247646 Ga0495635_0247646_160_585 141
1998 3300046674 Ga0495588_0046679 Ga0495588_0046679_188_637 141
1999 3300046674 Ga0495588_0565561 Ga0495588_0565561_106_531 141
2000 3300046675 Ga0495657_0046387 Ga0495657_0046387_36_461 141
2001 3300046675 Ga0495657_0060841 Ga0495657_0060841_1911_2336 141
2002 3300046675 Ga0495657_0126032 Ga0495657_0126032_70_495 141
2003 3300046678 Ga0495599_0171862 Ga0495599_0171862_561_986 141
2004 3300046678 Ga0495599_0496087 Ga0495599_0496087_73_498 141
2005 3300046681 Ga0495647_0159116 Ga0495647_0159116_508_933 141
2006 3300046681 Ga0495647_0600541 Ga0495647_0600541_64_489 141
2007 3300046683 Ga0495658_0138762 Ga0495658_0138762_1019_1444 141
2008 3300046683 Ga0495658_0313168 Ga0495658_0313168_195_620 141
2009 3300046689 Ga0495613_0554554 Ga0495613_0554554_137_562 141
2010 3300046690 Ga0495624_0183355 Ga0495624_0183355_582_1007 141
2011 3300046690 Ga0495624_0284224 Ga0495624_0284224_466_891 141
2012 3300046690 Ga0495624_0658121 Ga0495624_0658121_55_504 141
2013 3300046692 Ga0495671_0449758 Ga0495671_0449758_58_483 141
2014 3300046794 Ga0495589_0199799 Ga0495589_0199799_156_584 141
2015 3300046809 Ga0495600_0040836 Ga0495600_0040836_166_591 141
2016 3300046809 Ga0495600_0553748 Ga0495600_0553748_120_545 141
2017 3300046810 Ga0495660_0183705 Ga0495660_0183705_28_453 141
2018 3300046810 Ga0495660_0320380 Ga0495660_0320380_164_589 141
2019 3300047315 Ga0495581_0020518 Ga0495581_0020518_872_1297 141
2020 3300047315 Ga0495581_0212185 Ga0495581_0212185_584_1009 141
2021 3300047317 Ga0495604_0581003 Ga0495604_0581003_37_462 141
2022 3300047317 Ga0495604_0646788 Ga0495604_0646788_116_541 141
2023 3300047318 Ga0495636_0062684 Ga0495636_0062684_678_1103 141
2024 3300047318 Ga0495636_0197220 Ga0495636_0197220_195_620 141
2025 3300047319 Ga0495674_0146979 Ga0495674_0146979_1215_1640 141
2026 3300047319 Ga0495674_0374683 Ga0495674_0374683_541_966 141
2027 3300047319 Ga0495674_0980742 Ga0495674_0980742_109_534 141
2028 3300047321 Ga0495676_0041359 Ga0495676_0041359_2625_3074 141
2029 3300047321 Ga0495676_0325777 Ga0495676_0325777_183_608 141
2030 3300047321 Ga0495676_1091282 Ga0495676_1091282_43_468 141
2031 3300047322 Ga0495680_0522356 Ga0495680_0522356_239_664 141
2032 3300047445 Ga0495677_0153014 Ga0495677_0153014_185_610 141
2033 3300047471 Ga0495684_0127096 Ga0495684_0127096_1163_1588 141
2034 3300047673 Ga0495593_0074003 Ga0495593_0074003_349_774 141
2035 3300048088 Ga0495602_0167575 Ga0495602_0167575_228_653 141
2036 3300048088 Ga0495602_1081457 Ga0495602_1081457_40_465 141
2037 3300048089 Ga0495614_0195479 Ga0495614_0195479_62_487 141
2038 3300048903 Ga0496100_0050650 Ga0496100_0050650_617_1042 141
2039 3300048903 Ga0496100_0619878 Ga0496100_0619878_29_454 141
2040 3300048903 Ga0496100_0680096 Ga0496100_0680096_31_456 141
2041 3300048904 Ga0496101_0104276 Ga0496101_0104276_509_934 141
2042 3300048904 Ga0496101_0151181 Ga0496101_0151181_871_1296 141
2043 3300048904 Ga0496101_0842977 Ga0496101_0842977_184_609 141
2044 3300048904 Ga0496101_1178944 Ga0496101_1178944_28_453 141
2045 3300048905 Ga0496102_0270862 Ga0496102_0270862_422_847 141
2046 3300048905 Ga0496102_0546275 Ga0496102_0546275_155_580 141
2047 3300048905 Ga0496102_0724028 Ga0496102_0724028_40_468 141
2048 3300048905 Ga0496102_1121548 Ga0496102_1121548_32_457 141
2049 3300048906 Ga0496103_0136694 Ga0496103_0136694_567_992 141
2050 3300048906 Ga0496103_0631776 Ga0496103_0631776_93_518 141
2051 3300048907 Ga0496104_0048572 Ga0496104_0048572_1485_1910 141
2052 3300048907 Ga0496104_0100791 Ga0496104_0100791_1199_1624 141
2053 3300048907 Ga0496104_0173708 Ga0496104_0173708_603_1028 141
2054 3300048907 Ga0496104_0257888 Ga0496104_0257888_77_502 141
2055 3300048907 Ga0496104_1212455 Ga0496104_1212455_193_618 141
2056 3300048907 Ga0496104_1358730 Ga0496104_1358730_131_556 141
2057 3300048908 Ga0496105_0079537 Ga0496105_0079537_1026_1451 141
2058 3300048908 Ga0496105_0120210 Ga0496105_0120210_1007_1432 141
2059 3300048908 Ga0496105_0354207 Ga0496105_0354207_150_575 141
2060 3300048909 Ga0496106_0282897 Ga0496106_0282897_68_493 141
2061 3300048909 Ga0496106_0296134 Ga0496106_0296134_277_702 141
2062 3300048909 Ga0496106_0297927 Ga0496106_0297927_430_855 141
2063 3300048910 Ga0496107_0043952 Ga0496107_0043952_735_1160 141
2064 3300048910 Ga0496107_0160065 Ga0496107_0160065_536_961 141
2065 3300048910 Ga0496107_0262058 Ga0496107_0262058_506_931 141
2066 3300048910 Ga0496107_0376008 Ga0496107_0376008_336_761 141
2067 3300048911 Ga0496108_0000261 Ga0496108_0000261_1279_1704 141
2068 3300048911 Ga0496108_0021720 Ga0496108_0021720_1202_1627 141
2069 3300048911 Ga0496108_0133733 Ga0496108_0133733_1083_1508 141
2070 3300048911 Ga0496108_0191948 Ga0496108_0191948_68_493 141
2071 3300048911 Ga0496108_0273827 Ga0496108_0273827_445_870 141
2072 3300048911 Ga0496108_0763867 Ga0496108_0763867_19_444 141
2073 3300048912 Ga0496109_0069348 Ga0496109_0069348_1227_1652 141
2074 3300048912 Ga0496109_0122176 Ga0496109_0122176_76_501 141
2075 3300048912 Ga0496109_0148659 Ga0496109_0148659_1625_2050 141
2076 3300048912 Ga0496109_0153122 Ga0496109_0153122_1622_2047 141
2077 3300048912 Ga0496109_1768200 Ga0496109_1768200_103_528 141
2078 3300048913 Ga0496110_0011469 Ga0496110_0011469_2701_3126 141
2079 3300048913 Ga0496110_0032222 Ga0496110_0032222_2914_3339 141
2080 3300048913 Ga0496110_0138624 Ga0496110_0138624_751_1176 141
2081 3300048913 Ga0496110_0347870 Ga0496110_0347870_260_685 141
2082 3300048913 Ga0496110_0853397 Ga0496110_0853397_44_469 141
2083 3300048913 Ga0496110_1189459 Ga0496110_1189459_180_605 141
2084 3300048914 Ga0496111_0031782 Ga0496111_0031782_992_1417 141
2085 3300048914 Ga0496111_0345099 Ga0496111_0345099_381_806 141
2086 3300048914 Ga0496111_1262184 Ga0496111_1262184_62_487 141
2087 3300048915 Ga0496112_0002202 Ga0496112_0002202_1190_1615 141
2088 3300048915 Ga0496112_0047852 Ga0496112_0047852_2071_2496 141
2089 3300048915 Ga0496112_0295204 Ga0496112_0295204_835_1260 141
2090 3300048915 Ga0496112_0806021 Ga0496112_0806021_68_493 141
2091 3300048916 Ga0496113_0069231 Ga0496113_0069231_1884_2309 141
2092 3300048916 Ga0496113_0144594 Ga0496113_0144594_539_964 141
2093 3300048917 Ga0496114_0165095 Ga0496114_0165095_186_611 141
2094 3300048917 Ga0496114_0165646 Ga0496114_0165646_1217_1642 141
2095 3300048917 Ga0496114_0186173 Ga0496114_0186173_885_1334 141
2096 3300048917 Ga0496114_0245393 Ga0496114_0245393_874_1299 141
2097 3300048917 Ga0496114_0373011 Ga0496114_0373011_359_784 141
2098 3300048917 Ga0496114_1580369 Ga0496114_1580369_17_442 141
2099 3300048917 Ga0496114_1767903 Ga0496114_1767903_46_471 141
2100 3300049127 Ga0501306_028260 Ga0501306_028260_143_568 141
2101 3300049128 Ga0501308_000545 Ga0501308_000545_1342_1767 141
2102 3300049128 Ga0501308_075966 Ga0501308_075966_36_461 141
2103 3300049160 Ga0501304_000239 Ga0501304_000239_750_1175 141
2104 3300049160 Ga0501304_019113 Ga0501304_019113_156_581 141
2105 3300049162 Ga0501307_003860 Ga0501307_003860_408_833 141
2106 3300049513 Ga0501290_001023 Ga0501290_001023_42_467 141
2107 3300049514 Ga0501291_006529 Ga0501291_006529_650_1075 141
2108 3300049515 Ga0501292_000099 Ga0501292_000099_1804_2229 141
2109 3300049516 Ga0501293_000919 Ga0501293_000919_1145_1570 141
2110 3300049518 Ga0501295_000301 Ga0501295_000301_1402_1827 141
2111 3300049519 Ga0501296_001093 Ga0501296_001093_1849_2274 141
2112 3300049520 Ga0501297_000031 Ga0501297_000031_1401_1826 141
2113 3300049521 Ga0501298_000270 Ga0501298_000270_4927_5352 141
2114 3300049522 Ga0501299_000277 Ga0501299_000277_4038_4463 141
2115 3300049523 Ga0501300_001419 Ga0501300_001419_2512_2937 141
2116 3300049524 Ga0501301_000218 Ga0501301_000218_2485_2910 141
2117 3300049525 Ga0501302_000534 Ga0501302_000534_575_1000 141
2118 3300049526 Ga0501303_001485 Ga0501303_001485_252_677 141
2119 3300049531 Ga0501315_000285 Ga0501315_000285_150_575 141
2120 3300049533 Ga0501317_096406 Ga0501317_096406_48_473 141
2121 3300049533 Ga0501317_099967 Ga0501317_099967_58_483 141
2122 3300049536 Ga0501320_040267 Ga0501320_040267_114_539 141
2123 3300049537 Ga0501321_066499 Ga0501321_066499_33_458 141
2124 3300049551 Ga0501335_017429 Ga0501335_017429_128_553 141
2125 3300049568 Ga0501031_0216581 Ga0501031_0216581_461_886 141
2126 3300049568 Ga0501031_0244799 Ga0501031_0244799_71_496 141
2127 3300049568 Ga0501031_0257348 Ga0501031_0257348_94_519 141
2128 3300049568 Ga0501031_0346230 Ga0501031_0346230_482_910 141
2129 3300049568 Ga0501031_0420186 Ga0501031_0420186_34_459 141
2130 3300049568 Ga0501031_0432745 Ga0501031_0432745_188_613 141
2131 3300049569 Ga0501032_0164124 Ga0501032_0164124_817_1242 141
2132 3300049569 Ga0501032_0212202 Ga0501032_0212202_125_550 141
2133 3300049569 Ga0501032_0362056 Ga0501032_0362056_24_449 141
2134 3300049570 Ga0501033_0259519 Ga0501033_0259519_462_887 141
2135 3300049570 Ga0501033_0800101 Ga0501033_0800101_188_613 141
2136 3300049571 Ga0501034_0043527 Ga0501034_0043527_2095_2520 141
2137 3300049571 Ga0501034_0267917 Ga0501034_0267917_632_1057 141
2138 3300049572 Ga0501036_0103065 Ga0501036_0103065_299_724 141
2139 3300049572 Ga0501036_0165028 Ga0501036_0165028_473_898 141
2140 3300049572 Ga0501036_0180675 Ga0501036_0180675_874_1302 141
2141 3300049572 Ga0501036_0303960 Ga0501036_0303960_708_1133 141
2142 3300049572 Ga0501036_0419709 Ga0501036_0419709_23_448 141
2143 3300049572 Ga0501036_1348411 Ga0501036_1348411_116_541 141
2144 3300049573 Ga0501037_0057660 Ga0501037_0057660_1547_1972 141
2145 3300049573 Ga0501037_0407609 Ga0501037_0407609_380_805 141
2146 3300049574 Ga0501038_0107808 Ga0501038_0107808_795_1220 141
2147 3300049574 Ga0501038_0356921 Ga0501038_0356921_249_674 141
2148 3300049574 Ga0501038_0406338 Ga0501038_0406338_579_1004 141
2149 3300049574 Ga0501038_1076902 Ga0501038_1076902_41_466 141
2150 3300049574 Ga0501038_1186369 Ga0501038_1186369_95_520 141
2151 3300049575 Ga0501039_0027633 Ga0501039_0027633_3868_4293 141
2152 3300049575 Ga0501039_0054948 Ga0501039_0054948_1627_2055 141
2153 3300049575 Ga0501039_0440602 Ga0501039_0440602_478_903 141
2154 3300049575 Ga0501039_0502303 Ga0501039_0502303_165_590 141
2155 3300049575 Ga0501039_0565604 Ga0501039_0565604_314_739 141
2156 3300049575 Ga0501039_0747493 Ga0501039_0747493_11_436 141
2157 3300049575 Ga0501039_0830298 Ga0501039_0830298_35_460 141
2158 3300049576 Ga0501040_0102211 Ga0501040_0102211_569_994 141
2159 3300049576 Ga0501040_0154328 Ga0501040_0154328_393_818 141
2160 3300049576 Ga0501040_0170598 Ga0501040_0170598_546_974 141
2161 3300049576 Ga0501040_0219591 Ga0501040_0219591_673_1098 141
2162 3300049576 Ga0501040_0368868 Ga0501040_0368868_455_883 141
2163 3300049576 Ga0501040_0613113 Ga0501040_0613113_298_723 141
2164 3300049576 Ga0501040_0794172 Ga0501040_0794172_158_592 141
2165 3300049577 Ga0501041_0028950 Ga0501041_0028950_2118_2546 141
2166 3300049577 Ga0501041_0035434 Ga0501041_0035434_1305_1730 141
2167 3300049577 Ga0501041_0110607 Ga0501041_0110607_885_1310 141
2168 3300049577 Ga0501041_0113853 Ga0501041_0113853_241_666 141
2169 3300049577 Ga0501041_0183725 Ga0501041_0183725_43_468 141
2170 3300049577 Ga0501041_0224518 Ga0501041_0224518_502_927 141
2171 3300049577 Ga0501041_0319377 Ga0501041_0319377_490_915 141
2172 3300049577 Ga0501041_0358086 Ga0501041_0358086_91_516 141
2173 3300049577 Ga0501041_0387903 Ga0501041_0387903_203_628 141
2174 3300049577 Ga0501041_0464684 Ga0501041_0464684_233_658 141
2175 3300049578 Ga0501042_0033891 Ga0501042_0033891_452_880 141
2176 3300049578 Ga0501042_0184689 Ga0501042_0184689_765_1190 141
2177 3300049578 Ga0501042_0258251 Ga0501042_0258251_775_1200 141
2178 3300049578 Ga0501042_0404942 Ga0501042_0404942_432_857 141
2179 3300049578 Ga0501042_0805952 Ga0501042_0805952_176_601 141
2180 3300049579 Ga0501043_0552920 Ga0501043_0552920_93_518 141
2181 3300049579 Ga0501043_0669332 Ga0501043_0669332_143_568 141
2182 3300049579 Ga0501043_0770615 Ga0501043_0770615_49_483 141
2183 3300049579 Ga0501043_1195552 Ga0501043_1195552_79_504 141
2184 3300049580 Ga0501046_0079419 Ga0501046_0079419_1683_2108 141
2185 3300049580 Ga0501046_0082775 Ga0501046_0082775_740_1165 141
2186 3300049580 Ga0501046_0141320 Ga0501046_0141320_519_944 141
2187 3300049580 Ga0501046_0288368 Ga0501046_0288368_401_826 141
2188 3300049582 Ga0501048_0037285 Ga0501048_0037285_581_1006 141
2189 3300049582 Ga0501048_0167248 Ga0501048_0167248_626_1051 141
2190 3300049582 Ga0501048_0180521 Ga0501048_0180521_779_1204 141
2191 3300049582 Ga0501048_0188112 Ga0501048_0188112_785_1210 141
2192 3300049582 Ga0501048_0240732 Ga0501048_0240732_406_831 141
2193 3300049582 Ga0501048_0301739 Ga0501048_0301739_376_801 141
2194 3300049582 Ga0501048_0326417 Ga0501048_0326417_201_629 141
2195 3300049582 Ga0501048_0445183 Ga0501048_0445183_70_495 141
2196 3300049582 Ga0501048_0652735 Ga0501048_0652735_275_700 141
2197 3300049583 Ga0501067_0036095 Ga0501067_0036095_1932_2357 141
2198 3300049583 Ga0501067_0092480 Ga0501067_0092480_1144_1569 141
2199 3300049583 Ga0501067_0095832 Ga0501067_0095832_218_643 141
2200 3300049583 Ga0501067_0106334 Ga0501067_0106334_203_631 141
2201 3300049583 Ga0501067_0278900 Ga0501067_0278900_202_627 141
2202 3300049584 Ga0501068_0021694 Ga0501068_0021694_995_1420 141
2203 3300049584 Ga0501068_0078593 Ga0501068_0078593_680_1105 141
2204 3300049584 Ga0501068_0092238 Ga0501068_0092238_591_1016 141
2205 3300049584 Ga0501068_0231192 Ga0501068_0231192_66_491 141
2206 3300049584 Ga0501068_0261188 Ga0501068_0261188_600_1025 141
2207 3300049584 Ga0501068_0274153 Ga0501068_0274153_362_787 141
2208 3300049584 Ga0501068_0294098 Ga0501068_0294098_420_845 141
2209 3300049584 Ga0501068_0305772 Ga0501068_0305772_355_780 141
2210 3300049585 Ga0501069_0613485 Ga0501069_0613485_56_481 141
2211 3300049586 Ga0501070_0410262 Ga0501070_0410262_519_944 141
2212 3300049586 Ga0501070_0410693 Ga0501070_0410693_517_942 141
2213 3300049586 Ga0501070_0587434 Ga0501070_0587434_133_561 141
2214 3300049586 Ga0501070_0984384 Ga0501070_0984384_86_511 141
2215 3300049587 Ga0501071_0019308 Ga0501071_0019308_3149_3574 141
2216 3300049587 Ga0501071_0042660 Ga0501071_0042660_2300_2725 141
2217 3300049587 Ga0501071_0078903 Ga0501071_0078903_1368_1793 141
2218 3300049587 Ga0501071_0208663 Ga0501071_0208663_945_1370 141
2219 3300049587 Ga0501071_0221866 Ga0501071_0221866_955_1380 141
2220 3300049587 Ga0501071_0274585 Ga0501071_0274585_352_777 141
2221 3300049587 Ga0501071_0287414 Ga0501071_0287414_287_712 141
2222 3300049587 Ga0501071_0363701 Ga0501071_0363701_151_576 141
2223 3300049587 Ga0501071_0430608 Ga0501071_0430608_553_978 141
2224 3300049587 Ga0501071_0446992 Ga0501071_0446992_499_927 141
2225 3300049587 Ga0501071_0716660 Ga0501071_0716660_213_638 141
2226 3300049587 Ga0501071_0920827 Ga0501071_0920827_160_585 141
2227 3300049587 Ga0501071_1044291 Ga0501071_1044291_194_619 141
2228 3300049588 Ga0501072_0028655 Ga0501072_0028655_1665_2090 141
2229 3300049588 Ga0501072_0055181 Ga0501072_0055181_1821_2246 141
2230 3300049588 Ga0501072_0089964 Ga0501072_0089964_208_633 141
2231 3300049588 Ga0501072_0144868 Ga0501072_0144868_1186_1611 141
2232 3300049588 Ga0501072_0170627 Ga0501072_0170627_1138_1563 141
2233 3300049588 Ga0501072_0344542 Ga0501072_0344542_213_638 141
2234 3300049588 Ga0501072_0472597 Ga0501072_0472597_517_942 141
2235 3300049588 Ga0501072_0828247 Ga0501072_0828247_151_576 141
2236 3300049588 Ga0501072_1272129 Ga0501072_1272129_23_448 141
2237 3300049589 Ga0501073_0037162 Ga0501073_0037162_2335_2760 141
2238 3300049589 Ga0501073_0145584 Ga0501073_0145584_1070_1495 141
2239 3300049589 Ga0501073_0247527 Ga0501073_0247527_121_546 141
2240 3300049589 Ga0501073_0526782 Ga0501073_0526782_183_608 141
2241 3300049590 Ga0501074_0097267 Ga0501074_0097267_827_1252 141
2242 3300049590 Ga0501074_0114081 Ga0501074_0114081_911_1339 141
2243 3300049590 Ga0501074_0281912 Ga0501074_0281912_741_1169 141
2244 3300049590 Ga0501074_0341162 Ga0501074_0341162_318_743 141
2245 3300049590 Ga0501074_0396766 Ga0501074_0396766_493_918 141
2246 3300049590 Ga0501074_0697313 Ga0501074_0697313_188_613 141
2247 3300049591 Ga0501075_0007600 Ga0501075_0007600_5285_5710 141
2248 3300049591 Ga0501075_0037524 Ga0501075_0037524_1028_1453 141
2249 3300049591 Ga0501075_0049327 Ga0501075_0049327_775_1200 141
2250 3300049591 Ga0501075_0056252 Ga0501075_0056252_978_1406 141
2251 3300049591 Ga0501075_0077513 Ga0501075_0077513_1900_2325 141
2252 3300049591 Ga0501075_0216692 Ga0501075_0216692_378_803 141
2253 3300049591 Ga0501075_0452286 Ga0501075_0452286_207_632 141
2254 3300049591 Ga0501075_0949574 Ga0501075_0949574_149_574 141
2255 3300049592 Ga0501076_0024555 Ga0501076_0024555_1470_1895 141
2256 3300049592 Ga0501076_0066166 Ga0501076_0066166_1968_2393 141
2257 3300049592 Ga0501076_0105295 Ga0501076_0105295_1383_1808 141
2258 3300049592 Ga0501076_0136338 Ga0501076_0136338_1305_1730 141
2259 3300049592 Ga0501076_0171941 Ga0501076_0171941_732_1157 141
2260 3300049592 Ga0501076_0295655 Ga0501076_0295655_784_1212 141
2261 3300049592 Ga0501076_0303367 Ga0501076_0303367_49_477 141
2262 3300049592 Ga0501076_0597903 Ga0501076_0597903_344_769 141
2263 3300049593 Ga0501077_0069941 Ga0501077_0069941_133_558 141
2264 3300049593 Ga0501077_0094922 Ga0501077_0094922_499_924 141
2265 3300049593 Ga0501077_0133044 Ga0501077_0133044_591_1016 141
2266 3300049593 Ga0501077_0351142 Ga0501077_0351142_269_694 141
2267 3300049593 Ga0501077_0429515 Ga0501077_0429515_381_809 141
2268 3300049593 Ga0501077_0520223 Ga0501077_0520223_25_450 141
2269 3300049593 Ga0501077_0657080 Ga0501077_0657080_141_566 141
2270 3300049649 Ga0501198_000368 Ga0501198_000368_1077_1502 141
2271 3300049650 Ga0501199_000395 Ga0501199_000395_1081_1506 141
2272 3300049651 Ga0501201_004108 Ga0501201_004108_79_504 141
2273 3300049652 Ga0501202_002581 Ga0501202_002581_627_1052 141
2274 3300049654 Ga0501207_001334 Ga0501207_001334_2624_3049 141
2275 3300049655 Ga0501208_014950 Ga0501208_014950_25_450 141
2276 3300049656 Ga0501209_000539 Ga0501209_000539_2882_3307 141
2277 3300049658 Ga0501211_000905 Ga0501211_000905_902_1327 141
2278 3300049660 Ga0501216_004848 Ga0501216_004848_1402_1827 141
2279 3300049666 Ga0501228_000274 Ga0501228_000274_2693_3118 141
2280 3300049667 Ga0501230_000123 Ga0501230_000123_156_581 141
2281 3300049670 Ga0501236_007457 Ga0501236_007457_599_1024 141
2282 3300049672 Ga0501239_000263 Ga0501239_000263_840_1265 141
2283 3300049672 Ga0501239_009315 Ga0501239_009315_621_1046 141
2284 3300049673 Ga0501240_077477 Ga0501240_077477_77_502 141
2285 3300049677 Ga0501247_003028 Ga0501247_003028_492_917 141
2286 3300049679 Ga0501249_001485 Ga0501249_001485_2999_3424 141
2287 3300049681 Ga0501251_000814 Ga0501251_000814_21_446 141
2288 3300049682 Ga0501252_001556 Ga0501252_001556_1232_1657 141
2289 3300049683 Ga0501253_000056 Ga0501253_000056_6781_7206 141
2290 3300049686 Ga0501257_028635 Ga0501257_028635_358_783 141
2291 3300049686 Ga0501257_103830 Ga0501257_103830_164_589 141
2292 3300049688 Ga0501259_025443 Ga0501259_025443_238_729 141
2293 3300049689 Ga0501260_000467 Ga0501260_000467_261_686 141
2294 3300049690 Ga0501261_000363 Ga0501261_000363_2432_2857 141
2295 3300049703 Ga0501219_003226 Ga0501219_003226_167_592 141
2296 3300049704 Ga0501221_001134 Ga0501221_001134_3002_3427 141
2297 3300049705 Ga0501225_0002251 Ga0501225_0002251_5121_5546 141
2298 3300049706 Ga0501229_000082 Ga0501229_000082_6766_7191 141
2299 3300049707 Ga0501234_000289 Ga0501234_000289_1809_2234 141
2300 3300049708 Ga0501245_038539 Ga0501245_038539_35_460 141
2301 3300049741 Ga0501079_0019241 Ga0501079_0019241_274_699 141
2302 3300049741 Ga0501079_0033531 Ga0501079_0033531_1999_2424 141
2303 3300049741 Ga0501079_0060533 Ga0501079_0060533_604_1029 141
2304 3300049741 Ga0501079_0146251 Ga0501079_0146251_707_1132 141
2305 3300049741 Ga0501079_0150311 Ga0501079_0150311_1117_1542 141
2306 3300049741 Ga0501079_0187932 Ga0501079_0187932_39_464 141
2307 3300049741 Ga0501079_0667119 Ga0501079_0667119_240_665 141
2308 3300049741 Ga0501079_0930768 Ga0501079_0930768_135_560 141
2309 3300049741 Ga0501079_0965285 Ga0501079_0965285_215_640 141
2310 3300049742 Ga0501080_0035459 Ga0501080_0035459_45_470 141
2311 3300049742 Ga0501080_0097121 Ga0501080_0097121_61_486 141
2312 3300049742 Ga0501080_0118564 Ga0501080_0118564_1398_1826 141
2313 3300049742 Ga0501080_0248500 Ga0501080_0248500_856_1281 141
2314 3300049742 Ga0501080_0259376 Ga0501080_0259376_984_1409 141
2315 3300049742 Ga0501080_0286173 Ga0501080_0286173_878_1303 141
2316 3300049742 Ga0501080_0579870 Ga0501080_0579870_439_864 141
2317 3300049742 Ga0501080_0593035 Ga0501080_0593035_274_699 141
2318 3300049743 Ga0501081_0006759 Ga0501081_0006759_1348_1776 141
2319 3300049743 Ga0501081_0022316 Ga0501081_0022316_2193_2618 141
2320 3300049743 Ga0501081_0025332 Ga0501081_0025332_2043_2468 141
2321 3300049743 Ga0501081_0089075 Ga0501081_0089075_125_550 141
2322 3300049743 Ga0501081_0353952 Ga0501081_0353952_60_485 141
2323 3300049743 Ga0501081_0578732 Ga0501081_0578732_392_817 141
2324 3300049744 Ga0501083_0091209 Ga0501083_0091209_68_496 141
2325 3300049744 Ga0501083_0116790 Ga0501083_0116790_621_1046 141
2326 3300049744 Ga0501083_0341467 Ga0501083_0341467_224_649 141
2327 3300049744 Ga0501083_0356589 Ga0501083_0356589_77_502 141
2328 3300049744 Ga0501083_0554030 Ga0501083_0554030_63_488 141
2329 3300049757 Ga0501232_011861 Ga0501232_011861_358_783 141
2330 3300049758 Ga0501241_012043 Ga0501241_012043_642_1067 141
2331 3300049761 Ga0501264_003563 Ga0501264_003563_485_910 141
2332 3300049762 Ga0501265_004230 Ga0501265_004230_554_979 141
2333 3300049763 Ga0501266_001760 Ga0501266_001760_1082_1507 141
2334 3300049763 Ga0501266_002235 Ga0501266_002235_1917_2342 141
2335 3300049765 Ga0501268_000911 Ga0501268_000911_293_718 141
2336 3300049768 Ga0501271_000172 Ga0501271_000172_1228_1653 141
2337 3300049769 Ga0501272_002436 Ga0501272_002436_1207_1632 141
2338 3300049770 Ga0501273_001201 Ga0501273_001201_1749_2174 141
2339 3300049771 Ga0501274_000707 Ga0501274_000707_1451_1876 141
2340 3300049772 Ga0501275_000572 Ga0501275_000572_363_788 141
2341 3300049773 Ga0501276_002427 Ga0501276_002427_426_851 141
2342 3300049775 Ga0501279_001069 Ga0501279_001069_1402_1827 141
2343 3300049776 Ga0501280_000659 Ga0501280_000659_5425_5850 141
2344 3300049777 Ga0501281_01603 Ga0501281_01603_807_1232 141
2345 3300049778 Ga0501282_005079 Ga0501282_005079_965_1390 141
2346 3300049779 Ga0501283_000955 Ga0501283_000955_522_947 141
2347 3300049822 Ga0501035_0157690 Ga0501035_0157690_603_1028 141
2348 3300049822 Ga0501035_0220120 Ga0501035_0220120_1177_1602 141
2349 3300049822 Ga0501035_0403284 Ga0501035_0403284_353_778 141
2350 3300049822 Ga0501035_0456002 Ga0501035_0456002_297_722 141
2351 3300049823 Ga0501044_1081626 Ga0501044_1081626_43_468 141
2352 3300049823 Ga0501044_1338417 Ga0501044_1338417_18_443 141
2353 3300049824 Ga0501045_0055520 Ga0501045_0055520_1751_2176 141
2354 3300049824 Ga0501045_0062422 Ga0501045_0062422_456_881 141
2355 3300049824 Ga0501045_0074014 Ga0501045_0074014_1670_2095 141
2356 3300049824 Ga0501045_0091753 Ga0501045_0091753_1232_1657 141
2357 3300049824 Ga0501045_0093478 Ga0501045_0093478_605_1030 141
2358 3300049824 Ga0501045_0096174 Ga0501045_0096174_519_944 141
2359 3300049824 Ga0501045_0136819 Ga0501045_0136819_12_440 141
2360 3300049824 Ga0501045_0366369 Ga0501045_0366369_141_566 141
2361 3300049824 Ga0501045_0489511 Ga0501045_0489511_309_734 141
2362 3300049824 Ga0501045_1397389 Ga0501045_1397389_17_442 141
2363 3300049851 Ga0501212_003040 Ga0501212_003040_567_992 141
2364 3300049853 Ga0501226_000129 Ga0501226_000129_11748_12173 141
2365 3300050489 nmdc:mga03683_115832_c1 nmdc:mga03683_115832_c1_85_510 141
2366 3300050492 nmdc:mga0yw44_163107_c1 nmdc:mga0yw44_163107_c1_238_663 141
2367 3300050492 nmdc:mga0yw44_629176_c1 nmdc:mga0yw44_629176_c1_82_507 141
2368 3300050507 nmdc:mga05p37_117232_c1 nmdc:mga05p37_117232_c1_2136_2561 141
2369 3300050507 nmdc:mga05p37_190879_c1 nmdc:mga05p37_190879_c1_317_742 141
2370 3300050507 nmdc:mga05p37_25219_c1 nmdc:mga05p37_25219_c1_1387_1815 141
2371 3300050507 nmdc:mga05p37_260629_c2 nmdc:mga05p37_260629_c2_561_986 141
2372 3300050507 nmdc:mga05p37_26424_c1 nmdc:mga05p37_26424_c1_1164_1589 141
2373 3300050507 nmdc:mga05p37_265854_c1 nmdc:mga05p37_265854_c1_1058_1483 141
2374 3300050507 nmdc:mga05p37_343133_c1 nmdc:mga05p37_343133_c1_1036_1461 141
2375 3300050507 nmdc:mga05p37_38754_c1 nmdc:mga05p37_38754_c1_4413_4838 141
2376 3300050507 nmdc:mga05p37_486765_c1 nmdc:mga05p37_486765_c1_430_855 141
2377 3300050507 nmdc:mga05p37_521066_c1 nmdc:mga05p37_521066_c1_704_1171 141
2378 3300050507 nmdc:mga05p37_524571_c1 nmdc:mga05p37_524571_c1_558_983 141
2379 3300050507 nmdc:mga05p37_777671_c1 nmdc:mga05p37_777671_c1_325_750 141
2380 3300050507 nmdc:mga05p37_950203_c1 nmdc:mga05p37_950203_c1_296_721 141
2381 3300050508 nmdc:mga09592_116447_c1 nmdc:mga09592_116447_c1_29_454 141
2382 3300050508 nmdc:mga09592_22191_c1 nmdc:mga09592_22191_c1_4517_4942 141
2383 3300050508 nmdc:mga09592_3324_c1 nmdc:mga09592_3324_c1_1398_1865 141
2384 3300050508 nmdc:mga09592_371838_c1 nmdc:mga09592_371838_c1_362_787 141
2385 3300050509 nmdc:mga0qj67_1014_c1 nmdc:mga0qj67_1014_c1_1046_1513 141
2386 3300050509 nmdc:mga0qj67_46647_c1 nmdc:mga0qj67_46647_c1_1356_1781 141
2387 3300050509 nmdc:mga0qj67_6401_c1 nmdc:mga0qj67_6401_c1_6961_7386 141
2388 3300050510 nmdc:mga06r32_11036_c1 nmdc:mga06r32_11036_c1_126_593 141
2389 3300050510 nmdc:mga06r32_14923_c1 nmdc:mga06r32_14923_c1_1272_1697 141
2390 3300050510 nmdc:mga06r32_329099_c1 nmdc:mga06r32_329099_c1_1023_1451 141
2391 3300050510 nmdc:mga06r32_367487_c1 nmdc:mga06r32_367487_c1_287_712 141
2392 3300050510 nmdc:mga06r32_623783_c1 nmdc:mga06r32_623783_c1_260_685 141
2393 3300050511 nmdc:mga08y16_19538_c1 nmdc:mga08y16_19538_c1_705_1130 141
2394 3300050511 nmdc:mga08y16_65151_c1 nmdc:mga08y16_65151_c1_2086_2511 141
2395 3300050511 nmdc:mga08y16_974389_c1 nmdc:mga08y16_974389_c1_173_598 141
2396 3300050512 nmdc:mga0n895_1601856_c1 nmdc:mga0n895_1601856_c1_20_445 141
2397 3300050512 nmdc:mga0n895_20924_c1 nmdc:mga0n895_20924_c1_4565_4990 141
2398 3300050512 nmdc:mga0n895_220821_c1 nmdc:mga0n895_220821_c1_163_588 141
2399 3300050512 nmdc:mga0n895_347639_c1 nmdc:mga0n895_347639_c1_380_805 141
2400 3300050512 nmdc:mga0n895_37549_c1 nmdc:mga0n895_37549_c1_517_942 141
2401 3300050512 nmdc:mga0n895_903334_c1 nmdc:mga0n895_903334_c1_403_828 141
2402 3300050512 nmdc:mga0n895_92986_c1 nmdc:mga0n895_92986_c1_626_1051 141
2403 3300050513 nmdc:mga0rr50_178102_c1 nmdc:mga0rr50_178102_c1_1272_1697 141
2404 3300050513 nmdc:mga0rr50_260439_c1 nmdc:mga0rr50_260439_c1_239_664 141
2405 3300050513 nmdc:mga0rr50_381365_c1 nmdc:mga0rr50_381365_c1_327_752 141
2406 3300050513 nmdc:mga0rr50_613998_c1 nmdc:mga0rr50_613998_c1_465_890 141
2407 3300050513 nmdc:mga0rr50_625424_c1 nmdc:mga0rr50_625424_c1_479_904 141
2408 3300050514 nmdc:mga08x19_1256887_c1 nmdc:mga08x19_1256887_c1_42_467 141
2409 3300050514 nmdc:mga08x19_138256_c1 nmdc:mga08x19_138256_c1_171_596 141
2410 3300050514 nmdc:mga08x19_235695_c1 nmdc:mga08x19_235695_c1_191_616 141
2411 3300050514 nmdc:mga08x19_523140_c1 nmdc:mga08x19_523140_c1_42_467 141
2412 3300050514 nmdc:mga08x19_913854_c1 nmdc:mga08x19_913854_c1_184_609 141
2413 3300050515 nmdc:mga0a205_200877_c2 nmdc:mga0a205_200877_c2_644_1069 141
2414 3300050515 nmdc:mga0a205_23945_c1 nmdc:mga0a205_23945_c1_759_1184 141
2415 3300050515 nmdc:mga0a205_24162_c1 nmdc:mga0a205_24162_c1_1441_1866 141
2416 3300050515 nmdc:mga0a205_2463_c1 nmdc:mga0a205_2463_c1_13273_13698 141
2417 3300050515 nmdc:mga0a205_545205_c1 nmdc:mga0a205_545205_c1_410_835 141
2418 3300050515 nmdc:mga0a205_62566_c1 nmdc:mga0a205_62566_c1_1258_1683 141
2419 3300050515 nmdc:mga0a205_83564_c1 nmdc:mga0a205_83564_c1_1226_1651 141
2420 3300050515 nmdc:mga0a205_836668_c1 nmdc:mga0a205_836668_c1_252_677 141
2421 3300050515 nmdc:mga0a205_957545_c1 nmdc:mga0a205_957545_c1_91_516 141
2422 3300050515 nmdc:mga0a205_972558_c1 nmdc:mga0a205_972558_c1_248_673 141
2423 3300053077 Ga0495601_0005585 Ga0495601_0005585_5987_6412 141
2424 3300053077 Ga0495601_0017386 Ga0495601_0017386_2344_2769 141
2425 3300053077 Ga0495601_0022243 Ga0495601_0022243_2302_2727 141
2426 3300053077 Ga0495601_0063259 Ga0495601_0063259_215_640 141
2427 3300053077 Ga0495601_0310902 Ga0495601_0310902_229_654 141
2428 3300053077 Ga0495601_0410332 Ga0495601_0410332_134_559 141
2429 3300053078 Ga0495612_0038924 Ga0495612_0038924_980_1405 141
2430 3300053084 Ga0495595_0014483 Ga0495595_0014483_1362_1787 141
2431 3300053084 Ga0495595_0028287 Ga0495595_0028287_278_703 141
2432 3300053084 Ga0495595_0210050 Ga0495595_0210050_34_459 141
2433 3300053084 Ga0495595_0391131 Ga0495595_0391131_216_641 141
2434 3300053085 Ga0495619_0004548 Ga0495619_0004548_411_836 141
2435 3300053085 Ga0495619_0042943 Ga0495619_0042943_876_1301 141
2436 3300053085 Ga0495619_0157294 Ga0495619_0157294_871_1296 141
2437 3300053085 Ga0495619_0185762 Ga0495619_0185762_481_906 141
2438 3300053085 Ga0495619_0626001 Ga0495619_0626001_82_507 141
2439 3300053104 Ga0500556_0000138 Ga0500556_0000138_868_1293 141
2440 3300053157 Ga0500624_002715 Ga0500624_002715_1625_2050 141
2441 3300053178 Ga0500637_0045088 Ga0500637_0045088_1559_1984 141
2442 3300053736 Ga0500599_000007 Ga0500599_000007_22410_22835 141
2443 3300054114 Ga0501084_0037447 Ga0501084_0037447_3028_3456 141
2444 3300054114 Ga0501084_0039544 Ga0501084_0039544_1101_1526 141
2445 3300054114 Ga0501084_0046030 Ga0501084_0046030_1320_1745 141
2446 3300054114 Ga0501084_0050245 Ga0501084_0050245_1006_1431 141
2447 3300054114 Ga0501084_0126336 Ga0501084_0126336_375_800 141
2448 3300054114 Ga0501084_0210828 Ga0501084_0210828_1142_1567 141
2449 3300054114 Ga0501084_0328148 Ga0501084_0328148_715_1140 141
2450 3300054114 Ga0501084_0344337 Ga0501084_0344337_41_466 141
2451 3300054114 Ga0501084_0349008 Ga0501084_0349008_502_927 141
2452 3300054114 Ga0501084_0369071 Ga0501084_0369071_485_910 141
2453 3300054114 Ga0501084_0382155 Ga0501084_0382155_676_1104 141
2454 3300054114 Ga0501084_0492744 Ga0501084_0492744_502_927 141
2455 3300054114 Ga0501084_0522911 Ga0501084_0522911_507_932 141
2456 3300054114 Ga0501084_0616465 Ga0501084_0616465_269_694 141
2457 3300054114 Ga0501084_1117089 Ga0501084_1117089_133_558 141
2458 3300059424 Ga0590075_010862 Ga0590075_010862_1613_2038 141
2459 3300059424 Ga0590075_021280 Ga0590075_021280_179_604 141
2460 3300059424 Ga0590075_116918 Ga0590075_116918_230_655 141
2461 3300059426 Ga0590077_102813 Ga0590077_102813_70_495 141
2462 3300059492 Ga0587073_0032691 Ga0587073_0032691_149_574 141
2463 3300059492 Ga0587073_0063111 Ga0587073_0063111_423_857 141
2464 3300059493 Ga0587077_025514 Ga0587077_025514_409_837 141
2465 3300059493 Ga0587077_062203 Ga0587077_062203_186_611 141
2466 3300059503 Ga0587080_077874 Ga0587080_077874_200_625 141
2467 3300059504 Ga0587082_013659 Ga0587082_013659_630_1055 141
2468 3300059504 Ga0587082_103352 Ga0587082_103352_116_541 141
2469 3300059505 Ga0587083_0016895 Ga0587083_0016895_63_488 141
2470 3300059506 Ga0587085_093235 Ga0587085_093235_81_506 141
2471 3300059506 Ga0587085_163265 Ga0587085_163265_28_453 141
2472 3300059507 Ga0587086_048315 Ga0587086_048315_108_533 141
2473 3300059508 Ga0587088_208858 Ga0587088_208858_45_470 141
2474 3300059509 Ga0587089_109700 Ga0587089_109700_51_476 141
2475 3300059512 Ga0587092_069526 Ga0587092_069526_181_606 141
2476 3300059513 Ga0587094_074758 Ga0587094_074758_56_481 141
2477 3300059605 Ga0587106_021680 Ga0587106_021680_460_885 141
2478 3300059622 Ga0587099_033797 Ga0587099_033797_35_460 141
2479 3300059622 Ga0587099_050038 Ga0587099_050038_106_531 141
2480 3300059623 Ga0587101_129979 Ga0587101_129979_39_482 141
2481 3300059624 Ga0587109_028251 Ga0587109_028251_169_597 141
2482 3300059624 Ga0587109_032284 Ga0587109_032284_266_691 141
2483 3300059624 Ga0587109_090174 Ga0587109_090174_179_604 141
2484 3300059627 Ga0587117_075674 Ga0587117_075674_149_577 141
2485 3300059630 Ga0587128_131274 Ga0587128_131274_74_499 141
2486 3300059631 Ga0587130_045768 Ga0587130_045768_28_453 141
2487 3300059639 Ga0587062_044819 Ga0587062_044819_183_626 141
2488 3300059640 Ga0587067_017299 Ga0587067_017299_52_477 141
2489 3300059640 Ga0587067_029086 Ga0587067_029086_150_575 141
2490 3300059640 Ga0587067_042609 Ga0587067_042609_108_533 141
2491 3300059641 Ga0587068_106105 Ga0587068_106105_122_547 141
2492 3300059644 Ga0587075_021557 Ga0587075_021557_343_768 141
2493 3300059644 Ga0587075_068584 Ga0587075_068584_140_565 141
2494 3300059645 Ga0587076_110413 Ga0587076_110413_28_453 141
2495 3300059646 Ga0587078_003548 Ga0587078_003548_1057_1482 141
2496 3300060353 Ga0501082_0036718 Ga0501082_0036718_1465_1890 141
2497 3300060353 Ga0501082_0046985 Ga0501082_0046985_1360_1785 141
2498 3300060353 Ga0501082_0057277 Ga0501082_0057277_773_1198 141
2499 3300060353 Ga0501082_0075898 Ga0501082_0075898_2028_2453 141
2500 3300060353 Ga0501082_0177278 Ga0501082_0177278_35_463 141
2501 3300060353 Ga0501082_0319552 Ga0501082_0319552_417_842 141
2502 3300060353 Ga0501082_0688065 Ga0501082_0688065_66_491 141
2503 3300060353 Ga0501082_1281614 Ga0501082_1281614_125_550 141
2504 3300061734 Ga0530510_0011210 Ga0530510_0011210_3607_4032 141
2505 3300061734 Ga0530510_0015703 Ga0530510_0015703_2850_3275 141
2506 3300061734 Ga0530510_0054013 Ga0530510_0054013_1255_1680 141
2507 3300061734 Ga0530510_0062704 Ga0530510_0062704_1479_1904 141
2508 3300061734 Ga0530510_0093204 Ga0530510_0093204_393_818 141
2509 3300061734 Ga0530510_0295279 Ga0530510_0295279_473_898 141
2510 3300061734 Ga0530510_0421061 Ga0530510_0421061_291_716 141
2511 3300061734 Ga0530510_0457339 Ga0530510_0457339_159_587 141
2512 3300061734 Ga0530510_0514600 Ga0530510_0514600_199_624 141
2513 3300061734 Ga0530510_0602309 Ga0530510_0602309_226_651 141
2514 3300061734 Ga0530510_0898370 Ga0530510_0898370_173_598 141
2515 3300061734 Ga0530510_0931005 Ga0530510_0931005_151_576 141
2516 3300061734 Ga0530510_1244471 Ga0530510_1244471_129_554 141

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03946

Ribosomal_L11_N

Ribosomal protein L11, N-terminal domain

31

88

0.99

PF00298

Ribosomal_L11

Ribosomal protein L11, RNA binding domain

93

160

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3egv-assembly1.cif.gz_B ribosomal protein l11 methyltransferase (prma) in complex with trimethylated ribosomal protein l11 0.9852 3 76
1mms-assembly2.cif.gz_B crystal structure of the ribosomal protein l11-rna complex 0.9789 71 140
3cjt-assembly4.cif.gz_H ribosomal protein l11 methyltransferase (prma) in complex with dimethylated ribosomal protein l11 0.9787 2 72
1y39-assembly2.cif.gz_B co-evolution of protein and rna structures within a highly conserved ribosomal domain 0.968 71 141
5gae-assembly1.cif.gz_J rnc in complex with a translocating secyeg 0.9672 71 140
ID Description Score Start End Superfamily
3egvB00 Alpha Beta;2-Layer Sandwich;Ribosomal protein L11, N-terminal domain;Ribosomal protein L11/L12, N-terminal domain 0.9852 3 76 3.30.1550.10
af_A0A0R4J4M9_4_71_3.30.1550.10 Alpha Beta;2-Layer Sandwich;Ribosomal protein L11, N-terminal domain;Ribosomal protein L11/L12, N-terminal domain 0.977 2 67 3.30.1550.10
af_I1J9L7_135_215_1.10.10.250 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Ribosomal protein L11/L12, C-terminal domain 0.9708 72 139 1.10.10.250
1vq4I00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Ribosomal protein L11/L12, C-terminal domain 0.9564 73 140 1.10.10.250
2qa4I02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Ribosomal protein L11/L12, C-terminal domain 0.9493 72 134 1.10.10.250
ID Description Score Start End GO Terms
AF-A0A7J4E0X6-F1-model_v4 deleted 1.007 1 69
AF-A0A2D7JF69-F1-model_v4 50S ribosomal protein L11 1.006 1 71 GO:0003735
GO:0006412
GO:0022625
GO:0070180
AF-A0A2N2LDD6-F1-model_v4 50S ribosomal protein L11 1.003 1 72 GO:0003735
GO:0006412
GO:0022625
GO:0070180
AF-A0A2S9F9H5-F1-model_v4 50S ribosomal protein L11 0.9994 3 74 GO:0003735
GO:0006412
GO:0022625
GO:0070180
AF-A0A5N9EE46-F1-model_v4 50S ribosomal protein L11 0.9977 1 67 GO:0003735
GO:0006412
GO:0022625
GO:0070180

Feature Viewer

pLDDT pTM Quality
91.09 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map