F496829

General Info

Members Datasets Scaffolds Average Seq Length
2466 842 2221 194

Family's Representative Sequence

Representative Sequence 3300025961|Ga0207712_10538583|Ga0207712_105385832
Length 220
Sequence MADKMKASIRKIATFVEETRSEMGHAVNPPTRRAAAVAVIENPCAGKYVEDLSELMLIGEELGELLTQRAVAALGIPATAVESYGKAAAVGENGELEHAAAILHPKLGAPVRKVLGKGAALIPSSKKRGGLGVALDIPLGHKDAAFVRSHFDGMEVRINDAPRANEIMVAVAVTDSGRPLPRVGGLTKGEDSISKASQVIGDGGASWRAKVCYCTSSGRR

Samples

Sample ID Description Type Environment
1 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
4 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
5 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
6 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
7 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
8 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
9 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
10 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
11 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
12 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
13 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
14 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
15 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
16 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
17 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
18 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
19 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
20 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
21 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
22 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
23 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
24 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
25 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
26 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
27 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
28 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
29 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
30 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
31 2643221736 Bosea sp. Root483D1 Isolate Unclassified
32 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
33 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
34 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
35 2738543024 Aminobacter sp. AP02 Isolate Unclassified
36 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
37 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
38 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
39 2791355199
40 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
41 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
42 2818991467 Bosea vestrisii 3192 Isolate Unclassified
43 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
44 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
45 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
46 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
47 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
48 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
49 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
50 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
51 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
52 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
53 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
54 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
55 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
56 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
57 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
58 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
59 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
60 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
61 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
62 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
63 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
64 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
65 2841760612 Bosea sp. Tri-49 Isolate Nodule
66 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
67 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
68 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
69 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
70 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
71 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
72 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
73 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
74 2844104063 Bosea sp. Tri-39 Isolate Nodule
75 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
76 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
77 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
78 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
79 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
80 2851182111 Bosea sp. Tri-44 Isolate Nodule
81 2851246043 Bosea sp. Tri-54 Isolate Nodule
82 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
83 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
84 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
85 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
86 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
87 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
88 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
89 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
90 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
91 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
92 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
93 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
94 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
95 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
96 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
97 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
98 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
99 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
100 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
101 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
102 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
103 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
104 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
105 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
106 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
107 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
108 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
109 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
110 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
111 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
112 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
113 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
114 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
115 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
116 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
117 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
118 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
119 2904699407
120 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
121 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
122 2906610324
123 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
124 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
125 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
126 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
127 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
128 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
129 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
130 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
131 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
132 2922368715
133 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
134 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
135 2922425934
136 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
137 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
138 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
139 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
140 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
141 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
142 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
143 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
144 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
145 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
146 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
147 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
148 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
149 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
150 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
151 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
152 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
153 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
154 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
155 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
156 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
157 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
158 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
159 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
160 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
161 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
162 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
163 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
164 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
165 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
166 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
167 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
168 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
169 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
170 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
171 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
172 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
173 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
174 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
175 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
176 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
177 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
178 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
179 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
180 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
181 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
182 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
183 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
184 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
185 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
186 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
187 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
188 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
189 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
190 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
191 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
192 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
193 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
194 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
195 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
196 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
197 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
198 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
199 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
200 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
201 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
202 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
203 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
204 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
205 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
206 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
207 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
208 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
209 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
210 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
211 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
212 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
213 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
214 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
215 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
216 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
217 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
218 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
219 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
220 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
221 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
222 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
223 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
224 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
225 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
226 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
227 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
228 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
229 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
230 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
231 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
232 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
233 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
234 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
235 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
236 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
237 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
238 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
239 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
240 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
241 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
242 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
243 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
244 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
245 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
246 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
247 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
248 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
249 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
250 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
251 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
252 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
253 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
254 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
255 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
256 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
257 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
258 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
259 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
260 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
261 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
262 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
263 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
264 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
265 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
266 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
267 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
268 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
269 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
270 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
271 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
272 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
273 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
274 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
275 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
276 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
277 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
278 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
279 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
280 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
281 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
282 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
283 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
284 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
285 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
286 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
287 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
288 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
289 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
290 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
291 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
292 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
293 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
294 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
295 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
296 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
297 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
298 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
299 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
300 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
301 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
302 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
303 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
304 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
305 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
306 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
307 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
308 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
309 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
310 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
311 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
312 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
313 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
314 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
315 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
316 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
317 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
318 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
319 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
320 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
321 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
322 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
323 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
324 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
325 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
326 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
327 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
328 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
329 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
330 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
331 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
332 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
333 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
334 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
335 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
336 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
337 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
338 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
339 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
340 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
341 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
342 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
343 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
344 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
345 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
346 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
347 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
348 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
349 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
350 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
351 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
352 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
353 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
354 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
355 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
356 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
357 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
358 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
359 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
360 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
361 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
362 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
363 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
364 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
365 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
366 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
367 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
368 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
369 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
370 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
371 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
372 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
373 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
374 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
375 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
376 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
377 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
378 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
379 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
380 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
381 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
382 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
383 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
384 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
385 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
386 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
387 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
388 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
389 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
390 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
391 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
392 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
393 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
394 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
395 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
396 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
397 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
398 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
399 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
400 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
401 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
402 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
403 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
404 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
405 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
406 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
407 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
408 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
409 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
410 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
411 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
412 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
413 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
414 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
415 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
416 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
417 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
418 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
419 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
420 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
421 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
422 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
423 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
424 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
425 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
426 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
427 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
428 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
429 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
430 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
431 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
432 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
433 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
434 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
435 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
436 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
437 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
438 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
439 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
440 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
441 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
442 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
443 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
444 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
445 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
446 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
447 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
448 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
449 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
450 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
451 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
452 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
453 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
454 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
455 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
456 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
457 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
458 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
459 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
460 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
461 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
462 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
463 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
464 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
465 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
466 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
467 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
468 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
469 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
470 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
471 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
472 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
473 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
474 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
475 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
476 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
477 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
478 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
479 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
480 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
481 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
482 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
483 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
484 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
485 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
486 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
487 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
488 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
489 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
490 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
491 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
492 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
493 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
494 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
495 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
496 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
497 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
498 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
499 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
500 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
501 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
502 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
503 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
504 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
505 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
506 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
507 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
508 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
509 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
510 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
511 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
512 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
513 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
514 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
515 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
516 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
517 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
518 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
519 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
520 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
521 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
522 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
523 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
524 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
525 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
526 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
527 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
528 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
529 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
530 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
531 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
532 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
533 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
534 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
535 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
536 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
537 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
538 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
539 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
540 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
541 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
542 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
543 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
544 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
545 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
546 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
547 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
548 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
549 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
550 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
551 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
552 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
553 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
554 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
555 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
556 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
557 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
558 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
559 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
560 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
561 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
562 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
563 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
564 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
565 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
566 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
567 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
568 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
569 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
570 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
571 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
572 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
573 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
574 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
575 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
576 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
577 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
578 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
579 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
580 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
581 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
582 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
583 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
584 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
585 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
586 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
587 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
588 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
589 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
590 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
591 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
592 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
593 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
594 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
595 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
596 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
597 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
598 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
599 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
600 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
601 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
602 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
603 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
604 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
605 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
606 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
607 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
608 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
609 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
610 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
611 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
612 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
613 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
614 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
615 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
616 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
617 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
618 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
619 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
620 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
621 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
622 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
623 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
624 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
625 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
626 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
627 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
628 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
629 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
630 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
631 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
632 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
633 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
634 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
635 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
636 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
637 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
638 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
639 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
640 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
641 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
642 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
643 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
644 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
645 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
646 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
647 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
648 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
649 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
650 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
651 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
652 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
653 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
654 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
655 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
656 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
657 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
658 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
659 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
660 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
661 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
662 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
663 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
664 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
665 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
666 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
667 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
668 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
669 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
670 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
671 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
672 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
673 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
674 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
675 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
676 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
677 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
678 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
679 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
680 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
681 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
682 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
683 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
684 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
685 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
686 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
687 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
688 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
689 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
690 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
691 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
692 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
693 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
694 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
695 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
696 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
697 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
698 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
699 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
700 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
701 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
702 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
703 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
704 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
705 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
706 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
707 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
708 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
709 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
710 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
711 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
712 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
713 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
714 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
715 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
716 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
717 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
718 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
719 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
720 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
721 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
722 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
723 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
724 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
725 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
726 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
727 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
728 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
729 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
730 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
731 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
732 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
733 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
734 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
735 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
736 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
737 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
738 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
739 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
740 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
741 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
742 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
743 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
744 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
745 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
746 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
747 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
748 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
749 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
750 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
751 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
752 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
753 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
754 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
755 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
756 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
757 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
758 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
759 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
760 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
761 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
762 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
763 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
764 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
765 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
766 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
767 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
768 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
769 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
770 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
771 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
772 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
773 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
774 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
775 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
776 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
777 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
778 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
779 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
780 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
781 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
782 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
783 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
784 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
785 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
786 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
787 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
788 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
789 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
790 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
791 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
792 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
793 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
794 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
795 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
796 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
797 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
798 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
799 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
800 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
801 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
802 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
803 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
804 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
805 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
806 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
807 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
808 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
809 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
810 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
811 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
812 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
813 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
814 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
815 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
816 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
817 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
818 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
819 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
820 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
821 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
822 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
823 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
824 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
825 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
826 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
827 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
828 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
829 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
830 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
831 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
832 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
833 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
834 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
835 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
836 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
837 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
838 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
839 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
840 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
841 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule
842 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.88
Metatranscriptomes 0.37
Isolates 9.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.04
Nodule 7.79
Rhizoplane 6.37
Rhizosphere 69.06
Stem 0
Stem Tuber 0
Unclassified 7.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 RicEn_C2269 2010549000 Bacteria 1221
2 MBSR1b_contig_5045328 2162886012 Unclassified 1120
3 LJNas_1000946 3300000546 Bacteria 4650
4 JGI24752J21851_1018463 3300001976 Unclassified 910
5 JGI24739J22299_10080285 3300001989 Bacteria 1003
6 JGI24034J26672_10002423 3300002239 Unclassified 2563
7 JGI24751J29686_10065522 3300002459 Bacteria 748
8 JGI25406J46586_10000019 3300003203 Bacteria 87589
9 JGI25406J46586_10012828 3300003203 Bacteria 3621
10 JGI25406J46586_10022155 3300003203 Bacteria 2538
11 JGI25153J46596_10000613 3300003215 Bacteria 21789
12 JGI25153J46596_10002769 3300003215 Bacteria 9965
13 JGI25153J46596_10006245 3300003215 Bacteria 6092
14 JGI25153J46596_10027034 3300003215 Bacteria 2018
15 JGI25153J46596_10079285 3300003215 Bacteria 824
16 JGI25153J46596_10086105 3300003215 Bacteria 771
17 JGI25160J50197_1004404 3300003354 Bacteria 6099
18 JGI25160J50197_1007770 3300003354 Bacteria 4157
19 JGI25160J50197_1014797 3300003354 Bacteria 2590
20 Ga0006562J51391_1048774 3300003578 Bacteria 2460
21 JGI25404J52841_10008986 3300003659 Bacteria 2135
22 Ga0055539_1017655 3300003752 Bacteria 862
23 Ga0055542_1006987 3300003762 Bacteria 2344
24 Ga0055524_1028578 3300003775 Bacteria 1668
25 Ga0055531_10004023 3300003794 Bacteria 9120
26 Ga0055543_1002866 3300004625 Bacteria 5433
27 Ga0055543_1035217 3300004625 Bacteria 861
28 Ga0065165_1000509 3300005262 Bacteria 59789
29 Ga0065165_1002034 3300005262 Bacteria 18805
30 Ga0065165_1002156 3300005262 Bacteria 17812
31 Ga0065165_1041981 3300005262 Bacteria 1353
32 Ga0065165_1042144 3300005262 Bacteria 1349
33 Ga0065165_1111117 3300005262 Bacteria 674
34 Ga0065715_10016860 3300005293 Unclassified 2476
35 Ga0065715_10331384 3300005293 Bacteria 983
36 Ga0065707_10111491 3300005295 Bacteria 2393
37 Ga0070658_10019858 3300005327 Bacteria 5382
38 Ga0070658_10039308 3300005327 Bacteria 3816
39 Ga0070658_10479420 3300005327 Bacteria 1073
40 Ga0070658_10490982 3300005327 Bacteria 1060
41 Ga0070658_10735628 3300005327 Bacteria 857
42 Ga0070676_10407231 3300005328 Bacteria 948
43 Ga0070676_10919157 3300005328 Bacteria 653
44 Ga0070683_100023255 3300005329 Bacteria 5542
45 Ga0070683_100025031 3300005329 Bacteria 5354
46 Ga0070683_100082867 3300005329 Bacteria 3004
47 Ga0070690_100062226 3300005330 Bacteria 2406
48 Ga0070670_100049799 3300005331 Unclassified 3601
49 Ga0070670_100321858 3300005331 Bacteria 1355
50 Ga0070670_100351186 3300005331 Bacteria 1295
51 Ga0070670_100424440 3300005331 Bacteria 1176
52 Ga0070677_10034970 3300005333 Unclassified 1944
53 Ga0068869_100057698 3300005334 Unclassified 2835
54 Ga0068869_100235503 3300005334 Bacteria 1456
55 Ga0070666_10025588 3300005335 Bacteria 3848
56 Ga0070666_10067509 3300005335 Bacteria 2428
57 Ga0070666_10305384 3300005335 Bacteria 1134
58 Ga0070666_10633034 3300005335 Bacteria 782
59 Ga0070680_100053378 3300005336 Bacteria 3300
60 Ga0070680_100134040 3300005336 Bacteria 2074
61 Ga0070680_100274943 3300005336 Bacteria 1426
62 Ga0070680_100300662 3300005336 Bacteria 1361
63 Ga0070680_100528708 3300005336 Bacteria 1010
64 Ga0070682_100052898 3300005337 Bacteria 2543
65 Ga0070682_100057006 3300005337 Bacteria 2460
66 Ga0070682_100255564 3300005337 Bacteria 1265
67 Ga0068868_100008525 3300005338 Bacteria 7339
68 Ga0068868_100009673 3300005338 Bacteria 6958
69 Ga0068868_100066009 3300005338 Unclassified 2876
70 Ga0068868_100076891 3300005338 Bacteria 2669
71 Ga0068868_100295980 3300005338 Bacteria 1373
72 Ga0070660_100014947 3300005339 Bacteria 5600
73 Ga0070660_100015839 3300005339 Bacteria 5457
74 Ga0070660_100643481 3300005339 Bacteria 888
75 Ga0070689_100048729 3300005340 Unclassified 3268
76 Ga0070689_100240864 3300005340 Bacteria 1490
77 Ga0070689_100266568 3300005340 Bacteria 1417
78 Ga0070689_100459408 3300005340 Bacteria 1085
79 Ga0070691_10076545 3300005341 Bacteria 1631
80 Ga0070691_10117534 3300005341 Bacteria 1336
81 Ga0070687_100009775 3300005343 Unclassified 4121
82 Ga0070661_100046375 3300005344 Unclassified 3179
83 Ga0070661_100104658 3300005344 Bacteria 2109
84 Ga0070661_100118401 3300005344 Bacteria 1982
85 Ga0070661_100254225 3300005344 Bacteria 1357
86 Ga0070661_100288953 3300005344 Bacteria 1274
87 Ga0070668_100030851 3300005347 Bacteria 4079
88 Ga0070668_100090764 3300005347 Bacteria 2407
89 Ga0070668_100150511 3300005347 Unclassified 1881
90 Ga0070668_100184993 3300005347 Bacteria 1703
91 Ga0070668_100204147 3300005347 Bacteria 1623
92 Ga0070668_100226336 3300005347 Bacteria 1545
93 Ga0070668_100250657 3300005347 Bacteria 1469
94 Ga0070668_100314695 3300005347 Bacteria 1316
95 Ga0070668_100596667 3300005347 Bacteria 966
96 Ga0070669_100022105 3300005353 Plasmid 4549
97 Ga0070669_100181034 3300005353 Bacteria 1649
98 Ga0070675_100142775 3300005354 Bacteria 2047
99 Ga0070675_100572766 3300005354 Unclassified 1022
100 Ga0070675_100676945 3300005354 Bacteria 939
101 Ga0070671_100056246 3300005355 Bacteria 3273
102 Ga0070671_100199205 3300005355 Bacteria 1698
103 Ga0070671_100287688 3300005355 Unclassified 1398
104 Ga0070671_100456112 3300005355 Bacteria 1097
105 Ga0070671_100506647 3300005355 Bacteria 1038
106 Ga0070671_100875959 3300005355 Bacteria 784
107 Ga0070674_100023279 3300005356 Unclassified 4007
108 Ga0070674_100043189 3300005356 Bacteria 3065
109 Ga0070674_100111580 3300005356 Bacteria 2008
110 Ga0070673_100074758 3300005364 Bacteria 2731
111 Ga0070688_100029760 3300005365 Unclassified 3272
112 Ga0070688_100288965 3300005365 Bacteria 1181
113 Ga0070659_100015051 3300005366 Bacteria 5786
114 Ga0070659_100213211 3300005366 Bacteria 1592
115 Ga0070659_100242003 3300005366 Bacteria 1493
116 Ga0070667_100029892 3300005367 Bacteria 4542
117 Ga0070667_100139676 3300005367 Bacteria 2120
118 Ga0070667_100178997 3300005367 Bacteria 1875
119 Ga0070667_100465446 3300005367 Bacteria 1156
120 Ga0070667_100593834 3300005367 Bacteria 1020
121 Ga0070667_100847974 3300005367 Bacteria 849
122 Ga0070709_10001083 3300005434 Bacteria 15083
123 Ga0070709_10002717 3300005434 Bacteria 9561
124 Ga0070709_10033515 3300005434 Bacteria 3107
125 Ga0070709_10085390 3300005434 Bacteria 2070
126 Ga0070709_10089494 3300005434 Bacteria 2027
127 Ga0070709_10109381 3300005434 Bacteria 1855
128 Ga0070709_10401687 3300005434 Bacteria 1023
129 Ga0070714_100001660 3300005435 Bacteria 16190
130 Ga0070714_100015456 3300005435 Bacteria 6142
131 Ga0070714_100059272 3300005435 Bacteria 3282
132 Ga0070714_100101373 3300005435 Bacteria 2537
133 Ga0070714_100182900 3300005435 Bacteria 1908
134 Ga0070714_100313716 3300005435 Bacteria 1465
135 Ga0070714_100367167 3300005435 Bacteria 1354
136 Ga0070714_100407529 3300005435 Bacteria 1286
137 Ga0070714_100416267 3300005435 Bacteria 1272
138 Ga0070714_100454779 3300005435 Bacteria 1217
139 Ga0070714_100555182 3300005435 Bacteria 1100
140 Ga0070714_100702469 3300005435 Bacteria 976
141 Ga0070713_100001545 3300005436 Bacteria 14712
142 Ga0070713_100008761 3300005436 Bacteria 7198
143 Ga0070713_100025417 3300005436 Bacteria 4630
144 Ga0070713_100053065 3300005436 Bacteria 3358
145 Ga0070713_100059519 3300005436 Bacteria 3190
146 Ga0070713_100109729 3300005436 Bacteria 2404
147 Ga0070713_100118871 3300005436 Bacteria 2315
148 Ga0070713_100127150 3300005436 Bacteria 2243
149 Ga0070713_100182802 3300005436 Bacteria 1885
150 Ga0070713_100212834 3300005436 Bacteria 1751
151 Ga0070713_100262741 3300005436 Bacteria 1578
152 Ga0070713_100287648 3300005436 Bacteria 1510
153 Ga0070713_100492566 3300005436 Bacteria 1156
154 Ga0070710_10000726 3300005437 Bacteria 15703
155 Ga0070710_10002079 3300005437 Bacteria 9489
156 Ga0070710_10005882 3300005437 Bacteria 5856
157 Ga0070710_10008674 3300005437 Bacteria 4954
158 Ga0070710_10012838 3300005437 Bacteria 4174
159 Ga0070710_10052870 3300005437 Bacteria 2286
160 Ga0070710_10056197 3300005437 Bacteria 2227
161 Ga0070710_10090608 3300005437 Bacteria 1803
162 Ga0070710_10424909 3300005437 Unclassified 896
163 Ga0070701_10037978 3300005438 Unclassified 2434
164 Ga0070701_10296496 3300005438 Bacteria 992
165 Ga0070711_100000331 3300005439 Bacteria 24358
166 Ga0070711_100002577 3300005439 Bacteria 10375
167 Ga0070711_100003388 3300005439 Bacteria 9287
168 Ga0070711_100006561 3300005439 Bacteria 7020
169 Ga0070711_100010091 3300005439 Bacteria 5835
170 Ga0070711_100017738 3300005439 Bacteria 4535
171 Ga0070711_100017822 3300005439 Bacteria 4525
172 Ga0070711_100019407 3300005439 Bacteria 4361
173 Ga0070711_100029656 3300005439 Bacteria 3612
174 Ga0070711_100079988 3300005439 Bacteria 2326
175 Ga0070711_100126075 3300005439 Bacteria 1901
176 Ga0070711_100136258 3300005439 Bacteria 1835
177 Ga0070711_100139630 3300005439 Bacteria 1815
178 Ga0070711_100529271 3300005439 Bacteria 975
179 Ga0070711_100683826 3300005439 Bacteria 863
180 Ga0070700_100229070 3300005441 Bacteria 1321
181 Ga0070700_100589122 3300005441 Bacteria 869
182 Ga0070700_100796181 3300005441 Bacteria 761
183 Ga0070694_100453577 3300005444 Bacteria 1013
184 Ga0070708_100000649 3300005445 Bacteria 26308
185 Ga0070708_100003946 3300005445 Bacteria 11647
186 Ga0070708_100014726 3300005445 Bacteria 6443
187 Ga0070708_100050654 3300005445 Bacteria 3678
188 Ga0070708_100077471 3300005445 Bacteria 3004
189 Ga0070663_100012111 3300005455 Bacteria 5444
190 Ga0070663_100038301 3300005455 Unclassified 3344
191 Ga0070663_100044626 3300005455 Bacteria 3127
192 Ga0070663_100176837 3300005455 Bacteria 1653
193 Ga0070663_100236106 3300005455 Bacteria 1442
194 Ga0070663_100289058 3300005455 Bacteria 1309
195 Ga0070663_100450637 3300005455 Bacteria 1060
196 Ga0070678_100087719 3300005456 Bacteria 2377
197 Ga0070678_100089402 3300005456 Unclassified 2357
198 Ga0070678_100090023 3300005456 Bacteria 2350
199 Ga0070678_100157151 3300005456 Bacteria 1838
200 Ga0070678_100288794 3300005456 Bacteria 1389
201 Ga0070678_101010466 3300005456 Bacteria 765
202 Ga0070662_100024253 3300005457 Plasmid 4177
203 Ga0070662_100186147 3300005457 Bacteria 1639
204 Ga0070662_100765225 3300005457 Bacteria 820
205 Ga0070681_10011285 3300005458 Bacteria 8837
206 Ga0070681_10071383 3300005458 Bacteria 3437
207 Ga0070681_10119263 3300005458 Bacteria 2574
208 Ga0070681_10123439 3300005458 Bacteria 2522
209 Ga0070681_10231882 3300005458 Bacteria 1761
210 Ga0070681_10560285 3300005458 Bacteria 1056
211 Ga0070681_10641961 3300005458 Bacteria 976
212 Ga0068867_100021264 3300005459 Plasmid 4630
213 Ga0068867_100087946 3300005459 Bacteria 2354
214 Ga0068867_101390156 3300005459 Bacteria 651
215 Ga0070685_10019815 3300005466 Unclassified 3634
216 Ga0070685_10119364 3300005466 Bacteria 1636
217 Ga0070706_100000744 3300005467 Bacteria 36621
218 Ga0070706_100005201 3300005467 Bacteria 12410
219 Ga0070706_100094091 3300005467 Bacteria 2781
220 Ga0070706_100447608 3300005467 Bacteria 1202
221 Ga0070707_100001340 3300005468 Bacteria 24225
222 Ga0070707_100018278 3300005468 Bacteria 6597
223 Ga0070707_100089822 3300005468 Bacteria 2973
224 Ga0070707_100551142 3300005468 Bacteria 1115
225 Ga0070707_101007820 3300005468 Bacteria 798
226 Ga0070707_101166599 3300005468 Unclassified 736
227 Ga0070698_100000590 3300005471 Bacteria 39001
228 Ga0070698_100014123 3300005471 Bacteria 8445
229 Ga0070698_100392457 3300005471 Bacteria 1321
230 Ga0070698_100764366 3300005471 Bacteria 910
231 Ga0070699_100000178 3300005518 Bacteria 61351
232 Ga0070699_100001656 3300005518 Bacteria 20334
233 Ga0070699_100015169 3300005518 Bacteria 6620
234 Ga0070699_100156870 3300005518 Bacteria 2014
235 Ga0070699_100194365 3300005518 Bacteria 1803
236 Ga0070699_100373856 3300005518 Bacteria 1286
237 Ga0070699_100385709 3300005518 Bacteria 1265
238 Ga0070699_100501328 3300005518 Bacteria 1103
239 Ga0070679_100018615 3300005530 Bacteria 6742
240 Ga0070679_100035187 3300005530 Bacteria 4968
241 Ga0070679_100066794 3300005530 Bacteria 3585
242 Ga0070679_100176110 3300005530 Bacteria 2111
243 Ga0070679_100213737 3300005530 Bacteria 1891
244 Ga0070679_100274063 3300005530 Bacteria 1641
245 Ga0070679_100276077 3300005530 Bacteria 1634
246 Ga0070679_100320432 3300005530 Bacteria 1499
247 Ga0070679_100905048 3300005530 Bacteria 826
248 Ga0070684_100005731 3300005535 Bacteria 9545
249 Ga0070684_100044893 3300005535 Bacteria 3825
250 Ga0070684_100134961 3300005535 Bacteria 2228
251 Ga0070684_100447588 3300005535 Bacteria 1194
252 Ga0070697_100000127 3300005536 Bacteria 60778
253 Ga0070697_100000455 3300005536 Bacteria 31443
254 Ga0070697_100012595 3300005536 Bacteria 6624
255 Ga0070697_100018555 3300005536 Bacteria 5486
256 Ga0070697_100055399 3300005536 Bacteria 3224
257 Ga0070697_100593993 3300005536 Bacteria 973
258 Ga0068853_100037739 3300005539 Bacteria 4112
259 Ga0068853_100083579 3300005539 Bacteria 2797
260 Ga0068853_100177222 3300005539 Bacteria 1932
261 Ga0068853_100202991 3300005539 Bacteria 1804
262 Ga0068853_100282448 3300005539 Bacteria 1530
263 Ga0068853_100289969 3300005539 Unclassified 1511
264 Ga0068853_100390138 3300005539 Bacteria 1302
265 Ga0068853_100401584 3300005539 Bacteria 1283
266 Ga0068853_100657657 3300005539 Bacteria 998
267 Ga0070672_100010216 3300005543 Bacteria 6503
268 Ga0070672_100326873 3300005543 Bacteria 1304
269 Ga0070672_100356305 3300005543 Bacteria 1248
270 Ga0070672_100447169 3300005543 Bacteria 1113
271 Ga0070672_100513352 3300005543 Bacteria 1038
272 Ga0070672_100518252 3300005543 Bacteria 1033
273 Ga0070686_100082469 3300005544 Bacteria 2132
274 Ga0070686_100710185 3300005544 Bacteria 803
275 Ga0070695_100160327 3300005545 Bacteria 1578
276 Ga0070695_100213540 3300005545 Bacteria 1386
277 Ga0070695_100221942 3300005545 Bacteria 1362
278 Ga0070695_100455004 3300005545 Bacteria 982
279 Ga0070696_100146500 3300005546 Bacteria 1730
280 Ga0070696_100257273 3300005546 Bacteria 1322
281 Ga0070696_100350872 3300005546 Bacteria 1143
282 Ga0070696_100539998 3300005546 Bacteria 933
283 Ga0070693_100221187 3300005547 Bacteria 1241
284 Ga0070693_100245198 3300005547 Bacteria 1185
285 Ga0070693_100316936 3300005547 Bacteria 1057
286 Ga0070693_100645766 3300005547 Bacteria 769
287 Ga0070665_100020157 3300005548 Bacteria 6694
288 Ga0070665_100036803 3300005548 Bacteria 4921
289 Ga0070665_100185614 3300005548 Bacteria 2080
290 Ga0070665_100433509 3300005548 Bacteria 1323
291 Ga0070665_101370563 3300005548 Bacteria 716
292 Ga0070704_100444118 3300005549 Bacteria 1115
293 Ga0070704_100483722 3300005549 Bacteria 1071
294 Ga0068855_100049708 3300005563 Bacteria 4944
295 Ga0068855_100052317 3300005563 Bacteria 4808
296 Ga0068855_100066996 3300005563 Bacteria 4185
297 Ga0068855_100067697 3300005563 Bacteria 4159
298 Ga0068855_100185575 3300005563 Bacteria 2349
299 Ga0068855_100389688 3300005563 Bacteria 1528
300 Ga0068855_100428807 3300005563 Bacteria 1445
301 Ga0068855_100546802 3300005563 Bacteria 1254
302 Ga0068855_100551588 3300005563 Bacteria 1247
303 Ga0070664_100015233 3300005564 Bacteria 6284
304 Ga0070664_100093702 3300005564 Bacteria 2603
305 Ga0070664_100147082 3300005564 Bacteria 2078
306 Ga0070664_100248952 3300005564 Bacteria 1597
307 Ga0070664_100480089 3300005564 Unclassified 1144
308 Ga0070664_100536902 3300005564 Bacteria 1080
309 Ga0068857_100056516 3300005577 Unclassified 3482
310 Ga0068857_100084315 3300005577 Bacteria 2839
311 Ga0068857_100100949 3300005577 Bacteria 2589
312 Ga0068857_100150992 3300005577 Bacteria 2104
313 Ga0068857_100857879 3300005577 Unclassified 869
314 Ga0068854_100047119 3300005578 Unclassified 3071
315 Ga0068854_100222002 3300005578 Bacteria 1495
316 Ga0068854_100475949 3300005578 Bacteria 1048
317 Ga0068856_100001908 3300005614 Bacteria 21735
318 Ga0068856_100004533 3300005614 Bacteria 13815
319 Ga0068856_100068608 3300005614 Unclassified 3505
320 Ga0068856_100125503 3300005614 Bacteria 2570
321 Ga0068856_100245049 3300005614 Bacteria 1807
322 Ga0068856_100292806 3300005614 Bacteria 1645
323 Ga0068856_100299814 3300005614 Bacteria 1625
324 Ga0068856_100630269 3300005614 Bacteria 1093
325 Ga0068856_100723472 3300005614 Bacteria 1015
326 Ga0068856_101154067 3300005614 Bacteria 791
327 Ga0070702_100003415 3300005615 Bacteria 7100
328 Ga0070702_100019562 3300005615 Bacteria 3534
329 Ga0070702_100354427 3300005615 Bacteria 1035
330 Ga0068852_100006500 3300005616 Bacteria 8450
331 Ga0068852_100010249 3300005616 Bacteria 6990
332 Ga0068852_100063394 3300005616 Bacteria 3218
333 Ga0068852_100157579 3300005616 Bacteria 2117
334 Ga0068852_100259722 3300005616 Unclassified 1667
335 Ga0068852_100493989 3300005616 Bacteria 1218
336 Ga0068852_100680119 3300005616 Bacteria 1038
337 Ga0068859_100041554 3300005617 Unclassified 4618
338 Ga0068859_100055546 3300005617 Bacteria 3984
339 Ga0068859_100067414 3300005617 Bacteria 3613
340 Ga0068859_100166183 3300005617 Bacteria 2286
341 Ga0068859_100286238 3300005617 Bacteria 1741
342 Ga0068864_100025741 3300005618 Unclassified 4959
343 Ga0068864_100123186 3300005618 Bacteria 2321
344 Ga0068864_100160193 3300005618 Bacteria 2045
345 Ga0068864_100939497 3300005618 Bacteria 855
346 Ga0068866_10020431 3300005718 Bacteria 3034
347 Ga0068866_10293201 3300005718 Bacteria 1013
348 Ga0068861_100072449 3300005719 Bacteria 2673
349 Ga0068851_10097919 3300005834 Unclassified 1552
350 Ga0068851_10200853 3300005834 Bacteria 1112
351 Ga0068870_10001691 3300005840 Bacteria 9012
352 Ga0068870_10325528 3300005840 Bacteria 978
353 Ga0068863_100035161 3300005841 Unclassified 4773
354 Ga0068863_100124446 3300005841 Bacteria 2460
355 Ga0068863_100475361 3300005841 Bacteria 1228
356 Ga0068858_100017267 3300005842 Bacteria 6769
357 Ga0068858_100054622 3300005842 Bacteria 3693
358 Ga0068858_100222584 3300005842 Bacteria 1787
359 Ga0068858_100714287 3300005842 Bacteria 976
360 Ga0068860_100000213 3300005843 Bacteria 91105
361 Ga0068860_100094458 3300005843 Bacteria 2850
362 Ga0068860_100228894 3300005843 Bacteria 1806
363 Ga0068860_100260764 3300005843 Bacteria 1689
364 Ga0068860_100317139 3300005843 Bacteria 1530
365 Ga0068860_100591405 3300005843 Bacteria 1114
366 Ga0068860_101346130 3300005843 Bacteria 735
367 Ga0068862_100018959 3300005844 Bacteria 5734
368 Ga0068862_100055174 3300005844 Unclassified 3403
369 Ga0068862_100108061 3300005844 Bacteria 2439
370 Ga0068862_100283311 3300005844 Bacteria 1519
371 Ga0068862_100325225 3300005844 Bacteria 1420
372 Ga0068862_100379285 3300005844 Bacteria 1318
373 Ga0081455_10005931 3300005937 Bacteria 13260
374 Ga0081455_10007164 3300005937 Bacteria 11793
375 Ga0081455_10073251 3300005937 Bacteria 2833
376 Ga0081455_10077607 3300005937 Bacteria 2732
377 Ga0081538_10116586 3300005981 Bacteria 1295
378 Ga0081540_1005943 3300005983 Bacteria 9008
379 Ga0081540_1008063 3300005983 Bacteria 7404
380 Ga0081540_1010718 3300005983 Bacteria 6177
381 Ga0081540_1011457 3300005983 Bacteria 5923
382 Ga0081540_1026578 3300005983 Bacteria 3300
383 Ga0081540_1028276 3300005983 Bacteria 3153
384 Ga0081540_1028376 3300005983 Bacteria 3144
385 Ga0081540_1037129 3300005983 Bacteria 2587
386 Ga0081540_1042937 3300005983 Bacteria 2326
387 Ga0081540_1094095 3300005983 Bacteria 1310
388 Ga0081540_1134147 3300005983 Bacteria 1005
389 Ga0081539_10000003 3300005985 Bacteria 594833
390 Ga0081539_10000199 3300005985 Bacteria 139305
391 Ga0081539_10008928 3300005985 Bacteria 8547
392 Ga0081539_10035474 3300005985 Bacteria 2997
393 Ga0070717_10002399 3300006028 Bacteria 13217
394 Ga0070717_10015462 3300006028 Bacteria 5896
395 Ga0070717_10022714 3300006028 Bacteria 4960
396 Ga0070717_10109952 3300006028 Bacteria 2350
397 Ga0070717_10197372 3300006028 Bacteria 1761
398 Ga0070717_10216611 3300006028 Bacteria 1682
399 Ga0070717_10236455 3300006028 Bacteria 1610
400 Ga0070717_10260320 3300006028 Bacteria 1535
401 Ga0070717_10319783 3300006028 Bacteria 1382
402 Ga0070717_10361075 3300006028 Bacteria 1300
403 Ga0070717_10473031 3300006028 Bacteria 1131
404 Ga0070717_10542546 3300006028 Bacteria 1053
405 Ga0070717_10552382 3300006028 Bacteria 1043
406 Ga0075365_10008592 3300006038 Bacteria 5813
407 Ga0075365_10182993 3300006038 Bacteria 1465
408 Ga0075365_10368915 3300006038 Bacteria 1012
409 Ga0075368_10020037 3300006042 Bacteria 2529
410 Ga0075368_10131358 3300006042 Bacteria 1041
411 Ga0075368_10338557 3300006042 Bacteria 653
412 Ga0075363_100033317 3300006048 Bacteria 2681
413 Ga0075363_100035848 3300006048 Bacteria 2598
414 Ga0075364_10056522 3300006051 Bacteria 2569
415 Ga0075364_10079455 3300006051 Bacteria 2167
416 Ga0070715_10001847 3300006163 Bacteria 6332
417 Ga0070715_10007524 3300006163 Bacteria 3753
418 Ga0070715_10010006 3300006163 Bacteria 3365
419 Ga0070716_100000955 3300006173 Bacteria 12539
420 Ga0070716_100006597 3300006173 Bacteria 5674
421 Ga0070716_100040256 3300006173 Bacteria 2599
422 Ga0070716_100072629 3300006173 Bacteria 2026
423 Ga0070716_100108611 3300006173 Bacteria 1715
424 Ga0070716_100241745 3300006173 Bacteria 1225
425 Ga0070716_100634195 3300006173 Bacteria 808
426 Ga0070712_100001046 3300006175 Bacteria 16713
427 Ga0070712_100001471 3300006175 Bacteria 14373
428 Ga0070712_100001601 3300006175 Bacteria 13837
429 Ga0070712_100002799 3300006175 Bacteria 10781
430 Ga0070712_100002958 3300006175 Bacteria 10518
431 Ga0070712_100006314 3300006175 Bacteria 7347
432 Ga0070712_100131223 3300006175 Bacteria 1899
433 Ga0070712_100182158 3300006175 Bacteria 1638
434 Ga0070712_100185103 3300006175 Bacteria 1626
435 Ga0070712_100276278 3300006175 Bacteria 1352
436 Ga0075362_10263576 3300006177 Bacteria 850
437 Ga0075367_10025647 3300006178 Bacteria 3335
438 Ga0075367_10060008 3300006178 Bacteria 2266
439 Ga0075367_10330670 3300006178 Bacteria 961
440 Ga0075369_10024803 3300006186 Bacteria 2488
441 Ga0075369_10069254 3300006186 Bacteria 1551
442 Ga0075366_10020960 3300006195 Bacteria 3798
443 Ga0075366_10158167 3300006195 Bacteria 1373
444 Ga0075366_10247863 3300006195 Bacteria 1086
445 Ga0075366_10645740 3300006195 Bacteria 657
446 Ga0097621_100029624 3300006237 Bacteria 4325
447 Ga0097621_100238125 3300006237 Unclassified 1590
448 Ga0075370_10034321 3300006353 Bacteria 2844
449 Ga0075370_10036633 3300006353 Bacteria 2756
450 Ga0075370_10040554 3300006353 Bacteria 2626
451 Ga0075370_10390225 3300006353 Bacteria 834
452 Ga0068871_100001342 3300006358 Bacteria 16460
453 Ga0068871_100049954 3300006358 Unclassified 3382
454 Ga0068871_100233060 3300006358 Bacteria 1598
455 Ga0068871_100272575 3300006358 Bacteria 1478
456 Ga0068871_100313924 3300006358 Bacteria 1378
457 Ga0068871_101235116 3300006358 Bacteria 701
458 Ga0075428_100087585 3300006844 Bacteria 3396
459 Ga0075431_100032321 3300006847 Bacteria 5392
460 Ga0075433_10003606 3300006852 Bacteria 11964
461 Ga0075433_10003976 3300006852 Bacteria 11440
462 Ga0075434_100000136 3300006871 Bacteria 44550
463 Ga0075434_100000632 3300006871 Bacteria 27249
464 Ga0075434_100008890 3300006871 Bacteria 9350
465 Ga0075434_100021169 3300006871 Bacteria 6320
466 Ga0075434_100232663 3300006871 Bacteria 1862
467 Ga0075434_100583905 3300006871 Bacteria 1137
468 Ga0075434_100925747 3300006871 Bacteria 886
469 Ga0075434_101281998 3300006871 Bacteria 744
470 Ga0068865_100002158 3300006881 Bacteria 11592
471 Ga0068865_100079062 3300006881 Bacteria 2354
472 Ga0068865_100091960 3300006881 Bacteria 2203
473 Ga0068865_100596873 3300006881 Bacteria 933
474 Ga0075436_100003564 3300006914 Bacteria 10677
475 Ga0075436_100064183 3300006914 Bacteria 2538
476 Ga0075436_100251296 3300006914 Bacteria 1259
477 Ga0075436_100256733 3300006914 Bacteria 1246
478 Ga0097620_100041553 3300006931 Unclassified 4618
479 Ga0097620_100055550 3300006931 Bacteria 3984
480 Ga0097620_100067415 3300006931 Bacteria 3613
481 Ga0097620_100166187 3300006931 Bacteria 2286
482 Ga0097620_100286248 3300006931 Bacteria 1741
483 Ga0099825_1027213 3300006941 Bacteria 2935
484 Ga0099825_1034631 3300006941 Bacteria 1864
485 Ga0099824_1025369 3300006942 Bacteria 3256
486 Ga0099822_1003531 3300006943 Bacteria 20044
487 Ga0075435_100001721 3300007076 Bacteria 14220
488 Ga0075435_100034404 3300007076 Bacteria 4015
489 Ga0075435_100054879 3300007076 Bacteria 3217
490 Ga0075435_100205743 3300007076 Bacteria 1668
491 Ga0075435_100541841 3300007076 Bacteria 1007
492 Ga0075435_100604367 3300007076 Bacteria 951
493 Ga0099794_10012570 3300007265 Bacteria 3658
494 Ga0099794_10176205 3300007265 Bacteria 1091
495 Ga0099794_10231202 3300007265 Bacteria 951
496 Ga0099795_10007914 3300007788 Bacteria 2998
497 Ga0099795_10022641 3300007788 Bacteria 2076
498 Ga0099795_10189135 3300007788 Bacteria 863
499 Ga0099795_10190384 3300007788 Bacteria 861
500 Ga0105240_10029222 3300009093 Bacteria 7188
501 Ga0105240_10034523 3300009093 Bacteria 6523
502 Ga0105240_10047668 3300009093 Bacteria 5421
503 Ga0105240_10064004 3300009093 Bacteria 4571
504 Ga0105240_10423030 3300009093 Bacteria 1496
505 Ga0105240_10587217 3300009093 Bacteria 1228
506 Ga0111539_10188696 3300009094 Bacteria 2406
507 Ga0111539_10209354 3300009094 Bacteria 2272
508 Ga0105245_10024567 3300009098 Bacteria 5293
509 Ga0105245_10050676 3300009098 Bacteria 3721
510 Ga0105245_10079782 3300009098 Bacteria 2989
511 Ga0105245_10111308 3300009098 Bacteria 2546
512 Ga0105245_10156379 3300009098 Bacteria 2159
513 Ga0105247_10027421 3300009101 Bacteria 3444
514 Ga0105247_10031330 3300009101 Unclassified 3227
515 Ga0105247_10037405 3300009101 Bacteria 2962
516 Ga0105247_10245822 3300009101 Bacteria 1221
517 Ga0105247_10286021 3300009101 Bacteria 1139
518 Ga0105247_10417006 3300009101 Bacteria 960
519 Ga0114129_10017885 3300009147 Bacteria 10091
520 Ga0114129_10098831 3300009147 Bacteria 4040
521 Ga0114129_10124072 3300009147 Bacteria 3552
522 Ga0114129_10268778 3300009147 Bacteria 2282
523 Ga0105243_10070915 3300009148 Bacteria 2815
524 Ga0105243_10245000 3300009148 Bacteria 1597
525 Ga0105243_10532677 3300009148 Bacteria 1119
526 Ga0105243_10599672 3300009148 Bacteria 1060
527 Ga0105243_10861817 3300009148 Bacteria 898
528 Ga0105241_10016613 3300009174 Bacteria 5401
529 Ga0105241_10020565 3300009174 Unclassified 4877
530 Ga0105241_10093062 3300009174 Bacteria 2381
531 Ga0105241_10110280 3300009174 Bacteria 2201
532 Ga0105241_10136918 3300009174 Bacteria 1989
533 Ga0105241_10242872 3300009174 Bacteria 1523
534 Ga0105241_10753080 3300009174 Bacteria 893
535 Ga0105241_10783554 3300009174 Bacteria 877
536 Ga0105242_10021558 3300009176 Bacteria 5061
537 Ga0105242_10398268 3300009176 Bacteria 1284
538 Ga0105242_10745382 3300009176 Bacteria 964
539 Ga0105242_10809568 3300009176 Unclassified 928
540 Ga0105248_10063141 3300009177 Bacteria 4157
541 Ga0105248_10143085 3300009177 Unclassified 2698
542 Ga0105248_10199139 3300009177 Bacteria 2256
543 Ga0105248_10324368 3300009177 Bacteria 1734
544 Ga0105248_10389370 3300009177 Bacteria 1569
545 Ga0105248_10454323 3300009177 Bacteria 1444
546 Ga0105248_10705765 3300009177 Bacteria 1138
547 Ga0105248_12159383 3300009177 Bacteria 633
548 Ga0105237_10026354 3300009545 Bacteria 5941
549 Ga0105237_10037340 3300009545 Bacteria 4912
550 Ga0105237_10096082 3300009545 Bacteria 2953
551 Ga0105237_10128323 3300009545 Bacteria 2530
552 Ga0105237_10144015 3300009545 Bacteria 2378
553 Ga0105237_10312916 3300009545 Bacteria 1573
554 Ga0105237_10513954 3300009545 Bacteria 1204
555 Ga0105237_10807764 3300009545 Bacteria 945
556 Ga0105238_10003681 3300009551 Bacteria 15277
557 Ga0105238_10021608 3300009551 Bacteria 6554
558 Ga0105238_10081331 3300009551 Bacteria 3229
559 Ga0105238_10130968 3300009551 Bacteria 2486
560 Ga0105238_10190362 3300009551 Bacteria 2028
561 Ga0105238_10257162 3300009551 Bacteria 1725
562 Ga0105238_10455330 3300009551 Bacteria 1277
563 Ga0105238_10625070 3300009551 Bacteria 1086
564 Ga0105238_11337437 3300009551 Bacteria 743
565 Ga0105249_10259318 3300009553 Unclassified 1727
566 Ga0105249_10406893 3300009553 Bacteria 1392
567 Ga0105249_10663097 3300009553 Bacteria 1101
568 Ga0105249_10766054 3300009553 Bacteria 1028
569 Ga0105249_11036404 3300009553 Bacteria 890
570 Ga0105033_101807 3300009986 Bacteria 1764
571 Ga0099796_10029746 3300010159 Bacteria 1766
572 Ga0099796_10030525 3300010159 Bacteria 1750
573 Ga0099796_10154648 3300010159 Bacteria 905
574 Ga0105239_10020985 3300010375 Bacteria 7208
575 Ga0105239_10022484 3300010375 Bacteria 6952
576 Ga0105239_10065549 3300010375 Bacteria 3989
577 Ga0105239_10068406 3300010375 Bacteria 3903
578 Ga0105239_10070205 3300010375 Bacteria 3847
579 Ga0105239_10077996 3300010375 Bacteria 3646
580 Ga0105239_10085098 3300010375 Bacteria 3484
581 Ga0105239_10099166 3300010375 Bacteria 3220
582 Ga0105239_10162882 3300010375 Bacteria 2493
583 Ga0105239_10248118 3300010375 Bacteria 1999
584 Ga0105239_10258518 3300010375 Bacteria 1957
585 Ga0105239_10291795 3300010375 Bacteria 1836
586 Ga0105239_10402519 3300010375 Bacteria 1549
587 Ga0105239_10545007 3300010375 Bacteria 1321
588 Ga0105239_10591341 3300010375 Bacteria 1265
589 Ga0105239_10680424 3300010375 Bacteria 1176
590 Ga0105239_10848811 3300010375 Bacteria 1047
591 Ga0105239_11211853 3300010375 Bacteria 870
592 Ga0105239_11410370 3300010375 Bacteria 804
593 Ga0105246_10008035 3300011119 Bacteria 6474
594 Ga0105246_10042239 3300011119 Bacteria 3087
595 Ga0105246_10228924 3300011119 Bacteria 1462
596 Ga0105246_10364989 3300011119 Bacteria 1188
597 Ga0105246_10687438 3300011119 Bacteria 895
598 Ga0105246_11265083 3300011119 Bacteria 682
599 Ga0157323_1024153 3300012495 Bacteria 602
600 Ga0157373_10022626 3300013100 Bacteria 4559
601 Ga0157373_10052636 3300013100 Bacteria 2896
602 Ga0157373_10170385 3300013100 Bacteria 1532
603 Ga0157373_10190638 3300013100 Bacteria 1445
604 Ga0157371_10102520 3300013102 Bacteria 2030
605 Ga0157371_10170984 3300013102 Unclassified 1553
606 Ga0157371_10316211 3300013102 Bacteria 1132
607 Ga0157370_10188965 3300013104 Bacteria 1912
608 Ga0157370_10284870 3300013104 Bacteria 1526
609 Ga0157370_10334140 3300013104 Bacteria 1397
610 Ga0157370_10473561 3300013104 Bacteria 1151
611 Ga0157370_10537267 3300013104 Bacteria 1072
612 Ga0157369_10002009 3300013105 Bacteria 24521
613 Ga0157369_10065211 3300013105 Bacteria 3920
614 Ga0157369_10112613 3300013105 Bacteria 2890
615 Ga0157369_10205229 3300013105 Bacteria 2067
616 Ga0157369_10262336 3300013105 Bacteria 1802
617 Ga0157369_10612490 3300013105 Bacteria 1124
618 Ga0157369_10766620 3300013105 Bacteria 992
619 Ga0157369_10808939 3300013105 Bacteria 963
620 Ga0157369_10984947 3300013105 Bacteria 863
621 Ga0157374_10021426 3300013296 Bacteria 5751
622 Ga0157374_10029759 3300013296 Bacteria 4951
623 Ga0157374_10036334 3300013296 Bacteria 4511
624 Ga0157374_10046727 3300013296 Bacteria 4011
625 Ga0157374_10085622 3300013296 Bacteria 2997
626 Ga0157374_10276341 3300013296 Bacteria 1657
627 Ga0157374_10486156 3300013296 Bacteria 1238
628 Ga0157374_10586466 3300013296 Bacteria 1124
629 Ga0157374_11269005 3300013296 Bacteria 758
630 Ga0157374_11409442 3300013296 Bacteria 720
631 Ga0157378_10005885 3300013297 Bacteria 10742
632 Ga0157378_10089371 3300013297 Unclassified 2797
633 Ga0157378_10208073 3300013297 Bacteria 1854
634 Ga0157378_10396594 3300013297 Bacteria 1359
635 Ga0157378_10658846 3300013297 Bacteria 1063
636 Ga0157378_10727221 3300013297 Bacteria 1014
637 Ga0163162_10020742 3300013306 Bacteria 6460
638 Ga0163162_10042840 3300013306 Bacteria 4532
639 Ga0163162_10075872 3300013306 Bacteria 3423
640 Ga0163162_10363461 3300013306 Bacteria 1580
641 Ga0163162_10484396 3300013306 Bacteria 1368
642 Ga0163162_10688047 3300013306 Bacteria 1145
643 Ga0163162_11451149 3300013306 Bacteria 781
644 Ga0157372_10007630 3300013307 Bacteria 11502
645 Ga0157372_10016818 3300013307 Bacteria 7853
646 Ga0157372_10025627 3300013307 Bacteria 6415
647 Ga0157372_10207445 3300013307 Bacteria 2271
648 Ga0157372_10247008 3300013307 Bacteria 2071
649 Ga0157372_10437633 3300013307 Bacteria 1524
650 Ga0157375_10030198 3300013308 Bacteria 5108
651 Ga0157375_10192808 3300013308 Unclassified 2193
652 Ga0157375_10196032 3300013308 Bacteria 2175
653 Ga0157375_11688217 3300013308 Bacteria 750
654 Ga0163163_10013064 3300014325 Bacteria 7584
655 Ga0163163_10016615 3300014325 Bacteria 6842
656 Ga0163163_10028233 3300014325 Bacteria 5386
657 Ga0163163_10056064 3300014325 Bacteria 3895
658 Ga0163163_10126036 3300014325 Unclassified 2599
659 Ga0163163_10254181 3300014325 Bacteria 1808
660 Ga0163163_10278639 3300014325 Bacteria 1724
661 Ga0163163_10351936 3300014325 Bacteria 1529
662 Ga0163163_10466726 3300014325 Bacteria 1323
663 Ga0163163_10545663 3300014325 Bacteria 1222
664 Ga0163163_10835494 3300014325 Bacteria 984
665 Ga0157380_10049727 3300014326 Bacteria 3308
666 Ga0157380_10078956 3300014326 Unclassified 2686
667 Ga0157380_10732410 3300014326 Bacteria 998
668 Ga0182008_10270651 3300014497 Bacteria 881
669 Ga0157377_10004855 3300014745 Bacteria 6251
670 Ga0157379_10002961 3300014968 Bacteria 14325
671 Ga0157379_10109090 3300014968 Bacteria 2485
672 Ga0157379_10121242 3300014968 Bacteria 2352
673 Ga0157379_10151476 3300014968 Bacteria 2092
674 Ga0157379_10180586 3300014968 Bacteria 1907
675 Ga0157379_10321160 3300014968 Bacteria 1414
676 Ga0157379_10544725 3300014968 Bacteria 1079
677 Ga0157379_10549396 3300014968 Bacteria 1074
678 Ga0157379_10913192 3300014968 Bacteria 833
679 Ga0157379_11520741 3300014968 Bacteria 652
680 Ga0157376_10105608 3300014969 Bacteria 2470
681 Ga0157376_10154785 3300014969 Bacteria 2071
682 Ga0157376_10186713 3300014969 Unclassified 1898
683 Ga0182007_10035887 3300015262 Bacteria 1670
684 Ga0163161_10087419 3300017792 Bacteria 2302
685 Ga0163161_10674334 3300017792 Bacteria 859
686 Ga0206354_10972822 3300020081 Bacteria 889
687 Ga0206353_10577094 3300020082 Bacteria 2489
688 Ga0214544_1000002 3300021320 Bacteria 753857
689 Ga0214542_1000001 3300021321 Bacteria 1018696
690 Ga0214545_1000001 3300021324 Bacteria 1092817
691 Ga0214543_1000001 3300021327 Bacteria 776921
692 Ga0213872_10043815 3300021361 Bacteria 2038
693 Ga0213874_10119551 3300021377 Bacteria 894
694 Ga0213876_10013768 3300021384 Bacteria 4286
695 Ga0213876_10033823 3300021384 Bacteria 2695
696 Ga0213876_10097220 3300021384 Bacteria 1560
697 Ga0213876_10120657 3300021384 Bacteria 1392
698 Ga0213875_10006485 3300021388 Bacteria 6136
699 Ga0213875_10114681 3300021388 Bacteria 1259
700 Ga0213875_10288178 3300021388 Bacteria 776
701 Ga0213871_10021775 3300021441 Bacteria 1601
702 Ga0213871_10122920 3300021441 Bacteria 775
703 Ga0224712_10020465 3300022467 Bacteria 2247
704 Ga0224569_100324 3300022732 Bacteria 4049
705 Ga0224571_100055 3300022734 Bacteria 3884
706 Ga0224572_1003956 3300024225 Bacteria 2541
707 Ga0224572_1015545 3300024225 Bacteria 1458
708 Ga0228598_1000345 3300024227 Bacteria 9163
709 Ga0228598_1000387 3300024227 Bacteria 8827
710 Ga0228598_1034168 3300024227 Bacteria 1002
711 Ga0209563_101866 3300025230 Bacteria 5126
712 Ga0207425_1003455 3300025245 Bacteria 5053
713 Ga0209677_102108 3300025253 Bacteria 7820
714 Ga0209677_105443 3300025253 Bacteria 3318
715 Ga0209148_1000500 3300025254 Bacteria 39994
716 Ga0209233_1001496 3300025261 Bacteria 9193
717 Ga0209233_1002337 3300025261 Bacteria 7062
718 Ga0209233_1012236 3300025261 Bacteria 2493
719 Ga0209233_1018269 3300025261 Bacteria 1890
720 Ga0209455_1004034 3300025272 Bacteria 4967
721 Ga0209455_1005592 3300025272 Bacteria 3856
722 Ga0209455_1006056 3300025272 Bacteria 3634
723 Ga0209455_1016743 3300025272 Bacteria 1564
724 Ga0209673_1010584 3300025273 Bacteria 3873
725 Ga0209130_1000246 3300025284 Bacteria 68572
726 Ga0209130_1000536 3300025284 Bacteria 38224
727 Ga0209676_1019647 3300025292 Bacteria 2319
728 Ga0209025_1001140 3300025294 Bacteria 37934
729 Ga0209025_1004941 3300025294 Bacteria 11194
730 Ga0209025_1031507 3300025294 Bacteria 2506
731 Ga0209564_1006742 3300025295 Bacteria 6097
732 Ga0209564_1008759 3300025295 Bacteria 4933
733 Ga0209758_1000024 3300025297 Bacteria 591966
734 Ga0209758_1000068 3300025297 Bacteria 286488
735 Ga0209758_1000169 3300025297 Bacteria 149782
736 Ga0209758_1002409 3300025297 Bacteria 19162
737 Ga0209758_1011950 3300025297 Bacteria 4938
738 Ga0209758_1023458 3300025297 Bacteria 2789
739 Ga0209758_1066478 3300025297 Bacteria 1158
740 Ga0209256_1006433 3300025299 Bacteria 6224
741 Ga0209256_1025580 3300025299 Bacteria 1715
742 Ga0207426_1000092 3300025302 Bacteria 278907
743 Ga0207426_1000238 3300025302 Bacteria 124393
744 Ga0207426_1002351 3300025302 Bacteria 12330
745 Ga0207426_1033857 3300025302 Bacteria 1643
746 Ga0207426_1052300 3300025302 Bacteria 1210
747 Ga0209257_1000640 3300025304 Bacteria 55997
748 Ga0209257_1001699 3300025304 Bacteria 24723
749 Ga0209257_1010441 3300025304 Bacteria 4698
750 Ga0207697_10006461 3300025315 Bacteria 5303
751 Ga0207697_10194740 3300025315 Bacteria 890
752 Ga0207656_10023120 3300025321 Unclassified 2500
753 Ga0207656_10052624 3300025321 Bacteria 1764
754 Ga0207656_10101155 3300025321 Bacteria 1322
755 Ga0207653_10022358 3300025885 Bacteria 2008
756 Ga0207692_10000763 3300025898 Bacteria 11404
757 Ga0207692_10000845 3300025898 Bacteria 10979
758 Ga0207692_10003883 3300025898 Bacteria 5870
759 Ga0207692_10010529 3300025898 Bacteria 3902
760 Ga0207692_10015295 3300025898 Bacteria 3373
761 Ga0207692_10023349 3300025898 Bacteria 2859
762 Ga0207692_10043469 3300025898 Bacteria 2236
763 Ga0207692_10183120 3300025898 Bacteria 1221
764 Ga0207692_10225774 3300025898 Bacteria 1112
765 Ga0207692_10318242 3300025898 Bacteria 951
766 Ga0207642_10316498 3300025899 Bacteria 910
767 Ga0207710_10042394 3300025900 Unclassified 2021
768 Ga0207710_10094509 3300025900 Bacteria 1403
769 Ga0207710_10129870 3300025900 Bacteria 1209
770 Ga0207710_10244497 3300025900 Bacteria 896
771 Ga0207688_10060955 3300025901 Unclassified 2126
772 Ga0207688_10107334 3300025901 Bacteria 1618
773 Ga0207688_10268322 3300025901 Bacteria 1037
774 Ga0207680_10022128 3300025903 Bacteria 3452
775 Ga0207680_10366578 3300025903 Bacteria 1014
776 Ga0207647_10006516 3300025904 Bacteria 8486
777 Ga0207647_10025481 3300025904 Bacteria 3884
778 Ga0207685_10016489 3300025905 Bacteria 2366
779 Ga0207685_10020039 3300025905 Bacteria 2215
780 Ga0207685_10027690 3300025905 Bacteria 1987
781 Ga0207685_10081238 3300025905 Bacteria 1342
782 Ga0207699_10000406 3300025906 Bacteria 22137
783 Ga0207699_10008314 3300025906 Bacteria 5115
784 Ga0207699_10024323 3300025906 Bacteria 3311
785 Ga0207699_10038107 3300025906 Bacteria 2752
786 Ga0207699_10052591 3300025906 Bacteria 2412
787 Ga0207699_10093028 3300025906 Bacteria 1897
788 Ga0207699_10192711 3300025906 Bacteria 1376
789 Ga0207699_10232734 3300025906 Bacteria 1262
790 Ga0207699_10270051 3300025906 Bacteria 1178
791 Ga0207699_10285392 3300025906 Bacteria 1148
792 Ga0207699_10704563 3300025906 Bacteria 739
793 Ga0207645_10001364 3300025907 Bacteria 20051
794 Ga0207645_10076723 3300025907 Bacteria 2141
795 Ga0207645_10375637 3300025907 Bacteria 953
796 Ga0207643_10003304 3300025908 Bacteria 8710
797 Ga0207643_10199760 3300025908 Bacteria 1217
798 Ga0207705_10073369 3300025909 Bacteria 2483
799 Ga0207705_10087315 3300025909 Bacteria 2281
800 Ga0207705_10289063 3300025909 Bacteria 1256
801 Ga0207705_10481719 3300025909 Bacteria 963
802 Ga0207705_10496024 3300025909 Bacteria 948
803 Ga0207705_10599024 3300025909 Bacteria 857
804 Ga0207684_10000229 3300025910 Bacteria 85591
805 Ga0207684_10000766 3300025910 Bacteria 37331
806 Ga0207654_10021290 3300025911 Bacteria 3446
807 Ga0207654_10025006 3300025911 Bacteria 3216
808 Ga0207654_10076452 3300025911 Bacteria 2004
809 Ga0207654_10130575 3300025911 Bacteria 1590
810 Ga0207654_10189313 3300025911 Bacteria 1347
811 Ga0207707_10000173 3300025912 Bacteria 67122
812 Ga0207707_10011453 3300025912 Bacteria 7724
813 Ga0207707_10043008 3300025912 Bacteria 3942
814 Ga0207707_10104297 3300025912 Bacteria 2478
815 Ga0207707_10487143 3300025912 Bacteria 1053
816 Ga0207695_10000008 3300025913 Bacteria 1058268
817 Ga0207695_10006864 3300025913 Bacteria 14654
818 Ga0207695_10023272 3300025913 Bacteria 7006
819 Ga0207695_10033658 3300025913 Bacteria 5584
820 Ga0207695_10049084 3300025913 Bacteria 4452
821 Ga0207695_10059623 3300025913 Bacteria 3956
822 Ga0207695_10397517 3300025913 Bacteria 1263
823 Ga0207695_10404169 3300025913 Bacteria 1250
824 Ga0207671_10006585 3300025914 Bacteria 10311
825 Ga0207671_10011165 3300025914 Bacteria 7335
826 Ga0207671_10192261 3300025914 Bacteria 1592
827 Ga0207671_10524323 3300025914 Bacteria 945
828 Ga0207671_10783091 3300025914 Bacteria 757
829 Ga0207693_10000170 3300025915 Bacteria 58902
830 Ga0207693_10000553 3300025915 Bacteria 33791
831 Ga0207693_10000950 3300025915 Bacteria 25981
832 Ga0207693_10001388 3300025915 Bacteria 21472
833 Ga0207693_10002846 3300025915 Bacteria 14982
834 Ga0207693_10006997 3300025915 Bacteria 9315
835 Ga0207693_10033683 3300025915 Bacteria 4041
836 Ga0207693_10043859 3300025915 Bacteria 3516
837 Ga0207693_10098302 3300025915 Bacteria 2295
838 Ga0207693_10140403 3300025915 Bacteria 1900
839 Ga0207663_10000515 3300025916 Bacteria 16967
840 Ga0207663_10003582 3300025916 Bacteria 7621
841 Ga0207663_10004881 3300025916 Bacteria 6715
842 Ga0207663_10020404 3300025916 Bacteria 3752
843 Ga0207663_10029753 3300025916 Bacteria 3212
844 Ga0207663_10033348 3300025916 Bacteria 3067
845 Ga0207663_10036887 3300025916 Bacteria 2943
846 Ga0207663_10046778 3300025916 Bacteria 2668
847 Ga0207663_10067588 3300025916 Bacteria 2292
848 Ga0207663_10433791 3300025916 Bacteria 1011
849 Ga0207663_10867863 3300025916 Bacteria 721
850 Ga0207660_10013563 3300025917 Bacteria 5343
851 Ga0207660_10047666 3300025917 Bacteria 3031
852 Ga0207660_10084112 3300025917 Bacteria 2345
853 Ga0207660_10711317 3300025917 Bacteria 819
854 Ga0207662_10000921 3300025918 Bacteria 13621
855 Ga0207657_10000565 3300025919 Bacteria 39272
856 Ga0207657_10000942 3300025919 Bacteria 30819
857 Ga0207657_10004866 3300025919 Bacteria 14133
858 Ga0207657_10066317 3300025919 Bacteria 3073
859 Ga0207657_10130730 3300025919 Bacteria 2058
860 Ga0207657_10544568 3300025919 Bacteria 908
861 Ga0207649_10081331 3300025920 Bacteria 2097
862 Ga0207649_10427623 3300025920 Bacteria 995
863 Ga0207649_10761888 3300025920 Bacteria 754
864 Ga0207652_10031853 3300025921 Bacteria 4428
865 Ga0207652_10034398 3300025921 Bacteria 4270
866 Ga0207652_10260005 3300025921 Bacteria 1566
867 Ga0207652_10605694 3300025921 Bacteria 982
868 Ga0207646_10000898 3300025922 Bacteria 38329
869 Ga0207646_10010676 3300025922 Bacteria 8942
870 Ga0207646_10132238 3300025922 Bacteria 2246
871 Ga0207646_10185426 3300025922 Bacteria 1879
872 Ga0207646_10457049 3300025922 Bacteria 1152
873 Ga0207681_10178634 3300025923 Bacteria 1615
874 Ga0207681_10214708 3300025923 Bacteria 1485
875 Ga0207681_10824369 3300025923 Unclassified 775
876 Ga0207694_10004313 3300025924 Bacteria 11107
877 Ga0207694_10032668 3300025924 Bacteria 3985
878 Ga0207694_10050874 3300025924 Bacteria 3211
879 Ga0207694_10432038 3300025924 Bacteria 1098
880 Ga0207694_10884038 3300025924 Bacteria 755
881 Ga0207650_10000121 3300025925 Bacteria 102877
882 Ga0207650_10036131 3300025925 Bacteria 3592
883 Ga0207659_10235438 3300025926 Bacteria 1479
884 Ga0207659_10402333 3300025926 Bacteria 1145
885 Ga0207659_10555467 3300025926 Unclassified 976
886 Ga0207687_10007335 3300025927 Bacteria 7271
887 Ga0207687_10048309 3300025927 Bacteria 2954
888 Ga0207687_10114884 3300025927 Bacteria 2004
889 Ga0207687_10218324 3300025927 Bacteria 1500
890 Ga0207687_10247681 3300025927 Bacteria 1415
891 Ga0207687_10512069 3300025927 Bacteria 1003
892 Ga0207700_10001554 3300025928 Bacteria 13025
893 Ga0207700_10003543 3300025928 Bacteria 9092
894 Ga0207700_10036858 3300025928 Bacteria 3536
895 Ga0207700_10040382 3300025928 Bacteria 3405
896 Ga0207700_10046879 3300025928 Bacteria 3200
897 Ga0207700_10086854 3300025928 Bacteria 2459
898 Ga0207700_10104572 3300025928 Bacteria 2266
899 Ga0207700_10105524 3300025928 Bacteria 2257
900 Ga0207700_10116907 3300025928 Bacteria 2155
901 Ga0207700_10148493 3300025928 Bacteria 1935
902 Ga0207700_10158124 3300025928 Bacteria 1880
903 Ga0207664_10002606 3300025929 Bacteria 11937
904 Ga0207664_10032949 3300025929 Bacteria 3976
905 Ga0207664_10209233 3300025929 Bacteria 1687
906 Ga0207664_10248703 3300025929 Bacteria 1551
907 Ga0207664_10417764 3300025929 Bacteria 1194
908 Ga0207644_10066511 3300025931 Unclassified 2624
909 Ga0207644_10093767 3300025931 Bacteria 2242
910 Ga0207644_10656209 3300025931 Bacteria 873
911 Ga0207644_10691331 3300025931 Bacteria 850
912 Ga0207690_10086011 3300025932 Bacteria 2208
913 Ga0207690_10105718 3300025932 Bacteria 2019
914 Ga0207690_10398926 3300025932 Bacteria 1097
915 Ga0207706_10000471 3300025933 Bacteria 43044
916 Ga0207706_10003758 3300025933 Bacteria 14479
917 Ga0207706_10114876 3300025933 Bacteria 2367
918 Ga0207706_10137024 3300025933 Bacteria 2153
919 Ga0207706_10151801 3300025933 Bacteria 2037
920 Ga0207706_10922985 3300025933 Bacteria 737
921 Ga0207686_10086888 3300025934 Unclassified 2055
922 Ga0207686_10634339 3300025934 Bacteria 844
923 Ga0207709_10037623 3300025935 Bacteria 2877
924 Ga0207709_10288991 3300025935 Bacteria 1214
925 Ga0207670_10045841 3300025936 Unclassified 2900
926 Ga0207670_10229732 3300025936 Bacteria 1424
927 Ga0207670_10278204 3300025936 Bacteria 1303
928 Ga0207669_10263330 3300025937 Bacteria 1291
929 Ga0207669_10561935 3300025937 Bacteria 922
930 Ga0207669_10703277 3300025937 Bacteria 831
931 Ga0207704_10048608 3300025938 Bacteria 2545
932 Ga0207704_10081926 3300025938 Bacteria 2089
933 Ga0207704_10191065 3300025938 Bacteria 1489
934 Ga0207704_10716949 3300025938 Bacteria 829
935 Ga0207665_10000552 3300025939 Bacteria 25226
936 Ga0207665_10000874 3300025939 Bacteria 20343
937 Ga0207665_10006432 3300025939 Bacteria 7793
938 Ga0207665_10044837 3300025939 Bacteria 2959
939 Ga0207665_10059539 3300025939 Bacteria 2585
940 Ga0207665_10061461 3300025939 Bacteria 2546
941 Ga0207665_10063425 3300025939 Bacteria 2509
942 Ga0207665_10077225 3300025939 Bacteria 2285
943 Ga0207665_10127742 3300025939 Bacteria 1801
944 Ga0207665_10302478 3300025939 Bacteria 1196
945 Ga0207665_10303496 3300025939 Bacteria 1194
946 Ga0207665_10347155 3300025939 Bacteria 1120
947 Ga0207665_10510784 3300025939 Unclassified 929
948 Ga0207691_10279738 3300025940 Bacteria 1436
949 Ga0207691_10915125 3300025940 Bacteria 734
950 Ga0207711_10013287 3300025941 Bacteria 6841
951 Ga0207711_10044634 3300025941 Bacteria 3784
952 Ga0207711_10070516 3300025941 Bacteria 3031
953 Ga0207711_10079952 3300025941 Bacteria 2855
954 Ga0207711_10238623 3300025941 Bacteria 1667
955 Ga0207689_10007261 3300025942 Bacteria 9728
956 Ga0207689_10121118 3300025942 Bacteria 2152
957 Ga0207689_10217100 3300025942 Bacteria 1580
958 Ga0207661_10000210 3300025944 Bacteria 37700
959 Ga0207661_10024349 3300025944 Bacteria 4587
960 Ga0207661_10049596 3300025944 Bacteria 3342
961 Ga0207661_10054352 3300025944 Bacteria 3208
962 Ga0207661_10160901 3300025944 Bacteria 1948
963 Ga0207679_10001610 3300025945 Bacteria 14047
964 Ga0207679_10107154 3300025945 Bacteria 2198
965 Ga0207679_10145104 3300025945 Bacteria 1924
966 Ga0207679_10296013 3300025945 Bacteria 1393
967 Ga0207679_10504337 3300025945 Bacteria 1080
968 Ga0207679_10571020 3300025945 Bacteria 1017
969 Ga0207667_10006339 3300025949 Bacteria 14341
970 Ga0207667_10043071 3300025949 Plasmid 4792
971 Ga0207667_10092380 3300025949 Bacteria 3125
972 Ga0207667_10174570 3300025949 Bacteria 2208
973 Ga0207667_10190599 3300025949 Bacteria 2104
974 Ga0207667_10294022 3300025949 Bacteria 1659
975 Ga0207667_10759491 3300025949 Bacteria 968
976 Ga0207667_11232667 3300025949 Bacteria 727
977 Ga0207651_10056765 3300025960 Unclassified 2696
978 Ga0207651_10527977 3300025960 Bacteria 1024
979 Ga0207712_10319277 3300025961 Bacteria 1281
980 Ga0207712_10538583 3300025961 Bacteria 1003
981 Ga0207668_10124987 3300025972 Bacteria 1954
982 Ga0207668_10138799 3300025972 Bacteria 1866
983 Ga0207668_10144872 3300025972 Bacteria 1831
984 Ga0207668_10163670 3300025972 Bacteria 1736
985 Ga0207668_10189847 3300025972 Bacteria 1627
986 Ga0207668_10234400 3300025972 Bacteria 1481
987 Ga0207668_10245726 3300025972 Unclassified 1450
988 Ga0207668_10299026 3300025972 Bacteria 1327
989 Ga0207668_10575225 3300025972 Bacteria 979
990 Ga0207668_10981957 3300025972 Bacteria 754
991 Ga0207640_10034141 3300025981 Bacteria 3171
992 Ga0207640_10069975 3300025981 Bacteria 2358
993 Ga0207640_10187396 3300025981 Bacteria 1557
994 Ga0207640_10785466 3300025981 Bacteria 824
995 Ga0207658_10128551 3300025986 Bacteria 2032
996 Ga0207658_10220572 3300025986 Bacteria 1595
997 Ga0207658_10286199 3300025986 Bacteria 1415
998 Ga0207658_10395271 3300025986 Bacteria 1214
999 Ga0207658_10688899 3300025986 Bacteria 923
1000 Ga0207658_10870005 3300025986 Bacteria 820
1001 Ga0207658_11265355 3300025986 Bacteria 675
1002 Ga0207677_10006451 3300026023 Bacteria 6438
1003 Ga0207677_10010738 3300026023 Bacteria 5191
1004 Ga0207677_10094857 3300026023 Bacteria 2179
1005 Ga0207703_10100425 3300026035 Bacteria 2451
1006 Ga0207703_10212403 3300026035 Bacteria 1726
1007 Ga0207703_10529438 3300026035 Bacteria 1109
1008 Ga0207703_10556568 3300026035 Bacteria 1082
1009 Ga0207703_10625789 3300026035 Bacteria 1019
1010 Ga0207639_10043625 3300026041 Bacteria 3368
1011 Ga0207639_10133496 3300026041 Unclassified 2058
1012 Ga0207639_10261610 3300026041 Bacteria 1513
1013 Ga0207639_10285835 3300026041 Bacteria 1452
1014 Ga0207639_10654297 3300026041 Bacteria 972
1015 Ga0207639_10939246 3300026041 Bacteria 809
1016 Ga0207639_11021697 3300026041 Bacteria 774
1017 Ga0207678_10009622 3300026067 Bacteria 8501
1018 Ga0207678_10017447 3300026067 Bacteria 6306
1019 Ga0207678_10031260 3300026067 Bacteria 4644
1020 Ga0207678_10042459 3300026067 Bacteria 3939
1021 Ga0207678_10182749 3300026067 Bacteria 1791
1022 Ga0207678_10273020 3300026067 Bacteria 1450
1023 Ga0207678_10451714 3300026067 Bacteria 1117
1024 Ga0207678_10579192 3300026067 Bacteria 983
1025 Ga0207708_10054613 3300026075 Bacteria 3046
1026 Ga0207708_10185101 3300026075 Bacteria 1655
1027 Ga0207708_10678004 3300026075 Bacteria 879
1028 Ga0207702_10001309 3300026078 Bacteria 24941
1029 Ga0207702_10224709 3300026078 Bacteria 1751
1030 Ga0207702_10256289 3300026078 Unclassified 1645
1031 Ga0207702_10355532 3300026078 Bacteria 1403
1032 Ga0207702_10366143 3300026078 Bacteria 1383
1033 Ga0207702_10648109 3300026078 Bacteria 1039
1034 Ga0207702_11057287 3300026078 Bacteria 805
1035 Ga0207641_10000317 3300026088 Bacteria 59841
1036 Ga0207641_10207506 3300026088 Bacteria 1810
1037 Ga0207641_10265129 3300026088 Bacteria 1610
1038 Ga0207641_10424053 3300026088 Bacteria 1281
1039 Ga0207641_10687246 3300026088 Bacteria 1007
1040 Ga0207641_11218444 3300026088 Bacteria 752
1041 Ga0207641_11246775 3300026088 Bacteria 744
1042 Ga0207648_10035150 3300026089 Unclassified 4415
1043 Ga0207648_10071057 3300026089 Unclassified 3034
1044 Ga0207648_10085124 3300026089 Bacteria 2758
1045 Ga0207648_10157466 3300026089 Bacteria 2005
1046 Ga0207648_10236951 3300026089 Bacteria 1624
1047 Ga0207648_10374763 3300026089 Bacteria 1286
1048 Ga0207648_10609947 3300026089 Bacteria 1006
1049 Ga0207676_10000076 3300026095 Bacteria 98185
1050 Ga0207676_10149817 3300026095 Bacteria 2008
1051 Ga0207676_10333379 3300026095 Bacteria 1397
1052 Ga0207676_10729649 3300026095 Bacteria 962
1053 Ga0207676_10813109 3300026095 Bacteria 912
1054 Ga0207674_10000117 3300026116 Bacteria 92896
1055 Ga0207674_10042222 3300026116 Bacteria 4712
1056 Ga0207674_10066539 3300026116 Bacteria 3629
1057 Ga0207674_10269795 3300026116 Bacteria 1649
1058 Ga0207674_10313976 3300026116 Bacteria 1516
1059 Ga0207674_10795296 3300026116 Unclassified 913
1060 Ga0207675_100023317 3300026118 Bacteria 5756
1061 Ga0207675_100121109 3300026118 Bacteria 2475
1062 Ga0207675_100170032 3300026118 Bacteria 2083
1063 Ga0207675_100289601 3300026118 Bacteria 1593
1064 Ga0207675_101026365 3300026118 Bacteria 843
1065 Ga0207683_10016038 3300026121 Bacteria 6376
1066 Ga0207683_10083926 3300026121 Bacteria 2831
1067 Ga0207683_10132192 3300026121 Bacteria 2245
1068 Ga0207683_10166299 3300026121 Bacteria 1996
1069 Ga0207683_10168668 3300026121 Bacteria 1982
1070 Ga0207683_10172909 3300026121 Bacteria 1957
1071 Ga0207683_10261891 3300026121 Bacteria 1579
1072 Ga0207683_10512825 3300026121 Bacteria 1108
1073 Ga0207683_10941821 3300026121 Bacteria 802
1074 Ga0207698_10050445 3300026142 Bacteria 3175
1075 Ga0207698_10123375 3300026142 Bacteria 2197
1076 Ga0207698_10196721 3300026142 Bacteria 1801
1077 Ga0207698_10233868 3300026142 Bacteria 1670
1078 Ga0207698_10299266 3300026142 Bacteria 1497
1079 Ga0207698_10435396 3300026142 Bacteria 1262
1080 Ga0207698_10546801 3300026142 Unclassified 1134
1081 Ga0207698_11405604 3300026142 Bacteria 713
1082 Ga0209389_1000107 3300027296 Bacteria 74129
1083 Ga0209389_1002563 3300027296 Bacteria 14077
1084 Ga0209589_1000011 3300027357 Bacteria 236981
1085 Ga0209589_1000036 3300027357 Bacteria 131278
1086 Ga0209489_100006 3300027361 Bacteria 475698
1087 Ga0209489_100012 3300027361 Bacteria 236981
1088 Ga0209489_115889 3300027361 Bacteria 4339
1089 Ga0209489_115890 3300027361 Bacteria 4339
1090 Ga0209700_100005 3300027363 Bacteria 573969
1091 Ga0209700_100019 3300027363 Bacteria 236981
1092 Ga0209179_1003780 3300027512 Bacteria 2218
1093 Ga0209588_1010104 3300027671 Bacteria 2831
1094 Ga0209588_1158374 3300027671 Bacteria 715
1095 Ga0209813_10020653 3300027866 Bacteria 1845
1096 Ga0209813_10022361 3300027866 Bacteria 1788
1097 Ga0209813_10148667 3300027866 Bacteria 837
1098 Ga0207428_10348298 3300027907 Bacteria 1090
1099 Ga0265356_1000368 3300028017 Bacteria 8193
1100 Ga0268266_10002874 3300028379 Bacteria 17897
1101 Ga0268266_10013866 3300028379 Bacteria 6938
1102 Ga0268266_10014156 3300028379 Bacteria 6863
1103 Ga0268266_10033522 3300028379 Bacteria 4365
1104 Ga0268266_10036975 3300028379 Bacteria 4160
1105 Ga0268266_10072145 3300028379 Bacteria 2993
1106 Ga0268266_10396089 3300028379 Bacteria 1305
1107 Ga0268266_10506768 3300028379 Bacteria 1153
1108 Ga0268265_10029692 3300028380 Unclassified 3928
1109 Ga0268265_10050782 3300028380 Bacteria 3127
1110 Ga0268265_10071970 3300028380 Bacteria 2695
1111 Ga0268265_10199577 3300028380 Bacteria 1734
1112 Ga0268265_10348359 3300028380 Bacteria 1351
1113 Ga0268265_10780442 3300028380 Bacteria 930
1114 Ga0268264_10000065 3300028381 Bacteria 298403
1115 Ga0268264_10075822 3300028381 Bacteria 2860
1116 Ga0268264_10164548 3300028381 Bacteria 2001
1117 Ga0268264_10891659 3300028381 Bacteria 892
1118 Ga0265337_1011253 3300028556 Bacteria 3091
1119 Ga0265326_10002479 3300028558 Bacteria 6218
1120 Ga0265319_1003252 3300028563 Bacteria 8549
1121 Ga0265334_10003859 3300028573 Bacteria 6760
1122 Ga0265334_10009956 3300028573 Bacteria 4018
1123 Ga0265318_10004124 3300028577 Bacteria 7110
1124 Ga0265323_10006219 3300028653 Bacteria 5027
1125 Ga0265336_10000125 3300028666 Bacteria 57377
1126 Ga0307517_10000279 3300028786 Bacteria 88025
1127 Ga0307517_10089150 3300028786 Bacteria 2543
1128 Ga0307515_10205191 3300028794 Bacteria 1834
1129 Ga0265338_10000085 3300028800 Bacteria 175080
1130 Ga0265338_10009964 3300028800 Bacteria 11234
1131 Ga0265338_10020377 3300028800 Bacteria 6979
1132 Ga0265338_10086009 3300028800 Bacteria 2619
1133 Ga0265338_10090539 3300028800 Bacteria 2531
1134 Ga0265338_10109676 3300028800 Bacteria 2226
1135 Ga0265338_10368566 3300028800 Bacteria 1029
1136 Ga0265338_10382886 3300028800 Bacteria 1006
1137 Ga0265324_10001316 3300029957 Bacteria 14567
1138 Ga0307511_10042483 3300030521 Bacteria 3817
1139 Ga0265762_1000180 3300030760 Bacteria 9928
1140 Ga0265770_1000774 3300030878 Bacteria 4464
1141 Ga0265765_1028426 3300030879 Bacteria 704
1142 Ga0265760_10000094 3300031090 Bacteria 23151
1143 Ga0265760_10128309 3300031090 Bacteria 818
1144 Ga0265330_10041412 3300031235 Bacteria 2042
1145 Ga0265330_10088639 3300031235 Bacteria 1329
1146 Ga0265332_10011140 3300031238 Bacteria 3995
1147 Ga0265328_10024215 3300031239 Bacteria 2295
1148 Ga0265328_10080753 3300031239 Bacteria 1198
1149 Ga0265325_10010622 3300031241 Bacteria 5322
1150 Ga0265340_10001234 3300031247 Bacteria 14646
1151 Ga0265340_10152500 3300031247 Bacteria 1052
1152 Ga0265339_10118873 3300031249 Bacteria 1360
1153 Ga0265339_10168380 3300031249 Bacteria 1098
1154 Ga0265331_10037710 3300031250 Bacteria 2365
1155 Ga0265316_10012437 3300031344 Bacteria 7631
1156 Ga0265316_10052801 3300031344 Bacteria 3187
1157 Ga0265316_10446832 3300031344 Bacteria 927
1158 Ga0307513_10144244 3300031456 Bacteria 2302
1159 Ga0307513_10321981 3300031456 Bacteria 1304
1160 Ga0307513_10437637 3300031456 Bacteria 1034
1161 Ga0307509_10019751 3300031507 Bacteria 7671
1162 Ga0307509_10029382 3300031507 Bacteria 6100
1163 Ga0307509_10105981 3300031507 Bacteria 2831
1164 Ga0307509_10458655 3300031507 Bacteria 967
1165 Ga0307509_10472266 3300031507 Bacteria 944
1166 Ga0307408_100790903 3300031548 Bacteria 860
1167 Ga0265313_10034401 3300031595 Bacteria 2563
1168 Ga0307508_10000018 3300031616 Bacteria 202701
1169 Ga0307508_10095251 3300031616 Bacteria 2568
1170 Ga0307508_10103951 3300031616 Bacteria 2437
1171 Ga0307508_10439197 3300031616 Bacteria 897
1172 Ga0265314_10000412 3300031711 Bacteria 57508
1173 Ga0265314_10014873 3300031711 Bacteria 6201
1174 Ga0265314_10083329 3300031711 Bacteria 2102
1175 Ga0265314_10257653 3300031711 Bacteria 998
1176 Ga0265342_10042929 3300031712 Bacteria 2730
1177 Ga0265342_10221517 3300031712 Bacteria 1019
1178 Ga0316576_10266649 3300031727 Bacteria 1284
1179 Ga0316578_10017137 3300031728 Bacteria 3938
1180 Ga0307516_10014449 3300031730 Bacteria 8350
1181 Ga0307516_10017791 3300031730 Bacteria 7403
1182 Ga0307516_10066336 3300031730 Bacteria 3481
1183 Ga0307516_10116424 3300031730 Bacteria 2468
1184 Ga0307516_10232988 3300031730 Bacteria 1544
1185 Ga0307516_10411956 3300031730 Bacteria 1010
1186 Ga0307405_10680392 3300031731 Bacteria 850
1187 Ga0307413_10702796 3300031824 Bacteria 840
1188 Ga0307410_10358398 3300031852 Bacteria 1167
1189 Ga0307410_10623458 3300031852 Bacteria 902
1190 Ga0307410_10669844 3300031852 Bacteria 872
1191 Ga0307406_10511889 3300031901 Bacteria 975
1192 Ga0307406_11240390 3300031901 Bacteria 649
1193 Ga0307412_10371452 3300031911 Bacteria 1155
1194 Ga0307409_101343778 3300031995 Bacteria 740
1195 Ga0307414_10260502 3300032004 Bacteria 1447
1196 Ga0307411_10087407 3300032005 Bacteria 2165
1197 Ga0307415_100044899 3300032126 Bacteria 2958
1198 Ga0307415_100272477 3300032126 Bacteria 1387
1199 Ga0307415_100680015 3300032126 Bacteria 926
1200 Ga0307507_10078827 3300033179 Bacteria 2916
1201 Ga0307510_10063240 3300033180 Bacteria 3771
1202 Ga0307510_10153408 3300033180 Bacteria 1916
1203 Ga0315911_1000003 3300033442 Bacteria 502217
1204 Ga0373938_0072160 3300034957 Bacteria 827
1205 Ga0373926_0014548 3300035083 Bacteria 2676
1206 Ga0373926_0054989 3300035083 Bacteria 1442
1207 Ga0373926_0177962 3300035083 Bacteria 815
1208 Ga0373934_0021161 3300035086 Bacteria 2504
1209 Ga0373934_0032951 3300035086 Bacteria 2034
1210 Ga0373934_0154213 3300035086 Bacteria 941
1211 Ga0373940_0054716 3300035088 Bacteria 1129
1212 Ga0373944_0012726 3300035089 Bacteria 2323
1213 Ga0373944_0022255 3300035089 Bacteria 1841
1214 Ga0373944_0025574 3300035089 Bacteria 1739
1215 Ga0373949_0078419 3300035090 Bacteria 877
1216 Ga0373923_0005230 3300035111 Bacteria 4392
1217 Ga0373923_0021210 3300035111 Bacteria 2533
1218 Ga0373923_0062597 3300035111 Bacteria 1584
1219 Ga0373923_0292786 3300035111 Bacteria 769
1220 Ga0373932_0010230 3300035112 Bacteria 2267
1221 Ga0373936_0002008 3300035113 Bacteria 7533
1222 Ga0373936_0080690 3300035113 Bacteria 1354
1223 Ga0373936_0089043 3300035113 Bacteria 1293
1224 Ga0373936_0208373 3300035113 Bacteria 864
1225 Ga0373941_0089621 3300035115 Bacteria 1053
1226 Ga0373945_0005788 3300035116 Bacteria 3967
1227 Ga0373945_0084090 3300035116 Bacteria 1223
1228 Ga0373953_0036943 3300035117 Bacteria 1925
1229 Ga0373953_0194490 3300035117 Bacteria 876
1230 Ga0373954_0010944 3300035118 Bacteria 4012
1231 Ga0373954_0017743 3300035118 Bacteria 3199
1232 Ga0373954_0027608 3300035118 Bacteria 2607
1233 Ga0373954_0052674 3300035118 Bacteria 1912
1234 Ga0373954_0089455 3300035118 Bacteria 1477
1235 Ga0373954_0195103 3300035118 Bacteria 994
1236 Ga0373956_0043683 3300035119 Bacteria 1996
1237 Ga0373956_0157830 3300035119 Bacteria 1068
1238 Ga0373956_0226542 3300035119 Bacteria 888
1239 Ga0373957_0000546 3300035120 Bacteria 9543
1240 Ga0373957_0034354 3300035120 Unclassified 1877
1241 Ga0373957_0170186 3300035120 Bacteria 900
1242 Ga0373960_0088427 3300035121 Bacteria 987
1243 Ga0373943_0000296 3300035170 Bacteria 20705
1244 Ga0373943_0062285 3300035170 Unclassified 1867
1245 Ga0373943_0373227 3300035170 Bacteria 820
1246 Ga0373943_0382501 3300035170 Bacteria 810
1247 Ga0373946_0002559 3300035171 Bacteria 6428
1248 Ga0373946_0098808 3300035171 Bacteria 1305
1249 Ga0373946_0177195 3300035171 Bacteria 1010
1250 Ga0373946_0230621 3300035171 Bacteria 897
1251 Ga0373946_0366882 3300035171 Bacteria 722
1252 Ga0373955_0002750 3300035172 Bacteria 7717
1253 Ga0373955_0010160 3300035172 Bacteria 4437
1254 Ga0373955_0014097 3300035172 Bacteria 3881
1255 Ga0373955_0015721 3300035172 Bacteria 3712
1256 Ga0373955_0031289 3300035172 Bacteria 2786
1257 Ga0373955_0078793 3300035172 Bacteria 1857
1258 Ga0373955_0081245 3300035172 Bacteria 1832
1259 Ga0373955_0187707 3300035172 Bacteria 1228
1260 Ga0373955_0249907 3300035172 Bacteria 1063
1261 Ga0316574_0000486 3300035398 Bacteria 16059
1262 Ga0373924_0016752 3300035410 Bacteria 2802
1263 Ga0373931_0015025 3300035691 Bacteria 3794
1264 Ga0373931_0197544 3300035691 Bacteria 1200
1265 Ga0373931_0222320 3300035691 Bacteria 1137
1266 Ga0373931_0490243 3300035691 Bacteria 791
1267 Ga0373935_0001575 3300035692 Bacteria 12718
1268 Ga0373935_0014638 3300035692 Bacteria 4735
1269 Ga0373935_0049902 3300035692 Bacteria 2654
1270 Ga0373927_0000041 3300035695 Bacteria 94763
1271 Ga0373927_0000147 3300035695 Bacteria 55399
1272 Ga0373927_0002863 3300035695 Bacteria 12559
1273 Ga0373927_0029888 3300035695 Bacteria 3554
1274 Ga0373927_0038537 3300035695 Bacteria 3103
1275 Ga0373927_0043468 3300035695 Bacteria 2908
1276 Ga0373927_0058916 3300035695 Bacteria 2484
1277 Ga0373927_0160085 3300035695 Bacteria 1475
1278 Ga0373927_0196330 3300035695 Bacteria 1324
1279 Ga0373927_0202760 3300035695 Bacteria 1302
1280 Ga0373927_0225049 3300035695 Bacteria 1232
1281 Ga0373933_0000751 3300035724 Bacteria 19833
1282 Ga0373933_0026227 3300035724 Bacteria 3346
1283 Ga0373933_0030514 3300035724 Bacteria 3122
1284 Ga0373933_0074105 3300035724 Bacteria 2075
1285 Ga0373933_0149796 3300035724 Bacteria 1477
1286 Ga0373933_0172619 3300035724 Bacteria 1376
1287 Ga0373933_0337905 3300035724 Unclassified 977
1288 Ga0373933_0672289 3300035724 Unclassified 681
1289 Ga0373947_0002136 3300035725 Bacteria 12039
1290 Ga0373947_0006447 3300035725 Bacteria 6815
1291 Ga0373947_0008159 3300035725 Bacteria 6037
1292 Ga0373947_0029638 3300035725 Bacteria 3212
1293 Ga0373947_0035652 3300035725 Bacteria 2946
1294 Ga0373947_0044842 3300035725 Bacteria 2645
1295 Ga0373947_0292104 3300035725 Bacteria 1085
1296 Ga0373947_0327532 3300035725 Bacteria 1025
1297 Ga0373937_0011695 3300036401 Bacteria 7697
1298 Ga0373937_0014364 3300036401 Bacteria 6991
1299 Ga0373937_0027533 3300036401 Bacteria 5140
1300 Ga0373937_0038419 3300036401 Bacteria 4361
1301 Ga0373937_0044202 3300036401 Bacteria 4068
1302 Ga0373937_0057708 3300036401 Bacteria 3566
1303 Ga0373937_0100925 3300036401 Bacteria 2678
1304 Ga0373937_0113893 3300036401 Bacteria 2517
1305 Ga0373937_0126809 3300036401 Bacteria 2381
1306 Ga0373937_0201034 3300036401 Bacteria 1873
1307 Ga0373937_0224582 3300036401 Bacteria 1768
1308 Ga0373937_0243303 3300036401 Bacteria 1695
1309 Ga0373937_0575613 3300036401 Bacteria 1069
1310 Ga0373937_0621894 3300036401 Bacteria 1025
1311 Ga0373937_1286169 3300036401 Bacteria 679
1312 Ga0373937_1430833 3300036401 Bacteria 639
1313 Ga0316584_0002956 3300036712 Bacteria 10926
1314 Ga0373925_0004268 3300037068 Bacteria 10827
1315 Ga0373925_0006220 3300037068 Bacteria 8809
1316 Ga0373925_0014767 3300037068 Bacteria 5643
1317 Ga0373925_0015217 3300037068 Bacteria 5562
1318 Ga0373925_0017861 3300037068 Bacteria 5148
1319 Ga0373925_0032350 3300037068 Bacteria 3850
1320 Ga0373925_0042086 3300037068 Bacteria 3388
1321 Ga0373925_0066047 3300037068 Bacteria 2726
1322 Ga0373925_0195355 3300037068 Bacteria 1607
1323 Ga0373925_0207738 3300037068 Bacteria 1559
1324 Ga0373925_0347016 3300037068 Bacteria 1205
1325 Ga0373925_0745213 3300037068 Bacteria 808
1326 Ga0395899_0155936 3300037312 Bacteria 1616
1327 Ga0395900_0001586 3300037418 Bacteria 26897
1328 Ga0395900_0017960 3300037418 Bacteria 7221
1329 Ga0395900_0197732 3300037418 Bacteria 2036
1330 Ga0395900_0534825 3300037418 Bacteria 1118
1331 Ga0395900_0980683 3300037418 Bacteria 766
1332 Ga0395898_0043732 3300037466 Bacteria 4413
1333 Ga0395898_0067374 3300037466 Bacteria 3466
1334 Ga0395898_0106414 3300037466 Bacteria 2690
1335 Ga0395905_0002364 3300037471 Bacteria 21019
1336 Ga0395905_0080667 3300037471 Bacteria 3049
1337 Ga0395905_0094419 3300037471 Bacteria 2806
1338 Ga0395905_0943345 3300037471 Bacteria 766
1339 Ga0436364_0032184 3300037853 Bacteria 606
1340 Ga0436364_0054707 3300037853 Bacteria 1630
1341 Ga0436364_0914320 3300037853 Bacteria 15277
1342 Ga0436364_1058656 3300037853 Bacteria 1848
1343 Ga0436364_1214450 3300037853 Bacteria 2392
1344 Ga0436364_1372359 3300037853 Bacteria 1442
1345 Ga0436364_1431371 3300037853 Bacteria 880
1346 Ga0436364_1468890 3300037853 Bacteria 3472
1347 Ga0395901_0033905 3300038443 Bacteria 5272
1348 Ga0395901_0034663 3300038443 Bacteria 5214
1349 Ga0395901_0417628 3300038443 Bacteria 1376
1350 Ga0395901_0650975 3300038443 Bacteria 1057
1351 Ga0395901_0734790 3300038443 Bacteria 981
1352 Ga0395901_0735997 3300038443 Bacteria 980
1353 Ga0395901_1401873 3300038443 Bacteria 657
1354 Ga0436365_0775744 3300039437 Bacteria 2264
1355 Ga0436365_0935505 3300039437 Bacteria 29785
1356 Ga0436365_0962701 3300039437 Bacteria 3132
1357 Ga0436365_1016700 3300039437 Bacteria 960
1358 Ga0436365_1081631 3300039437 Bacteria 1548
1359 Ga0436365_1538861 3300039437 Bacteria 3220
1360 Ga0436365_1664010 3300039437 Bacteria 786
1361 Ga0436365_1787150 3300039437 Bacteria 1311
1362 Ga0436365_1827259 3300039437 Bacteria 830
1363 Ga0436365_1849409 3300039437 Bacteria 1864
1364 Ga0436365_1853184 3300039437 Bacteria 1602
1365 Ga0436365_1894771 3300039437 Bacteria 1681
1366 Ga0436360_0116973 3300039438 Bacteria 5473
1367 Ga0436360_0154239 3300039438 Bacteria 1528
1368 Ga0436360_0234819 3300039438 Bacteria 1727
1369 Ga0436360_0414842 3300039438 Bacteria 2552
1370 Ga0436360_1036035 3300039438 Bacteria 1003
1371 Ga0436360_1200965 3300039438 Bacteria 1045
1372 Ga0436361_0048611 3300039447 Bacteria 1135
1373 Ga0436361_0235455 3300039447 Bacteria 3237
1374 Ga0436361_0266463 3300039447 Bacteria 803
1375 Ga0436361_0327683 3300039447 Bacteria 2262
1376 Ga0436361_0397174 3300039447 Bacteria 3294
1377 Ga0436361_0479799 3300039447 Bacteria 2008
1378 Ga0436361_0553282 3300039447 Bacteria 5181
1379 Ga0436361_0558075 3300039447 Bacteria 4877
1380 Ga0436361_0926283 3300039447 Bacteria 1005
1381 Ga0436363_0409094 3300039450 Bacteria 896
1382 Ga0436363_0431723 3300039450 Bacteria 1528
1383 Ga0436363_0749072 3300039450 Bacteria 1979
1384 Ga0436363_1128968 3300039450 Bacteria 1149
1385 Ga0436363_1253331 3300039450 Bacteria 3286
1386 Ga0436363_1487443 3300039450 Bacteria 2337
1387 Ga0436362_1098508 3300039453 Bacteria 893
1388 Ga0439465_0055699 3300041413 Bacteria 1302
1389 Ga0439465_0130760 3300041413 Bacteria 886
1390 Ga0451793_1625392 3300041452 Bacteria 906
1391 Ga0451807_0285454 3300041486 Bacteria 794
1392 Ga0451839_0912736 3300041496 Bacteria 682
1393 Ga0451839_0997822 3300041496 Bacteria 1350
1394 Ga0451843_0641134 3300041509 Bacteria 1276
1395 Ga0451853_2458675 3300041512 Bacteria 981
1396 Ga0466969_0006735 3300044656 Bacteria 6111
1397 Ga0466969_0091856 3300044656 Bacteria 1438
1398 Ga0466969_0132346 3300044656 Bacteria 1156
1399 Ga0466969_0148511 3300044656 Bacteria 1081
1400 Ga0466972_0000122 3300044658 Bacteria 65679
1401 Ga0466972_0143688 3300044658 Bacteria 1123
1402 Ga0466965_0362131 3300044683 Bacteria 796
1403 Ga0466965_0426936 3300044683 Bacteria 735
1404 Ga0466966_0008365 3300044684 Bacteria 6853
1405 Ga0466966_0020376 3300044684 Bacteria 4361
1406 Ga0466966_0070231 3300044684 Bacteria 2196
1407 Ga0466966_0134314 3300044684 Bacteria 1513
1408 Ga0466966_0641086 3300044684 Bacteria 640
1409 Ga0466961_0000038 3300044693 Bacteria 80721
1410 Ga0466961_0159409 3300044693 Bacteria 1406
1411 Ga0466963_0105996 3300044694 Bacteria 1927
1412 Ga0466963_0186590 3300044694 Bacteria 1448
1413 Ga0466964_0024309 3300044706 Bacteria 2361
1414 Ga0466964_0035916 3300044706 Bacteria 1985
1415 Ga0466971_0066052 3300044719 Bacteria 1638
1416 Ga0466971_0200122 3300044719 Bacteria 943
1417 Ga0466971_0550961 3300044719 Bacteria 572
1418 Ga0466968_0067179 3300044735 Bacteria 1554
1419 Ga0466968_0089106 3300044735 Bacteria 1365
1420 Ga0466970_0202081 3300044765 Bacteria 1106
1421 Ga0466970_0377338 3300044765 Bacteria 807
1422 Ga0466957_0041797 3300044842 Bacteria 2772
1423 Ga0466957_0176032 3300044842 Bacteria 1395
1424 Ga0466957_0206643 3300044842 Bacteria 1292
1425 Ga0466960_0114086 3300044901 Bacteria 1407
1426 Ga0466960_0144904 3300044901 Bacteria 1264
1427 Ga0466960_0424507 3300044901 Bacteria 769
1428 Ga0466959_0009876 3300045049 Bacteria 6803
1429 Ga0466959_0029135 3300045049 Bacteria 4091
1430 Ga0466959_0071972 3300045049 Bacteria 2503
1431 Ga0466959_0087844 3300045049 Bacteria 2236
1432 Ga0466959_0128662 3300045049 Bacteria 1796
1433 Ga0466959_0175793 3300045049 Bacteria 1500
1434 Ga0451576_0001864 3300045051 Bacteria 34040
1435 Ga0451576_0538391 3300045051 Bacteria 1227
1436 Ga0466958_0339333 3300045836 Bacteria 967
1437 Ga0466967_0084499 3300045976 Bacteria 2872
1438 Ga0466967_0250626 3300045976 Bacteria 1691
1439 Ga0466967_0322653 3300045976 Bacteria 1489
1440 Ga0466967_0535695 3300045976 Bacteria 1151
1441 Ga0466967_0657132 3300045976 Bacteria 1037
1442 Ga0466967_1182082 3300045976 Bacteria 762
1443 Ga0495592_0008874 3300046454 Bacteria 7550
1444 Ga0495592_0050724 3300046454 Bacteria 3083
1445 Ga0495592_0135788 3300046454 Bacteria 1716
1446 Ga0495592_0474153 3300046454 Bacteria 780
1447 Ga0495603_0002054 3300046455 Bacteria 11838
1448 Ga0495603_0007756 3300046455 Bacteria 6468
1449 Ga0495603_0017026 3300046455 Bacteria 4398
1450 Ga0495603_0050941 3300046455 Bacteria 2461
1451 Ga0495603_0052443 3300046455 Bacteria 2422
1452 Ga0495603_0099920 3300046455 Bacteria 1694
1453 Ga0495603_0176863 3300046455 Bacteria 1235
1454 Ga0495603_0362769 3300046455 Bacteria 831
1455 Ga0495603_0559724 3300046455 Bacteria 655
1456 Ga0495629_0000094 3300046459 Bacteria 77297
1457 Ga0495629_0013453 3300046459 Bacteria 5901
1458 Ga0495629_0015868 3300046459 Bacteria 5412
1459 Ga0495629_0058549 3300046459 Bacteria 2694
1460 Ga0495629_0068333 3300046459 Bacteria 2480
1461 Ga0495629_0194914 3300046459 Bacteria 1401
1462 Ga0495638_0010923 3300046460 Bacteria 6278
1463 Ga0495638_0034940 3300046460 Bacteria 3206
1464 Ga0495638_0080272 3300046460 Bacteria 1982
1465 Ga0495638_0180102 3300046460 Bacteria 1206
1466 Ga0495638_0312022 3300046460 Bacteria 843
1467 Ga0495641_0022861 3300046461 Bacteria 3119
1468 Ga0495641_0072831 3300046461 Bacteria 1541
1469 Ga0495651_0006245 3300046462 Bacteria 9112
1470 Ga0495651_0018771 3300046462 Bacteria 5357
1471 Ga0495651_0078004 3300046462 Bacteria 2506
1472 Ga0495651_0146063 3300046462 Bacteria 1710
1473 Ga0495651_0228040 3300046462 Bacteria 1285
1474 Ga0495653_0007949 3300046463 Bacteria 8683
1475 Ga0495653_0061976 3300046463 Bacteria 2827
1476 Ga0495653_0144811 3300046463 Unclassified 1667
1477 Ga0495653_0541537 3300046463 Bacteria 721
1478 Ga0495650_0142108 3300046471 Bacteria 868
1479 Ga0495580_0000186 3300046472 Bacteria 46950
1480 Ga0495580_0001489 3300046472 Bacteria 20570
1481 Ga0495580_0001862 3300046472 Bacteria 18548
1482 Ga0495580_0003657 3300046472 Bacteria 13031
1483 Ga0495580_0007037 3300046472 Bacteria 9071
1484 Ga0495580_0046212 3300046472 Bacteria 3090
1485 Ga0495580_0164039 3300046472 Bacteria 1537
1486 Ga0495580_0202109 3300046472 Bacteria 1369
1487 Ga0495580_0414789 3300046472 Bacteria 906
1488 Ga0495580_0430282 3300046472 Bacteria 887
1489 Ga0495582_0000030 3300046473 Bacteria 77594
1490 Ga0495582_0004278 3300046473 Bacteria 8030
1491 Ga0495582_0027266 3300046473 Bacteria 3130
1492 Ga0495582_0080035 3300046473 Bacteria 1814
1493 Ga0495605_0050201 3300046474 Bacteria 2036
1494 Ga0495639_0000003 3300046475 Bacteria 118479
1495 Ga0495639_0054966 3300046475 Bacteria 1815
1496 Ga0495639_0119989 3300046475 Bacteria 1254
1497 Ga0495639_0420493 3300046475 Bacteria 677
1498 Ga0495662_0000008 3300046476 Bacteria 71128
1499 Ga0495662_0069375 3300046476 Bacteria 1707
1500 Ga0495664_0003617 3300046477 Bacteria 8425
1501 Ga0495664_0013305 3300046477 Bacteria 4667
1502 Ga0495664_0015465 3300046477 Bacteria 4338
1503 Ga0495664_0032353 3300046477 Bacteria 3068
1504 Ga0495664_0059436 3300046477 Bacteria 2275
1505 Ga0495584_0071544 3300046491 Bacteria 1743
1506 Ga0495585_0011478 3300046492 Bacteria 5241
1507 Ga0495585_0062631 3300046492 Bacteria 2043
1508 Ga0495585_0085626 3300046492 Bacteria 1703
1509 Ga0495594_0008593 3300046499 Bacteria 5263
1510 Ga0495594_0050048 3300046499 Bacteria 2298
1511 Ga0495594_0052150 3300046499 Bacteria 2252
1512 Ga0495594_0077351 3300046499 Bacteria 1856
1513 Ga0495594_0154078 3300046499 Bacteria 1305
1514 Ga0495594_0182272 3300046499 Bacteria 1195
1515 Ga0495606_0113465 3300046507 Bacteria 1631
1516 Ga0495608_0003691 3300046511 Bacteria 11008
1517 Ga0495608_0122683 3300046511 Bacteria 1665
1518 Ga0495610_0004376 3300046512 Bacteria 10468
1519 Ga0495610_0076024 3300046512 Bacteria 1554
1520 Ga0495610_0206773 3300046512 Bacteria 800
1521 Ga0495616_0322352 3300046513 Bacteria 648
1522 Ga0495618_0030253 3300046514 Bacteria 3381
1523 Ga0495618_0065708 3300046514 Bacteria 2305
1524 Ga0495618_0071993 3300046514 Bacteria 2199
1525 Ga0495618_0215788 3300046514 Bacteria 1212
1526 Ga0495618_0523933 3300046514 Bacteria 712
1527 Ga0495620_0059771 3300046515 Bacteria 1592
1528 Ga0495628_0009637 3300046516 Bacteria 8239
1529 Ga0495628_0039608 3300046516 Bacteria 3768
1530 Ga0495628_0077032 3300046516 Bacteria 2594
1531 Ga0495628_0288990 3300046516 Bacteria 1216
1532 Ga0495628_0488492 3300046516 Bacteria 890
1533 Ga0495630_0004998 3300046517 Bacteria 9330
1534 Ga0495630_0018830 3300046517 Bacteria 5075
1535 Ga0495630_0054615 3300046517 Bacteria 2992
1536 Ga0495630_0159984 3300046517 Bacteria 1715
1537 Ga0495630_0218370 3300046517 Bacteria 1455
1538 Ga0495630_0264322 3300046517 Bacteria 1314
1539 Ga0495630_0293311 3300046517 Bacteria 1243
1540 Ga0495631_0052491 3300046518 Bacteria 1780
1541 Ga0495631_0090409 3300046518 Bacteria 1318
1542 Ga0495631_0206324 3300046518 Bacteria 840
1543 Ga0495632_0150656 3300046519 Bacteria 1075
1544 Ga0495643_0017469 3300046522 Bacteria 4192
1545 Ga0495643_0150948 3300046522 Bacteria 1151
1546 Ga0495643_0166346 3300046522 Bacteria 1081
1547 Ga0495648_0168063 3300046524 Bacteria 1127
1548 Ga0495648_0201987 3300046524 Bacteria 994
1549 Ga0495666_0219843 3300046526 Bacteria 870
1550 Ga0495642_0178899 3300046528 Bacteria 923
1551 Ga0495652_0013965 3300046529 Bacteria 7218
1552 Ga0495652_0022169 3300046529 Bacteria 5639
1553 Ga0495652_0068629 3300046529 Bacteria 2969
1554 Ga0495652_0095062 3300046529 Bacteria 2429
1555 Ga0495652_0148906 3300046529 Bacteria 1831
1556 Ga0495652_0159756 3300046529 Bacteria 1751
1557 Ga0495652_0537795 3300046529 Bacteria 805
1558 Ga0495665_0000001 3300046531 Bacteria 156121
1559 Ga0495640_0000274 3300046533 Bacteria 35048
1560 Ga0495640_0008852 3300046533 Bacteria 7868
1561 Ga0495640_0050710 3300046533 Bacteria 2857
1562 Ga0495640_0118194 3300046533 Bacteria 1725
1563 Ga0495586_0157905 3300046535 Bacteria 1278
1564 Ga0495586_0498929 3300046535 Bacteria 702
1565 Ga0495587_0044257 3300046536 Bacteria 2648
1566 Ga0495587_0054669 3300046536 Bacteria 2352
1567 Ga0495587_0237377 3300046536 Bacteria 1026
1568 Ga0495598_0019675 3300046537 Bacteria 1774
1569 Ga0495609_0064667 3300046538 Bacteria 1613
1570 Ga0495609_0297038 3300046538 Bacteria 658
1571 Ga0495621_0066795 3300046539 Bacteria 1316
1572 Ga0495597_0052189 3300046542 Bacteria 1801
1573 Ga0495645_0008361 3300046543 Bacteria 7224
1574 Ga0495645_0106947 3300046543 Bacteria 1983
1575 Ga0495645_0173296 3300046543 Bacteria 1484
1576 Ga0495622_0017465 3300046557 Bacteria 3340
1577 Ga0495622_0029867 3300046557 Bacteria 2546
1578 Ga0495622_0086080 3300046557 Bacteria 1445
1579 Ga0495622_0095640 3300046557 Bacteria 1363
1580 Ga0495667_0008493 3300046559 Bacteria 6972
1581 Ga0495667_0033108 3300046559 Bacteria 3458
1582 Ga0495667_0035612 3300046559 Bacteria 3325
1583 Ga0495667_0076418 3300046559 Bacteria 2179
1584 Ga0495656_0121102 3300046615 Bacteria 1235
1585 Ga0495656_0157041 3300046615 Bacteria 1103
1586 Ga0495668_0363634 3300046616 Bacteria 794
1587 Ga0495634_0000360 3300046642 Bacteria 44196
1588 Ga0495634_0018688 3300046642 Bacteria 4931
1589 Ga0495634_0046073 3300046642 Bacteria 2944
1590 Ga0495634_0088620 3300046642 Bacteria 2012
1591 Ga0495634_0300579 3300046642 Bacteria 970
1592 Ga0495611_0083149 3300046648 Bacteria 1474
1593 Ga0495611_0112556 3300046648 Bacteria 1267
1594 Ga0495611_0203838 3300046648 Bacteria 922
1595 Ga0495611_0222343 3300046648 Bacteria 878
1596 Ga0495625_0146864 3300046660 Bacteria 1587
1597 Ga0495625_0498029 3300046660 Bacteria 745
1598 Ga0495635_0000578 3300046663 Bacteria 23501
1599 Ga0495635_0003851 3300046663 Bacteria 10423
1600 Ga0495635_0005522 3300046663 Bacteria 8796
1601 Ga0495635_0032615 3300046663 Bacteria 3613
1602 Ga0495635_0039940 3300046663 Bacteria 3245
1603 Ga0495659_0017583 3300046664 Bacteria 2372
1604 Ga0495659_0102256 3300046664 Bacteria 1111
1605 Ga0495661_0153335 3300046665 Bacteria 1243
1606 Ga0495661_0268013 3300046665 Bacteria 865
1607 Ga0495661_0386966 3300046665 Bacteria 682
1608 Ga0495588_0004457 3300046674 Bacteria 6184
1609 Ga0495588_0060051 3300046674 Bacteria 1968
1610 Ga0495588_0082493 3300046674 Bacteria 1679
1611 Ga0495588_0092366 3300046674 Bacteria 1586
1612 Ga0495588_0279954 3300046674 Bacteria 879
1613 Ga0495657_0004230 3300046675 Bacteria 11484
1614 Ga0495657_0005377 3300046675 Bacteria 10127
1615 Ga0495657_0029589 3300046675 Bacteria 3840
1616 Ga0495657_0107437 3300046675 Bacteria 1771
1617 Ga0495657_0468345 3300046675 Bacteria 736
1618 Ga0495599_0004042 3300046678 Bacteria 8637
1619 Ga0495599_0062448 3300046678 Bacteria 2328
1620 Ga0495599_0097130 3300046678 Bacteria 1837
1621 Ga0495599_0174392 3300046678 Bacteria 1326
1622 Ga0495599_0197532 3300046678 Bacteria 1236
1623 Ga0495599_0423485 3300046678 Bacteria 791
1624 Ga0495623_0006266 3300046679 Bacteria 7733
1625 Ga0495623_0013886 3300046679 Bacteria 5220
1626 Ga0495623_0027474 3300046679 Bacteria 3661
1627 Ga0495623_0116215 3300046679 Bacteria 1616
1628 Ga0495623_0283336 3300046679 Bacteria 921
1629 Ga0495646_0006847 3300046680 Bacteria 7233
1630 Ga0495646_0025076 3300046680 Bacteria 3751
1631 Ga0495646_0028494 3300046680 Bacteria 3496
1632 Ga0495646_0318077 3300046680 Bacteria 820
1633 Ga0495647_0000625 3300046681 Bacteria 10423
1634 Ga0495647_0039720 3300046681 Bacteria 1785
1635 Ga0495658_0000136 3300046683 Bacteria 40715
1636 Ga0495658_0018149 3300046683 Bacteria 3651
1637 Ga0495658_0018566 3300046683 Bacteria 3618
1638 Ga0495658_0440977 3300046683 Bacteria 831
1639 Ga0495669_0263899 3300046684 Bacteria 827
1640 Ga0495669_0272777 3300046684 Bacteria 813
1641 Ga0495613_0001913 3300046689 Bacteria 15795
1642 Ga0495613_0019527 3300046689 Bacteria 5051
1643 Ga0495613_0075126 3300046689 Bacteria 2460
1644 Ga0495613_0118514 3300046689 Bacteria 1903
1645 Ga0495624_0000943 3300046690 Bacteria 22927
1646 Ga0495624_0007215 3300046690 Bacteria 7814
1647 Ga0495624_0014653 3300046690 Bacteria 5313
1648 Ga0495624_0121474 3300046690 Bacteria 1604
1649 Ga0495624_0148236 3300046690 Bacteria 1436
1650 Ga0495670_0053234 3300046691 Bacteria 2027
1651 Ga0495671_0168458 3300046692 Bacteria 1065
1652 Ga0495649_0192630 3300046694 Bacteria 1061
1653 Ga0495589_0221382 3300046794 Bacteria 889
1654 Ga0495589_0243660 3300046794 Bacteria 841
1655 Ga0495600_0003420 3300046809 Bacteria 9334
1656 Ga0495600_0025895 3300046809 Bacteria 3782
1657 Ga0495600_0032711 3300046809 Bacteria 3375
1658 Ga0495600_0101761 3300046809 Bacteria 1872
1659 Ga0495600_0586680 3300046809 Bacteria 678
1660 Ga0495581_0000011 3300047315 Bacteria 63980
1661 Ga0495581_0056549 3300047315 Bacteria 2265
1662 Ga0495581_0238042 3300047315 Bacteria 1064
1663 Ga0495581_0276203 3300047315 Bacteria 982
1664 Ga0495581_0305699 3300047315 Bacteria 929
1665 Ga0495604_0005841 3300047317 Bacteria 9756
1666 Ga0495604_0013536 3300047317 Bacteria 6504
1667 Ga0495604_0027104 3300047317 Bacteria 4559
1668 Ga0495604_0039735 3300047317 Bacteria 3696
1669 Ga0495604_0077370 3300047317 Bacteria 2500
1670 Ga0495604_0171322 3300047317 Bacteria 1526
1671 Ga0495604_0205973 3300047317 Bacteria 1361
1672 Ga0495636_0257927 3300047318 Bacteria 808
1673 Ga0495674_0001053 3300047319 Bacteria 26515
1674 Ga0495674_0008705 3300047319 Bacteria 9652
1675 Ga0495674_0009845 3300047319 Bacteria 9072
1676 Ga0495674_0023678 3300047319 Bacteria 5656
1677 Ga0495674_0125265 3300047319 Bacteria 2168
1678 Ga0495674_0131168 3300047319 Bacteria 2111
1679 Ga0495672_0099731 3300047320 Bacteria 1578
1680 Ga0495672_0259786 3300047320 Bacteria 839
1681 Ga0495672_0355560 3300047320 Bacteria 679
1682 Ga0495676_0076509 3300047321 Bacteria 2555
1683 Ga0495676_0096204 3300047321 Bacteria 2202
1684 Ga0495680_0012021 3300047322 Bacteria 7637
1685 Ga0495680_0027181 3300047322 Bacteria 4705
1686 Ga0495680_0044145 3300047322 Bacteria 3526
1687 Ga0495683_0022488 3300047323 Bacteria 3242
1688 Ga0495683_0066552 3300047323 Bacteria 1775
1689 Ga0495683_0212685 3300047323 Bacteria 866
1690 Ga0495687_034841 3300047443 Bacteria 2269
1691 Ga0495675_0013389 3300047444 Bacteria 5177
1692 Ga0495675_0026387 3300047444 Bacteria 3704
1693 Ga0495675_0115545 3300047444 Bacteria 1673
1694 Ga0495679_074673 3300047446 Bacteria 971
1695 Ga0495673_0171679 3300047469 Bacteria 826
1696 Ga0495673_0241989 3300047469 Bacteria 661
1697 Ga0495684_0011545 3300047471 Bacteria 6824
1698 Ga0495684_0029473 3300047471 Bacteria 4212
1699 Ga0495684_0042716 3300047471 Bacteria 3471
1700 Ga0495684_0356435 3300047471 Bacteria 1037
1701 Ga0495686_0167256 3300047472 Bacteria 1281
1702 Ga0495686_0291793 3300047472 Bacteria 903
1703 Ga0495686_0406994 3300047472 Bacteria 729
1704 Ga0495593_0000209 3300047673 Bacteria 30963
1705 Ga0495593_0021422 3300047673 Bacteria 3611
1706 Ga0495593_0528161 3300047673 Bacteria 592
1707 Ga0495602_0010034 3300048088 Bacteria 9831
1708 Ga0495602_0137385 3300048088 Bacteria 1939
1709 Ga0495602_0183972 3300048088 Bacteria 1609
1710 Ga0495602_0288031 3300048088 Bacteria 1207
1711 Ga0495602_0489199 3300048088 Bacteria 862
1712 Ga0495602_0506547 3300048088 Bacteria 843
1713 Ga0495614_0007619 3300048089 Bacteria 4814
1714 Ga0496100_0002317 3300048903 Bacteria 9638
1715 Ga0496100_0045007 3300048903 Bacteria 2830
1716 Ga0496100_0056928 3300048903 Bacteria 2559
1717 Ga0496100_0252288 3300048903 Bacteria 1305
1718 Ga0496100_0287989 3300048903 Bacteria 1226
1719 Ga0496100_0537518 3300048903 Bacteria 903
1720 Ga0496100_0617975 3300048903 Bacteria 842
1721 Ga0496101_0000648 3300048904 Bacteria 20964
1722 Ga0496101_0034163 3300048904 Bacteria 3590
1723 Ga0496101_0048916 3300048904 Bacteria 3040
1724 Ga0496101_0106879 3300048904 Bacteria 2102
1725 Ga0496101_0364982 3300048904 Bacteria 1135
1726 Ga0496101_0397064 3300048904 Bacteria 1086
1727 Ga0496101_0457391 3300048904 Bacteria 1007
1728 Ga0496101_0648735 3300048904 Bacteria 834
1729 Ga0496101_0818307 3300048904 Bacteria 734
1730 Ga0496101_1238718 3300048904 Bacteria 584
1731 Ga0496102_0001635 3300048905 Bacteria 19757
1732 Ga0496102_0005693 3300048905 Bacteria 10582
1733 Ga0496102_0025539 3300048905 Bacteria 5260
1734 Ga0496102_0048945 3300048905 Bacteria 3844
1735 Ga0496102_0154755 3300048905 Bacteria 2155
1736 Ga0496102_0157220 3300048905 Bacteria 2137
1737 Ga0496102_0184205 3300048905 Bacteria 1967
1738 Ga0496102_0230070 3300048905 Bacteria 1748
1739 Ga0496102_0281655 3300048905 Bacteria 1567
1740 Ga0496102_0322832 3300048905 Bacteria 1454
1741 Ga0496102_0344943 3300048905 Bacteria 1402
1742 Ga0496102_0387045 3300048905 Bacteria 1316
1743 Ga0496102_0404641 3300048905 Bacteria 1283
1744 Ga0496102_0501708 3300048905 Bacteria 1136
1745 Ga0496102_0602278 3300048905 Bacteria 1022
1746 Ga0496102_0960841 3300048905 Bacteria 775
1747 Ga0496102_1165829 3300048905 Bacteria 690
1748 Ga0496103_0010060 3300048906 Bacteria 5593
1749 Ga0496103_0020553 3300048906 Bacteria 3967
1750 Ga0496103_0052012 3300048906 Bacteria 2537
1751 Ga0496103_0053278 3300048906 Unclassified 2507
1752 Ga0496103_0105235 3300048906 Bacteria 1789
1753 Ga0496103_0151222 3300048906 Bacteria 1487
1754 Ga0496103_0170110 3300048906 Bacteria 1399
1755 Ga0496103_0269742 3300048906 Bacteria 1095
1756 Ga0496103_0296652 3300048906 Bacteria 1040
1757 Ga0496103_0417211 3300048906 Bacteria 862
1758 Ga0496104_0003846 3300048907 Bacteria 12994
1759 Ga0496104_0010866 3300048907 Bacteria 8142
1760 Ga0496104_0013631 3300048907 Bacteria 7329
1761 Ga0496104_0018066 3300048907 Bacteria 6429
1762 Ga0496104_0079584 3300048907 Bacteria 3124
1763 Ga0496104_0095659 3300048907 Bacteria 2841
1764 Ga0496104_0232060 3300048907 Bacteria 1757
1765 Ga0496104_0258208 3300048907 Bacteria 1655
1766 Ga0496104_0307385 3300048907 Bacteria 1498
1767 Ga0496104_0307444 3300048907 Bacteria 1498
1768 Ga0496104_0447162 3300048907 Bacteria 1204
1769 Ga0496104_0481360 3300048907 Bacteria 1152
1770 Ga0496104_0522681 3300048907 Bacteria 1098
1771 Ga0496104_0581185 3300048907 Bacteria 1031
1772 Ga0496105_0004124 3300048908 Bacteria 10892
1773 Ga0496105_0007025 3300048908 Bacteria 8672
1774 Ga0496105_0015111 3300048908 Bacteria 6144
1775 Ga0496105_0020682 3300048908 Bacteria 5320
1776 Ga0496105_0047185 3300048908 Bacteria 3554
1777 Ga0496105_0100507 3300048908 Bacteria 2388
1778 Ga0496105_0209615 3300048908 Bacteria 1589
1779 Ga0496105_0314289 3300048908 Bacteria 1257
1780 Ga0496105_0436465 3300048908 Unclassified 1035
1781 Ga0496106_0033959 3300048909 Bacteria 3808
1782 Ga0496106_0043710 3300048909 Unclassified 3362
1783 Ga0496106_0124003 3300048909 Bacteria 2021
1784 Ga0496106_0131246 3300048909 Bacteria 1965
1785 Ga0496106_0147962 3300048909 Bacteria 1851
1786 Ga0496106_0215707 3300048909 Bacteria 1529
1787 Ga0496106_0240972 3300048909 Bacteria 1445
1788 Ga0496106_0598806 3300048909 Bacteria 883
1789 Ga0496106_0707085 3300048909 Bacteria 803
1790 Ga0496106_0864200 3300048909 Bacteria 715
1791 Ga0496107_0014148 3300048910 Bacteria 5586
1792 Ga0496107_0027901 3300048910 Bacteria 4010
1793 Ga0496107_0099767 3300048910 Bacteria 2128
1794 Ga0496107_0114631 3300048910 Bacteria 1983
1795 Ga0496107_0165544 3300048910 Bacteria 1639
1796 Ga0496107_0194873 3300048910 Bacteria 1506
1797 Ga0496107_0215697 3300048910 Bacteria 1427
1798 Ga0496108_0003657 3300048911 Bacteria 12335
1799 Ga0496108_0010006 3300048911 Bacteria 7686
1800 Ga0496108_0048242 3300048911 Bacteria 3560
1801 Ga0496108_0090160 3300048911 Bacteria 2606
1802 Ga0496108_0184989 3300048911 Bacteria 1804
1803 Ga0496108_0281141 3300048911 Bacteria 1449
1804 Ga0496108_0405365 3300048911 Bacteria 1191
1805 Ga0496108_1212680 3300048911 Bacteria 638
1806 Ga0496109_0000980 3300048912 Bacteria 23630
1807 Ga0496109_0105583 3300048912 Bacteria 2616
1808 Ga0496109_0126924 3300048912 Bacteria 2379
1809 Ga0496109_0152961 3300048912 Bacteria 2160
1810 Ga0496109_0170401 3300048912 Bacteria 2042
1811 Ga0496109_0383800 3300048912 Bacteria 1327
1812 Ga0496109_0506910 3300048912 Bacteria 1139
1813 Ga0496109_0509061 3300048912 Bacteria 1136
1814 Ga0496110_0051969 3300048913 Bacteria 3601
1815 Ga0496110_0058595 3300048913 Bacteria 3392
1816 Ga0496110_0060190 3300048913 Unclassified 3348
1817 Ga0496110_0071937 3300048913 Bacteria 3068
1818 Ga0496110_0180534 3300048913 Bacteria 1916
1819 Ga0496110_0767061 3300048913 Bacteria 868
1820 Ga0496110_1075030 3300048913 Bacteria 712
1821 Ga0496111_0032260 3300048914 Bacteria 3733
1822 Ga0496111_0092430 3300048914 Bacteria 2218
1823 Ga0496111_0228758 3300048914 Bacteria 1381
1824 Ga0496111_0391800 3300048914 Bacteria 1027
1825 Ga0496111_0550026 3300048914 Bacteria 847
1826 Ga0496112_0000039 3300048915 Bacteria 91123
1827 Ga0496112_0000622 3300048915 Bacteria 24569
1828 Ga0496112_0002865 3300048915 Bacteria 14019
1829 Ga0496112_0020839 3300048915 Bacteria 6221
1830 Ga0496112_0057096 3300048915 Bacteria 3843
1831 Ga0496112_0063694 3300048915 Bacteria 3637
1832 Ga0496112_0096051 3300048915 Bacteria 2934
1833 Ga0496112_0106666 3300048915 Bacteria 2771
1834 Ga0496112_0157593 3300048915 Bacteria 2237
1835 Ga0496112_0182685 3300048915 Bacteria 2061
1836 Ga0496112_0306368 3300048915 Bacteria 1533
1837 Ga0496112_0432969 3300048915 Bacteria 1253
1838 Ga0496112_0479626 3300048915 Bacteria 1180
1839 Ga0496112_0541223 3300048915 Bacteria 1099
1840 Ga0496112_0978634 3300048915 Bacteria 766
1841 Ga0496113_0003280 3300048916 Bacteria 9661
1842 Ga0496113_0004638 3300048916 Bacteria 8474
1843 Ga0496113_0073839 3300048916 Bacteria 2599
1844 Ga0496113_0074614 3300048916 Bacteria 2586
1845 Ga0496113_0075350 3300048916 Bacteria 2575
1846 Ga0496113_0243802 3300048916 Bacteria 1434
1847 Ga0496113_0281081 3300048916 Bacteria 1331
1848 Ga0496113_0635302 3300048916 Bacteria 854
1849 Ga0496113_1036796 3300048916 Bacteria 645
1850 Ga0496114_0008449 3300048917 Bacteria 8158
1851 Ga0496114_0020318 3300048917 Bacteria 5389
1852 Ga0496114_0046929 3300048917 Bacteria 3591
1853 Ga0496114_0169323 3300048917 Bacteria 1903
1854 Ga0496114_0719958 3300048917 Bacteria 874
1855 Ga0496114_0727442 3300048917 Bacteria 869
1856 Ga0496114_1145899 3300048917 Bacteria 663
1857 Ga0496115_0002904 3300048918 Bacteria 12366
1858 Ga0496115_0005724 3300048918 Bacteria 9048
1859 Ga0496115_0013729 3300048918 Bacteria 6133
1860 Ga0496115_0024897 3300048918 Bacteria 4655
1861 Ga0496115_0043847 3300048918 Bacteria 3567
1862 Ga0496115_0111755 3300048918 Bacteria 2245
1863 Ga0496115_0128154 3300048918 Bacteria 2091
1864 Ga0496115_0141217 3300048918 Bacteria 1987
1865 Ga0496115_0161520 3300048918 Bacteria 1851
1866 Ga0496115_0241956 3300048918 Bacteria 1487
1867 Ga0496115_0447846 3300048918 Unclassified 1043
1868 Ga0496116_0009705 3300048919 Bacteria 8179
1869 Ga0496116_0157588 3300048919 Bacteria 1251
1870 Ga0496116_0175799 3300048919 Bacteria 1153
1871 Ga0496116_0377699 3300048919 Bacteria 637
1872 Ga0496117_0064911 3300048920 Bacteria 2485
1873 Ga0496117_0084139 3300048920 Bacteria 2077
1874 Ga0496117_0183531 3300048920 Bacteria 1200
1875 Ga0496117_0345102 3300048920 Bacteria 771
1876 Ga0496118_0006064 3300048921 Bacteria 13465
1877 Ga0496118_0009367 3300048921 Bacteria 9915
1878 Ga0496118_0173926 3300048921 Bacteria 1311
1879 Ga0496118_0224781 3300048921 Bacteria 1089
1880 Ga0496119_0026644 3300048922 Bacteria 4001
1881 Ga0496119_0043726 3300048922 Bacteria 2827
1882 Ga0496120_0011600 3300048923 Bacteria 6051
1883 Ga0496120_0045275 3300048923 Bacteria 2549
1884 Ga0496120_0114707 3300048923 Bacteria 1402
1885 Ga0496121_0000868 3300048924 Bacteria 54616
1886 Ga0496121_0001157 3300048924 Bacteria 46239
1887 Ga0496121_0049110 3300048924 Bacteria 3582
1888 Ga0496121_0050969 3300048924 Bacteria 3490
1889 Ga0496121_0069775 3300048924 Bacteria 2834
1890 Ga0496121_0090761 3300048924 Bacteria 2387
1891 Ga0496121_0092561 3300048924 Bacteria 2356
1892 Ga0496121_0170339 3300048924 Bacteria 1582
1893 Ga0496121_0221136 3300048924 Bacteria 1334
1894 Ga0496121_0223389 3300048924 Bacteria 1325
1895 Ga0496122_0118718 3300048925 Bacteria 1712
1896 Ga0496122_0143879 3300048925 Bacteria 1486
1897 Ga0496123_0123055 3300048926 Bacteria 1454
1898 Ga0496124_0021056 3300048927 Bacteria 6013
1899 Ga0496124_0097903 3300048927 Bacteria 2381
1900 Ga0496124_0128012 3300048927 Bacteria 2021
1901 Ga0496124_0168541 3300048927 Bacteria 1699
1902 Ga0496124_0562225 3300048927 Bacteria 750
1903 Ga0496125_0038850 3300048928 Bacteria 4110
1904 Ga0496125_0089224 3300048928 Bacteria 2320
1905 Ga0496125_0172994 3300048928 Bacteria 1449
1906 Ga0496125_0190334 3300048928 Bacteria 1355
1907 Ga0496126_0002588 3300048929 Bacteria 24124
1908 Ga0496126_0007487 3300048929 Bacteria 11959
1909 Ga0496126_0045817 3300048929 Bacteria 4016
1910 Ga0496126_0050629 3300048929 Bacteria 3784
1911 Ga0496126_0065300 3300048929 Bacteria 3257
1912 Ga0496126_0066290 3300048929 Bacteria 3228
1913 Ga0496126_0068168 3300048929 Bacteria 3177
1914 Ga0496126_0087269 3300048929 Bacteria 2749
1915 Ga0496126_0092720 3300048929 Bacteria 2653
1916 Ga0496126_0118408 3300048929 Bacteria 2299
1917 Ga0496126_0143078 3300048929 Bacteria 2056
1918 Ga0496126_0161879 3300048929 Bacteria 1912
1919 Ga0496126_0169312 3300048929 Bacteria 1862
1920 Ga0496126_0177964 3300048929 Bacteria 1808
1921 Ga0496126_0193402 3300048929 Bacteria 1722
1922 Ga0496126_0278724 3300048929 Bacteria 1385
1923 Ga0496126_0294445 3300048929 Bacteria 1341
1924 Ga0496126_0310868 3300048929 Bacteria 1297
1925 Ga0496126_0547834 3300048929 Bacteria 918
1926 Ga0496126_0552433 3300048929 Bacteria 913
1927 Ga0496126_0866649 3300048929 Bacteria 687
1928 Ga0496126_0973589 3300048929 Bacteria 638
1929 Ga0495682_0032176 3300049460 Bacteria 1938
1930 Ga0501031_0030795 3300049568 Bacteria 3500
1931 Ga0501031_0067611 3300049568 Bacteria 2327
1932 Ga0501032_0000086 3300049569 Bacteria 81788
1933 Ga0501032_0001083 3300049569 Bacteria 21774
1934 Ga0501032_0573843 3300049569 Bacteria 718
1935 Ga0501033_0000116 3300049570 Bacteria 76410
1936 Ga0501033_0004811 3300049570 Bacteria 10786
1937 Ga0501033_0026010 3300049570 Bacteria 4404
1938 Ga0501033_0084108 3300049570 Bacteria 2332
1939 Ga0501034_0000108 3300049571 Bacteria 152258
1940 Ga0501034_0009225 3300049571 Bacteria 10342
1941 Ga0501034_0093381 3300049571 Bacteria 3005
1942 Ga0501036_0000065 3300049572 Bacteria 68031
1943 Ga0501036_0001511 3300049572 Bacteria 17940
1944 Ga0501037_0000173 3300049573 Bacteria 61084
1945 Ga0501037_0001396 3300049573 Bacteria 17728
1946 Ga0501037_0092548 3300049573 Bacteria 2187
1947 Ga0501037_0098180 3300049573 Bacteria 2116
1948 Ga0501038_0000416 3300049574 Bacteria 36963
1949 Ga0501038_0001849 3300049574 Bacteria 19541
1950 Ga0501038_0328592 3300049574 Bacteria 1195
1951 Ga0501038_0728706 3300049574 Bacteria 741
1952 Ga0501039_0000265 3300049575 Bacteria 38188
1953 Ga0501039_0001908 3300049575 Bacteria 15432
1954 Ga0501039_0056245 3300049575 Bacteria 3047
1955 Ga0501039_0581645 3300049575 Bacteria 878
1956 Ga0501042_0373583 3300049578 Bacteria 1032
1957 Ga0501043_0000226 3300049579 Bacteria 51303
1958 Ga0501043_0001794 3300049579 Bacteria 18435
1959 Ga0501043_0088222 3300049579 Bacteria 2437
1960 Ga0501043_0209139 3300049579 Bacteria 1512
1961 Ga0501046_0002295 3300049580 Bacteria 18039
1962 Ga0501046_0002922 3300049580 Bacteria 15807
1963 Ga0501046_0057022 3300049580 Bacteria 3065
1964 Ga0501046_0064839 3300049580 Bacteria 2851
1965 Ga0501047_0000325 3300049581 Bacteria 55223
1966 Ga0501047_0075613 3300049581 Bacteria 3241
1967 Ga0501047_0172020 3300049581 Bacteria 2034
1968 Ga0501047_0200519 3300049581 Bacteria 1856
1969 Ga0501047_0265558 3300049581 Bacteria 1563
1970 Ga0501047_0843666 3300049581 Bacteria 730
1971 Ga0501047_0882390 3300049581 Bacteria 708
1972 Ga0501048_0017293 3300049582 Bacteria 5312
1973 Ga0501048_0025050 3300049582 Bacteria 4351
1974 Ga0501067_0001155 3300049583 Bacteria 14322
1975 Ga0501067_0053367 3300049583 Bacteria 2240
1976 Ga0501067_0064556 3300049583 Bacteria 2027
1977 Ga0501068_0002505 3300049584 Bacteria 9756
1978 Ga0501068_0007958 3300049584 Bacteria 5876
1979 Ga0501068_0290720 3300049584 Bacteria 1045
1980 Ga0501069_0000334 3300049585 Bacteria 21262
1981 Ga0501069_0001508 3300049585 Bacteria 11512
1982 Ga0501069_0348001 3300049585 Bacteria 873
1983 Ga0501069_0394318 3300049585 Bacteria 819
1984 Ga0501070_0000560 3300049586 Bacteria 33902
1985 Ga0501070_0008334 3300049586 Bacteria 8757
1986 Ga0501070_0059865 3300049586 Bacteria 3157
1987 Ga0501070_0127900 3300049586 Bacteria 2099
1988 Ga0501070_0182667 3300049586 Bacteria 1726
1989 Ga0501070_0184977 3300049586 Bacteria 1714
1990 Ga0501070_0259920 3300049586 Bacteria 1419
1991 Ga0501070_0600506 3300049586 Bacteria 877
1992 Ga0501072_0007218 3300049588 Bacteria 8434
1993 Ga0501072_0107925 3300049588 Bacteria 2214
1994 Ga0501073_0000058 3300049589 Bacteria 70421
1995 Ga0501073_0001880 3300049589 Bacteria 15625
1996 Ga0501073_0033545 3300049589 Bacteria 3655
1997 Ga0501073_0070511 3300049589 Bacteria 2435
1998 Ga0501073_0118663 3300049589 Bacteria 1833
1999 Ga0501073_0120442 3300049589 Bacteria 1819
2000 Ga0501073_0172987 3300049589 Bacteria 1495
2001 Ga0501074_0000493 3300049590 Bacteria 24109
2002 Ga0501074_0001430 3300049590 Bacteria 15941
2003 Ga0501074_0092468 3300049590 Bacteria 2166
2004 Ga0501076_0225195 3300049592 Bacteria 1533
2005 Ga0501076_0280820 3300049592 Bacteria 1364
2006 Ga0501076_0868484 3300049592 Bacteria 744
2007 Ga0501079_0007949 3300049741 Bacteria 8041
2008 Ga0501079_0060942 3300049741 Bacteria 2911
2009 Ga0501079_0076867 3300049741 Bacteria 2582
2010 Ga0501079_0924853 3300049741 Bacteria 687
2011 Ga0501080_0000317 3300049742 Bacteria 36817
2012 Ga0501080_0001937 3300049742 Bacteria 17876
2013 Ga0501080_0050868 3300049742 Bacteria 3855
2014 Ga0501080_0053502 3300049742 Bacteria 3759
2015 Ga0501080_0107885 3300049742 Bacteria 2581
2016 Ga0501083_0000286 3300049744 Bacteria 32127
2017 Ga0501083_0003151 3300049744 Bacteria 11479
2018 Ga0501083_0039418 3300049744 Bacteria 3209
2019 Ga0501083_0064149 3300049744 Bacteria 2448
2020 Ga0501083_0155657 3300049744 Bacteria 1496
2021 Ga0501035_0000079 3300049822 Bacteria 118194
2022 Ga0501035_0006457 3300049822 Bacteria 11011
2023 Ga0501035_0210914 3300049822 Bacteria 1661
2024 Ga0501035_0505600 3300049822 Bacteria 994
2025 Ga0501035_0667224 3300049822 Bacteria 841
2026 Ga0501044_0000085 3300049823 Bacteria 114339
2027 Ga0501044_0003491 3300049823 Bacteria 17698
2028 Ga0501044_0040477 3300049823 Bacteria 4857
2029 Ga0501044_0047276 3300049823 Bacteria 4451
2030 Ga0501044_0164033 3300049823 Bacteria 2197
2031 Ga0501044_0166353 3300049823 Bacteria 2179
2032 Ga0501044_0408425 3300049823 Bacteria 1269
2033 Ga0501044_0693483 3300049823 Bacteria 904
2034 Ga0501045_0060047 3300049824 Bacteria 2787
2035 nmdc:mga03683_318339_c1 3300050489 Bacteria 732
2036 nmdc:mga03683_92071_c1 3300050489 Bacteria 1323
2037 nmdc:mga03n38_201503_c1 3300050490 Bacteria 1030
2038 nmdc:mga03n38_8874_c1 3300050490 Bacteria 3629
2039 nmdc:mga00v17_113171_c1 3300050491 Bacteria 1723
2040 nmdc:mga00v17_129639_c1 3300050491 Bacteria 1611
2041 nmdc:mga00v17_466050_c1 3300050491 Bacteria 820
2042 nmdc:mga0yw44_235648_c1 3300050492 Bacteria 1216
2043 nmdc:mga0yw44_380097_c1 3300050492 Bacteria 954
2044 nmdc:mga0k408_113107_c1 3300050493 Bacteria 1605
2045 nmdc:mga0k408_146845_c1 3300050493 Bacteria 1404
2046 nmdc:mga0k408_68779_c1 3300050493 Bacteria 2066
2047 nmdc:mga06z11_102195_c1 3300050494 Bacteria 1575
2048 nmdc:mga06z11_5930_c1 3300050494 Bacteria 4935
2049 nmdc:mga04h51_18815_c1 3300050495 Bacteria 2040
2050 nmdc:mga04h51_32865_c1 3300050495 Bacteria 1648
2051 nmdc:mga07m45_265178_c1 3300050496 Bacteria 999
2052 nmdc:mga07m45_28600_c1 3300050496 Bacteria 3077
2053 nmdc:mga07m45_348726_c1 3300050496 Bacteria 860
2054 nmdc:mga07m45_56467_c1 3300050496 Bacteria 2219
2055 nmdc:mga07m45_97123_c1 3300050496 Bacteria 1691
2056 nmdc:mga05p37_116860_c1 3300050507 Bacteria 3278
2057 nmdc:mga05p37_14669_c1 3300050507 Bacteria 9413
2058 nmdc:mga05p37_190945_c1 3300050507 Bacteria 2487
2059 nmdc:mga05p37_541593_c1 3300050507 Bacteria 1327
2060 nmdc:mga09592_579874_c1 3300050508 Bacteria 962
2061 nmdc:mga06r32_87339_c1 3300050510 Bacteria 3043
2062 nmdc:mga08y16_201463_c1 3300050511 Bacteria 2063
2063 nmdc:mga0n895_1170165_c1 3300050512 Bacteria 744
2064 nmdc:mga0n895_137076_c1 3300050512 Bacteria 2474
2065 nmdc:mga0n895_17804_c1 3300050512 Bacteria 6559
2066 nmdc:mga0n895_503889_c1 3300050512 Bacteria 1219
2067 nmdc:mga0n895_662_c1 3300050512 Bacteria 24071
2068 nmdc:mga0n895_9753_c1 3300050512 Bacteria 8425
2069 nmdc:mga0rr50_10959_c1 3300050513 Bacteria 5783
2070 nmdc:mga0rr50_17170_c1 3300050513 Bacteria 4825
2071 nmdc:mga0rr50_55771_c1 3300050513 Bacteria 2949
2072 nmdc:mga0rr50_65971_c1 3300050513 Bacteria 2744
2073 nmdc:mga08x19_241247_c1 3300050514 Bacteria 1246
2074 nmdc:mga08x19_3966_c1 3300050514 Bacteria 8807
2075 nmdc:mga08x19_656913_c1 3300050514 Bacteria 744
2076 nmdc:mga08x19_8013_c1 3300050514 Bacteria 6278
2077 nmdc:mga0a205_2883_c1 3300050515 Bacteria 13127
2078 nmdc:mga0a205_5062_c1 3300050515 Bacteria 11859
2079 nmdc:mga0a205_506819_c1 3300050515 Bacteria 1063
2080 nmdc:mga0sz30_113071_c1 3300050516 Bacteria 1191
2081 nmdc:mga0sz30_33134_c1 3300050516 Bacteria 2146
2082 Ga0495601_0012431 3300053077 Bacteria 5108
2083 Ga0495601_0038162 3300053077 Bacteria 3003
2084 Ga0495601_0047689 3300053077 Bacteria 2697
2085 Ga0495601_0059658 3300053077 Bacteria 2420
2086 Ga0495601_0292932 3300053077 Bacteria 1061
2087 Ga0495612_0015113 3300053078 Bacteria 3095
2088 Ga0495612_0016164 3300053078 Bacteria 2990
2089 Ga0500610_0228911 3300053079 Bacteria 874
2090 Ga0500635_0001194 3300053080 Bacteria 6219
2091 Ga0500635_0001309 3300053080 Bacteria 5949
2092 Ga0500635_0056405 3300053080 Bacteria 1359
2093 Ga0495655_0025140 3300053083 Bacteria 1390
2094 Ga0495655_0051877 3300053083 Bacteria 1089
2095 Ga0495595_0006178 3300053084 Bacteria 4871
2096 Ga0495595_0013228 3300053084 Bacteria 3484
2097 Ga0495595_0092866 3300053084 Bacteria 1449
2098 Ga0495595_0095942 3300053084 Bacteria 1427
2099 Ga0495619_0074586 3300053085 Bacteria 2275
2100 Ga0495619_0136591 3300053085 Bacteria 1687
2101 Ga0495619_0140224 3300053085 Bacteria 1664
2102 Ga0495619_0225010 3300053085 Bacteria 1300
2103 Ga0495619_0258211 3300053085 Bacteria 1207
2104 Ga0500643_000007 3300053087 Bacteria 462836
2105 Ga0500644_0012070 3300053088 Bacteria 2380
2106 Ga0500646_0074071 3300053090 Bacteria 1027
2107 Ga0500646_0163234 3300053090 Bacteria 745
2108 Ga0500646_0174135 3300053090 Bacteria 725
2109 Ga0500647_0006809 3300053091 Bacteria 4865
2110 Ga0500583_0297877 3300053092 Bacteria 789
2111 Ga0500583_0354714 3300053092 Bacteria 710
2112 Ga0500651_0011013 3300053093 Bacteria 5440
2113 Ga0500566_0000003 3300053094 Bacteria 166820
2114 Ga0500566_0001155 3300053094 Bacteria 15356
2115 Ga0500566_0039034 3300053094 Bacteria 2746
2116 Ga0500566_0214652 3300053094 Bacteria 961
2117 Ga0500640_000579 3300053095 Bacteria 9420
2118 Ga0500641_0001798 3300053096 Bacteria 7601
2119 Ga0500641_0031420 3300053096 Bacteria 2094
2120 Ga0500641_0035927 3300053096 Bacteria 1980
2121 Ga0500648_191769 3300053097 Bacteria 1038
2122 Ga0500650_0244547 3300053098 Bacteria 806
2123 Ga0500554_000816 3300053102 Bacteria 6136
2124 Ga0500555_001725 3300053103 Bacteria 6562
2125 Ga0500555_016907 3300053103 Bacteria 2102
2126 Ga0500555_044228 3300053103 Bacteria 1233
2127 Ga0500556_0005578 3300053104 Bacteria 3553
2128 Ga0500557_000052 3300053105 Bacteria 50636
2129 Ga0500562_030999 3300053108 Bacteria 1410
2130 Ga0500569_045808 3300053109 Bacteria 1301
2131 Ga0500572_002602 3300053111 Bacteria 4288
2132 Ga0500572_003949 3300053111 Bacteria 3368
2133 Ga0500572_075652 3300053111 Bacteria 1047
2134 Ga0500591_111664 3300053115 Bacteria 1144
2135 Ga0500594_0223550 3300053118 Bacteria 623
2136 Ga0500595_000395 3300053119 Bacteria 28044
2137 Ga0500595_002313 3300053119 Bacteria 9533
2138 Ga0500595_010388 3300053119 Bacteria 3702
2139 Ga0500595_023883 3300053119 Bacteria 2142
2140 Ga0500595_110998 3300053119 Bacteria 780
2141 Ga0500607_012093 3300053121 Bacteria 5081
2142 Ga0500608_003401 3300053122 Bacteria 5958
2143 Ga0500608_014443 3300053122 Bacteria 3527
2144 Ga0500614_012420 3300053123 Bacteria 1858
2145 Ga0500621_098790 3300053126 Bacteria 1154
2146 Ga0500626_163139 3300053128 Bacteria 914
2147 Ga0500642_0000306 3300053130 Bacteria 17531
2148 Ga0500642_0000414 3300053130 Bacteria 13963
2149 Ga0500642_0018796 3300053130 Bacteria 2681
2150 Ga0500642_0055511 3300053130 Bacteria 1762
2151 Ga0500652_181167 3300053131 Bacteria 863
2152 Ga0500658_0065368 3300053134 Bacteria 1523
2153 Ga0500658_0093358 3300053134 Bacteria 1304
2154 Ga0500559_0001626 3300053136 Bacteria 12489
2155 Ga0500559_0002366 3300053136 Bacteria 9829
2156 Ga0500559_0013274 3300053136 Bacteria 3490
2157 Ga0500559_0013422 3300053136 Bacteria 3469
2158 Ga0500559_0042434 3300053136 Bacteria 1984
2159 Ga0500559_0051986 3300053136 Bacteria 1810
2160 Ga0500559_0391540 3300053136 Bacteria 647
2161 Ga0500568_0088527 3300053139 Bacteria 1169
2162 Ga0500568_0236792 3300053139 Bacteria 666
2163 Ga0500573_0065364 3300053140 Bacteria 2079
2164 Ga0500573_0198215 3300053140 Bacteria 1068
2165 Ga0500577_0030213 3300053142 Bacteria 1884
2166 Ga0500577_0300642 3300053142 Bacteria 700
2167 Ga0500588_0303384 3300053146 Bacteria 604
2168 Ga0500589_131606 3300053147 Bacteria 1044
2169 Ga0500589_185958 3300053147 Bacteria 812
2170 Ga0500590_131278 3300053148 Bacteria 1158
2171 Ga0500590_174959 3300053148 Bacteria 939
2172 Ga0500603_000184 3300053150 Bacteria 16166
2173 Ga0500603_002335 3300053150 Bacteria 4169
2174 Ga0500603_091156 3300053150 Bacteria 895
2175 Ga0500604_0001384 3300053151 Bacteria 6751
2176 Ga0500604_0018792 3300053151 Bacteria 1930
2177 Ga0500604_0020084 3300053151 Bacteria 1877
2178 Ga0500604_0132721 3300053151 Bacteria 838
2179 Ga0500616_0000997 3300053153 Bacteria 30619
2180 Ga0500616_0028617 3300053153 Bacteria 3070
2181 Ga0500620_085238 3300053155 Bacteria 1097
2182 Ga0500622_0023013 3300053156 Bacteria 3300
2183 Ga0500622_0152746 3300053156 Bacteria 1090
2184 Ga0500627_0087461 3300053158 Bacteria 1393
2185 Ga0500627_0102022 3300053158 Bacteria 1288
2186 Ga0500630_001089 3300053159 Bacteria 12674
2187 Ga0500634_0081961 3300053161 Bacteria 1660
2188 Ga0500638_016718 3300053162 Bacteria 3393
2189 Ga0500638_088132 3300053162 Bacteria 1465
2190 Ga0500639_000033 3300053163 Bacteria 68969
2191 Ga0500639_036153 3300053163 Bacteria 2605
2192 Ga0500639_181940 3300053163 Bacteria 928
2193 Ga0500636_0000042 3300053177 Bacteria 69412
2194 Ga0500636_0017069 3300053177 Bacteria 4282
2195 Ga0500636_0073613 3300053177 Bacteria 1978
2196 Ga0500637_0000026 3300053178 Bacteria 59050
2197 Ga0500637_0007084 3300053178 Bacteria 5584
2198 Ga0500637_0370156 3300053178 Bacteria 755
2199 Ga0500625_000139 3300053729 Bacteria 14808
2200 Ga0500645_028397 3300053730 Bacteria 1693
2201 Ga0500645_100990 3300053730 Bacteria 814
2202 Ga0500609_001833 3300053731 Bacteria 3078
2203 Ga0500609_006897 3300053731 Bacteria 1540
2204 Ga0500609_014847 3300053731 Bacteria 1054
2205 Ga0500609_026818 3300053731 Bacteria 790
2206 Ga0500596_001686 3300053735 Bacteria 4475
2207 Ga0500596_004563 3300053735 Bacteria 2527
2208 Ga0500599_001249 3300053736 Bacteria 2907
2209 Ga0500601_000553 3300053737 Bacteria 5521
2210 Ga0501084_0010662 3300054114 Bacteria 7607
2211 Ga0501084_0020382 3300054114 Bacteria 5529
2212 Ga0501084_0098331 3300054114 Bacteria 2457
2213 Ga0501084_0355186 3300054114 Bacteria 1238
2214 Ga0500661_002036 3300055283 Bacteria 3816
2215 Ga0500661_009951 3300055283 Bacteria 1734
2216 Ga0590074_017657 3300059423 Bacteria 1220
2217 Ga0501082_0002220 3300060353 Bacteria 16980
2218 Ga0501082_0014490 3300060353 Bacteria 6787
2219 Ga0501082_0018904 3300060353 Bacteria 5936
2220 Ga0501082_0510417 3300060353 Bacteria 1051
2221 Ga0466962_0100235 3300061719 Bacteria 1391

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009174 Ga0105241_10783554 Ga0105241_107835542 176
2 3300031090 Ga0265760_10000094 Ga0265760_1000009420 176
3 3300035724 Ga0373933_0672289 Ga0373933_0672289_26_556 176
4 3300037853 Ga0436364_0032184 Ga0436364_0032184_61_591 176
5 3300039438 Ga0436360_1200965 Ga0436360_1200965_86_619 176
6 3300041496 Ga0451839_0912736 Ga0451839_0912736_139_669 176
7 3300046455 Ga0495603_0176863 Ga0495603_0176863_25_555 176
8 3300046472 Ga0495580_0164039 Ga0495580_0164039_198_728 176
9 3300046518 Ga0495631_0206324 Ga0495631_0206324_287_817 176
10 3300047472 Ga0495686_0406994 Ga0495686_0406994_20_550 176
11 3300047673 Ga0495593_0528161 Ga0495593_0528161_17_547 176
12 3300048904 Ga0496101_1238718 Ga0496101_1238718_12_542 176
13 3300048911 Ga0496108_1212680 Ga0496108_1212680_20_550 176
14 3300048929 Ga0496126_0973589 Ga0496126_0973589_91_621 176
15 3300053126 Ga0500621_098790 Ga0500621_098790_607_1137 176
16 3300053136 Ga0500559_0391540 Ga0500559_0391540_12_542 176
17 3300012495 Ga0157323_1024153 Ga0157323_10241531 178
18 3300044719 Ga0466971_0550961 Ga0466971_0550961_17_553 178
19 3300046459 Ga0495629_0015868 Ga0495629_0015868_4864_5400 178
20 3300046524 Ga0495648_0168063 Ga0495648_0168063_17_553 178
21 3300053085 Ga0495619_0258211 Ga0495619_0258211_10_546 178
22 iso_pu_bacteria 2977957713 2977961079 178
23 3300025914 Ga0207671_10783091 Ga0207671_107830911 179
24 3300048920 Ga0496117_0345102 Ga0496117_0345102_120_755 179
25 3300025906 Ga0207699_10704563 Ga0207699_107045631 180
26 3300035691 Ga0373931_0197544 Ga0373931_0197544_82_678 180
27 3300048904 Ga0496101_0048916 Ga0496101_0048916_1649_2245 180
28 3300048905 Ga0496102_0001635 Ga0496102_0001635_14821_15417 180
29 iso_pu_bacteria 2874131515 2874131722 180
30 iso_pu_bacteria 8004300914 8004304302 181
31 3300025939 Ga0207665_10302478 Ga0207665_103024782 182
32 iso_pu_bacteria 8019597564 8019600368 182
33 3300010375 Ga0105239_10248118 Ga0105239_102481182 184
34 3300035090 Ga0373949_0078419 Ga0373949_0078419_312_866 184
35 3300005445 Ga0070708_100050654 Ga0070708_1000506544 187
36 3300005467 Ga0070706_100447608 Ga0070706_1004476082 187
37 3300005468 Ga0070707_100089822 Ga0070707_1000898223 187
38 3300005518 Ga0070699_100015169 Ga0070699_1000151694 187
39 3300025922 Ga0207646_10010676 Ga0207646_100106763 187
40 3300005367 Ga0070667_100465446 Ga0070667_1004654461 188
41 3300005545 Ga0070695_100213540 Ga0070695_1002135402 188
42 3300005843 Ga0068860_100228894 Ga0068860_1002288942 188
43 3300006028 Ga0070717_10361075 Ga0070717_103610752 188
44 3300009101 Ga0105247_10037405 Ga0105247_100374054 188
45 3300009174 Ga0105241_10016613 Ga0105241_100166134 188
46 3300014968 Ga0157379_10002961 Ga0157379_100029615 188
47 3300025911 Ga0207654_10025006 Ga0207654_100250063 188
48 3300025986 Ga0207658_10395271 Ga0207658_103952711 188
49 3300048906 Ga0496103_0052012 Ga0496103_0052012_981_1577 188
50 3300048907 Ga0496104_0095659 Ga0496104_0095659_531_1127 188
51 3300025909 Ga0207705_10496024 Ga0207705_104960242 190
52 iso_pu_bacteria 2507262055 2507508223 190
53 iso_pu_bacteria 2508501009 2508542292 190
54 iso_pu_bacteria 2508501042 2508691946 190
55 iso_pu_bacteria 2508501128 2509148371 190
56 iso_pu_bacteria 2511231028 2511397521 190
57 iso_pu_bacteria 2513237087 2513589226 190
58 iso_pu_bacteria 2513237092 2513622352 190
59 iso_pu_bacteria 2513237094 2513640529 190
60 iso_pu_bacteria 2513237095 2513645447 190
61 iso_pu_bacteria 2513237096 2513657154 190
62 iso_pu_bacteria 2513237098 2513674044 190
63 iso_pu_bacteria 2513237101 2513693740 190
64 iso_pu_bacteria 2513237102 2513701717 190
65 iso_pu_bacteria 2513237104 2513718395 190
66 iso_pu_bacteria 2513237137 2513863160 190
67 iso_pu_bacteria 2513237139 2513873135 190
68 iso_pu_bacteria 2513237141 2513892627 190
69 iso_pu_bacteria 2513237145 2513919162 190
70 iso_pu_bacteria 2513237161 2514016520 190
71 iso_pu_bacteria 2515154112 2515627271 190
72 iso_pu_bacteria 2517093001 2517102626 190
73 iso_pu_bacteria 2517572143 2517891145 190
74 iso_pu_bacteria 2524023205 2524437734 190
75 iso_pu_bacteria 2524023210 2524465596 190
76 iso_pu_bacteria 2524023228 2524533671 190
77 iso_pu_bacteria 2528768022 2528848703 190
78 iso_pu_bacteria 2617270735 2617346996 190
79 iso_pu_bacteria 2617270741 2617375414 190
80 iso_pu_bacteria 2643221736 2644743386 190
81 iso_pu_bacteria 2667528175 2671123253 190
82 iso_pu_bacteria 2721755755 2723843481 190
83 iso_pu_bacteria 2738543024 2739309936 190
84 iso_pu_bacteria 2744054633 2745081201 190
85 iso_pu_bacteria 2791355196 2793062598 190
86 iso_pu_bacteria 2791355197 2793066488 190
87 iso_pu_bacteria 2791355199 2793083994 190
88 iso_pu_bacteria 2802429603 2805914966 190
89 iso_pu_bacteria 2816332527 2818239674 190
90 iso_pu_bacteria 2818991467 2819718474 190
91 iso_pu_bacteria 2821443989 2821450575 190
92 iso_pu_bacteria 2824600985 2824602356 190
93 iso_pu_bacteria 2824609381 2824610550 190
94 iso_pu_bacteria 2824617872 2824618110 190
95 iso_pu_bacteria 2824626560 2824626778 190
96 iso_pu_bacteria 2824635225 2824636587 190
97 iso_pu_bacteria 2824644064 2824645121 190
98 iso_pu_bacteria 2824653114 2824654325 190
99 iso_pu_bacteria 2824661429 2824661590 190
100 iso_pu_bacteria 2824671348 2824672039 190
101 iso_pu_bacteria 2824679649 2824679863 190
102 iso_pu_bacteria 2824687955 2824688638 190
103 iso_pu_bacteria 2824696289 2824697126 190
104 iso_pu_bacteria 2824704595 2824705090 190
105 iso_pu_bacteria 2824714736 2824715718 190
106 iso_pu_bacteria 2824723954 2824725201 190
107 iso_pu_bacteria 2824732956 2824733425 190
108 iso_pu_bacteria 2824746037 2824746448 190
109 iso_pu_bacteria 2824753945 2824754373 190
110 iso_pu_bacteria 2824763712 2824767872 190
111 iso_pu_bacteria 2824773399 2824775252 190
112 iso_pu_bacteria 2838122688 2838123350 190
113 iso_pu_bacteria 2841760612 2841764663 190
114 iso_pu_bacteria 2841941048 2841946644 190
115 iso_pu_bacteria 2841949485 2841954123 190
116 iso_pu_bacteria 2841957949 2841960976 190
117 iso_pu_bacteria 2841966195 2841969501 190
118 iso_pu_bacteria 2841974524 2841974615 190
119 iso_pu_bacteria 2841983080 2841983826 190
120 iso_pu_bacteria 2842038055 2842040182 190
121 iso_pu_bacteria 2842045827 2842046873 190
122 iso_pu_bacteria 2844104063 2844107889 190
123 iso_pu_bacteria 2844315083 2844319406 190
124 iso_pu_bacteria 2844533157 2844535838 190
125 iso_pu_bacteria 2847930680 2847936582 190
126 iso_pu_bacteria 2847939898 2847946926 190
127 iso_pu_bacteria 2849076700 2849078963 190
128 iso_pu_bacteria 2851182111 2851183308 190
129 iso_pu_bacteria 2851246043 2851249995 190
130 iso_pu_bacteria 2857509624 2857515912 190
131 iso_pu_bacteria 2869162929 2869164937 190
132 iso_pu_bacteria 2874590934 2874598407 190
133 iso_pu_bacteria 2874604998 2874611604 190
134 iso_pu_bacteria 2874612657 2874619378 190
135 iso_pu_bacteria 2874620515 2874626407 190
136 iso_pu_bacteria 2874628541 2874632269 190
137 iso_pu_bacteria 2874645413 2874652538 190
138 iso_pu_bacteria 2876761206 2876764956 190
139 iso_pu_bacteria 2876771140 2876778115 190
140 iso_pu_bacteria 2876808645 2876813602 190
141 iso_pu_bacteria 2876818435 2876826016 190
142 iso_pu_bacteria 2879074833 2879081909 190
143 iso_pu_bacteria 2879083081 2879088074 190
144 iso_pu_bacteria 2879099564 2879108343 190
145 iso_pu_bacteria 2879110137 2879117468 190
146 iso_pu_bacteria 2879127579 2879135031 190
147 iso_pu_bacteria 2879142872 2879149716 190
148 iso_pu_bacteria 2881364244 2881368467 190
149 iso_pu_bacteria 2881665667 2881672532 190
150 iso_pu_bacteria 2883291878 2883295365 190
151 iso_pu_bacteria 2883354860 2883358232 190
152 iso_pu_bacteria 2884298095 2884301501 190
153 iso_pu_bacteria 2885366525 2885369260 190
154 iso_pu_bacteria 2885374607 2885378225 190
155 iso_pu_bacteria 2885383462 2885389810 190
156 iso_pu_bacteria 2885409591 2885413316 190
157 iso_pu_bacteria 2888378607 2888384475 190
158 iso_pu_bacteria 2888388044 2888393435 190
159 iso_pu_bacteria 2888419890 2888424925 190
160 iso_pu_bacteria 2889033259 2889037794 190
161 iso_pu_bacteria 2903727486 2903734348 190
162 iso_pu_bacteria 2903748898 2903752234 190
163 iso_pu_bacteria 2903768456 2903775917 190
164 iso_pu_bacteria 2904666416 2904671746 190
165 iso_pu_bacteria 2904690495 2904698955 190
166 iso_pu_bacteria 2904699407 2904701024 190
167 iso_pu_bacteria 2904711408 2904715096 190
168 iso_pu_bacteria 2906602504 2906605592 190
169 iso_pu_bacteria 2906610324 2906616325 190
170 iso_pu_bacteria 2906626472 2906627162 190
171 iso_pu_bacteria 2906635258 2906641530 190
172 iso_pu_bacteria 2906643746 2906646194 190
173 iso_pu_bacteria 2906660503 2906662892 190
174 iso_pu_bacteria 2908739725 2908741465 190
175 iso_pu_bacteria 2908756301 2908758752 190
176 iso_pu_bacteria 2908775508 2908780528 190
177 iso_pu_bacteria 2915650412 2915651361 190
178 iso_pu_bacteria 2922361189 2922361737 190
179 iso_pu_bacteria 2922368715 2922374887 190
180 iso_pu_bacteria 2922386360 2922387013 190
181 iso_pu_bacteria 2922393267 2922400428 190
182 iso_pu_bacteria 2922425934 2922431677 190
183 iso_pu_bacteria 2929615660 2929621931 190
184 iso_pu_bacteria 2929624759 2929629762 190
185 iso_pu_bacteria 2932784394 2932788798 190
186 iso_pu_bacteria 2932794094 2932797997 190
187 iso_pu_bacteria 2932801729 2932807161 190
188 iso_pu_bacteria 2932809354 2932812772 190
189 iso_pu_bacteria 2932818245 2932819136 190
190 iso_pu_bacteria 2932828146 2932830464 190
191 iso_pu_bacteria 2933577622 2933583793 190
192 iso_pu_bacteria 2935608549 2935609294 190
193 iso_pu_bacteria 2935616580 2935616758 190
194 iso_pu_bacteria 2935630451 2935635775 190
195 iso_pu_bacteria 2935638405 2935641912 190
196 iso_pu_bacteria 2935648319 2935650916 190
197 iso_pu_bacteria 2935656913 2935659097 190
198 iso_pu_bacteria 2935665750 2935673043 190
199 iso_pu_bacteria 2935675223 2935675848 190
200 iso_pu_bacteria 2935684952 2935685845 190
201 iso_pu_bacteria 2935694250 2935697909 190
202 iso_pu_bacteria 2935703347 2935705685 190
203 iso_pu_bacteria 2935713505 2935714397 190
204 iso_pu_bacteria 2935722832 2935725016 190
205 iso_pu_bacteria 2935732158 2935732625 190
206 iso_pu_bacteria 2935741537 2935742004 190
207 iso_pu_bacteria 2935750917 2935751810 190
208 iso_pu_bacteria 2935760218 2935765067 190
209 iso_pu_bacteria 2935769743 2935771682 190
210 iso_pu_bacteria 2935777560 2935778903 190
211 iso_pu_bacteria 2935785616 2935791176 190
212 iso_pu_bacteria 2935793552 2935795495 190
213 iso_pu_bacteria 2935801545 2935802663 190
214 iso_pu_bacteria 2935810662 2935813507 190
215 iso_pu_bacteria 2935819856 2935822454 190
216 iso_pu_bacteria 2935827899 2935830079 190
217 iso_pu_bacteria 2935837841 2935837997 190
218 iso_pu_bacteria 2935847175 2935848037 190
219 iso_pu_bacteria 2935855204 2935855382 190
220 iso_pu_bacteria 2935864058 2935867374 190
221 iso_pu_bacteria 2935873716 2935875807 190
222 iso_pu_bacteria 2935883170 2935886724 190
223 iso_pu_bacteria 2935908558 2935908740 190
224 iso_pu_bacteria 2935916978 2935917885 190
225 iso_pu_bacteria 2935926038 2935926686 190
226 iso_pu_bacteria 2935934488 2935935136 190
227 iso_pu_bacteria 2935942939 2935943586 190
228 iso_pu_bacteria 2935951376 2935952024 190
229 iso_pu_bacteria 2935959822 2935960787 190
230 iso_pu_bacteria 2935967501 2935968149 190
231 iso_pu_bacteria 2935975950 2935978765 190
232 iso_pu_bacteria 2935984226 2935987366 190
233 iso_pu_bacteria 2935992306 2935996471 190
234 iso_pu_bacteria 2936002035 2936003751 190
235 iso_pu_bacteria 2936011229 2936013512 190
236 iso_pu_bacteria 2936019824 2936022361 190
237 iso_pu_bacteria 2936028420 2936030807 190
238 iso_pu_bacteria 2936037263 2936042456 190
239 iso_pu_bacteria 2936046547 2936048620 190
240 iso_pu_bacteria 2936055302 2936058834 190
241 iso_pu_bacteria 2940556831 2940557387 190
242 iso_pu_bacteria 2941507105 2941512388 190
243 iso_pu_bacteria 2941515067 2941520107 190
244 iso_pu_bacteria 2941523033 2941528256 190
245 iso_pu_bacteria 2941531003 2941533178 190
246 iso_pu_bacteria 2941538514 2941539337 190
247 iso_pu_bacteria 3005474847 3005481476 190
248 iso_pu_bacteria 3005483717 3005484658 190
249 iso_pu_bacteria 3005506211 3005510670 190
250 iso_pu_bacteria 3005587118 3005587691 190
251 iso_pu_bacteria 3005594810 3005599607 190
252 iso_pu_bacteria 3005710791 3005715264 190
253 iso_pu_bacteria 3005718088 3005722644 190
254 iso_pu_bacteria 8002285264 8002286647 190
255 iso_pu_bacteria 8006926726 8006933113 190
256 iso_pu_bacteria 8006933436 8006939241 190
257 iso_pu_bacteria 8006964411 8006966852 190
258 iso_pu_bacteria 8006973647 8006978899 190
259 iso_pu_bacteria 8006984368 8006984641 190
260 iso_pu_bacteria 8006994254 8006994636 190
261 iso_pu_bacteria 8016511872 8016521829 190
262 iso_pu_bacteria 8016522445 8016529238 190
263 iso_pu_bacteria 8016539877 8016547671 190
264 iso_pu_bacteria 8016548790 8016554465 190
265 iso_pu_bacteria 8016557553 8016562838 190
266 iso_pu_bacteria 8016566248 8016572790 190
267 iso_pu_bacteria 8016575299 8016576948 190
268 iso_pu_bacteria 8016603502 8016610126 190
269 iso_pu_bacteria 8016613128 8016614809 190
270 iso_pu_bacteria 8016622563 8016626165 190
271 iso_pu_bacteria 8016630954 8016639943 190
272 iso_pu_bacteria 8017057580 8017063825 190
273 iso_pu_bacteria 8019530166 8019534210 190
274 iso_pu_bacteria 8019538911 8019545249 190
275 iso_pu_bacteria 8019547302 8019553260 190
276 iso_pu_bacteria 8019555841 8019565100 190
277 iso_pu_bacteria 8019586578 8019590977 190
278 iso_pu_bacteria 8019608314 8019618175 190
279 iso_pu_bacteria 8019619141 8019628574 190
280 iso_pu_bacteria 8019638758 8019645665 190
281 iso_pu_bacteria 8019648815 8019658928 190
282 iso_pu_bacteria 8019659431 8019661943 190
283 iso_pu_bacteria 8019668869 8019671465 190
284 iso_pu_bacteria 8019678201 8019684640 190
285 iso_pu_bacteria 8019687851 8019690460 190
286 iso_pu_bacteria 8055742211 8055745903 190
287 iso_pu_bacteria 8056673599 8056680896 190
288 iso_pu_bacteria 8056681323 8056684263 190
289 iso_pu_bacteria 8056689827 8056690605 190
290 iso_pu_bacteria 8056967851 8056968395 190
291 iso_pu_bacteria 8057529695 8057533265 190
292 3300006028 Ga0070717_10109952 Ga0070717_101099522 192
293 3300005336 Ga0070680_100053378 Ga0070680_1000533783 193
294 3300005616 Ga0068852_100010249 Ga0068852_1000102495 193
295 3300026078 Ga0207702_10224709 Ga0207702_102247092 193
296 2010549000 RicEn_C2269 RicEn_41540 194
297 2162886012 MBSR1b_contig_5045328 MBSR1b_0583.00006430 194
298 3300000546 LJNas_1000946 LJNas_10009463 194
299 3300001976 JGI24752J21851_1018463 JGI24752J21851_10184632 194
300 3300001989 JGI24739J22299_10080285 JGI24739J22299_100802852 194
301 3300002239 JGI24034J26672_10002423 JGI24034J26672_100024232 194
302 3300002459 JGI24751J29686_10065522 JGI24751J29686_100655221 194
303 3300003203 JGI25406J46586_10000019 JGI25406J46586_1000001921 194
304 3300003203 JGI25406J46586_10012828 JGI25406J46586_100128282 194
305 3300003203 JGI25406J46586_10022155 JGI25406J46586_100221552 194
306 3300003215 JGI25153J46596_10000613 JGI25153J46596_100006132 194
307 3300003215 JGI25153J46596_10002769 JGI25153J46596_100027698 194
308 3300003215 JGI25153J46596_10006245 JGI25153J46596_100062453 194
309 3300003215 JGI25153J46596_10027034 JGI25153J46596_100270342 194
310 3300003215 JGI25153J46596_10079285 JGI25153J46596_100792851 194
311 3300003215 JGI25153J46596_10086105 JGI25153J46596_100861051 194
312 3300003354 JGI25160J50197_1004404 JGI25160J50197_10044044 194
313 3300003354 JGI25160J50197_1007770 JGI25160J50197_10077704 194
314 3300003354 JGI25160J50197_1014797 JGI25160J50197_10147972 194
315 3300003578 Ga0006562J51391_1048774 Ga0006562J51391_10487743 194
316 3300003659 JGI25404J52841_10008986 JGI25404J52841_100089863 194
317 3300003752 Ga0055539_1017655 Ga0055539_10176552 194
318 3300003762 Ga0055542_1006987 Ga0055542_10069872 194
319 3300003775 Ga0055524_1028578 Ga0055524_10285782 194
320 3300003794 Ga0055531_10004023 Ga0055531_100040238 194
321 3300004625 Ga0055543_1002866 Ga0055543_10028663 194
322 3300004625 Ga0055543_1035217 Ga0055543_10352171 194
323 3300005262 Ga0065165_1000509 Ga0065165_100050947 194
324 3300005262 Ga0065165_1002034 Ga0065165_100203410 194
325 3300005262 Ga0065165_1002156 Ga0065165_10021569 194
326 3300005262 Ga0065165_1041981 Ga0065165_10419811 194
327 3300005262 Ga0065165_1042144 Ga0065165_10421442 194
328 3300005262 Ga0065165_1111117 Ga0065165_11111171 194
329 3300005293 Ga0065715_10016860 Ga0065715_100168602 194
330 3300005293 Ga0065715_10331384 Ga0065715_103313842 194
331 3300005295 Ga0065707_10111491 Ga0065707_101114912 194
332 3300005327 Ga0070658_10019858 Ga0070658_100198584 194
333 3300005327 Ga0070658_10039308 Ga0070658_100393082 194
334 3300005327 Ga0070658_10479420 Ga0070658_104794202 194
335 3300005327 Ga0070658_10490982 Ga0070658_104909822 194
336 3300005327 Ga0070658_10735628 Ga0070658_107356281 194
337 3300005328 Ga0070676_10407231 Ga0070676_104072312 194
338 3300005328 Ga0070676_10919157 Ga0070676_109191571 194
339 3300005329 Ga0070683_100023255 Ga0070683_1000232553 194
340 3300005329 Ga0070683_100025031 Ga0070683_1000250313 194
341 3300005329 Ga0070683_100082867 Ga0070683_1000828673 194
342 3300005330 Ga0070690_100062226 Ga0070690_1000622263 194
343 3300005331 Ga0070670_100049799 Ga0070670_1000497993 194
344 3300005331 Ga0070670_100321858 Ga0070670_1003218582 194
345 3300005331 Ga0070670_100351186 Ga0070670_1003511861 194
346 3300005331 Ga0070670_100424440 Ga0070670_1004244401 194
347 3300005333 Ga0070677_10034970 Ga0070677_100349703 194
348 3300005334 Ga0068869_100057698 Ga0068869_1000576982 194
349 3300005334 Ga0068869_100235503 Ga0068869_1002355032 194
350 3300005335 Ga0070666_10025588 Ga0070666_100255883 194
351 3300005335 Ga0070666_10067509 Ga0070666_100675092 194
352 3300005335 Ga0070666_10305384 Ga0070666_103053841 194
353 3300005335 Ga0070666_10633034 Ga0070666_106330341 194
354 3300005336 Ga0070680_100134040 Ga0070680_1001340402 194
355 3300005336 Ga0070680_100274943 Ga0070680_1002749431 194
356 3300005336 Ga0070680_100300662 Ga0070680_1003006622 194
357 3300005336 Ga0070680_100528708 Ga0070680_1005287081 194
358 3300005337 Ga0070682_100052898 Ga0070682_1000528982 194
359 3300005337 Ga0070682_100057006 Ga0070682_1000570063 194
360 3300005337 Ga0070682_100255564 Ga0070682_1002555642 194
361 3300005338 Ga0068868_100008525 Ga0068868_1000085254 194
362 3300005338 Ga0068868_100009673 Ga0068868_1000096734 194
363 3300005338 Ga0068868_100066009 Ga0068868_1000660092 194
364 3300005338 Ga0068868_100076891 Ga0068868_1000768913 194
365 3300005338 Ga0068868_100295980 Ga0068868_1002959802 194
366 3300005339 Ga0070660_100014947 Ga0070660_1000149475 194
367 3300005339 Ga0070660_100015839 Ga0070660_1000158396 194
368 3300005339 Ga0070660_100643481 Ga0070660_1006434811 194
369 3300005340 Ga0070689_100048729 Ga0070689_1000487293 194
370 3300005340 Ga0070689_100240864 Ga0070689_1002408642 194
371 3300005340 Ga0070689_100266568 Ga0070689_1002665682 194
372 3300005340 Ga0070689_100459408 Ga0070689_1004594082 194
373 3300005341 Ga0070691_10076545 Ga0070691_100765452 194
374 3300005341 Ga0070691_10117534 Ga0070691_101175342 194
375 3300005343 Ga0070687_100009775 Ga0070687_1000097753 194
376 3300005344 Ga0070661_100046375 Ga0070661_1000463753 194
377 3300005344 Ga0070661_100104658 Ga0070661_1001046583 194
378 3300005344 Ga0070661_100118401 Ga0070661_1001184012 194
379 3300005344 Ga0070661_100254225 Ga0070661_1002542252 194
380 3300005344 Ga0070661_100288953 Ga0070661_1002889532 194
381 3300005347 Ga0070668_100030851 Ga0070668_1000308512 194
382 3300005347 Ga0070668_100090764 Ga0070668_1000907642 194
383 3300005347 Ga0070668_100150511 Ga0070668_1001505113 194
384 3300005347 Ga0070668_100184993 Ga0070668_1001849932 194
385 3300005347 Ga0070668_100204147 Ga0070668_1002041472 194
386 3300005347 Ga0070668_100226336 Ga0070668_1002263362 194
387 3300005347 Ga0070668_100250657 Ga0070668_1002506573 194
388 3300005347 Ga0070668_100314695 Ga0070668_1003146952 194
389 3300005347 Ga0070668_100596667 Ga0070668_1005966671 194
390 3300005353 Ga0070669_100022105 Ga0070669_1000221054 194
391 3300005353 Ga0070669_100181034 Ga0070669_1001810341 194
392 3300005354 Ga0070675_100142775 Ga0070675_1001427752 194
393 3300005354 Ga0070675_100572766 Ga0070675_1005727661 194
394 3300005354 Ga0070675_100676945 Ga0070675_1006769452 194
395 3300005355 Ga0070671_100056246 Ga0070671_1000562462 194
396 3300005355 Ga0070671_100199205 Ga0070671_1001992051 194
397 3300005355 Ga0070671_100287688 Ga0070671_1002876882 194
398 3300005355 Ga0070671_100456112 Ga0070671_1004561122 194
399 3300005355 Ga0070671_100506647 Ga0070671_1005066471 194
400 3300005355 Ga0070671_100875959 Ga0070671_1008759591 194
401 3300005356 Ga0070674_100023279 Ga0070674_1000232793 194
402 3300005356 Ga0070674_100043189 Ga0070674_1000431892 194
403 3300005356 Ga0070674_100111580 Ga0070674_1001115802 194
404 3300005364 Ga0070673_100074758 Ga0070673_1000747582 194
405 3300005365 Ga0070688_100029760 Ga0070688_1000297603 194
406 3300005365 Ga0070688_100288965 Ga0070688_1002889652 194
407 3300005366 Ga0070659_100015051 Ga0070659_1000150515 194
408 3300005366 Ga0070659_100213211 Ga0070659_1002132112 194
409 3300005366 Ga0070659_100242003 Ga0070659_1002420032 194
410 3300005367 Ga0070667_100029892 Ga0070667_1000298924 194
411 3300005367 Ga0070667_100139676 Ga0070667_1001396761 194
412 3300005367 Ga0070667_100178997 Ga0070667_1001789972 194
413 3300005367 Ga0070667_100593834 Ga0070667_1005938341 194
414 3300005367 Ga0070667_100847974 Ga0070667_1008479742 194
415 3300005434 Ga0070709_10001083 Ga0070709_100010838 194
416 3300005434 Ga0070709_10002717 Ga0070709_100027172 194
417 3300005434 Ga0070709_10033515 Ga0070709_100335153 194
418 3300005434 Ga0070709_10085390 Ga0070709_100853903 194
419 3300005434 Ga0070709_10089494 Ga0070709_100894942 194
420 3300005434 Ga0070709_10109381 Ga0070709_101093813 194
421 3300005434 Ga0070709_10401687 Ga0070709_104016872 194
422 3300005435 Ga0070714_100001660 Ga0070714_10000166010 194
423 3300005435 Ga0070714_100015456 Ga0070714_1000154563 194
424 3300005435 Ga0070714_100059272 Ga0070714_1000592722 194
425 3300005435 Ga0070714_100101373 Ga0070714_1001013733 194
426 3300005435 Ga0070714_100182900 Ga0070714_1001829002 194
427 3300005435 Ga0070714_100313716 Ga0070714_1003137162 194
428 3300005435 Ga0070714_100367167 Ga0070714_1003671671 194
429 3300005435 Ga0070714_100407529 Ga0070714_1004075292 194
430 3300005435 Ga0070714_100416267 Ga0070714_1004162672 194
431 3300005435 Ga0070714_100454779 Ga0070714_1004547791 194
432 3300005435 Ga0070714_100555182 Ga0070714_1005551821 194
433 3300005435 Ga0070714_100702469 Ga0070714_1007024692 194
434 3300005436 Ga0070713_100001545 Ga0070713_1000015457 194
435 3300005436 Ga0070713_100008761 Ga0070713_1000087617 194
436 3300005436 Ga0070713_100025417 Ga0070713_1000254173 194
437 3300005436 Ga0070713_100053065 Ga0070713_1000530652 194
438 3300005436 Ga0070713_100059519 Ga0070713_1000595194 194
439 3300005436 Ga0070713_100109729 Ga0070713_1001097294 194
440 3300005436 Ga0070713_100118871 Ga0070713_1001188713 194
441 3300005436 Ga0070713_100127150 Ga0070713_1001271503 194
442 3300005436 Ga0070713_100182802 Ga0070713_1001828023 194
443 3300005436 Ga0070713_100212834 Ga0070713_1002128341 194
444 3300005436 Ga0070713_100262741 Ga0070713_1002627412 194
445 3300005436 Ga0070713_100287648 Ga0070713_1002876482 194
446 3300005436 Ga0070713_100492566 Ga0070713_1004925661 194
447 3300005437 Ga0070710_10000726 Ga0070710_1000072611 194
448 3300005437 Ga0070710_10002079 Ga0070710_100020793 194
449 3300005437 Ga0070710_10005882 Ga0070710_100058824 194
450 3300005437 Ga0070710_10008674 Ga0070710_100086742 194
451 3300005437 Ga0070710_10012838 Ga0070710_100128384 194
452 3300005437 Ga0070710_10052870 Ga0070710_100528702 194
453 3300005437 Ga0070710_10056197 Ga0070710_100561972 194
454 3300005437 Ga0070710_10090608 Ga0070710_100906082 194
455 3300005437 Ga0070710_10424909 Ga0070710_104249091 194
456 3300005438 Ga0070701_10037978 Ga0070701_100379782 194
457 3300005438 Ga0070701_10296496 Ga0070701_102964961 194
458 3300005439 Ga0070711_100000331 Ga0070711_1000003312 194
459 3300005439 Ga0070711_100002577 Ga0070711_1000025775 194
460 3300005439 Ga0070711_100003388 Ga0070711_1000033883 194
461 3300005439 Ga0070711_100006561 Ga0070711_1000065616 194
462 3300005439 Ga0070711_100010091 Ga0070711_1000100914 194
463 3300005439 Ga0070711_100017738 Ga0070711_1000177385 194
464 3300005439 Ga0070711_100017822 Ga0070711_1000178223 194
465 3300005439 Ga0070711_100019407 Ga0070711_1000194072 194
466 3300005439 Ga0070711_100029656 Ga0070711_1000296563 194
467 3300005439 Ga0070711_100079988 Ga0070711_1000799882 194
468 3300005439 Ga0070711_100126075 Ga0070711_1001260752 194
469 3300005439 Ga0070711_100136258 Ga0070711_1001362582 194
470 3300005439 Ga0070711_100139630 Ga0070711_1001396301 194
471 3300005439 Ga0070711_100529271 Ga0070711_1005292711 194
472 3300005439 Ga0070711_100683826 Ga0070711_1006838262 194
473 3300005441 Ga0070700_100229070 Ga0070700_1002290702 194
474 3300005441 Ga0070700_100589122 Ga0070700_1005891221 194
475 3300005441 Ga0070700_100796181 Ga0070700_1007961811 194
476 3300005444 Ga0070694_100453577 Ga0070694_1004535772 194
477 3300005445 Ga0070708_100000649 Ga0070708_10000064921 194
478 3300005445 Ga0070708_100003946 Ga0070708_1000039465 194
479 3300005445 Ga0070708_100014726 Ga0070708_1000147265 194
480 3300005445 Ga0070708_100077471 Ga0070708_1000774712 194
481 3300005455 Ga0070663_100012111 Ga0070663_1000121113 194
482 3300005455 Ga0070663_100038301 Ga0070663_1000383012 194
483 3300005455 Ga0070663_100044626 Ga0070663_1000446262 194
484 3300005455 Ga0070663_100176837 Ga0070663_1001768372 194
485 3300005455 Ga0070663_100236106 Ga0070663_1002361062 194
486 3300005455 Ga0070663_100289058 Ga0070663_1002890582 194
487 3300005455 Ga0070663_100450637 Ga0070663_1004506372 194
488 3300005456 Ga0070678_100087719 Ga0070678_1000877193 194
489 3300005456 Ga0070678_100089402 Ga0070678_1000894023 194
490 3300005456 Ga0070678_100090023 Ga0070678_1000900232 194
491 3300005456 Ga0070678_100157151 Ga0070678_1001571512 194
492 3300005456 Ga0070678_100288794 Ga0070678_1002887941 194
493 3300005456 Ga0070678_101010466 Ga0070678_1010104662 194
494 3300005457 Ga0070662_100024253 Ga0070662_1000242533 194
495 3300005457 Ga0070662_100186147 Ga0070662_1001861472 194
496 3300005457 Ga0070662_100765225 Ga0070662_1007652251 194
497 3300005458 Ga0070681_10011285 Ga0070681_100112853 194
498 3300005458 Ga0070681_10071383 Ga0070681_100713833 194
499 3300005458 Ga0070681_10119263 Ga0070681_101192632 194
500 3300005458 Ga0070681_10123439 Ga0070681_101234392 194
501 3300005458 Ga0070681_10231882 Ga0070681_102318823 194
502 3300005458 Ga0070681_10560285 Ga0070681_105602851 194
503 3300005458 Ga0070681_10641961 Ga0070681_106419611 194
504 3300005459 Ga0068867_100021264 Ga0068867_1000212644 194
505 3300005459 Ga0068867_100087946 Ga0068867_1000879463 194
506 3300005459 Ga0068867_101390156 Ga0068867_1013901561 194
507 3300005466 Ga0070685_10019815 Ga0070685_100198153 194
508 3300005466 Ga0070685_10119364 Ga0070685_101193642 194
509 3300005467 Ga0070706_100000744 Ga0070706_10000074413 194
510 3300005467 Ga0070706_100005201 Ga0070706_1000052011 194
511 3300005467 Ga0070706_100094091 Ga0070706_1000940911 194
512 3300005468 Ga0070707_100001340 Ga0070707_1000013401 194
513 3300005468 Ga0070707_100018278 Ga0070707_1000182785 194
514 3300005468 Ga0070707_100551142 Ga0070707_1005511422 194
515 3300005468 Ga0070707_101007820 Ga0070707_1010078201 194
516 3300005468 Ga0070707_101166599 Ga0070707_1011665991 194
517 3300005471 Ga0070698_100000590 Ga0070698_10000059010 194
518 3300005471 Ga0070698_100014123 Ga0070698_1000141234 194
519 3300005471 Ga0070698_100392457 Ga0070698_1003924572 194
520 3300005471 Ga0070698_100764366 Ga0070698_1007643661 194
521 3300005518 Ga0070699_100000178 Ga0070699_10000017821 194
522 3300005518 Ga0070699_100001656 Ga0070699_1000016567 194
523 3300005518 Ga0070699_100156870 Ga0070699_1001568703 194
524 3300005518 Ga0070699_100194365 Ga0070699_1001943652 194
525 3300005518 Ga0070699_100373856 Ga0070699_1003738561 194
526 3300005518 Ga0070699_100385709 Ga0070699_1003857092 194
527 3300005518 Ga0070699_100501328 Ga0070699_1005013282 194
528 3300005530 Ga0070679_100018615 Ga0070679_1000186156 194
529 3300005530 Ga0070679_100035187 Ga0070679_1000351873 194
530 3300005530 Ga0070679_100066794 Ga0070679_1000667941 194
531 3300005530 Ga0070679_100176110 Ga0070679_1001761101 194
532 3300005530 Ga0070679_100213737 Ga0070679_1002137372 194
533 3300005530 Ga0070679_100274063 Ga0070679_1002740632 194
534 3300005530 Ga0070679_100276077 Ga0070679_1002760772 194
535 3300005530 Ga0070679_100320432 Ga0070679_1003204322 194
536 3300005530 Ga0070679_100905048 Ga0070679_1009050481 194
537 3300005535 Ga0070684_100005731 Ga0070684_1000057315 194
538 3300005535 Ga0070684_100044893 Ga0070684_1000448933 194
539 3300005535 Ga0070684_100134961 Ga0070684_1001349612 194
540 3300005535 Ga0070684_100447588 Ga0070684_1004475882 194
541 3300005536 Ga0070697_100000127 Ga0070697_10000012722 194
542 3300005536 Ga0070697_100000455 Ga0070697_1000004559 194
543 3300005536 Ga0070697_100012595 Ga0070697_1000125954 194
544 3300005536 Ga0070697_100018555 Ga0070697_1000185554 194
545 3300005536 Ga0070697_100055399 Ga0070697_1000553993 194
546 3300005536 Ga0070697_100593993 Ga0070697_1005939932 194
547 3300005539 Ga0068853_100037739 Ga0068853_1000377394 194
548 3300005539 Ga0068853_100083579 Ga0068853_1000835792 194
549 3300005539 Ga0068853_100177222 Ga0068853_1001772223 194
550 3300005539 Ga0068853_100202991 Ga0068853_1002029912 194
551 3300005539 Ga0068853_100282448 Ga0068853_1002824482 194
552 3300005539 Ga0068853_100289969 Ga0068853_1002899691 194
553 3300005539 Ga0068853_100390138 Ga0068853_1003901381 194
554 3300005539 Ga0068853_100401584 Ga0068853_1004015842 194
555 3300005539 Ga0068853_100657657 Ga0068853_1006576572 194
556 3300005543 Ga0070672_100010216 Ga0070672_1000102163 194
557 3300005543 Ga0070672_100326873 Ga0070672_1003268732 194
558 3300005543 Ga0070672_100356305 Ga0070672_1003563052 194
559 3300005543 Ga0070672_100447169 Ga0070672_1004471692 194
560 3300005543 Ga0070672_100513352 Ga0070672_1005133522 194
561 3300005543 Ga0070672_100518252 Ga0070672_1005182522 194
562 3300005544 Ga0070686_100082469 Ga0070686_1000824692 194
563 3300005544 Ga0070686_100710185 Ga0070686_1007101851 194
564 3300005545 Ga0070695_100160327 Ga0070695_1001603272 194
565 3300005545 Ga0070695_100221942 Ga0070695_1002219422 194
566 3300005545 Ga0070695_100455004 Ga0070695_1004550042 194
567 3300005546 Ga0070696_100146500 Ga0070696_1001465003 194
568 3300005546 Ga0070696_100257273 Ga0070696_1002572732 194
569 3300005546 Ga0070696_100350872 Ga0070696_1003508722 194
570 3300005546 Ga0070696_100539998 Ga0070696_1005399981 194
571 3300005547 Ga0070693_100221187 Ga0070693_1002211872 194
572 3300005547 Ga0070693_100245198 Ga0070693_1002451982 194
573 3300005547 Ga0070693_100316936 Ga0070693_1003169362 194
574 3300005547 Ga0070693_100645766 Ga0070693_1006457661 194
575 3300005548 Ga0070665_100020157 Ga0070665_1000201573 194
576 3300005548 Ga0070665_100036803 Ga0070665_1000368035 194
577 3300005548 Ga0070665_100185614 Ga0070665_1001856142 194
578 3300005548 Ga0070665_100433509 Ga0070665_1004335092 194
579 3300005548 Ga0070665_101370563 Ga0070665_1013705631 194
580 3300005549 Ga0070704_100444118 Ga0070704_1004441182 194
581 3300005549 Ga0070704_100483722 Ga0070704_1004837222 194
582 3300005563 Ga0068855_100049708 Ga0068855_1000497083 194
583 3300005563 Ga0068855_100052317 Ga0068855_1000523172 194
584 3300005563 Ga0068855_100066996 Ga0068855_1000669965 194
585 3300005563 Ga0068855_100067697 Ga0068855_1000676974 194
586 3300005563 Ga0068855_100185575 Ga0068855_1001855752 194
587 3300005563 Ga0068855_100389688 Ga0068855_1003896882 194
588 3300005563 Ga0068855_100428807 Ga0068855_1004288072 194
589 3300005563 Ga0068855_100546802 Ga0068855_1005468022 194
590 3300005563 Ga0068855_100551588 Ga0068855_1005515882 194
591 3300005564 Ga0070664_100015233 Ga0070664_1000152335 194
592 3300005564 Ga0070664_100093702 Ga0070664_1000937023 194
593 3300005564 Ga0070664_100147082 Ga0070664_1001470823 194
594 3300005564 Ga0070664_100248952 Ga0070664_1002489522 194
595 3300005564 Ga0070664_100480089 Ga0070664_1004800892 194
596 3300005564 Ga0070664_100536902 Ga0070664_1005369022 194
597 3300005577 Ga0068857_100056516 Ga0068857_1000565163 194
598 3300005577 Ga0068857_100084315 Ga0068857_1000843152 194
599 3300005577 Ga0068857_100100949 Ga0068857_1001009493 194
600 3300005577 Ga0068857_100150992 Ga0068857_1001509922 194
601 3300005577 Ga0068857_100857879 Ga0068857_1008578792 194
602 3300005578 Ga0068854_100047119 Ga0068854_1000471192 194
603 3300005578 Ga0068854_100222002 Ga0068854_1002220022 194
604 3300005578 Ga0068854_100475949 Ga0068854_1004759491 194
605 3300005614 Ga0068856_100001908 Ga0068856_1000019089 194
606 3300005614 Ga0068856_100004533 Ga0068856_1000045336 194
607 3300005614 Ga0068856_100068608 Ga0068856_1000686084 194
608 3300005614 Ga0068856_100125503 Ga0068856_1001255032 194
609 3300005614 Ga0068856_100245049 Ga0068856_1002450492 194
610 3300005614 Ga0068856_100292806 Ga0068856_1002928062 194
611 3300005614 Ga0068856_100299814 Ga0068856_1002998142 194
612 3300005614 Ga0068856_100630269 Ga0068856_1006302692 194
613 3300005614 Ga0068856_100723472 Ga0068856_1007234721 194
614 3300005614 Ga0068856_101154067 Ga0068856_1011540671 194
615 3300005615 Ga0070702_100003415 Ga0070702_1000034155 194
616 3300005615 Ga0070702_100019562 Ga0070702_1000195622 194
617 3300005615 Ga0070702_100354427 Ga0070702_1003544272 194
618 3300005616 Ga0068852_100006500 Ga0068852_1000065006 194
619 3300005616 Ga0068852_100063394 Ga0068852_1000633943 194
620 3300005616 Ga0068852_100157579 Ga0068852_1001575792 194
621 3300005616 Ga0068852_100259722 Ga0068852_1002597223 194
622 3300005616 Ga0068852_100493989 Ga0068852_1004939892 194
623 3300005616 Ga0068852_100680119 Ga0068852_1006801192 194
624 3300005617 Ga0068859_100041554 Ga0068859_1000415544 194
625 3300005617 Ga0068859_100055546 Ga0068859_1000555464 194
626 3300005617 Ga0068859_100067414 Ga0068859_1000674143 194
627 3300005617 Ga0068859_100166183 Ga0068859_1001661833 194
628 3300005617 Ga0068859_100286238 Ga0068859_1002862382 194
629 3300005618 Ga0068864_100025741 Ga0068864_1000257413 194
630 3300005618 Ga0068864_100123186 Ga0068864_1001231862 194
631 3300005618 Ga0068864_100160193 Ga0068864_1001601933 194
632 3300005618 Ga0068864_100939497 Ga0068864_1009394972 194
633 3300005718 Ga0068866_10020431 Ga0068866_100204312 194
634 3300005718 Ga0068866_10293201 Ga0068866_102932011 194
635 3300005719 Ga0068861_100072449 Ga0068861_1000724493 194
636 3300005834 Ga0068851_10097919 Ga0068851_100979191 194
637 3300005834 Ga0068851_10200853 Ga0068851_102008532 194
638 3300005840 Ga0068870_10001691 Ga0068870_100016915 194
639 3300005840 Ga0068870_10325528 Ga0068870_103255282 194
640 3300005841 Ga0068863_100035161 Ga0068863_1000351614 194
641 3300005841 Ga0068863_100124446 Ga0068863_1001244463 194
642 3300005841 Ga0068863_100475361 Ga0068863_1004753612 194
643 3300005842 Ga0068858_100017267 Ga0068858_1000172675 194
644 3300005842 Ga0068858_100054622 Ga0068858_1000546223 194
645 3300005842 Ga0068858_100222584 Ga0068858_1002225842 194
646 3300005842 Ga0068858_100714287 Ga0068858_1007142872 194
647 3300005843 Ga0068860_100000213 Ga0068860_10000021346 194
648 3300005843 Ga0068860_100094458 Ga0068860_1000944583 194
649 3300005843 Ga0068860_100260764 Ga0068860_1002607642 194
650 3300005843 Ga0068860_100317139 Ga0068860_1003171392 194
651 3300005843 Ga0068860_100591405 Ga0068860_1005914051 194
652 3300005843 Ga0068860_101346130 Ga0068860_1013461302 194
653 3300005844 Ga0068862_100018959 Ga0068862_1000189593 194
654 3300005844 Ga0068862_100055174 Ga0068862_1000551744 194
655 3300005844 Ga0068862_100108061 Ga0068862_1001080612 194
656 3300005844 Ga0068862_100283311 Ga0068862_1002833112 194
657 3300005844 Ga0068862_100325225 Ga0068862_1003252251 194
658 3300005844 Ga0068862_100379285 Ga0068862_1003792852 194
659 3300005937 Ga0081455_10005931 Ga0081455_100059316 194
660 3300005937 Ga0081455_10007164 Ga0081455_100071643 194
661 3300005937 Ga0081455_10073251 Ga0081455_100732513 194
662 3300005937 Ga0081455_10077607 Ga0081455_100776073 194
663 3300005981 Ga0081538_10116586 Ga0081538_101165862 194
664 3300005983 Ga0081540_1005943 Ga0081540_10059436 194
665 3300005983 Ga0081540_1008063 Ga0081540_10080635 194
666 3300005983 Ga0081540_1010718 Ga0081540_10107184 194
667 3300005983 Ga0081540_1011457 Ga0081540_10114574 194
668 3300005983 Ga0081540_1026578 Ga0081540_10265783 194
669 3300005983 Ga0081540_1028276 Ga0081540_10282763 194
670 3300005983 Ga0081540_1028376 Ga0081540_10283762 194
671 3300005983 Ga0081540_1037129 Ga0081540_10371293 194
672 3300005983 Ga0081540_1042937 Ga0081540_10429373 194
673 3300005983 Ga0081540_1094095 Ga0081540_10940952 194
674 3300005983 Ga0081540_1134147 Ga0081540_11341472 194
675 3300005985 Ga0081539_10000003 Ga0081539_10000003190 194
676 3300005985 Ga0081539_10000199 Ga0081539_10000199140 194
677 3300005985 Ga0081539_10008928 Ga0081539_100089286 194
678 3300005985 Ga0081539_10035474 Ga0081539_100354743 194
679 3300006028 Ga0070717_10002399 Ga0070717_100023997 194
680 3300006028 Ga0070717_10015462 Ga0070717_100154624 194
681 3300006028 Ga0070717_10022714 Ga0070717_100227145 194
682 3300006028 Ga0070717_10197372 Ga0070717_101973722 194
683 3300006028 Ga0070717_10216611 Ga0070717_102166112 194
684 3300006028 Ga0070717_10236455 Ga0070717_102364552 194
685 3300006028 Ga0070717_10260320 Ga0070717_102603203 194
686 3300006028 Ga0070717_10319783 Ga0070717_103197832 194
687 3300006028 Ga0070717_10473031 Ga0070717_104730311 194
688 3300006028 Ga0070717_10542546 Ga0070717_105425461 194
689 3300006028 Ga0070717_10552382 Ga0070717_105523821 194
690 3300006038 Ga0075365_10008592 Ga0075365_100085922 194
691 3300006038 Ga0075365_10182993 Ga0075365_101829932 194
692 3300006038 Ga0075365_10368915 Ga0075365_103689152 194
693 3300006042 Ga0075368_10020037 Ga0075368_100200372 194
694 3300006042 Ga0075368_10131358 Ga0075368_101313582 194
695 3300006042 Ga0075368_10338557 Ga0075368_103385571 194
696 3300006048 Ga0075363_100033317 Ga0075363_1000333172 194
697 3300006048 Ga0075363_100035848 Ga0075363_1000358483 194
698 3300006051 Ga0075364_10056522 Ga0075364_100565223 194
699 3300006051 Ga0075364_10079455 Ga0075364_100794552 194
700 3300006163 Ga0070715_10001847 Ga0070715_100018472 194
701 3300006163 Ga0070715_10007524 Ga0070715_100075243 194
702 3300006163 Ga0070715_10010006 Ga0070715_100100064 194
703 3300006173 Ga0070716_100000955 Ga0070716_1000009559 194
704 3300006173 Ga0070716_100006597 Ga0070716_1000065972 194
705 3300006173 Ga0070716_100040256 Ga0070716_1000402564 194
706 3300006173 Ga0070716_100072629 Ga0070716_1000726292 194
707 3300006173 Ga0070716_100108611 Ga0070716_1001086113 194
708 3300006173 Ga0070716_100241745 Ga0070716_1002417452 194
709 3300006173 Ga0070716_100634195 Ga0070716_1006341951 194
710 3300006175 Ga0070712_100001046 Ga0070712_1000010465 194
711 3300006175 Ga0070712_100001471 Ga0070712_1000014717 194
712 3300006175 Ga0070712_100001601 Ga0070712_1000016013 194
713 3300006175 Ga0070712_100002799 Ga0070712_1000027997 194
714 3300006175 Ga0070712_100002958 Ga0070712_1000029586 194
715 3300006175 Ga0070712_100006314 Ga0070712_1000063143 194
716 3300006175 Ga0070712_100131223 Ga0070712_1001312231 194
717 3300006175 Ga0070712_100182158 Ga0070712_1001821582 194
718 3300006175 Ga0070712_100185103 Ga0070712_1001851032 194
719 3300006175 Ga0070712_100276278 Ga0070712_1002762782 194
720 3300006177 Ga0075362_10263576 Ga0075362_102635762 194
721 3300006178 Ga0075367_10025647 Ga0075367_100256472 194
722 3300006178 Ga0075367_10060008 Ga0075367_100600083 194
723 3300006178 Ga0075367_10330670 Ga0075367_103306702 194
724 3300006186 Ga0075369_10024803 Ga0075369_100248032 194
725 3300006186 Ga0075369_10069254 Ga0075369_100692542 194
726 3300006195 Ga0075366_10020960 Ga0075366_100209602 194
727 3300006195 Ga0075366_10158167 Ga0075366_101581672 194
728 3300006195 Ga0075366_10247863 Ga0075366_102478632 194
729 3300006195 Ga0075366_10645740 Ga0075366_106457401 194
730 3300006237 Ga0097621_100029624 Ga0097621_1000296242 194
731 3300006237 Ga0097621_100238125 Ga0097621_1002381253 194
732 3300006353 Ga0075370_10034321 Ga0075370_100343213 194
733 3300006353 Ga0075370_10036633 Ga0075370_100366333 194
734 3300006353 Ga0075370_10040554 Ga0075370_100405543 194
735 3300006353 Ga0075370_10390225 Ga0075370_103902251 194
736 3300006358 Ga0068871_100001342 Ga0068871_1000013428 194
737 3300006358 Ga0068871_100049954 Ga0068871_1000499542 194
738 3300006358 Ga0068871_100233060 Ga0068871_1002330602 194
739 3300006358 Ga0068871_100272575 Ga0068871_1002725752 194
740 3300006358 Ga0068871_100313924 Ga0068871_1003139242 194
741 3300006358 Ga0068871_101235116 Ga0068871_1012351161 194
742 3300006844 Ga0075428_100087585 Ga0075428_1000875852 194
743 3300006847 Ga0075431_100032321 Ga0075431_1000323212 194
744 3300006852 Ga0075433_10003606 Ga0075433_100036065 194
745 3300006852 Ga0075433_10003976 Ga0075433_100039764 194
746 3300006871 Ga0075434_100000136 Ga0075434_1000001366 194
747 3300006871 Ga0075434_100000632 Ga0075434_1000006329 194
748 3300006871 Ga0075434_100008890 Ga0075434_1000088903 194
749 3300006871 Ga0075434_100021169 Ga0075434_1000211692 194
750 3300006871 Ga0075434_100232663 Ga0075434_1002326633 194
751 3300006871 Ga0075434_100583905 Ga0075434_1005839052 194
752 3300006871 Ga0075434_100925747 Ga0075434_1009257472 194
753 3300006871 Ga0075434_101281998 Ga0075434_1012819981 194
754 3300006881 Ga0068865_100002158 Ga0068865_1000021589 194
755 3300006881 Ga0068865_100079062 Ga0068865_1000790623 194
756 3300006881 Ga0068865_100091960 Ga0068865_1000919602 194
757 3300006881 Ga0068865_100596873 Ga0068865_1005968732 194
758 3300006914 Ga0075436_100003564 Ga0075436_1000035643 194
759 3300006914 Ga0075436_100064183 Ga0075436_1000641832 194
760 3300006914 Ga0075436_100251296 Ga0075436_1002512962 194
761 3300006914 Ga0075436_100256733 Ga0075436_1002567332 194
762 3300006931 Ga0097620_100041553 Ga0097620_1000415534 194
763 3300006931 Ga0097620_100055550 Ga0097620_1000555502 194
764 3300006931 Ga0097620_100067415 Ga0097620_1000674153 194
765 3300006931 Ga0097620_100166187 Ga0097620_1001661872 194
766 3300006931 Ga0097620_100286248 Ga0097620_1002862482 194
767 3300006941 Ga0099825_1027213 Ga0099825_10272133 194
768 3300006941 Ga0099825_1034631 Ga0099825_10346312 194
769 3300006942 Ga0099824_1025369 Ga0099824_10253693 194
770 3300006943 Ga0099822_1003531 Ga0099822_10035318 194
771 3300007076 Ga0075435_100001721 Ga0075435_1000017217 194
772 3300007076 Ga0075435_100034404 Ga0075435_1000344043 194
773 3300007076 Ga0075435_100054879 Ga0075435_1000548792 194
774 3300007076 Ga0075435_100205743 Ga0075435_1002057432 194
775 3300007076 Ga0075435_100541841 Ga0075435_1005418412 194
776 3300007076 Ga0075435_100604367 Ga0075435_1006043671 194
777 3300007265 Ga0099794_10012570 Ga0099794_100125701 194
778 3300007265 Ga0099794_10176205 Ga0099794_101762052 194
779 3300007265 Ga0099794_10231202 Ga0099794_102312021 194
780 3300007788 Ga0099795_10007914 Ga0099795_100079142 194
781 3300007788 Ga0099795_10022641 Ga0099795_100226412 194
782 3300007788 Ga0099795_10189135 Ga0099795_101891351 194
783 3300007788 Ga0099795_10190384 Ga0099795_101903841 194
784 3300009093 Ga0105240_10029222 Ga0105240_100292222 194
785 3300009093 Ga0105240_10034523 Ga0105240_100345235 194
786 3300009093 Ga0105240_10047668 Ga0105240_100476686 194
787 3300009093 Ga0105240_10064004 Ga0105240_100640044 194
788 3300009093 Ga0105240_10423030 Ga0105240_104230302 194
789 3300009093 Ga0105240_10587217 Ga0105240_105872172 194
790 3300009094 Ga0111539_10188696 Ga0111539_101886963 194
791 3300009094 Ga0111539_10209354 Ga0111539_102093542 194
792 3300009098 Ga0105245_10024567 Ga0105245_100245673 194
793 3300009098 Ga0105245_10050676 Ga0105245_100506763 194
794 3300009098 Ga0105245_10079782 Ga0105245_100797824 194
795 3300009098 Ga0105245_10111308 Ga0105245_101113083 194
796 3300009098 Ga0105245_10156379 Ga0105245_101563793 194
797 3300009101 Ga0105247_10027421 Ga0105247_100274212 194
798 3300009101 Ga0105247_10031330 Ga0105247_100313302 194
799 3300009101 Ga0105247_10245822 Ga0105247_102458222 194
800 3300009101 Ga0105247_10286021 Ga0105247_102860212 194
801 3300009101 Ga0105247_10417006 Ga0105247_104170062 194
802 3300009147 Ga0114129_10017885 Ga0114129_100178859 194
803 3300009147 Ga0114129_10098831 Ga0114129_100988314 194
804 3300009147 Ga0114129_10124072 Ga0114129_101240724 194
805 3300009147 Ga0114129_10268778 Ga0114129_102687783 194
806 3300009148 Ga0105243_10070915 Ga0105243_100709153 194
807 3300009148 Ga0105243_10245000 Ga0105243_102450002 194
808 3300009148 Ga0105243_10532677 Ga0105243_105326772 194
809 3300009148 Ga0105243_10599672 Ga0105243_105996722 194
810 3300009148 Ga0105243_10861817 Ga0105243_108618172 194
811 3300009174 Ga0105241_10020565 Ga0105241_100205653 194
812 3300009174 Ga0105241_10093062 Ga0105241_100930621 194
813 3300009174 Ga0105241_10110280 Ga0105241_101102803 194
814 3300009174 Ga0105241_10136918 Ga0105241_101369183 194
815 3300009174 Ga0105241_10242872 Ga0105241_102428722 194
816 3300009174 Ga0105241_10753080 Ga0105241_107530801 194
817 3300009176 Ga0105242_10021558 Ga0105242_100215584 194
818 3300009176 Ga0105242_10398268 Ga0105242_103982681 194
819 3300009176 Ga0105242_10745382 Ga0105242_107453821 194
820 3300009176 Ga0105242_10809568 Ga0105242_108095681 194
821 3300009177 Ga0105248_10063141 Ga0105248_100631411 194
822 3300009177 Ga0105248_10143085 Ga0105248_101430852 194
823 3300009177 Ga0105248_10199139 Ga0105248_101991392 194
824 3300009177 Ga0105248_10324368 Ga0105248_103243681 194
825 3300009177 Ga0105248_10389370 Ga0105248_103893702 194
826 3300009177 Ga0105248_10454323 Ga0105248_104543231 194
827 3300009177 Ga0105248_10705765 Ga0105248_107057652 194
828 3300009177 Ga0105248_12159383 Ga0105248_121593831 194
829 3300009545 Ga0105237_10026354 Ga0105237_100263546 194
830 3300009545 Ga0105237_10037340 Ga0105237_100373403 194
831 3300009545 Ga0105237_10096082 Ga0105237_100960823 194
832 3300009545 Ga0105237_10128323 Ga0105237_101283232 194
833 3300009545 Ga0105237_10144015 Ga0105237_101440153 194
834 3300009545 Ga0105237_10312916 Ga0105237_103129162 194
835 3300009545 Ga0105237_10513954 Ga0105237_105139542 194
836 3300009545 Ga0105237_10807764 Ga0105237_108077642 194
837 3300009551 Ga0105238_10003681 Ga0105238_100036816 194
838 3300009551 Ga0105238_10021608 Ga0105238_100216084 194
839 3300009551 Ga0105238_10081331 Ga0105238_100813313 194
840 3300009551 Ga0105238_10130968 Ga0105238_101309683 194
841 3300009551 Ga0105238_10190362 Ga0105238_101903623 194
842 3300009551 Ga0105238_10257162 Ga0105238_102571621 194
843 3300009551 Ga0105238_10455330 Ga0105238_104553301 194
844 3300009551 Ga0105238_10625070 Ga0105238_106250701 194
845 3300009551 Ga0105238_11337437 Ga0105238_113374372 194
846 3300009553 Ga0105249_10259318 Ga0105249_102593182 194
847 3300009553 Ga0105249_10406893 Ga0105249_104068932 194
848 3300009553 Ga0105249_10663097 Ga0105249_106630972 194
849 3300009553 Ga0105249_10766054 Ga0105249_107660542 194
850 3300009553 Ga0105249_11036404 Ga0105249_110364042 194
851 3300009986 Ga0105033_101807 Ga0105033_1018072 194
852 3300010159 Ga0099796_10029746 Ga0099796_100297462 194
853 3300010159 Ga0099796_10030525 Ga0099796_100305252 194
854 3300010159 Ga0099796_10154648 Ga0099796_101546481 194
855 3300010375 Ga0105239_10020985 Ga0105239_100209855 194
856 3300010375 Ga0105239_10022484 Ga0105239_100224844 194
857 3300010375 Ga0105239_10065549 Ga0105239_100655493 194
858 3300010375 Ga0105239_10068406 Ga0105239_100684063 194
859 3300010375 Ga0105239_10070205 Ga0105239_100702053 194
860 3300010375 Ga0105239_10077996 Ga0105239_100779963 194
861 3300010375 Ga0105239_10085098 Ga0105239_100850983 194
862 3300010375 Ga0105239_10099166 Ga0105239_100991663 194
863 3300010375 Ga0105239_10162882 Ga0105239_101628823 194
864 3300010375 Ga0105239_10258518 Ga0105239_102585182 194
865 3300010375 Ga0105239_10291795 Ga0105239_102917952 194
866 3300010375 Ga0105239_10402519 Ga0105239_104025192 194
867 3300010375 Ga0105239_10545007 Ga0105239_105450072 194
868 3300010375 Ga0105239_10591341 Ga0105239_105913412 194
869 3300010375 Ga0105239_10680424 Ga0105239_106804242 194
870 3300010375 Ga0105239_10848811 Ga0105239_108488112 194
871 3300010375 Ga0105239_11211853 Ga0105239_112118531 194
872 3300010375 Ga0105239_11410370 Ga0105239_114103701 194
873 3300011119 Ga0105246_10008035 Ga0105246_100080355 194
874 3300011119 Ga0105246_10042239 Ga0105246_100422393 194
875 3300011119 Ga0105246_10228924 Ga0105246_102289242 194
876 3300011119 Ga0105246_10364989 Ga0105246_103649892 194
877 3300011119 Ga0105246_10687438 Ga0105246_106874382 194
878 3300011119 Ga0105246_11265083 Ga0105246_112650831 194
879 3300013100 Ga0157373_10022626 Ga0157373_100226261 194
880 3300013100 Ga0157373_10052636 Ga0157373_100526362 194
881 3300013100 Ga0157373_10170385 Ga0157373_101703852 194
882 3300013100 Ga0157373_10190638 Ga0157373_101906382 194
883 3300013102 Ga0157371_10102520 Ga0157371_101025202 194
884 3300013102 Ga0157371_10170984 Ga0157371_101709843 194
885 3300013102 Ga0157371_10316211 Ga0157371_103162112 194
886 3300013104 Ga0157370_10188965 Ga0157370_101889652 194
887 3300013104 Ga0157370_10284870 Ga0157370_102848702 194
888 3300013104 Ga0157370_10334140 Ga0157370_103341402 194
889 3300013104 Ga0157370_10473561 Ga0157370_104735612 194
890 3300013104 Ga0157370_10537267 Ga0157370_105372672 194
891 3300013105 Ga0157369_10002009 Ga0157369_1000200917 194
892 3300013105 Ga0157369_10065211 Ga0157369_100652113 194
893 3300013105 Ga0157369_10112613 Ga0157369_101126133 194
894 3300013105 Ga0157369_10205229 Ga0157369_102052293 194
895 3300013105 Ga0157369_10262336 Ga0157369_102623362 194
896 3300013105 Ga0157369_10612490 Ga0157369_106124901 194
897 3300013105 Ga0157369_10766620 Ga0157369_107666202 194
898 3300013105 Ga0157369_10808939 Ga0157369_108089391 194
899 3300013105 Ga0157369_10984947 Ga0157369_109849472 194
900 3300013296 Ga0157374_10021426 Ga0157374_100214263 194
901 3300013296 Ga0157374_10029759 Ga0157374_100297593 194
902 3300013296 Ga0157374_10036334 Ga0157374_100363345 194
903 3300013296 Ga0157374_10046727 Ga0157374_100467272 194
904 3300013296 Ga0157374_10085622 Ga0157374_100856222 194
905 3300013296 Ga0157374_10276341 Ga0157374_102763412 194
906 3300013296 Ga0157374_10486156 Ga0157374_104861562 194
907 3300013296 Ga0157374_10586466 Ga0157374_105864662 194
908 3300013296 Ga0157374_11269005 Ga0157374_112690052 194
909 3300013296 Ga0157374_11409442 Ga0157374_114094421 194
910 3300013297 Ga0157378_10005885 Ga0157378_100058855 194
911 3300013297 Ga0157378_10089371 Ga0157378_100893713 194
912 3300013297 Ga0157378_10208073 Ga0157378_102080732 194
913 3300013297 Ga0157378_10396594 Ga0157378_103965942 194
914 3300013297 Ga0157378_10658846 Ga0157378_106588462 194
915 3300013297 Ga0157378_10727221 Ga0157378_107272211 194
916 3300013306 Ga0163162_10020742 Ga0163162_100207423 194
917 3300013306 Ga0163162_10042840 Ga0163162_100428404 194
918 3300013306 Ga0163162_10075872 Ga0163162_100758723 194
919 3300013306 Ga0163162_10363461 Ga0163162_103634612 194
920 3300013306 Ga0163162_10484396 Ga0163162_104843962 194
921 3300013306 Ga0163162_10688047 Ga0163162_106880472 194
922 3300013306 Ga0163162_11451149 Ga0163162_114511491 194
923 3300013307 Ga0157372_10007630 Ga0157372_100076307 194
924 3300013307 Ga0157372_10016818 Ga0157372_100168185 194
925 3300013307 Ga0157372_10025627 Ga0157372_100256275 194
926 3300013307 Ga0157372_10207445 Ga0157372_102074452 194
927 3300013307 Ga0157372_10247008 Ga0157372_102470083 194
928 3300013307 Ga0157372_10437633 Ga0157372_104376332 194
929 3300013308 Ga0157375_10030198 Ga0157375_100301982 194
930 3300013308 Ga0157375_10192808 Ga0157375_101928082 194
931 3300013308 Ga0157375_10196032 Ga0157375_101960323 194
932 3300013308 Ga0157375_11688217 Ga0157375_116882172 194
933 3300014325 Ga0163163_10013064 Ga0163163_1001306410 194
934 3300014325 Ga0163163_10016615 Ga0163163_100166156 194
935 3300014325 Ga0163163_10028233 Ga0163163_100282333 194
936 3300014325 Ga0163163_10056064 Ga0163163_100560643 194
937 3300014325 Ga0163163_10126036 Ga0163163_101260363 194
938 3300014325 Ga0163163_10254181 Ga0163163_102541812 194
939 3300014325 Ga0163163_10278639 Ga0163163_102786392 194
940 3300014325 Ga0163163_10351936 Ga0163163_103519362 194
941 3300014325 Ga0163163_10466726 Ga0163163_104667262 194
942 3300014325 Ga0163163_10545663 Ga0163163_105456631 194
943 3300014325 Ga0163163_10835494 Ga0163163_108354942 194
944 3300014326 Ga0157380_10049727 Ga0157380_100497272 194
945 3300014326 Ga0157380_10078956 Ga0157380_100789563 194
946 3300014326 Ga0157380_10732410 Ga0157380_107324102 194
947 3300014497 Ga0182008_10270651 Ga0182008_102706511 194
948 3300014745 Ga0157377_10004855 Ga0157377_100048553 194
949 3300014968 Ga0157379_10109090 Ga0157379_101090902 194
950 3300014968 Ga0157379_10121242 Ga0157379_101212422 194
951 3300014968 Ga0157379_10151476 Ga0157379_101514762 194
952 3300014968 Ga0157379_10180586 Ga0157379_101805862 194
953 3300014968 Ga0157379_10321160 Ga0157379_103211602 194
954 3300014968 Ga0157379_10544725 Ga0157379_105447251 194
955 3300014968 Ga0157379_10549396 Ga0157379_105493962 194
956 3300014968 Ga0157379_10913192 Ga0157379_109131922 194
957 3300014968 Ga0157379_11520741 Ga0157379_115207411 194
958 3300014969 Ga0157376_10105608 Ga0157376_101056082 194
959 3300014969 Ga0157376_10154785 Ga0157376_101547852 194
960 3300014969 Ga0157376_10186713 Ga0157376_101867133 194
961 3300015262 Ga0182007_10035887 Ga0182007_100358872 194
962 3300017792 Ga0163161_10087419 Ga0163161_100874193 194
963 3300017792 Ga0163161_10674334 Ga0163161_106743341 194
964 3300020081 Ga0206354_10972822 Ga0206354_109728222 194
965 3300020082 Ga0206353_10577094 Ga0206353_105770942 194
966 3300021320 Ga0214544_1000002 Ga0214544_100000292 194
967 3300021321 Ga0214542_1000001 Ga0214542_1000001442 194
968 3300021324 Ga0214545_1000001 Ga0214545_1000001508 194
969 3300021327 Ga0214543_1000001 Ga0214543_1000001688 194
970 3300021361 Ga0213872_10043815 Ga0213872_100438152 194
971 3300021377 Ga0213874_10119551 Ga0213874_101195512 194
972 3300021384 Ga0213876_10013768 Ga0213876_100137683 194
973 3300021384 Ga0213876_10033823 Ga0213876_100338232 194
974 3300021384 Ga0213876_10097220 Ga0213876_100972203 194
975 3300021384 Ga0213876_10120657 Ga0213876_101206572 194
976 3300021388 Ga0213875_10006485 Ga0213875_100064853 194
977 3300021388 Ga0213875_10114681 Ga0213875_101146812 194
978 3300021388 Ga0213875_10288178 Ga0213875_102881781 194
979 3300021441 Ga0213871_10021775 Ga0213871_100217752 194
980 3300021441 Ga0213871_10122920 Ga0213871_101229201 194
981 3300022467 Ga0224712_10020465 Ga0224712_100204653 194
982 3300022732 Ga0224569_100324 Ga0224569_1003244 194
983 3300022734 Ga0224571_100055 Ga0224571_1000555 194
984 3300024225 Ga0224572_1003956 Ga0224572_10039561 194
985 3300024225 Ga0224572_1015545 Ga0224572_10155452 194
986 3300024227 Ga0228598_1000345 Ga0228598_10003456 194
987 3300024227 Ga0228598_1000387 Ga0228598_10003872 194
988 3300024227 Ga0228598_1034168 Ga0228598_10341682 194
989 3300025230 Ga0209563_101866 Ga0209563_1018662 194
990 3300025245 Ga0207425_1003455 Ga0207425_10034552 194
991 3300025253 Ga0209677_102108 Ga0209677_1021083 194
992 3300025253 Ga0209677_105443 Ga0209677_1054433 194
993 3300025254 Ga0209148_1000500 Ga0209148_100050026 194
994 3300025261 Ga0209233_1001496 Ga0209233_10014969 194
995 3300025261 Ga0209233_1002337 Ga0209233_10023375 194
996 3300025261 Ga0209233_1012236 Ga0209233_10122362 194
997 3300025261 Ga0209233_1018269 Ga0209233_10182693 194
998 3300025272 Ga0209455_1004034 Ga0209455_10040342 194
999 3300025272 Ga0209455_1005592 Ga0209455_10055922 194
1000 3300025272 Ga0209455_1006056 Ga0209455_10060563 194
1001 3300025272 Ga0209455_1016743 Ga0209455_10167432 194
1002 3300025273 Ga0209673_1010584 Ga0209673_10105843 194
1003 3300025284 Ga0209130_1000246 Ga0209130_100024655 194
1004 3300025284 Ga0209130_1000536 Ga0209130_100053611 194
1005 3300025292 Ga0209676_1019647 Ga0209676_10196472 194
1006 3300025294 Ga0209025_1001140 Ga0209025_10011401 194
1007 3300025294 Ga0209025_1004941 Ga0209025_10049414 194
1008 3300025294 Ga0209025_1031507 Ga0209025_10315073 194
1009 3300025295 Ga0209564_1006742 Ga0209564_10067423 194
1010 3300025295 Ga0209564_1008759 Ga0209564_10087593 194
1011 3300025297 Ga0209758_1000024 Ga0209758_100002484 194
1012 3300025297 Ga0209758_1000068 Ga0209758_100006843 194
1013 3300025297 Ga0209758_1000169 Ga0209758_100016942 194
1014 3300025297 Ga0209758_1002409 Ga0209758_100240915 194
1015 3300025297 Ga0209758_1011950 Ga0209758_10119505 194
1016 3300025297 Ga0209758_1023458 Ga0209758_10234584 194
1017 3300025297 Ga0209758_1066478 Ga0209758_10664782 194
1018 3300025299 Ga0209256_1006433 Ga0209256_10064334 194
1019 3300025299 Ga0209256_1025580 Ga0209256_10255802 194
1020 3300025302 Ga0207426_1000092 Ga0207426_100009275 194
1021 3300025302 Ga0207426_1000238 Ga0207426_100023827 194
1022 3300025302 Ga0207426_1002351 Ga0207426_10023516 194
1023 3300025302 Ga0207426_1033857 Ga0207426_10338572 194
1024 3300025302 Ga0207426_1052300 Ga0207426_10523001 194
1025 3300025304 Ga0209257_1000640 Ga0209257_100064032 194
1026 3300025304 Ga0209257_1001699 Ga0209257_100169918 194
1027 3300025304 Ga0209257_1010441 Ga0209257_10104415 194
1028 3300025315 Ga0207697_10006461 Ga0207697_100064615 194
1029 3300025315 Ga0207697_10194740 Ga0207697_101947402 194
1030 3300025321 Ga0207656_10023120 Ga0207656_100231202 194
1031 3300025321 Ga0207656_10052624 Ga0207656_100526242 194
1032 3300025321 Ga0207656_10101155 Ga0207656_101011551 194
1033 3300025885 Ga0207653_10022358 Ga0207653_100223582 194
1034 3300025898 Ga0207692_10000763 Ga0207692_100007634 194
1035 3300025898 Ga0207692_10000845 Ga0207692_100008453 194
1036 3300025898 Ga0207692_10003883 Ga0207692_100038834 194
1037 3300025898 Ga0207692_10010529 Ga0207692_100105293 194
1038 3300025898 Ga0207692_10015295 Ga0207692_100152953 194
1039 3300025898 Ga0207692_10023349 Ga0207692_100233492 194
1040 3300025898 Ga0207692_10043469 Ga0207692_100434692 194
1041 3300025898 Ga0207692_10183120 Ga0207692_101831202 194
1042 3300025898 Ga0207692_10225774 Ga0207692_102257742 194
1043 3300025898 Ga0207692_10318242 Ga0207692_103182422 194
1044 3300025899 Ga0207642_10316498 Ga0207642_103164982 194
1045 3300025900 Ga0207710_10042394 Ga0207710_100423943 194
1046 3300025900 Ga0207710_10094509 Ga0207710_100945092 194
1047 3300025900 Ga0207710_10129870 Ga0207710_101298701 194
1048 3300025900 Ga0207710_10244497 Ga0207710_102444972 194
1049 3300025901 Ga0207688_10060955 Ga0207688_100609552 194
1050 3300025901 Ga0207688_10107334 Ga0207688_101073342 194
1051 3300025901 Ga0207688_10268322 Ga0207688_102683222 194
1052 3300025903 Ga0207680_10022128 Ga0207680_100221283 194
1053 3300025903 Ga0207680_10366578 Ga0207680_103665781 194
1054 3300025904 Ga0207647_10006516 Ga0207647_100065164 194
1055 3300025904 Ga0207647_10025481 Ga0207647_100254814 194
1056 3300025905 Ga0207685_10016489 Ga0207685_100164893 194
1057 3300025905 Ga0207685_10020039 Ga0207685_100200392 194
1058 3300025905 Ga0207685_10027690 Ga0207685_100276902 194
1059 3300025905 Ga0207685_10081238 Ga0207685_100812382 194
1060 3300025906 Ga0207699_10000406 Ga0207699_100004068 194
1061 3300025906 Ga0207699_10008314 Ga0207699_100083145 194
1062 3300025906 Ga0207699_10024323 Ga0207699_100243232 194
1063 3300025906 Ga0207699_10038107 Ga0207699_100381072 194
1064 3300025906 Ga0207699_10052591 Ga0207699_100525913 194
1065 3300025906 Ga0207699_10093028 Ga0207699_100930282 194
1066 3300025906 Ga0207699_10192711 Ga0207699_101927111 194
1067 3300025906 Ga0207699_10232734 Ga0207699_102327342 194
1068 3300025906 Ga0207699_10270051 Ga0207699_102700512 194
1069 3300025906 Ga0207699_10285392 Ga0207699_102853922 194
1070 3300025907 Ga0207645_10001364 Ga0207645_1000136413 194
1071 3300025907 Ga0207645_10076723 Ga0207645_100767232 194
1072 3300025907 Ga0207645_10375637 Ga0207645_103756372 194
1073 3300025908 Ga0207643_10003304 Ga0207643_100033045 194
1074 3300025908 Ga0207643_10199760 Ga0207643_101997602 194
1075 3300025909 Ga0207705_10073369 Ga0207705_100733692 194
1076 3300025909 Ga0207705_10087315 Ga0207705_100873152 194
1077 3300025909 Ga0207705_10289063 Ga0207705_102890632 194
1078 3300025909 Ga0207705_10481719 Ga0207705_104817192 194
1079 3300025909 Ga0207705_10599024 Ga0207705_105990242 194
1080 3300025910 Ga0207684_10000229 Ga0207684_1000022968 194
1081 3300025910 Ga0207684_10000766 Ga0207684_1000076616 194
1082 3300025911 Ga0207654_10021290 Ga0207654_100212902 194
1083 3300025911 Ga0207654_10076452 Ga0207654_100764522 194
1084 3300025911 Ga0207654_10130575 Ga0207654_101305752 194
1085 3300025911 Ga0207654_10189313 Ga0207654_101893131 194
1086 3300025912 Ga0207707_10000173 Ga0207707_1000017362 194
1087 3300025912 Ga0207707_10011453 Ga0207707_100114532 194
1088 3300025912 Ga0207707_10043008 Ga0207707_100430083 194
1089 3300025912 Ga0207707_10104297 Ga0207707_101042972 194
1090 3300025912 Ga0207707_10487143 Ga0207707_104871432 194
1091 3300025913 Ga0207695_10000008 Ga0207695_10000008158 194
1092 3300025913 Ga0207695_10006864 Ga0207695_100068645 194
1093 3300025913 Ga0207695_10023272 Ga0207695_100232726 194
1094 3300025913 Ga0207695_10033658 Ga0207695_100336582 194
1095 3300025913 Ga0207695_10049084 Ga0207695_100490843 194
1096 3300025913 Ga0207695_10059623 Ga0207695_100596233 194
1097 3300025913 Ga0207695_10397517 Ga0207695_103975172 194
1098 3300025913 Ga0207695_10404169 Ga0207695_104041692 194
1099 3300025914 Ga0207671_10006585 Ga0207671_100065857 194
1100 3300025914 Ga0207671_10011165 Ga0207671_100111655 194
1101 3300025914 Ga0207671_10192261 Ga0207671_101922611 194
1102 3300025914 Ga0207671_10524323 Ga0207671_105243232 194
1103 3300025915 Ga0207693_10000170 Ga0207693_1000017040 194
1104 3300025915 Ga0207693_10000553 Ga0207693_100005537 194
1105 3300025915 Ga0207693_10000950 Ga0207693_100009504 194
1106 3300025915 Ga0207693_10001388 Ga0207693_1000138811 194
1107 3300025915 Ga0207693_10002846 Ga0207693_100028462 194
1108 3300025915 Ga0207693_10006997 Ga0207693_100069973 194
1109 3300025915 Ga0207693_10033683 Ga0207693_100336833 194
1110 3300025915 Ga0207693_10043859 Ga0207693_100438592 194
1111 3300025915 Ga0207693_10098302 Ga0207693_100983022 194
1112 3300025915 Ga0207693_10140403 Ga0207693_101404032 194
1113 3300025916 Ga0207663_10000515 Ga0207663_1000051514 194
1114 3300025916 Ga0207663_10003582 Ga0207663_100035828 194
1115 3300025916 Ga0207663_10004881 Ga0207663_100048815 194
1116 3300025916 Ga0207663_10020404 Ga0207663_100204043 194
1117 3300025916 Ga0207663_10029753 Ga0207663_100297532 194
1118 3300025916 Ga0207663_10033348 Ga0207663_100333484 194
1119 3300025916 Ga0207663_10036887 Ga0207663_100368872 194
1120 3300025916 Ga0207663_10046778 Ga0207663_100467783 194
1121 3300025916 Ga0207663_10067588 Ga0207663_100675883 194
1122 3300025916 Ga0207663_10433791 Ga0207663_104337911 194
1123 3300025916 Ga0207663_10867863 Ga0207663_108678631 194
1124 3300025917 Ga0207660_10013563 Ga0207660_100135631 194
1125 3300025917 Ga0207660_10047666 Ga0207660_100476662 194
1126 3300025917 Ga0207660_10084112 Ga0207660_100841122 194
1127 3300025917 Ga0207660_10711317 Ga0207660_107113171 194
1128 3300025918 Ga0207662_10000921 Ga0207662_100009218 194
1129 3300025919 Ga0207657_10000565 Ga0207657_1000056531 194
1130 3300025919 Ga0207657_10000942 Ga0207657_100009427 194
1131 3300025919 Ga0207657_10004866 Ga0207657_1000486611 194
1132 3300025919 Ga0207657_10066317 Ga0207657_100663172 194
1133 3300025919 Ga0207657_10130730 Ga0207657_101307303 194
1134 3300025919 Ga0207657_10544568 Ga0207657_105445682 194
1135 3300025920 Ga0207649_10081331 Ga0207649_100813312 194
1136 3300025920 Ga0207649_10427623 Ga0207649_104276232 194
1137 3300025920 Ga0207649_10761888 Ga0207649_107618881 194
1138 3300025921 Ga0207652_10031853 Ga0207652_100318534 194
1139 3300025921 Ga0207652_10034398 Ga0207652_100343983 194
1140 3300025921 Ga0207652_10260005 Ga0207652_102600052 194
1141 3300025921 Ga0207652_10605694 Ga0207652_106056942 194
1142 3300025922 Ga0207646_10000898 Ga0207646_100008985 194
1143 3300025922 Ga0207646_10132238 Ga0207646_101322383 194
1144 3300025922 Ga0207646_10185426 Ga0207646_101854262 194
1145 3300025922 Ga0207646_10457049 Ga0207646_104570492 194
1146 3300025923 Ga0207681_10178634 Ga0207681_101786342 194
1147 3300025923 Ga0207681_10214708 Ga0207681_102147082 194
1148 3300025923 Ga0207681_10824369 Ga0207681_108243692 194
1149 3300025924 Ga0207694_10004313 Ga0207694_100043134 194
1150 3300025924 Ga0207694_10032668 Ga0207694_100326685 194
1151 3300025924 Ga0207694_10050874 Ga0207694_100508743 194
1152 3300025924 Ga0207694_10432038 Ga0207694_104320382 194
1153 3300025924 Ga0207694_10884038 Ga0207694_108840381 194
1154 3300025925 Ga0207650_10000121 Ga0207650_1000012172 194
1155 3300025925 Ga0207650_10036131 Ga0207650_100361314 194
1156 3300025926 Ga0207659_10235438 Ga0207659_102354382 194
1157 3300025926 Ga0207659_10402333 Ga0207659_104023332 194
1158 3300025926 Ga0207659_10555467 Ga0207659_105554672 194
1159 3300025927 Ga0207687_10007335 Ga0207687_100073354 194
1160 3300025927 Ga0207687_10048309 Ga0207687_100483093 194
1161 3300025927 Ga0207687_10114884 Ga0207687_101148842 194
1162 3300025927 Ga0207687_10218324 Ga0207687_102183242 194
1163 3300025927 Ga0207687_10247681 Ga0207687_102476813 194
1164 3300025927 Ga0207687_10512069 Ga0207687_105120692 194
1165 3300025928 Ga0207700_10001554 Ga0207700_100015547 194
1166 3300025928 Ga0207700_10003543 Ga0207700_100035433 194
1167 3300025928 Ga0207700_10036858 Ga0207700_100368583 194
1168 3300025928 Ga0207700_10040382 Ga0207700_100403823 194
1169 3300025928 Ga0207700_10046879 Ga0207700_100468794 194
1170 3300025928 Ga0207700_10086854 Ga0207700_100868541 194
1171 3300025928 Ga0207700_10104572 Ga0207700_101045723 194
1172 3300025928 Ga0207700_10105524 Ga0207700_101055242 194
1173 3300025928 Ga0207700_10116907 Ga0207700_101169072 194
1174 3300025928 Ga0207700_10148493 Ga0207700_101484933 194
1175 3300025928 Ga0207700_10158124 Ga0207700_101581242 194
1176 3300025929 Ga0207664_10002606 Ga0207664_100026064 194
1177 3300025929 Ga0207664_10032949 Ga0207664_100329492 194
1178 3300025929 Ga0207664_10209233 Ga0207664_102092332 194
1179 3300025929 Ga0207664_10248703 Ga0207664_102487032 194
1180 3300025929 Ga0207664_10417764 Ga0207664_104177642 194
1181 3300025931 Ga0207644_10066511 Ga0207644_100665113 194
1182 3300025931 Ga0207644_10093767 Ga0207644_100937673 194
1183 3300025931 Ga0207644_10656209 Ga0207644_106562092 194
1184 3300025931 Ga0207644_10691331 Ga0207644_106913311 194
1185 3300025932 Ga0207690_10086011 Ga0207690_100860112 194
1186 3300025932 Ga0207690_10105718 Ga0207690_101057181 194
1187 3300025932 Ga0207690_10398926 Ga0207690_103989262 194
1188 3300025933 Ga0207706_10000471 Ga0207706_100004715 194
1189 3300025933 Ga0207706_10003758 Ga0207706_100037585 194
1190 3300025933 Ga0207706_10114876 Ga0207706_101148762 194
1191 3300025933 Ga0207706_10137024 Ga0207706_101370243 194
1192 3300025933 Ga0207706_10151801 Ga0207706_101518012 194
1193 3300025933 Ga0207706_10922985 Ga0207706_109229852 194
1194 3300025934 Ga0207686_10086888 Ga0207686_100868882 194
1195 3300025934 Ga0207686_10634339 Ga0207686_106343392 194
1196 3300025935 Ga0207709_10037623 Ga0207709_100376233 194
1197 3300025935 Ga0207709_10288991 Ga0207709_102889912 194
1198 3300025936 Ga0207670_10045841 Ga0207670_100458412 194
1199 3300025936 Ga0207670_10229732 Ga0207670_102297322 194
1200 3300025936 Ga0207670_10278204 Ga0207670_102782042 194
1201 3300025937 Ga0207669_10263330 Ga0207669_102633302 194
1202 3300025937 Ga0207669_10561935 Ga0207669_105619352 194
1203 3300025937 Ga0207669_10703277 Ga0207669_107032771 194
1204 3300025938 Ga0207704_10048608 Ga0207704_100486083 194
1205 3300025938 Ga0207704_10081926 Ga0207704_100819263 194
1206 3300025938 Ga0207704_10191065 Ga0207704_101910652 194
1207 3300025938 Ga0207704_10716949 Ga0207704_107169491 194
1208 3300025939 Ga0207665_10000552 Ga0207665_1000055223 194
1209 3300025939 Ga0207665_10000874 Ga0207665_1000087410 194
1210 3300025939 Ga0207665_10006432 Ga0207665_100064325 194
1211 3300025939 Ga0207665_10044837 Ga0207665_100448373 194
1212 3300025939 Ga0207665_10059539 Ga0207665_100595392 194
1213 3300025939 Ga0207665_10061461 Ga0207665_100614613 194
1214 3300025939 Ga0207665_10063425 Ga0207665_100634254 194
1215 3300025939 Ga0207665_10077225 Ga0207665_100772251 194
1216 3300025939 Ga0207665_10127742 Ga0207665_101277422 194
1217 3300025939 Ga0207665_10303496 Ga0207665_103034962 194
1218 3300025939 Ga0207665_10347155 Ga0207665_103471552 194
1219 3300025939 Ga0207665_10510784 Ga0207665_105107842 194
1220 3300025940 Ga0207691_10279738 Ga0207691_102797382 194
1221 3300025940 Ga0207691_10915125 Ga0207691_109151251 194
1222 3300025941 Ga0207711_10013287 Ga0207711_100132873 194
1223 3300025941 Ga0207711_10044634 Ga0207711_100446344 194
1224 3300025941 Ga0207711_10070516 Ga0207711_100705163 194
1225 3300025941 Ga0207711_10079952 Ga0207711_100799523 194
1226 3300025941 Ga0207711_10238623 Ga0207711_102386232 194
1227 3300025942 Ga0207689_10007261 Ga0207689_100072615 194
1228 3300025942 Ga0207689_10121118 Ga0207689_101211183 194
1229 3300025942 Ga0207689_10217100 Ga0207689_102171002 194
1230 3300025944 Ga0207661_10000210 Ga0207661_1000021034 194
1231 3300025944 Ga0207661_10024349 Ga0207661_100243495 194
1232 3300025944 Ga0207661_10049596 Ga0207661_100495963 194
1233 3300025944 Ga0207661_10054352 Ga0207661_100543522 194
1234 3300025944 Ga0207661_10160901 Ga0207661_101609012 194
1235 3300025945 Ga0207679_10001610 Ga0207679_100016109 194
1236 3300025945 Ga0207679_10107154 Ga0207679_101071542 194
1237 3300025945 Ga0207679_10145104 Ga0207679_101451042 194
1238 3300025945 Ga0207679_10296013 Ga0207679_102960132 194
1239 3300025945 Ga0207679_10504337 Ga0207679_105043371 194
1240 3300025945 Ga0207679_10571020 Ga0207679_105710202 194
1241 3300025949 Ga0207667_10006339 Ga0207667_100063393 194
1242 3300025949 Ga0207667_10043071 Ga0207667_100430714 194
1243 3300025949 Ga0207667_10092380 Ga0207667_100923803 194
1244 3300025949 Ga0207667_10174570 Ga0207667_101745702 194
1245 3300025949 Ga0207667_10190599 Ga0207667_101905992 194
1246 3300025949 Ga0207667_10294022 Ga0207667_102940222 194
1247 3300025949 Ga0207667_10759491 Ga0207667_107594912 194
1248 3300025949 Ga0207667_11232667 Ga0207667_112326672 194
1249 3300025960 Ga0207651_10056765 Ga0207651_100567652 194
1250 3300025960 Ga0207651_10527977 Ga0207651_105279771 194
1251 3300025961 Ga0207712_10319277 Ga0207712_103192772 194
1252 3300025961 Ga0207712_10538583 Ga0207712_105385832 194
1253 3300025972 Ga0207668_10124987 Ga0207668_101249872 194
1254 3300025972 Ga0207668_10138799 Ga0207668_101387992 194
1255 3300025972 Ga0207668_10144872 Ga0207668_101448722 194
1256 3300025972 Ga0207668_10163670 Ga0207668_101636702 194
1257 3300025972 Ga0207668_10189847 Ga0207668_101898472 194
1258 3300025972 Ga0207668_10234400 Ga0207668_102344002 194
1259 3300025972 Ga0207668_10245726 Ga0207668_102457261 194
1260 3300025972 Ga0207668_10299026 Ga0207668_102990262 194
1261 3300025972 Ga0207668_10575225 Ga0207668_105752251 194
1262 3300025972 Ga0207668_10981957 Ga0207668_109819572 194
1263 3300025981 Ga0207640_10034141 Ga0207640_100341416 194
1264 3300025981 Ga0207640_10069975 Ga0207640_100699753 194
1265 3300025981 Ga0207640_10187396 Ga0207640_101873961 194
1266 3300025981 Ga0207640_10785466 Ga0207640_107854661 194
1267 3300025986 Ga0207658_10128551 Ga0207658_101285512 194
1268 3300025986 Ga0207658_10220572 Ga0207658_102205722 194
1269 3300025986 Ga0207658_10286199 Ga0207658_102861992 194
1270 3300025986 Ga0207658_10688899 Ga0207658_106888991 194
1271 3300025986 Ga0207658_10870005 Ga0207658_108700052 194
1272 3300025986 Ga0207658_11265355 Ga0207658_112653551 194
1273 3300026023 Ga0207677_10006451 Ga0207677_100064513 194
1274 3300026023 Ga0207677_10010738 Ga0207677_100107383 194
1275 3300026023 Ga0207677_10094857 Ga0207677_100948573 194
1276 3300026035 Ga0207703_10100425 Ga0207703_101004253 194
1277 3300026035 Ga0207703_10212403 Ga0207703_102124032 194
1278 3300026035 Ga0207703_10529438 Ga0207703_105294381 194
1279 3300026035 Ga0207703_10556568 Ga0207703_105565682 194
1280 3300026035 Ga0207703_10625789 Ga0207703_106257892 194
1281 3300026041 Ga0207639_10043625 Ga0207639_100436252 194
1282 3300026041 Ga0207639_10133496 Ga0207639_101334962 194
1283 3300026041 Ga0207639_10261610 Ga0207639_102616102 194
1284 3300026041 Ga0207639_10285835 Ga0207639_102858351 194
1285 3300026041 Ga0207639_10654297 Ga0207639_106542972 194
1286 3300026041 Ga0207639_10939246 Ga0207639_109392461 194
1287 3300026041 Ga0207639_11021697 Ga0207639_110216972 194
1288 3300026067 Ga0207678_10009622 Ga0207678_100096226 194
1289 3300026067 Ga0207678_10017447 Ga0207678_100174472 194
1290 3300026067 Ga0207678_10031260 Ga0207678_100312605 194
1291 3300026067 Ga0207678_10042459 Ga0207678_100424593 194
1292 3300026067 Ga0207678_10182749 Ga0207678_101827492 194
1293 3300026067 Ga0207678_10273020 Ga0207678_102730202 194
1294 3300026067 Ga0207678_10451714 Ga0207678_104517141 194
1295 3300026067 Ga0207678_10579192 Ga0207678_105791922 194
1296 3300026075 Ga0207708_10054613 Ga0207708_100546132 194
1297 3300026075 Ga0207708_10185101 Ga0207708_101851012 194
1298 3300026075 Ga0207708_10678004 Ga0207708_106780042 194
1299 3300026078 Ga0207702_10001309 Ga0207702_100013097 194
1300 3300026078 Ga0207702_10256289 Ga0207702_102562892 194
1301 3300026078 Ga0207702_10355532 Ga0207702_103555322 194
1302 3300026078 Ga0207702_10366143 Ga0207702_103661432 194
1303 3300026078 Ga0207702_10648109 Ga0207702_106481091 194
1304 3300026078 Ga0207702_11057287 Ga0207702_110572871 194
1305 3300026088 Ga0207641_10000317 Ga0207641_100003175 194
1306 3300026088 Ga0207641_10207506 Ga0207641_102075062 194
1307 3300026088 Ga0207641_10265129 Ga0207641_102651292 194
1308 3300026088 Ga0207641_10424053 Ga0207641_104240532 194
1309 3300026088 Ga0207641_10687246 Ga0207641_106872462 194
1310 3300026088 Ga0207641_11218444 Ga0207641_112184442 194
1311 3300026088 Ga0207641_11246775 Ga0207641_112467751 194
1312 3300026089 Ga0207648_10035150 Ga0207648_100351504 194
1313 3300026089 Ga0207648_10071057 Ga0207648_100710573 194
1314 3300026089 Ga0207648_10085124 Ga0207648_100851243 194
1315 3300026089 Ga0207648_10157466 Ga0207648_101574662 194
1316 3300026089 Ga0207648_10236951 Ga0207648_102369512 194
1317 3300026089 Ga0207648_10374763 Ga0207648_103747632 194
1318 3300026089 Ga0207648_10609947 Ga0207648_106099471 194
1319 3300026095 Ga0207676_10000076 Ga0207676_1000007663 194
1320 3300026095 Ga0207676_10149817 Ga0207676_101498172 194
1321 3300026095 Ga0207676_10333379 Ga0207676_103333793 194
1322 3300026095 Ga0207676_10729649 Ga0207676_107296492 194
1323 3300026095 Ga0207676_10813109 Ga0207676_108131092 194
1324 3300026116 Ga0207674_10000117 Ga0207674_1000011747 194
1325 3300026116 Ga0207674_10042222 Ga0207674_100422225 194
1326 3300026116 Ga0207674_10066539 Ga0207674_100665394 194
1327 3300026116 Ga0207674_10269795 Ga0207674_102697952 194
1328 3300026116 Ga0207674_10313976 Ga0207674_103139762 194
1329 3300026116 Ga0207674_10795296 Ga0207674_107952962 194
1330 3300026118 Ga0207675_100023317 Ga0207675_1000233173 194
1331 3300026118 Ga0207675_100121109 Ga0207675_1001211092 194
1332 3300026118 Ga0207675_100170032 Ga0207675_1001700322 194
1333 3300026118 Ga0207675_100289601 Ga0207675_1002896012 194
1334 3300026118 Ga0207675_101026365 Ga0207675_1010263651 194
1335 3300026121 Ga0207683_10016038 Ga0207683_100160384 194
1336 3300026121 Ga0207683_10083926 Ga0207683_100839263 194
1337 3300026121 Ga0207683_10132192 Ga0207683_101321922 194
1338 3300026121 Ga0207683_10166299 Ga0207683_101662992 194
1339 3300026121 Ga0207683_10168668 Ga0207683_101686682 194
1340 3300026121 Ga0207683_10172909 Ga0207683_101729092 194
1341 3300026121 Ga0207683_10261891 Ga0207683_102618912 194
1342 3300026121 Ga0207683_10512825 Ga0207683_105128252 194
1343 3300026121 Ga0207683_10941821 Ga0207683_109418212 194
1344 3300026142 Ga0207698_10050445 Ga0207698_100504451 194
1345 3300026142 Ga0207698_10123375 Ga0207698_101233752 194
1346 3300026142 Ga0207698_10196721 Ga0207698_101967212 194
1347 3300026142 Ga0207698_10233868 Ga0207698_102338682 194
1348 3300026142 Ga0207698_10299266 Ga0207698_102992662 194
1349 3300026142 Ga0207698_10435396 Ga0207698_104353962 194
1350 3300026142 Ga0207698_10546801 Ga0207698_105468012 194
1351 3300026142 Ga0207698_11405604 Ga0207698_114056041 194
1352 3300027296 Ga0209389_1000107 Ga0209389_100010759 194
1353 3300027296 Ga0209389_1002563 Ga0209389_10025637 194
1354 3300027357 Ga0209589_1000011 Ga0209589_100001127 194
1355 3300027357 Ga0209589_1000036 Ga0209589_1000036123 194
1356 3300027361 Ga0209489_100006 Ga0209489_100006451 194
1357 3300027361 Ga0209489_100012 Ga0209489_10001227 194
1358 3300027361 Ga0209489_115889 Ga0209489_1158893 194
1359 3300027361 Ga0209489_115890 Ga0209489_1158903 194
1360 3300027363 Ga0209700_100005 Ga0209700_100005320 194
1361 3300027363 Ga0209700_100019 Ga0209700_10001927 194
1362 3300027512 Ga0209179_1003780 Ga0209179_10037802 194
1363 3300027671 Ga0209588_1010104 Ga0209588_10101042 194
1364 3300027671 Ga0209588_1158374 Ga0209588_11583741 194
1365 3300027866 Ga0209813_10020653 Ga0209813_100206533 194
1366 3300027866 Ga0209813_10022361 Ga0209813_100223612 194
1367 3300027866 Ga0209813_10148667 Ga0209813_101486671 194
1368 3300027907 Ga0207428_10348298 Ga0207428_103482982 194
1369 3300028017 Ga0265356_1000368 Ga0265356_10003686 194
1370 3300028379 Ga0268266_10002874 Ga0268266_1000287413 194
1371 3300028379 Ga0268266_10013866 Ga0268266_100138662 194
1372 3300028379 Ga0268266_10014156 Ga0268266_100141565 194
1373 3300028379 Ga0268266_10033522 Ga0268266_100335223 194
1374 3300028379 Ga0268266_10036975 Ga0268266_100369753 194
1375 3300028379 Ga0268266_10072145 Ga0268266_100721452 194
1376 3300028379 Ga0268266_10396089 Ga0268266_103960892 194
1377 3300028379 Ga0268266_10506768 Ga0268266_105067682 194
1378 3300028380 Ga0268265_10029692 Ga0268265_100296924 194
1379 3300028380 Ga0268265_10050782 Ga0268265_100507822 194
1380 3300028380 Ga0268265_10071970 Ga0268265_100719702 194
1381 3300028380 Ga0268265_10199577 Ga0268265_101995772 194
1382 3300028380 Ga0268265_10348359 Ga0268265_103483592 194
1383 3300028380 Ga0268265_10780442 Ga0268265_107804422 194
1384 3300028381 Ga0268264_10000065 Ga0268264_10000065185 194
1385 3300028381 Ga0268264_10075822 Ga0268264_100758224 194
1386 3300028381 Ga0268264_10164548 Ga0268264_101645483 194
1387 3300028381 Ga0268264_10891659 Ga0268264_108916591 194
1388 3300028556 Ga0265337_1011253 Ga0265337_10112533 194
1389 3300028558 Ga0265326_10002479 Ga0265326_100024797 194
1390 3300028563 Ga0265319_1003252 Ga0265319_10032525 194
1391 3300028573 Ga0265334_10003859 Ga0265334_100038593 194
1392 3300028573 Ga0265334_10009956 Ga0265334_100099563 194
1393 3300028577 Ga0265318_10004124 Ga0265318_100041244 194
1394 3300028653 Ga0265323_10006219 Ga0265323_100062193 194
1395 3300028666 Ga0265336_10000125 Ga0265336_1000012541 194
1396 3300028786 Ga0307517_10000279 Ga0307517_1000027937 194
1397 3300028786 Ga0307517_10089150 Ga0307517_100891502 194
1398 3300028794 Ga0307515_10205191 Ga0307515_102051912 194
1399 3300028800 Ga0265338_10000085 Ga0265338_1000008567 194
1400 3300028800 Ga0265338_10009964 Ga0265338_1000996410 194
1401 3300028800 Ga0265338_10020377 Ga0265338_100203773 194
1402 3300028800 Ga0265338_10086009 Ga0265338_100860094 194
1403 3300028800 Ga0265338_10090539 Ga0265338_100905392 194
1404 3300028800 Ga0265338_10109676 Ga0265338_101096762 194
1405 3300028800 Ga0265338_10368566 Ga0265338_103685661 194
1406 3300028800 Ga0265338_10382886 Ga0265338_103828862 194
1407 3300029957 Ga0265324_10001316 Ga0265324_100013164 194
1408 3300030521 Ga0307511_10042483 Ga0307511_100424832 194
1409 3300030760 Ga0265762_1000180 Ga0265762_10001802 194
1410 3300030878 Ga0265770_1000774 Ga0265770_10007744 194
1411 3300030879 Ga0265765_1028426 Ga0265765_10284261 194
1412 3300031090 Ga0265760_10128309 Ga0265760_101283091 194
1413 3300031235 Ga0265330_10041412 Ga0265330_100414122 194
1414 3300031235 Ga0265330_10088639 Ga0265330_100886392 194
1415 3300031238 Ga0265332_10011140 Ga0265332_100111404 194
1416 3300031239 Ga0265328_10024215 Ga0265328_100242152 194
1417 3300031239 Ga0265328_10080753 Ga0265328_100807532 194
1418 3300031241 Ga0265325_10010622 Ga0265325_100106225 194
1419 3300031247 Ga0265340_10001234 Ga0265340_1000123412 194
1420 3300031247 Ga0265340_10152500 Ga0265340_101525002 194
1421 3300031249 Ga0265339_10118873 Ga0265339_101188732 194
1422 3300031249 Ga0265339_10168380 Ga0265339_101683802 194
1423 3300031250 Ga0265331_10037710 Ga0265331_100377102 194
1424 3300031344 Ga0265316_10012437 Ga0265316_100124375 194
1425 3300031344 Ga0265316_10052801 Ga0265316_100528013 194
1426 3300031344 Ga0265316_10446832 Ga0265316_104468322 194
1427 3300031456 Ga0307513_10144244 Ga0307513_101442442 194
1428 3300031456 Ga0307513_10321981 Ga0307513_103219812 194
1429 3300031456 Ga0307513_10437637 Ga0307513_104376372 194
1430 3300031507 Ga0307509_10019751 Ga0307509_100197515 194
1431 3300031507 Ga0307509_10029382 Ga0307509_100293825 194
1432 3300031507 Ga0307509_10105981 Ga0307509_101059812 194
1433 3300031507 Ga0307509_10458655 Ga0307509_104586551 194
1434 3300031507 Ga0307509_10472266 Ga0307509_104722662 194
1435 3300031548 Ga0307408_100790903 Ga0307408_1007909031 194
1436 3300031595 Ga0265313_10034401 Ga0265313_100344012 194
1437 3300031616 Ga0307508_10000018 Ga0307508_10000018156 194
1438 3300031616 Ga0307508_10095251 Ga0307508_100952513 194
1439 3300031616 Ga0307508_10103951 Ga0307508_101039512 194
1440 3300031616 Ga0307508_10439197 Ga0307508_104391972 194
1441 3300031711 Ga0265314_10000412 Ga0265314_100004123 194
1442 3300031711 Ga0265314_10014873 Ga0265314_100148732 194
1443 3300031711 Ga0265314_10083329 Ga0265314_100833291 194
1444 3300031711 Ga0265314_10257653 Ga0265314_102576532 194
1445 3300031712 Ga0265342_10042929 Ga0265342_100429293 194
1446 3300031712 Ga0265342_10221517 Ga0265342_102215172 194
1447 3300031727 Ga0316576_10266649 Ga0316576_102666492 194
1448 3300031728 Ga0316578_10017137 Ga0316578_100171374 194
1449 3300031730 Ga0307516_10014449 Ga0307516_100144495 194
1450 3300031730 Ga0307516_10017791 Ga0307516_100177913 194
1451 3300031730 Ga0307516_10066336 Ga0307516_100663363 194
1452 3300031730 Ga0307516_10116424 Ga0307516_101164243 194
1453 3300031730 Ga0307516_10232988 Ga0307516_102329882 194
1454 3300031730 Ga0307516_10411956 Ga0307516_104119562 194
1455 3300031731 Ga0307405_10680392 Ga0307405_106803921 194
1456 3300031824 Ga0307413_10702796 Ga0307413_107027962 194
1457 3300031852 Ga0307410_10358398 Ga0307410_103583982 194
1458 3300031852 Ga0307410_10623458 Ga0307410_106234582 194
1459 3300031852 Ga0307410_10669844 Ga0307410_106698441 194
1460 3300031901 Ga0307406_10511889 Ga0307406_105118892 194
1461 3300031901 Ga0307406_11240390 Ga0307406_112403901 194
1462 3300031911 Ga0307412_10371452 Ga0307412_103714522 194
1463 3300031995 Ga0307409_101343778 Ga0307409_1013437781 194
1464 3300032004 Ga0307414_10260502 Ga0307414_102605022 194
1465 3300032005 Ga0307411_10087407 Ga0307411_100874072 194
1466 3300032126 Ga0307415_100044899 Ga0307415_1000448992 194
1467 3300032126 Ga0307415_100272477 Ga0307415_1002724772 194
1468 3300032126 Ga0307415_100680015 Ga0307415_1006800152 194
1469 3300033179 Ga0307507_10078827 Ga0307507_100788272 194
1470 3300033180 Ga0307510_10063240 Ga0307510_100632402 194
1471 3300033180 Ga0307510_10153408 Ga0307510_101534082 194
1472 3300033442 Ga0315911_1000003 Ga0315911_1000003433 194
1473 3300034957 Ga0373938_0072160 Ga0373938_0072160_102_686 194
1474 3300035083 Ga0373926_0014548 Ga0373926_0014548_1565_2149 194
1475 3300035083 Ga0373926_0054989 Ga0373926_0054989_558_1148 194
1476 3300035083 Ga0373926_0177962 Ga0373926_0177962_128_712 194
1477 3300035086 Ga0373934_0021161 Ga0373934_0021161_1422_2006 194
1478 3300035086 Ga0373934_0032951 Ga0373934_0032951_827_1411 194
1479 3300035086 Ga0373934_0154213 Ga0373934_0154213_159_743 194
1480 3300035088 Ga0373940_0054716 Ga0373940_0054716_52_636 194
1481 3300035089 Ga0373944_0012726 Ga0373944_0012726_257_841 194
1482 3300035089 Ga0373944_0022255 Ga0373944_0022255_527_1117 194
1483 3300035089 Ga0373944_0025574 Ga0373944_0025574_1098_1682 194
1484 3300035111 Ga0373923_0005230 Ga0373923_0005230_827_1411 194
1485 3300035111 Ga0373923_0021210 Ga0373923_0021210_1333_1917 194
1486 3300035111 Ga0373923_0062597 Ga0373923_0062597_946_1530 194
1487 3300035111 Ga0373923_0292786 Ga0373923_0292786_26_610 194
1488 3300035112 Ga0373932_0010230 Ga0373932_0010230_92_676 194
1489 3300035113 Ga0373936_0002008 Ga0373936_0002008_1989_2573 194
1490 3300035113 Ga0373936_0080690 Ga0373936_0080690_24_608 194
1491 3300035113 Ga0373936_0089043 Ga0373936_0089043_683_1267 194
1492 3300035113 Ga0373936_0208373 Ga0373936_0208373_110_694 194
1493 3300035115 Ga0373941_0089621 Ga0373941_0089621_99_683 194
1494 3300035116 Ga0373945_0005788 Ga0373945_0005788_1292_1876 194
1495 3300035116 Ga0373945_0084090 Ga0373945_0084090_319_903 194
1496 3300035117 Ga0373953_0036943 Ga0373953_0036943_211_795 194
1497 3300035117 Ga0373953_0194490 Ga0373953_0194490_56_640 194
1498 3300035118 Ga0373954_0010944 Ga0373954_0010944_2253_2837 194
1499 3300035118 Ga0373954_0017743 Ga0373954_0017743_290_874 194
1500 3300035118 Ga0373954_0027608 Ga0373954_0027608_763_1347 194
1501 3300035118 Ga0373954_0052674 Ga0373954_0052674_1119_1703 194
1502 3300035118 Ga0373954_0089455 Ga0373954_0089455_483_1067 194
1503 3300035118 Ga0373954_0195103 Ga0373954_0195103_111_695 194
1504 3300035119 Ga0373956_0043683 Ga0373956_0043683_1138_1722 194
1505 3300035119 Ga0373956_0157830 Ga0373956_0157830_315_899 194
1506 3300035119 Ga0373956_0226542 Ga0373956_0226542_207_791 194
1507 3300035120 Ga0373957_0000546 Ga0373957_0000546_2297_2881 194
1508 3300035120 Ga0373957_0034354 Ga0373957_0034354_1211_1795 194
1509 3300035120 Ga0373957_0170186 Ga0373957_0170186_192_776 194
1510 3300035121 Ga0373960_0088427 Ga0373960_0088427_272_856 194
1511 3300035170 Ga0373943_0000296 Ga0373943_0000296_12047_12631 194
1512 3300035170 Ga0373943_0062285 Ga0373943_0062285_622_1212 194
1513 3300035170 Ga0373943_0373227 Ga0373943_0373227_167_751 194
1514 3300035170 Ga0373943_0382501 Ga0373943_0382501_92_676 194
1515 3300035171 Ga0373946_0002559 Ga0373946_0002559_3621_4205 194
1516 3300035171 Ga0373946_0098808 Ga0373946_0098808_184_768 194
1517 3300035171 Ga0373946_0177195 Ga0373946_0177195_223_807 194
1518 3300035171 Ga0373946_0230621 Ga0373946_0230621_252_836 194
1519 3300035171 Ga0373946_0366882 Ga0373946_0366882_57_641 194
1520 3300035172 Ga0373955_0002750 Ga0373955_0002750_223_807 194
1521 3300035172 Ga0373955_0010160 Ga0373955_0010160_1199_1783 194
1522 3300035172 Ga0373955_0014097 Ga0373955_0014097_3008_3592 194
1523 3300035172 Ga0373955_0015721 Ga0373955_0015721_985_1569 194
1524 3300035172 Ga0373955_0031289 Ga0373955_0031289_1579_2163 194
1525 3300035172 Ga0373955_0078793 Ga0373955_0078793_473_1057 194
1526 3300035172 Ga0373955_0081245 Ga0373955_0081245_30_620 194
1527 3300035172 Ga0373955_0187707 Ga0373955_0187707_599_1183 194
1528 3300035172 Ga0373955_0249907 Ga0373955_0249907_179_763 194
1529 3300035398 Ga0316574_0000486 Ga0316574_0000486_14014_14601 194
1530 3300035410 Ga0373924_0016752 Ga0373924_0016752_2065_2649 194
1531 3300035691 Ga0373931_0015025 Ga0373931_0015025_1927_2511 194
1532 3300035691 Ga0373931_0222320 Ga0373931_0222320_385_981 194
1533 3300035691 Ga0373931_0490243 Ga0373931_0490243_19_603 194
1534 3300035692 Ga0373935_0001575 Ga0373935_0001575_6121_6705 194
1535 3300035692 Ga0373935_0014638 Ga0373935_0014638_2996_3586 194
1536 3300035692 Ga0373935_0049902 Ga0373935_0049902_157_741 194
1537 3300035695 Ga0373927_0000041 Ga0373927_0000041_3900_4484 194
1538 3300035695 Ga0373927_0000147 Ga0373927_0000147_10874_11458 194
1539 3300035695 Ga0373927_0002863 Ga0373927_0002863_6286_6870 194
1540 3300035695 Ga0373927_0029888 Ga0373927_0029888_2460_3044 194
1541 3300035695 Ga0373927_0038537 Ga0373927_0038537_2145_2729 194
1542 3300035695 Ga0373927_0043468 Ga0373927_0043468_1517_2101 194
1543 3300035695 Ga0373927_0058916 Ga0373927_0058916_980_1564 194
1544 3300035695 Ga0373927_0160085 Ga0373927_0160085_729_1313 194
1545 3300035695 Ga0373927_0196330 Ga0373927_0196330_280_864 194
1546 3300035695 Ga0373927_0202760 Ga0373927_0202760_318_902 194
1547 3300035695 Ga0373927_0225049 Ga0373927_0225049_357_941 194
1548 3300035724 Ga0373933_0000751 Ga0373933_0000751_11697_12281 194
1549 3300035724 Ga0373933_0026227 Ga0373933_0026227_316_900 194
1550 3300035724 Ga0373933_0030514 Ga0373933_0030514_1154_1738 194
1551 3300035724 Ga0373933_0074105 Ga0373933_0074105_467_1051 194
1552 3300035724 Ga0373933_0149796 Ga0373933_0149796_168_752 194
1553 3300035724 Ga0373933_0172619 Ga0373933_0172619_46_630 194
1554 3300035724 Ga0373933_0337905 Ga0373933_0337905_319_903 194
1555 3300035725 Ga0373947_0002136 Ga0373947_0002136_7352_7936 194
1556 3300035725 Ga0373947_0006447 Ga0373947_0006447_4411_4995 194
1557 3300035725 Ga0373947_0008159 Ga0373947_0008159_313_897 194
1558 3300035725 Ga0373947_0029638 Ga0373947_0029638_1434_2024 194
1559 3300035725 Ga0373947_0035652 Ga0373947_0035652_899_1483 194
1560 3300035725 Ga0373947_0044842 Ga0373947_0044842_403_987 194
1561 3300035725 Ga0373947_0292104 Ga0373947_0292104_191_775 194
1562 3300035725 Ga0373947_0327532 Ga0373947_0327532_150_734 194
1563 3300036401 Ga0373937_0011695 Ga0373937_0011695_1333_1917 194
1564 3300036401 Ga0373937_0014364 Ga0373937_0014364_1348_1932 194
1565 3300036401 Ga0373937_0027533 Ga0373937_0027533_2138_2722 194
1566 3300036401 Ga0373937_0038419 Ga0373937_0038419_2778_3362 194
1567 3300036401 Ga0373937_0044202 Ga0373937_0044202_918_1502 194
1568 3300036401 Ga0373937_0057708 Ga0373937_0057708_1925_2509 194
1569 3300036401 Ga0373937_0100925 Ga0373937_0100925_1140_1724 194
1570 3300036401 Ga0373937_0113893 Ga0373937_0113893_1708_2292 194
1571 3300036401 Ga0373937_0126809 Ga0373937_0126809_1003_1587 194
1572 3300036401 Ga0373937_0201034 Ga0373937_0201034_39_623 194
1573 3300036401 Ga0373937_0224582 Ga0373937_0224582_341_925 194
1574 3300036401 Ga0373937_0243303 Ga0373937_0243303_421_1005 194
1575 3300036401 Ga0373937_0575613 Ga0373937_0575613_261_845 194
1576 3300036401 Ga0373937_0621894 Ga0373937_0621894_337_921 194
1577 3300036401 Ga0373937_1286169 Ga0373937_1286169_12_596 194
1578 3300036401 Ga0373937_1430833 Ga0373937_1430833_11_595 194
1579 3300036712 Ga0316584_0002956 Ga0316584_0002956_1557_2144 194
1580 3300037068 Ga0373925_0004268 Ga0373925_0004268_3241_3831 194
1581 3300037068 Ga0373925_0006220 Ga0373925_0006220_735_1319 194
1582 3300037068 Ga0373925_0014767 Ga0373925_0014767_2380_2964 194
1583 3300037068 Ga0373925_0015217 Ga0373925_0015217_869_1453 194
1584 3300037068 Ga0373925_0017861 Ga0373925_0017861_3617_4201 194
1585 3300037068 Ga0373925_0032350 Ga0373925_0032350_3106_3690 194
1586 3300037068 Ga0373925_0042086 Ga0373925_0042086_2118_2702 194
1587 3300037068 Ga0373925_0066047 Ga0373925_0066047_386_970 194
1588 3300037068 Ga0373925_0195355 Ga0373925_0195355_109_693 194
1589 3300037068 Ga0373925_0207738 Ga0373925_0207738_759_1343 194
1590 3300037068 Ga0373925_0347016 Ga0373925_0347016_176_760 194
1591 3300037068 Ga0373925_0745213 Ga0373925_0745213_74_664 194
1592 3300037312 Ga0395899_0155936 Ga0395899_0155936_501_1085 194
1593 3300037418 Ga0395900_0001586 Ga0395900_0001586_4308_4892 194
1594 3300037418 Ga0395900_0017960 Ga0395900_0017960_524_1108 194
1595 3300037418 Ga0395900_0197732 Ga0395900_0197732_1159_1743 194
1596 3300037418 Ga0395900_0534825 Ga0395900_0534825_141_725 194
1597 3300037418 Ga0395900_0980683 Ga0395900_0980683_96_680 194
1598 3300037466 Ga0395898_0043732 Ga0395898_0043732_3071_3655 194
1599 3300037466 Ga0395898_0067374 Ga0395898_0067374_2788_3372 194
1600 3300037466 Ga0395898_0106414 Ga0395898_0106414_1442_2026 194
1601 3300037471 Ga0395905_0002364 Ga0395905_0002364_15153_15737 194
1602 3300037471 Ga0395905_0080667 Ga0395905_0080667_1855_2439 194
1603 3300037471 Ga0395905_0094419 Ga0395905_0094419_1407_1991 194
1604 3300037471 Ga0395905_0943345 Ga0395905_0943345_80_664 194
1605 3300037853 Ga0436364_0054707 Ga0436364_0054707_353_937 194
1606 3300037853 Ga0436364_0914320 Ga0436364_0914320_9980_10564 194
1607 3300037853 Ga0436364_1058656 Ga0436364_1058656_976_1560 194
1608 3300037853 Ga0436364_1214450 Ga0436364_1214450_805_1389 194
1609 3300037853 Ga0436364_1372359 Ga0436364_1372359_512_1096 194
1610 3300037853 Ga0436364_1431371 Ga0436364_1431371_99_683 194
1611 3300037853 Ga0436364_1468890 Ga0436364_1468890_1804_2388 194
1612 3300038443 Ga0395901_0033905 Ga0395901_0033905_1404_1988 194
1613 3300038443 Ga0395901_0034663 Ga0395901_0034663_2883_3467 194
1614 3300038443 Ga0395901_0417628 Ga0395901_0417628_126_710 194
1615 3300038443 Ga0395901_0650975 Ga0395901_0650975_356_940 194
1616 3300038443 Ga0395901_0734790 Ga0395901_0734790_297_893 194
1617 3300038443 Ga0395901_0735997 Ga0395901_0735997_81_665 194
1618 3300038443 Ga0395901_1401873 Ga0395901_1401873_37_621 194
1619 3300039437 Ga0436365_0775744 Ga0436365_0775744_255_839 194
1620 3300039437 Ga0436365_0935505 Ga0436365_0935505_24611_25195 194
1621 3300039437 Ga0436365_0962701 Ga0436365_0962701_1632_2216 194
1622 3300039437 Ga0436365_1016700 Ga0436365_1016700_268_852 194
1623 3300039437 Ga0436365_1081631 Ga0436365_1081631_31_615 194
1624 3300039437 Ga0436365_1538861 Ga0436365_1538861_2528_3112 194
1625 3300039437 Ga0436365_1664010 Ga0436365_1664010_37_621 194
1626 3300039437 Ga0436365_1787150 Ga0436365_1787150_36_620 194
1627 3300039437 Ga0436365_1827259 Ga0436365_1827259_222_806 194
1628 3300039437 Ga0436365_1849409 Ga0436365_1849409_598_1182 194
1629 3300039437 Ga0436365_1853184 Ga0436365_1853184_858_1442 194
1630 3300039437 Ga0436365_1894771 Ga0436365_1894771_555_1139 194
1631 3300039438 Ga0436360_0116973 Ga0436360_0116973_1137_1721 194
1632 3300039438 Ga0436360_0154239 Ga0436360_0154239_850_1434 194
1633 3300039438 Ga0436360_0234819 Ga0436360_0234819_233_817 194
1634 3300039438 Ga0436360_0414842 Ga0436360_0414842_994_1578 194
1635 3300039438 Ga0436360_1036035 Ga0436360_1036035_38_622 194
1636 3300039447 Ga0436361_0048611 Ga0436361_0048611_445_1029 194
1637 3300039447 Ga0436361_0235455 Ga0436361_0235455_431_1015 194
1638 3300039447 Ga0436361_0266463 Ga0436361_0266463_12_596 194
1639 3300039447 Ga0436361_0327683 Ga0436361_0327683_63_647 194
1640 3300039447 Ga0436361_0397174 Ga0436361_0397174_681_1265 194
1641 3300039447 Ga0436361_0479799 Ga0436361_0479799_774_1358 194
1642 3300039447 Ga0436361_0553282 Ga0436361_0553282_4349_4933 194
1643 3300039447 Ga0436361_0558075 Ga0436361_0558075_1589_2173 194
1644 3300039447 Ga0436361_0926283 Ga0436361_0926283_56_640 194
1645 3300039450 Ga0436363_0409094 Ga0436363_0409094_250_834 194
1646 3300039450 Ga0436363_0431723 Ga0436363_0431723_767_1351 194
1647 3300039450 Ga0436363_0749072 Ga0436363_0749072_136_720 194
1648 3300039450 Ga0436363_1128968 Ga0436363_1128968_456_1040 194
1649 3300039450 Ga0436363_1253331 Ga0436363_1253331_2671_3255 194
1650 3300039450 Ga0436363_1487443 Ga0436363_1487443_1539_2123 194
1651 3300039453 Ga0436362_1098508 Ga0436362_1098508_152_736 194
1652 3300041413 Ga0439465_0055699 Ga0439465_0055699_221_805 194
1653 3300041413 Ga0439465_0130760 Ga0439465_0130760_195_779 194
1654 3300041452 Ga0451793_1625392 Ga0451793_1625392_274_858 194
1655 3300041486 Ga0451807_0285454 Ga0451807_0285454_53_637 194
1656 3300041496 Ga0451839_0997822 Ga0451839_0997822_467_1051 194
1657 3300041509 Ga0451843_0641134 Ga0451843_0641134_365_949 194
1658 3300041512 Ga0451853_2458675 Ga0451853_2458675_46_630 194
1659 3300044656 Ga0466969_0006735 Ga0466969_0006735_3110_3694 194
1660 3300044656 Ga0466969_0091856 Ga0466969_0091856_330_914 194
1661 3300044656 Ga0466969_0132346 Ga0466969_0132346_59_643 194
1662 3300044656 Ga0466969_0148511 Ga0466969_0148511_346_930 194
1663 3300044658 Ga0466972_0000122 Ga0466972_0000122_7853_8437 194
1664 3300044658 Ga0466972_0143688 Ga0466972_0143688_70_654 194
1665 3300044683 Ga0466965_0362131 Ga0466965_0362131_197_781 194
1666 3300044683 Ga0466965_0426936 Ga0466965_0426936_44_628 194
1667 3300044684 Ga0466966_0008365 Ga0466966_0008365_1271_1855 194
1668 3300044684 Ga0466966_0020376 Ga0466966_0020376_1734_2318 194
1669 3300044684 Ga0466966_0070231 Ga0466966_0070231_704_1288 194
1670 3300044684 Ga0466966_0134314 Ga0466966_0134314_700_1284 194
1671 3300044684 Ga0466966_0641086 Ga0466966_0641086_20_604 194
1672 3300044693 Ga0466961_0000038 Ga0466961_0000038_66420_67004 194
1673 3300044693 Ga0466961_0159409 Ga0466961_0159409_274_858 194
1674 3300044694 Ga0466963_0105996 Ga0466963_0105996_116_700 194
1675 3300044694 Ga0466963_0186590 Ga0466963_0186590_538_1122 194
1676 3300044706 Ga0466964_0024309 Ga0466964_0024309_1403_1987 194
1677 3300044706 Ga0466964_0035916 Ga0466964_0035916_92_676 194
1678 3300044719 Ga0466971_0066052 Ga0466971_0066052_811_1395 194
1679 3300044719 Ga0466971_0200122 Ga0466971_0200122_87_671 194
1680 3300044735 Ga0466968_0067179 Ga0466968_0067179_867_1451 194
1681 3300044735 Ga0466968_0089106 Ga0466968_0089106_516_1100 194
1682 3300044765 Ga0466970_0202081 Ga0466970_0202081_364_948 194
1683 3300044765 Ga0466970_0377338 Ga0466970_0377338_165_749 194
1684 3300044842 Ga0466957_0041797 Ga0466957_0041797_1294_1878 194
1685 3300044842 Ga0466957_0176032 Ga0466957_0176032_295_879 194
1686 3300044842 Ga0466957_0206643 Ga0466957_0206643_206_790 194
1687 3300044901 Ga0466960_0114086 Ga0466960_0114086_384_968 194
1688 3300044901 Ga0466960_0144904 Ga0466960_0144904_128_712 194
1689 3300044901 Ga0466960_0424507 Ga0466960_0424507_40_624 194
1690 3300045049 Ga0466959_0009876 Ga0466959_0009876_53_637 194
1691 3300045049 Ga0466959_0029135 Ga0466959_0029135_2391_2975 194
1692 3300045049 Ga0466959_0071972 Ga0466959_0071972_1570_2154 194
1693 3300045049 Ga0466959_0087844 Ga0466959_0087844_664_1248 194
1694 3300045049 Ga0466959_0128662 Ga0466959_0128662_495_1079 194
1695 3300045049 Ga0466959_0175793 Ga0466959_0175793_776_1360 194
1696 3300045051 Ga0451576_0001864 Ga0451576_0001864_10804_11391 194
1697 3300045051 Ga0451576_0538391 Ga0451576_0538391_553_1137 194
1698 3300045836 Ga0466958_0339333 Ga0466958_0339333_83_679 194
1699 3300045976 Ga0466967_0084499 Ga0466967_0084499_37_621 194
1700 3300045976 Ga0466967_0250626 Ga0466967_0250626_138_722 194
1701 3300045976 Ga0466967_0322653 Ga0466967_0322653_43_627 194
1702 3300045976 Ga0466967_0535695 Ga0466967_0535695_241_825 194
1703 3300045976 Ga0466967_0657132 Ga0466967_0657132_262_846 194
1704 3300045976 Ga0466967_1182082 Ga0466967_1182082_119_703 194
1705 3300046454 Ga0495592_0008874 Ga0495592_0008874_6731_7315 194
1706 3300046454 Ga0495592_0050724 Ga0495592_0050724_39_623 194
1707 3300046454 Ga0495592_0135788 Ga0495592_0135788_567_1151 194
1708 3300046454 Ga0495592_0474153 Ga0495592_0474153_48_632 194
1709 3300046455 Ga0495603_0002054 Ga0495603_0002054_787_1371 194
1710 3300046455 Ga0495603_0007756 Ga0495603_0007756_1125_1709 194
1711 3300046455 Ga0495603_0017026 Ga0495603_0017026_481_1065 194
1712 3300046455 Ga0495603_0050941 Ga0495603_0050941_930_1514 194
1713 3300046455 Ga0495603_0052443 Ga0495603_0052443_943_1527 194
1714 3300046455 Ga0495603_0099920 Ga0495603_0099920_555_1139 194
1715 3300046455 Ga0495603_0362769 Ga0495603_0362769_24_608 194
1716 3300046455 Ga0495603_0559724 Ga0495603_0559724_11_595 194
1717 3300046459 Ga0495629_0000094 Ga0495629_0000094_2611_3195 194
1718 3300046459 Ga0495629_0013453 Ga0495629_0013453_2666_3256 194
1719 3300046459 Ga0495629_0058549 Ga0495629_0058549_1182_1766 194
1720 3300046459 Ga0495629_0068333 Ga0495629_0068333_1117_1701 194
1721 3300046459 Ga0495629_0194914 Ga0495629_0194914_297_881 194
1722 3300046460 Ga0495638_0010923 Ga0495638_0010923_1488_2072 194
1723 3300046460 Ga0495638_0034940 Ga0495638_0034940_827_1411 194
1724 3300046460 Ga0495638_0080272 Ga0495638_0080272_883_1467 194
1725 3300046460 Ga0495638_0180102 Ga0495638_0180102_199_783 194
1726 3300046460 Ga0495638_0312022 Ga0495638_0312022_38_622 194
1727 3300046461 Ga0495641_0022861 Ga0495641_0022861_164_748 194
1728 3300046461 Ga0495641_0072831 Ga0495641_0072831_763_1347 194
1729 3300046462 Ga0495651_0006245 Ga0495651_0006245_1109_1693 194
1730 3300046462 Ga0495651_0018771 Ga0495651_0018771_531_1115 194
1731 3300046462 Ga0495651_0078004 Ga0495651_0078004_1828_2412 194
1732 3300046462 Ga0495651_0146063 Ga0495651_0146063_1099_1692 194
1733 3300046462 Ga0495651_0228040 Ga0495651_0228040_131_715 194
1734 3300046463 Ga0495653_0007949 Ga0495653_0007949_7137_7721 194
1735 3300046463 Ga0495653_0061976 Ga0495653_0061976_1712_2296 194
1736 3300046463 Ga0495653_0144811 Ga0495653_0144811_423_1007 194
1737 3300046463 Ga0495653_0541537 Ga0495653_0541537_64_648 194
1738 3300046471 Ga0495650_0142108 Ga0495650_0142108_190_774 194
1739 3300046472 Ga0495580_0000186 Ga0495580_0000186_40298_40888 194
1740 3300046472 Ga0495580_0001489 Ga0495580_0001489_5152_5736 194
1741 3300046472 Ga0495580_0001862 Ga0495580_0001862_12824_13408 194
1742 3300046472 Ga0495580_0003657 Ga0495580_0003657_6298_6882 194
1743 3300046472 Ga0495580_0007037 Ga0495580_0007037_3184_3768 194
1744 3300046472 Ga0495580_0046212 Ga0495580_0046212_149_733 194
1745 3300046472 Ga0495580_0202109 Ga0495580_0202109_366_950 194
1746 3300046472 Ga0495580_0414789 Ga0495580_0414789_165_749 194
1747 3300046472 Ga0495580_0430282 Ga0495580_0430282_87_671 194
1748 3300046473 Ga0495582_0000030 Ga0495582_0000030_72361_72945 194
1749 3300046473 Ga0495582_0004278 Ga0495582_0004278_2853_3443 194
1750 3300046473 Ga0495582_0027266 Ga0495582_0027266_1749_2333 194
1751 3300046473 Ga0495582_0080035 Ga0495582_0080035_566_1150 194
1752 3300046474 Ga0495605_0050201 Ga0495605_0050201_657_1241 194
1753 3300046475 Ga0495639_0000003 Ga0495639_0000003_35148_35732 194
1754 3300046475 Ga0495639_0054966 Ga0495639_0054966_869_1453 194
1755 3300046475 Ga0495639_0119989 Ga0495639_0119989_552_1136 194
1756 3300046475 Ga0495639_0420493 Ga0495639_0420493_56_640 194
1757 3300046476 Ga0495662_0000008 Ga0495662_0000008_6748_7332 194
1758 3300046476 Ga0495662_0069375 Ga0495662_0069375_436_1020 194
1759 3300046477 Ga0495664_0003617 Ga0495664_0003617_214_798 194
1760 3300046477 Ga0495664_0013305 Ga0495664_0013305_943_1527 194
1761 3300046477 Ga0495664_0015465 Ga0495664_0015465_2849_3433 194
1762 3300046477 Ga0495664_0032353 Ga0495664_0032353_1181_1765 194
1763 3300046477 Ga0495664_0059436 Ga0495664_0059436_930_1514 194
1764 3300046491 Ga0495584_0071544 Ga0495584_0071544_1130_1714 194
1765 3300046492 Ga0495585_0011478 Ga0495585_0011478_2805_3389 194
1766 3300046492 Ga0495585_0062631 Ga0495585_0062631_476_1060 194
1767 3300046492 Ga0495585_0085626 Ga0495585_0085626_294_878 194
1768 3300046499 Ga0495594_0008593 Ga0495594_0008593_1582_2166 194
1769 3300046499 Ga0495594_0050048 Ga0495594_0050048_1451_2035 194
1770 3300046499 Ga0495594_0052150 Ga0495594_0052150_412_996 194
1771 3300046499 Ga0495594_0077351 Ga0495594_0077351_74_658 194
1772 3300046499 Ga0495594_0154078 Ga0495594_0154078_255_839 194
1773 3300046499 Ga0495594_0182272 Ga0495594_0182272_372_956 194
1774 3300046507 Ga0495606_0113465 Ga0495606_0113465_587_1171 194
1775 3300046511 Ga0495608_0003691 Ga0495608_0003691_3247_3831 194
1776 3300046511 Ga0495608_0122683 Ga0495608_0122683_854_1438 194
1777 3300046512 Ga0495610_0004376 Ga0495610_0004376_8000_8584 194
1778 3300046512 Ga0495610_0076024 Ga0495610_0076024_401_985 194
1779 3300046512 Ga0495610_0206773 Ga0495610_0206773_204_788 194
1780 3300046513 Ga0495616_0322352 Ga0495616_0322352_40_624 194
1781 3300046514 Ga0495618_0030253 Ga0495618_0030253_2275_2859 194
1782 3300046514 Ga0495618_0065708 Ga0495618_0065708_279_863 194
1783 3300046514 Ga0495618_0071993 Ga0495618_0071993_675_1259 194
1784 3300046514 Ga0495618_0215788 Ga0495618_0215788_33_617 194
1785 3300046514 Ga0495618_0523933 Ga0495618_0523933_111_695 194
1786 3300046515 Ga0495620_0059771 Ga0495620_0059771_100_684 194
1787 3300046516 Ga0495628_0009637 Ga0495628_0009637_445_1029 194
1788 3300046516 Ga0495628_0039608 Ga0495628_0039608_263_847 194
1789 3300046516 Ga0495628_0077032 Ga0495628_0077032_739_1323 194
1790 3300046516 Ga0495628_0288990 Ga0495628_0288990_551_1135 194
1791 3300046516 Ga0495628_0488492 Ga0495628_0488492_218_802 194
1792 3300046517 Ga0495630_0004998 Ga0495630_0004998_4955_5539 194
1793 3300046517 Ga0495630_0018830 Ga0495630_0018830_1021_1605 194
1794 3300046517 Ga0495630_0054615 Ga0495630_0054615_1764_2348 194
1795 3300046517 Ga0495630_0159984 Ga0495630_0159984_1097_1681 194
1796 3300046517 Ga0495630_0218370 Ga0495630_0218370_30_614 194
1797 3300046517 Ga0495630_0264322 Ga0495630_0264322_565_1155 194
1798 3300046517 Ga0495630_0293311 Ga0495630_0293311_644_1228 194
1799 3300046518 Ga0495631_0052491 Ga0495631_0052491_193_777 194
1800 3300046518 Ga0495631_0090409 Ga0495631_0090409_676_1260 194
1801 3300046519 Ga0495632_0150656 Ga0495632_0150656_289_873 194
1802 3300046522 Ga0495643_0017469 Ga0495643_0017469_2105_2689 194
1803 3300046522 Ga0495643_0150948 Ga0495643_0150948_79_663 194
1804 3300046522 Ga0495643_0166346 Ga0495643_0166346_122_706 194
1805 3300046524 Ga0495648_0201987 Ga0495648_0201987_381_965 194
1806 3300046526 Ga0495666_0219843 Ga0495666_0219843_192_776 194
1807 3300046528 Ga0495642_0178899 Ga0495642_0178899_207_791 194
1808 3300046529 Ga0495652_0013965 Ga0495652_0013965_5765_6349 194
1809 3300046529 Ga0495652_0022169 Ga0495652_0022169_941_1525 194
1810 3300046529 Ga0495652_0068629 Ga0495652_0068629_802_1386 194
1811 3300046529 Ga0495652_0095062 Ga0495652_0095062_54_638 194
1812 3300046529 Ga0495652_0148906 Ga0495652_0148906_87_671 194
1813 3300046529 Ga0495652_0159756 Ga0495652_0159756_576_1160 194
1814 3300046529 Ga0495652_0537795 Ga0495652_0537795_145_729 194
1815 3300046531 Ga0495665_0000001 Ga0495665_0000001_154413_154997 194
1816 3300046533 Ga0495640_0000274 Ga0495640_0000274_9621_10205 194
1817 3300046533 Ga0495640_0008852 Ga0495640_0008852_572_1156 194
1818 3300046533 Ga0495640_0050710 Ga0495640_0050710_1424_2008 194
1819 3300046533 Ga0495640_0118194 Ga0495640_0118194_623_1207 194
1820 3300046535 Ga0495586_0157905 Ga0495586_0157905_76_660 194
1821 3300046535 Ga0495586_0498929 Ga0495586_0498929_37_621 194
1822 3300046536 Ga0495587_0044257 Ga0495587_0044257_269_853 194
1823 3300046536 Ga0495587_0054669 Ga0495587_0054669_424_1008 194
1824 3300046536 Ga0495587_0237377 Ga0495587_0237377_87_671 194
1825 3300046537 Ga0495598_0019675 Ga0495598_0019675_1120_1704 194
1826 3300046538 Ga0495609_0064667 Ga0495609_0064667_201_785 194
1827 3300046538 Ga0495609_0297038 Ga0495609_0297038_42_626 194
1828 3300046539 Ga0495621_0066795 Ga0495621_0066795_186_770 194
1829 3300046542 Ga0495597_0052189 Ga0495597_0052189_1081_1665 194
1830 3300046543 Ga0495645_0008361 Ga0495645_0008361_679_1263 194
1831 3300046543 Ga0495645_0106947 Ga0495645_0106947_764_1348 194
1832 3300046543 Ga0495645_0173296 Ga0495645_0173296_447_1037 194
1833 3300046557 Ga0495622_0017465 Ga0495622_0017465_2739_3323 194
1834 3300046557 Ga0495622_0029867 Ga0495622_0029867_767_1351 194
1835 3300046557 Ga0495622_0086080 Ga0495622_0086080_74_658 194
1836 3300046557 Ga0495622_0095640 Ga0495622_0095640_310_894 194
1837 3300046559 Ga0495667_0008493 Ga0495667_0008493_3315_3899 194
1838 3300046559 Ga0495667_0033108 Ga0495667_0033108_2582_3166 194
1839 3300046559 Ga0495667_0035612 Ga0495667_0035612_1433_2017 194
1840 3300046559 Ga0495667_0076418 Ga0495667_0076418_528_1112 194
1841 3300046615 Ga0495656_0121102 Ga0495656_0121102_52_636 194
1842 3300046615 Ga0495656_0157041 Ga0495656_0157041_182_766 194
1843 3300046616 Ga0495668_0363634 Ga0495668_0363634_80_664 194
1844 3300046642 Ga0495634_0000360 Ga0495634_0000360_9057_9641 194
1845 3300046642 Ga0495634_0018688 Ga0495634_0018688_83_667 194
1846 3300046642 Ga0495634_0046073 Ga0495634_0046073_1613_2197 194
1847 3300046642 Ga0495634_0088620 Ga0495634_0088620_846_1430 194
1848 3300046642 Ga0495634_0300579 Ga0495634_0300579_84_668 194
1849 3300046648 Ga0495611_0083149 Ga0495611_0083149_221_805 194
1850 3300046648 Ga0495611_0112556 Ga0495611_0112556_562_1146 194
1851 3300046648 Ga0495611_0203838 Ga0495611_0203838_18_602 194
1852 3300046648 Ga0495611_0222343 Ga0495611_0222343_264_848 194
1853 3300046660 Ga0495625_0146864 Ga0495625_0146864_92_676 194
1854 3300046660 Ga0495625_0498029 Ga0495625_0498029_42_626 194
1855 3300046663 Ga0495635_0000578 Ga0495635_0000578_13459_14043 194
1856 3300046663 Ga0495635_0003851 Ga0495635_0003851_7737_8321 194
1857 3300046663 Ga0495635_0005522 Ga0495635_0005522_7246_7830 194
1858 3300046663 Ga0495635_0032615 Ga0495635_0032615_240_824 194
1859 3300046663 Ga0495635_0039940 Ga0495635_0039940_307_891 194
1860 3300046664 Ga0495659_0017583 Ga0495659_0017583_764_1348 194
1861 3300046664 Ga0495659_0102256 Ga0495659_0102256_76_660 194
1862 3300046665 Ga0495661_0153335 Ga0495661_0153335_247_831 194
1863 3300046665 Ga0495661_0268013 Ga0495661_0268013_214_798 194
1864 3300046665 Ga0495661_0386966 Ga0495661_0386966_65_649 194
1865 3300046674 Ga0495588_0004457 Ga0495588_0004457_544_1128 194
1866 3300046674 Ga0495588_0060051 Ga0495588_0060051_1257_1841 194
1867 3300046674 Ga0495588_0082493 Ga0495588_0082493_567_1151 194
1868 3300046674 Ga0495588_0092366 Ga0495588_0092366_397_981 194
1869 3300046674 Ga0495588_0279954 Ga0495588_0279954_97_681 194
1870 3300046675 Ga0495657_0004230 Ga0495657_0004230_5555_6139 194
1871 3300046675 Ga0495657_0005377 Ga0495657_0005377_1925_2509 194
1872 3300046675 Ga0495657_0029589 Ga0495657_0029589_2306_2890 194
1873 3300046675 Ga0495657_0107437 Ga0495657_0107437_784_1368 194
1874 3300046675 Ga0495657_0468345 Ga0495657_0468345_132_716 194
1875 3300046678 Ga0495599_0004042 Ga0495599_0004042_1090_1674 194
1876 3300046678 Ga0495599_0062448 Ga0495599_0062448_606_1190 194
1877 3300046678 Ga0495599_0097130 Ga0495599_0097130_622_1206 194
1878 3300046678 Ga0495599_0174392 Ga0495599_0174392_514_1098 194
1879 3300046678 Ga0495599_0197532 Ga0495599_0197532_352_936 194
1880 3300046678 Ga0495599_0423485 Ga0495599_0423485_125_709 194
1881 3300046679 Ga0495623_0006266 Ga0495623_0006266_6189_6773 194
1882 3300046679 Ga0495623_0013886 Ga0495623_0013886_522_1106 194
1883 3300046679 Ga0495623_0027474 Ga0495623_0027474_1670_2254 194
1884 3300046679 Ga0495623_0116215 Ga0495623_0116215_345_929 194
1885 3300046679 Ga0495623_0283336 Ga0495623_0283336_129_713 194
1886 3300046680 Ga0495646_0006847 Ga0495646_0006847_6494_7078 194
1887 3300046680 Ga0495646_0025076 Ga0495646_0025076_2739_3323 194
1888 3300046680 Ga0495646_0028494 Ga0495646_0028494_2291_2875 194
1889 3300046680 Ga0495646_0318077 Ga0495646_0318077_88_672 194
1890 3300046681 Ga0495647_0000625 Ga0495647_0000625_5097_5681 194
1891 3300046681 Ga0495647_0039720 Ga0495647_0039720_528_1112 194
1892 3300046683 Ga0495658_0000136 Ga0495658_0000136_8906_9490 194
1893 3300046683 Ga0495658_0018149 Ga0495658_0018149_2122_2712 194
1894 3300046683 Ga0495658_0018566 Ga0495658_0018566_1517_2101 194
1895 3300046683 Ga0495658_0440977 Ga0495658_0440977_122_706 194
1896 3300046684 Ga0495669_0263899 Ga0495669_0263899_185_769 194
1897 3300046684 Ga0495669_0272777 Ga0495669_0272777_135_719 194
1898 3300046689 Ga0495613_0001913 Ga0495613_0001913_8047_8631 194
1899 3300046689 Ga0495613_0019527 Ga0495613_0019527_3879_4463 194
1900 3300046689 Ga0495613_0075126 Ga0495613_0075126_881_1465 194
1901 3300046689 Ga0495613_0118514 Ga0495613_0118514_888_1472 194
1902 3300046690 Ga0495624_0000943 Ga0495624_0000943_11023_11607 194
1903 3300046690 Ga0495624_0007215 Ga0495624_0007215_4935_5519 194
1904 3300046690 Ga0495624_0014653 Ga0495624_0014653_319_903 194
1905 3300046690 Ga0495624_0121474 Ga0495624_0121474_186_776 194
1906 3300046690 Ga0495624_0148236 Ga0495624_0148236_287_871 194
1907 3300046691 Ga0495670_0053234 Ga0495670_0053234_352_936 194
1908 3300046692 Ga0495671_0168458 Ga0495671_0168458_38_622 194
1909 3300046694 Ga0495649_0192630 Ga0495649_0192630_386_970 194
1910 3300046794 Ga0495589_0221382 Ga0495589_0221382_284_868 194
1911 3300046794 Ga0495589_0243660 Ga0495589_0243660_192_776 194
1912 3300046809 Ga0495600_0003420 Ga0495600_0003420_5021_5605 194
1913 3300046809 Ga0495600_0025895 Ga0495600_0025895_2326_2910 194
1914 3300046809 Ga0495600_0032711 Ga0495600_0032711_1641_2225 194
1915 3300046809 Ga0495600_0101761 Ga0495600_0101761_1260_1844 194
1916 3300046809 Ga0495600_0586680 Ga0495600_0586680_36_620 194
1917 3300047315 Ga0495581_0000011 Ga0495581_0000011_46792_47376 194
1918 3300047315 Ga0495581_0056549 Ga0495581_0056549_208_792 194
1919 3300047315 Ga0495581_0238042 Ga0495581_0238042_400_984 194
1920 3300047315 Ga0495581_0276203 Ga0495581_0276203_190_774 194
1921 3300047315 Ga0495581_0305699 Ga0495581_0305699_265_849 194
1922 3300047317 Ga0495604_0005841 Ga0495604_0005841_1520_2104 194
1923 3300047317 Ga0495604_0013536 Ga0495604_0013536_643_1227 194
1924 3300047317 Ga0495604_0027104 Ga0495604_0027104_3056_3640 194
1925 3300047317 Ga0495604_0039735 Ga0495604_0039735_659_1243 194
1926 3300047317 Ga0495604_0077370 Ga0495604_0077370_537_1121 194
1927 3300047317 Ga0495604_0171322 Ga0495604_0171322_751_1335 194
1928 3300047317 Ga0495604_0205973 Ga0495604_0205973_158_742 194
1929 3300047318 Ga0495636_0257927 Ga0495636_0257927_40_624 194
1930 3300047319 Ga0495674_0001053 Ga0495674_0001053_19637_20221 194
1931 3300047319 Ga0495674_0008705 Ga0495674_0008705_7418_8002 194
1932 3300047319 Ga0495674_0009845 Ga0495674_0009845_5415_5999 194
1933 3300047319 Ga0495674_0023678 Ga0495674_0023678_4558_5148 194
1934 3300047319 Ga0495674_0125265 Ga0495674_0125265_11_595 194
1935 3300047319 Ga0495674_0131168 Ga0495674_0131168_1042_1626 194
1936 3300047320 Ga0495672_0099731 Ga0495672_0099731_579_1163 194
1937 3300047320 Ga0495672_0259786 Ga0495672_0259786_182_766 194
1938 3300047320 Ga0495672_0355560 Ga0495672_0355560_34_618 194
1939 3300047321 Ga0495676_0076509 Ga0495676_0076509_1675_2259 194
1940 3300047321 Ga0495676_0096204 Ga0495676_0096204_1190_1774 194
1941 3300047322 Ga0495680_0012021 Ga0495680_0012021_4115_4699 194
1942 3300047322 Ga0495680_0027181 Ga0495680_0027181_2089_2673 194
1943 3300047322 Ga0495680_0044145 Ga0495680_0044145_2293_2877 194
1944 3300047323 Ga0495683_0022488 Ga0495683_0022488_2238_2822 194
1945 3300047323 Ga0495683_0066552 Ga0495683_0066552_1152_1736 194
1946 3300047323 Ga0495683_0212685 Ga0495683_0212685_48_632 194
1947 3300047443 Ga0495687_034841 Ga0495687_034841_480_1064 194
1948 3300047444 Ga0495675_0013389 Ga0495675_0013389_4243_4827 194
1949 3300047444 Ga0495675_0026387 Ga0495675_0026387_206_790 194
1950 3300047444 Ga0495675_0115545 Ga0495675_0115545_778_1362 194
1951 3300047446 Ga0495679_074673 Ga0495679_074673_374_958 194
1952 3300047469 Ga0495673_0171679 Ga0495673_0171679_161_745 194
1953 3300047469 Ga0495673_0241989 Ga0495673_0241989_53_637 194
1954 3300047471 Ga0495684_0011545 Ga0495684_0011545_980_1564 194
1955 3300047471 Ga0495684_0029473 Ga0495684_0029473_3200_3784 194
1956 3300047471 Ga0495684_0042716 Ga0495684_0042716_2351_2935 194
1957 3300047471 Ga0495684_0356435 Ga0495684_0356435_22_606 194
1958 3300047472 Ga0495686_0167256 Ga0495686_0167256_89_673 194
1959 3300047472 Ga0495686_0291793 Ga0495686_0291793_308_892 194
1960 3300047673 Ga0495593_0000209 Ga0495593_0000209_13890_14474 194
1961 3300047673 Ga0495593_0021422 Ga0495593_0021422_1252_1836 194
1962 3300048088 Ga0495602_0010034 Ga0495602_0010034_1594_2178 194
1963 3300048088 Ga0495602_0137385 Ga0495602_0137385_29_613 194
1964 3300048088 Ga0495602_0183972 Ga0495602_0183972_436_1020 194
1965 3300048088 Ga0495602_0288031 Ga0495602_0288031_83_667 194
1966 3300048088 Ga0495602_0489199 Ga0495602_0489199_204_788 194
1967 3300048088 Ga0495602_0506547 Ga0495602_0506547_160_744 194
1968 3300048089 Ga0495614_0007619 Ga0495614_0007619_3567_4151 194
1969 3300048903 Ga0496100_0002317 Ga0496100_0002317_7132_7716 194
1970 3300048903 Ga0496100_0045007 Ga0496100_0045007_1430_2014 194
1971 3300048903 Ga0496100_0056928 Ga0496100_0056928_645_1229 194
1972 3300048903 Ga0496100_0252288 Ga0496100_0252288_497_1081 194
1973 3300048903 Ga0496100_0287989 Ga0496100_0287989_25_609 194
1974 3300048903 Ga0496100_0537518 Ga0496100_0537518_223_807 194
1975 3300048903 Ga0496100_0617975 Ga0496100_0617975_26_610 194
1976 3300048904 Ga0496101_0000648 Ga0496101_0000648_5218_5802 194
1977 3300048904 Ga0496101_0034163 Ga0496101_0034163_858_1442 194
1978 3300048904 Ga0496101_0106879 Ga0496101_0106879_350_934 194
1979 3300048904 Ga0496101_0364982 Ga0496101_0364982_64_648 194
1980 3300048904 Ga0496101_0397064 Ga0496101_0397064_356_940 194
1981 3300048904 Ga0496101_0457391 Ga0496101_0457391_328_912 194
1982 3300048904 Ga0496101_0648735 Ga0496101_0648735_74_658 194
1983 3300048904 Ga0496101_0818307 Ga0496101_0818307_99_683 194
1984 3300048905 Ga0496102_0005693 Ga0496102_0005693_9322_9906 194
1985 3300048905 Ga0496102_0025539 Ga0496102_0025539_978_1562 194
1986 3300048905 Ga0496102_0048945 Ga0496102_0048945_883_1467 194
1987 3300048905 Ga0496102_0154755 Ga0496102_0154755_938_1522 194
1988 3300048905 Ga0496102_0157220 Ga0496102_0157220_994_1578 194
1989 3300048905 Ga0496102_0184205 Ga0496102_0184205_633_1217 194
1990 3300048905 Ga0496102_0230070 Ga0496102_0230070_563_1147 194
1991 3300048905 Ga0496102_0281655 Ga0496102_0281655_690_1298 194
1992 3300048905 Ga0496102_0322832 Ga0496102_0322832_293_877 194
1993 3300048905 Ga0496102_0344943 Ga0496102_0344943_470_1054 194
1994 3300048905 Ga0496102_0387045 Ga0496102_0387045_535_1119 194
1995 3300048905 Ga0496102_0404641 Ga0496102_0404641_346_930 194
1996 3300048905 Ga0496102_0501708 Ga0496102_0501708_42_626 194
1997 3300048905 Ga0496102_0602278 Ga0496102_0602278_149_733 194
1998 3300048905 Ga0496102_0960841 Ga0496102_0960841_157_753 194
1999 3300048905 Ga0496102_1165829 Ga0496102_1165829_63_647 194
2000 3300048906 Ga0496103_0010060 Ga0496103_0010060_4823_5407 194
2001 3300048906 Ga0496103_0020553 Ga0496103_0020553_1372_1956 194
2002 3300048906 Ga0496103_0053278 Ga0496103_0053278_479_1063 194
2003 3300048906 Ga0496103_0105235 Ga0496103_0105235_939_1523 194
2004 3300048906 Ga0496103_0151222 Ga0496103_0151222_216_800 194
2005 3300048906 Ga0496103_0170110 Ga0496103_0170110_553_1137 194
2006 3300048906 Ga0496103_0269742 Ga0496103_0269742_315_899 194
2007 3300048906 Ga0496103_0296652 Ga0496103_0296652_375_971 194
2008 3300048906 Ga0496103_0417211 Ga0496103_0417211_184_768 194
2009 3300048907 Ga0496104_0003846 Ga0496104_0003846_7819_8403 194
2010 3300048907 Ga0496104_0010866 Ga0496104_0010866_2033_2617 194
2011 3300048907 Ga0496104_0013631 Ga0496104_0013631_2179_2763 194
2012 3300048907 Ga0496104_0018066 Ga0496104_0018066_5022_5606 194
2013 3300048907 Ga0496104_0079584 Ga0496104_0079584_2084_2668 194
2014 3300048907 Ga0496104_0232060 Ga0496104_0232060_988_1584 194
2015 3300048907 Ga0496104_0258208 Ga0496104_0258208_82_666 194
2016 3300048907 Ga0496104_0307385 Ga0496104_0307385_457_1041 194
2017 3300048907 Ga0496104_0307444 Ga0496104_0307444_275_859 194
2018 3300048907 Ga0496104_0447162 Ga0496104_0447162_436_1020 194
2019 3300048907 Ga0496104_0481360 Ga0496104_0481360_429_1013 194
2020 3300048907 Ga0496104_0522681 Ga0496104_0522681_151_735 194
2021 3300048907 Ga0496104_0581185 Ga0496104_0581185_375_959 194
2022 3300048908 Ga0496105_0004124 Ga0496105_0004124_1332_1916 194
2023 3300048908 Ga0496105_0007025 Ga0496105_0007025_4352_4936 194
2024 3300048908 Ga0496105_0015111 Ga0496105_0015111_550_1134 194
2025 3300048908 Ga0496105_0020682 Ga0496105_0020682_3823_4407 194
2026 3300048908 Ga0496105_0047185 Ga0496105_0047185_1995_2579 194
2027 3300048908 Ga0496105_0100507 Ga0496105_0100507_1102_1686 194
2028 3300048908 Ga0496105_0209615 Ga0496105_0209615_50_634 194
2029 3300048908 Ga0496105_0314289 Ga0496105_0314289_301_885 194
2030 3300048908 Ga0496105_0436465 Ga0496105_0436465_55_639 194
2031 3300048909 Ga0496106_0033959 Ga0496106_0033959_2314_2898 194
2032 3300048909 Ga0496106_0043710 Ga0496106_0043710_395_979 194
2033 3300048909 Ga0496106_0124003 Ga0496106_0124003_1243_1827 194
2034 3300048909 Ga0496106_0131246 Ga0496106_0131246_303_887 194
2035 3300048909 Ga0496106_0147962 Ga0496106_0147962_1240_1824 194
2036 3300048909 Ga0496106_0215707 Ga0496106_0215707_870_1454 194
2037 3300048909 Ga0496106_0240972 Ga0496106_0240972_393_977 194
2038 3300048909 Ga0496106_0598806 Ga0496106_0598806_10_594 194
2039 3300048909 Ga0496106_0707085 Ga0496106_0707085_68_652 194
2040 3300048909 Ga0496106_0864200 Ga0496106_0864200_43_651 194
2041 3300048910 Ga0496107_0014148 Ga0496107_0014148_291_875 194
2042 3300048910 Ga0496107_0027901 Ga0496107_0027901_3370_3954 194
2043 3300048910 Ga0496107_0099767 Ga0496107_0099767_159_743 194
2044 3300048910 Ga0496107_0114631 Ga0496107_0114631_46_630 194
2045 3300048910 Ga0496107_0165544 Ga0496107_0165544_764_1348 194
2046 3300048910 Ga0496107_0194873 Ga0496107_0194873_64_648 194
2047 3300048910 Ga0496107_0215697 Ga0496107_0215697_647_1231 194
2048 3300048911 Ga0496108_0003657 Ga0496108_0003657_3367_3951 194
2049 3300048911 Ga0496108_0010006 Ga0496108_0010006_2456_3040 194
2050 3300048911 Ga0496108_0048242 Ga0496108_0048242_193_777 194
2051 3300048911 Ga0496108_0090160 Ga0496108_0090160_1646_2230 194
2052 3300048911 Ga0496108_0184989 Ga0496108_0184989_38_622 194
2053 3300048911 Ga0496108_0281141 Ga0496108_0281141_16_600 194
2054 3300048911 Ga0496108_0405365 Ga0496108_0405365_86_670 194
2055 3300048912 Ga0496109_0000980 Ga0496109_0000980_17813_18397 194
2056 3300048912 Ga0496109_0105583 Ga0496109_0105583_591_1175 194
2057 3300048912 Ga0496109_0126924 Ga0496109_0126924_797_1393 194
2058 3300048912 Ga0496109_0152961 Ga0496109_0152961_196_780 194
2059 3300048912 Ga0496109_0170401 Ga0496109_0170401_1330_1914 194
2060 3300048912 Ga0496109_0383800 Ga0496109_0383800_115_699 194
2061 3300048912 Ga0496109_0506910 Ga0496109_0506910_28_612 194
2062 3300048912 Ga0496109_0509061 Ga0496109_0509061_399_983 194
2063 3300048913 Ga0496110_0051969 Ga0496110_0051969_733_1317 194
2064 3300048913 Ga0496110_0058595 Ga0496110_0058595_1343_1927 194
2065 3300048913 Ga0496110_0060190 Ga0496110_0060190_1856_2440 194
2066 3300048913 Ga0496110_0071937 Ga0496110_0071937_414_998 194
2067 3300048913 Ga0496110_0180534 Ga0496110_0180534_769_1353 194
2068 3300048913 Ga0496110_0767061 Ga0496110_0767061_152_736 194
2069 3300048913 Ga0496110_1075030 Ga0496110_1075030_61_645 194
2070 3300048914 Ga0496111_0032260 Ga0496111_0032260_2455_3039 194
2071 3300048914 Ga0496111_0092430 Ga0496111_0092430_961_1545 194
2072 3300048914 Ga0496111_0228758 Ga0496111_0228758_250_834 194
2073 3300048914 Ga0496111_0391800 Ga0496111_0391800_374_958 194
2074 3300048914 Ga0496111_0550026 Ga0496111_0550026_220_804 194
2075 3300048915 Ga0496112_0000039 Ga0496112_0000039_77137_77721 194
2076 3300048915 Ga0496112_0000622 Ga0496112_0000622_23618_24202 194
2077 3300048915 Ga0496112_0002865 Ga0496112_0002865_11658_12242 194
2078 3300048915 Ga0496112_0020839 Ga0496112_0020839_3713_4297 194
2079 3300048915 Ga0496112_0057096 Ga0496112_0057096_570_1154 194
2080 3300048915 Ga0496112_0063694 Ga0496112_0063694_414_998 194
2081 3300048915 Ga0496112_0096051 Ga0496112_0096051_1940_2524 194
2082 3300048915 Ga0496112_0106666 Ga0496112_0106666_318_902 194
2083 3300048915 Ga0496112_0157593 Ga0496112_0157593_1265_1861 194
2084 3300048915 Ga0496112_0182685 Ga0496112_0182685_758_1342 194
2085 3300048915 Ga0496112_0306368 Ga0496112_0306368_823_1407 194
2086 3300048915 Ga0496112_0432969 Ga0496112_0432969_442_1026 194
2087 3300048915 Ga0496112_0479626 Ga0496112_0479626_49_633 194
2088 3300048915 Ga0496112_0541223 Ga0496112_0541223_137_733 194
2089 3300048915 Ga0496112_0978634 Ga0496112_0978634_37_621 194
2090 3300048916 Ga0496113_0003280 Ga0496113_0003280_3805_4389 194
2091 3300048916 Ga0496113_0004638 Ga0496113_0004638_3304_3888 194
2092 3300048916 Ga0496113_0073839 Ga0496113_0073839_1337_1921 194
2093 3300048916 Ga0496113_0074614 Ga0496113_0074614_647_1231 194
2094 3300048916 Ga0496113_0075350 Ga0496113_0075350_867_1451 194
2095 3300048916 Ga0496113_0243802 Ga0496113_0243802_41_625 194
2096 3300048916 Ga0496113_0281081 Ga0496113_0281081_28_612 194
2097 3300048916 Ga0496113_0635302 Ga0496113_0635302_97_681 194
2098 3300048916 Ga0496113_1036796 Ga0496113_1036796_50_634 194
2099 3300048917 Ga0496114_0008449 Ga0496114_0008449_72_656 194
2100 3300048917 Ga0496114_0020318 Ga0496114_0020318_2727_3311 194
2101 3300048917 Ga0496114_0046929 Ga0496114_0046929_1785_2369 194
2102 3300048917 Ga0496114_0169323 Ga0496114_0169323_103_687 194
2103 3300048917 Ga0496114_0719958 Ga0496114_0719958_123_707 194
2104 3300048917 Ga0496114_0727442 Ga0496114_0727442_44_634 194
2105 3300048917 Ga0496114_1145899 Ga0496114_1145899_47_631 194
2106 3300048918 Ga0496115_0002904 Ga0496115_0002904_8127_8717 194
2107 3300048918 Ga0496115_0005724 Ga0496115_0005724_545_1129 194
2108 3300048918 Ga0496115_0013729 Ga0496115_0013729_1594_2178 194
2109 3300048918 Ga0496115_0024897 Ga0496115_0024897_3433_4017 194
2110 3300048918 Ga0496115_0043847 Ga0496115_0043847_957_1541 194
2111 3300048918 Ga0496115_0111755 Ga0496115_0111755_1604_2188 194
2112 3300048918 Ga0496115_0128154 Ga0496115_0128154_1022_1606 194
2113 3300048918 Ga0496115_0141217 Ga0496115_0141217_1125_1709 194
2114 3300048918 Ga0496115_0161520 Ga0496115_0161520_295_879 194
2115 3300048918 Ga0496115_0241956 Ga0496115_0241956_212_796 194
2116 3300048918 Ga0496115_0447846 Ga0496115_0447846_262_846 194
2117 3300048919 Ga0496116_0009705 Ga0496116_0009705_2661_3245 194
2118 3300048919 Ga0496116_0157588 Ga0496116_0157588_392_976 194
2119 3300048919 Ga0496116_0175799 Ga0496116_0175799_526_1110 194
2120 3300048919 Ga0496116_0377699 Ga0496116_0377699_31_615 194
2121 3300048920 Ga0496117_0064911 Ga0496117_0064911_1708_2292 194
2122 3300048920 Ga0496117_0084139 Ga0496117_0084139_760_1344 194
2123 3300048920 Ga0496117_0183531 Ga0496117_0183531_531_1115 194
2124 3300048921 Ga0496118_0006064 Ga0496118_0006064_1471_2055 194
2125 3300048921 Ga0496118_0009367 Ga0496118_0009367_2599_3183 194
2126 3300048921 Ga0496118_0173926 Ga0496118_0173926_650_1234 194
2127 3300048921 Ga0496118_0224781 Ga0496118_0224781_31_615 194
2128 3300048922 Ga0496119_0026644 Ga0496119_0026644_3045_3629 194
2129 3300048922 Ga0496119_0043726 Ga0496119_0043726_1497_2081 194
2130 3300048923 Ga0496120_0011600 Ga0496120_0011600_5065_5649 194
2131 3300048923 Ga0496120_0045275 Ga0496120_0045275_212_796 194
2132 3300048923 Ga0496120_0114707 Ga0496120_0114707_333_917 194
2133 3300048924 Ga0496121_0000868 Ga0496121_0000868_44550_45134 194
2134 3300048924 Ga0496121_0001157 Ga0496121_0001157_30169_30753 194
2135 3300048924 Ga0496121_0049110 Ga0496121_0049110_1887_2471 194
2136 3300048924 Ga0496121_0050969 Ga0496121_0050969_2053_2637 194
2137 3300048924 Ga0496121_0069775 Ga0496121_0069775_808_1392 194
2138 3300048924 Ga0496121_0090761 Ga0496121_0090761_1714_2298 194
2139 3300048924 Ga0496121_0092561 Ga0496121_0092561_267_851 194
2140 3300048924 Ga0496121_0170339 Ga0496121_0170339_450_1034 194
2141 3300048924 Ga0496121_0221136 Ga0496121_0221136_170_754 194
2142 3300048924 Ga0496121_0223389 Ga0496121_0223389_473_1057 194
2143 3300048925 Ga0496122_0118718 Ga0496122_0118718_330_914 194
2144 3300048925 Ga0496122_0143879 Ga0496122_0143879_781_1365 194
2145 3300048926 Ga0496123_0123055 Ga0496123_0123055_356_940 194
2146 3300048927 Ga0496124_0021056 Ga0496124_0021056_857_1441 194
2147 3300048927 Ga0496124_0097903 Ga0496124_0097903_1283_1867 194
2148 3300048927 Ga0496124_0128012 Ga0496124_0128012_1159_1743 194
2149 3300048927 Ga0496124_0168541 Ga0496124_0168541_171_755 194
2150 3300048927 Ga0496124_0562225 Ga0496124_0562225_13_597 194
2151 3300048928 Ga0496125_0038850 Ga0496125_0038850_2400_2984 194
2152 3300048928 Ga0496125_0089224 Ga0496125_0089224_1383_1967 194
2153 3300048928 Ga0496125_0172994 Ga0496125_0172994_256_840 194
2154 3300048928 Ga0496125_0190334 Ga0496125_0190334_408_1028 194
2155 3300048929 Ga0496126_0002588 Ga0496126_0002588_10737_11321 194
2156 3300048929 Ga0496126_0007487 Ga0496126_0007487_9171_9755 194
2157 3300048929 Ga0496126_0045817 Ga0496126_0045817_172_756 194
2158 3300048929 Ga0496126_0050629 Ga0496126_0050629_2312_2896 194
2159 3300048929 Ga0496126_0065300 Ga0496126_0065300_579_1163 194
2160 3300048929 Ga0496126_0066290 Ga0496126_0066290_265_849 194
2161 3300048929 Ga0496126_0068168 Ga0496126_0068168_2283_2867 194
2162 3300048929 Ga0496126_0087269 Ga0496126_0087269_1817_2401 194
2163 3300048929 Ga0496126_0092720 Ga0496126_0092720_714_1298 194
2164 3300048929 Ga0496126_0118408 Ga0496126_0118408_1202_1786 194
2165 3300048929 Ga0496126_0143078 Ga0496126_0143078_664_1248 194
2166 3300048929 Ga0496126_0161879 Ga0496126_0161879_652_1260 194
2167 3300048929 Ga0496126_0169312 Ga0496126_0169312_1103_1687 194
2168 3300048929 Ga0496126_0177964 Ga0496126_0177964_280_864 194
2169 3300048929 Ga0496126_0193402 Ga0496126_0193402_525_1109 194
2170 3300048929 Ga0496126_0278724 Ga0496126_0278724_47_631 194
2171 3300048929 Ga0496126_0294445 Ga0496126_0294445_682_1266 194
2172 3300048929 Ga0496126_0310868 Ga0496126_0310868_85_669 194
2173 3300048929 Ga0496126_0547834 Ga0496126_0547834_71_655 194
2174 3300048929 Ga0496126_0552433 Ga0496126_0552433_117_701 194
2175 3300048929 Ga0496126_0866649 Ga0496126_0866649_88_672 194
2176 3300049460 Ga0495682_0032176 Ga0495682_0032176_777_1361 194
2177 3300049568 Ga0501031_0030795 Ga0501031_0030795_2073_2657 194
2178 3300049568 Ga0501031_0067611 Ga0501031_0067611_280_864 194
2179 3300049569 Ga0501032_0000086 Ga0501032_0000086_21523_22107 194
2180 3300049569 Ga0501032_0001083 Ga0501032_0001083_16997_17581 194
2181 3300049569 Ga0501032_0573843 Ga0501032_0573843_107_691 194
2182 3300049570 Ga0501033_0000116 Ga0501033_0000116_18404_18988 194
2183 3300049570 Ga0501033_0004811 Ga0501033_0004811_7384_7968 194
2184 3300049570 Ga0501033_0026010 Ga0501033_0026010_117_707 194
2185 3300049570 Ga0501033_0084108 Ga0501033_0084108_962_1549 194
2186 3300049571 Ga0501034_0000108 Ga0501034_0000108_42181_42765 194
2187 3300049571 Ga0501034_0009225 Ga0501034_0009225_4703_5287 194
2188 3300049571 Ga0501034_0093381 Ga0501034_0093381_2244_2828 194
2189 3300049572 Ga0501036_0000065 Ga0501036_0000065_30392_30976 194
2190 3300049572 Ga0501036_0001511 Ga0501036_0001511_13367_13951 194
2191 3300049573 Ga0501037_0000173 Ga0501037_0000173_26659_27243 194
2192 3300049573 Ga0501037_0001396 Ga0501037_0001396_6954_7538 194
2193 3300049573 Ga0501037_0092548 Ga0501037_0092548_1331_1915 194
2194 3300049573 Ga0501037_0098180 Ga0501037_0098180_1427_2011 194
2195 3300049574 Ga0501038_0000416 Ga0501038_0000416_4659_5243 194
2196 3300049574 Ga0501038_0001849 Ga0501038_0001849_6266_6850 194
2197 3300049574 Ga0501038_0328592 Ga0501038_0328592_541_1125 194
2198 3300049574 Ga0501038_0728706 Ga0501038_0728706_41_625 194
2199 3300049575 Ga0501039_0000265 Ga0501039_0000265_16667_17251 194
2200 3300049575 Ga0501039_0001908 Ga0501039_0001908_6170_6754 194
2201 3300049575 Ga0501039_0056245 Ga0501039_0056245_142_732 194
2202 3300049575 Ga0501039_0581645 Ga0501039_0581645_241_825 194
2203 3300049578 Ga0501042_0373583 Ga0501042_0373583_189_773 194
2204 3300049579 Ga0501043_0000226 Ga0501043_0000226_11642_12226 194
2205 3300049579 Ga0501043_0001794 Ga0501043_0001794_6705_7289 194
2206 3300049579 Ga0501043_0088222 Ga0501043_0088222_1623_2207 194
2207 3300049579 Ga0501043_0209139 Ga0501043_0209139_402_986 194
2208 3300049580 Ga0501046_0002295 Ga0501046_0002295_13333_13917 194
2209 3300049580 Ga0501046_0002922 Ga0501046_0002922_11581_12165 194
2210 3300049580 Ga0501046_0057022 Ga0501046_0057022_1480_2064 194
2211 3300049580 Ga0501046_0064839 Ga0501046_0064839_1102_1686 194
2212 3300049581 Ga0501047_0000325 Ga0501047_0000325_15562_16146 194
2213 3300049581 Ga0501047_0075613 Ga0501047_0075613_1513_2097 194
2214 3300049581 Ga0501047_0172020 Ga0501047_0172020_1266_1850 194
2215 3300049581 Ga0501047_0200519 Ga0501047_0200519_783_1367 194
2216 3300049581 Ga0501047_0265558 Ga0501047_0265558_204_788 194
2217 3300049581 Ga0501047_0843666 Ga0501047_0843666_111_719 194
2218 3300049581 Ga0501047_0882390 Ga0501047_0882390_85_669 194
2219 3300049582 Ga0501048_0017293 Ga0501048_0017293_3438_4022 194
2220 3300049582 Ga0501048_0025050 Ga0501048_0025050_1455_2039 194
2221 3300049583 Ga0501067_0001155 Ga0501067_0001155_1615_2199 194
2222 3300049583 Ga0501067_0053367 Ga0501067_0053367_783_1367 194
2223 3300049583 Ga0501067_0064556 Ga0501067_0064556_1358_1942 194
2224 3300049584 Ga0501068_0002505 Ga0501068_0002505_3459_4043 194
2225 3300049584 Ga0501068_0007958 Ga0501068_0007958_3734_4318 194
2226 3300049584 Ga0501068_0290720 Ga0501068_0290720_429_1013 194
2227 3300049585 Ga0501069_0000334 Ga0501069_0000334_17636_18220 194
2228 3300049585 Ga0501069_0001508 Ga0501069_0001508_7928_8512 194
2229 3300049585 Ga0501069_0348001 Ga0501069_0348001_271_855 194
2230 3300049585 Ga0501069_0394318 Ga0501069_0394318_147_731 194
2231 3300049586 Ga0501070_0000560 Ga0501070_0000560_18501_19085 194
2232 3300049586 Ga0501070_0008334 Ga0501070_0008334_3520_4104 194
2233 3300049586 Ga0501070_0059865 Ga0501070_0059865_1588_2172 194
2234 3300049586 Ga0501070_0127900 Ga0501070_0127900_1044_1628 194
2235 3300049586 Ga0501070_0182667 Ga0501070_0182667_55_639 194
2236 3300049586 Ga0501070_0184977 Ga0501070_0184977_60_650 194
2237 3300049586 Ga0501070_0259920 Ga0501070_0259920_473_1057 194
2238 3300049586 Ga0501070_0600506 Ga0501070_0600506_277_861 194
2239 3300049588 Ga0501072_0007218 Ga0501072_0007218_65_649 194
2240 3300049588 Ga0501072_0107925 Ga0501072_0107925_1023_1607 194
2241 3300049589 Ga0501073_0000058 Ga0501073_0000058_17934_18518 194
2242 3300049589 Ga0501073_0001880 Ga0501073_0001880_10885_11469 194
2243 3300049589 Ga0501073_0033545 Ga0501073_0033545_1428_2012 194
2244 3300049589 Ga0501073_0070511 Ga0501073_0070511_417_1001 194
2245 3300049589 Ga0501073_0118663 Ga0501073_0118663_133_717 194
2246 3300049589 Ga0501073_0120442 Ga0501073_0120442_1151_1741 194
2247 3300049589 Ga0501073_0172987 Ga0501073_0172987_356_940 194
2248 3300049590 Ga0501074_0000493 Ga0501074_0000493_4365_4949 194
2249 3300049590 Ga0501074_0001430 Ga0501074_0001430_11509_12093 194
2250 3300049590 Ga0501074_0092468 Ga0501074_0092468_277_861 194
2251 3300049592 Ga0501076_0225195 Ga0501076_0225195_637_1221 194
2252 3300049592 Ga0501076_0280820 Ga0501076_0280820_422_1006 194
2253 3300049592 Ga0501076_0868484 Ga0501076_0868484_110_694 194
2254 3300049741 Ga0501079_0007949 Ga0501079_0007949_1601_2185 194
2255 3300049741 Ga0501079_0060942 Ga0501079_0060942_1123_1707 194
2256 3300049741 Ga0501079_0076867 Ga0501079_0076867_481_1065 194
2257 3300049741 Ga0501079_0924853 Ga0501079_0924853_41_625 194
2258 3300049742 Ga0501080_0000317 Ga0501080_0000317_4513_5097 194
2259 3300049742 Ga0501080_0001937 Ga0501080_0001937_4096_4680 194
2260 3300049742 Ga0501080_0050868 Ga0501080_0050868_168_752 194
2261 3300049742 Ga0501080_0053502 Ga0501080_0053502_1853_2437 194
2262 3300049742 Ga0501080_0107885 Ga0501080_0107885_973_1563 194
2263 3300049744 Ga0501083_0000286 Ga0501083_0000286_19928_20512 194
2264 3300049744 Ga0501083_0003151 Ga0501083_0003151_9386_9970 194
2265 3300049744 Ga0501083_0039418 Ga0501083_0039418_1999_2583 194
2266 3300049744 Ga0501083_0064149 Ga0501083_0064149_517_1101 194
2267 3300049744 Ga0501083_0155657 Ga0501083_0155657_532_1116 194
2268 3300049822 Ga0501035_0000079 Ga0501035_0000079_40963_41547 194
2269 3300049822 Ga0501035_0006457 Ga0501035_0006457_2916_3500 194
2270 3300049822 Ga0501035_0210914 Ga0501035_0210914_953_1537 194
2271 3300049822 Ga0501035_0505600 Ga0501035_0505600_228_812 194
2272 3300049822 Ga0501035_0667224 Ga0501035_0667224_193_783 194
2273 3300049823 Ga0501044_0000085 Ga0501044_0000085_78819_79403 194
2274 3300049823 Ga0501044_0003491 Ga0501044_0003491_2179_2763 194
2275 3300049823 Ga0501044_0040477 Ga0501044_0040477_2575_3159 194
2276 3300049823 Ga0501044_0047276 Ga0501044_0047276_381_968 194
2277 3300049823 Ga0501044_0164033 Ga0501044_0164033_1242_1826 194
2278 3300049823 Ga0501044_0166353 Ga0501044_0166353_1123_1707 194
2279 3300049823 Ga0501044_0408425 Ga0501044_0408425_31_615 194
2280 3300049823 Ga0501044_0693483 Ga0501044_0693483_216_824 194
2281 3300049824 Ga0501045_0060047 Ga0501045_0060047_267_851 194
2282 3300050489 nmdc:mga03683_318339_c1 nmdc:mga03683_318339_c1_103_687 194
2283 3300050489 nmdc:mga03683_92071_c1 nmdc:mga03683_92071_c1_720_1304 194
2284 3300050490 nmdc:mga03n38_201503_c1 nmdc:mga03n38_201503_c1_306_890 194
2285 3300050490 nmdc:mga03n38_8874_c1 nmdc:mga03n38_8874_c1_2754_3338 194
2286 3300050491 nmdc:mga00v17_113171_c1 nmdc:mga00v17_113171_c1_167_751 194
2287 3300050491 nmdc:mga00v17_129639_c1 nmdc:mga00v17_129639_c1_695_1279 194
2288 3300050491 nmdc:mga00v17_466050_c1 nmdc:mga00v17_466050_c1_191_775 194
2289 3300050492 nmdc:mga0yw44_235648_c1 nmdc:mga0yw44_235648_c1_540_1124 194
2290 3300050492 nmdc:mga0yw44_380097_c1 nmdc:mga0yw44_380097_c1_215_799 194
2291 3300050493 nmdc:mga0k408_113107_c1 nmdc:mga0k408_113107_c1_692_1276 194
2292 3300050493 nmdc:mga0k408_146845_c1 nmdc:mga0k408_146845_c1_667_1251 194
2293 3300050493 nmdc:mga0k408_68779_c1 nmdc:mga0k408_68779_c1_1041_1625 194
2294 3300050494 nmdc:mga06z11_102195_c1 nmdc:mga06z11_102195_c1_422_1006 194
2295 3300050494 nmdc:mga06z11_5930_c1 nmdc:mga06z11_5930_c1_1570_2154 194
2296 3300050495 nmdc:mga04h51_18815_c1 nmdc:mga04h51_18815_c1_766_1350 194
2297 3300050495 nmdc:mga04h51_32865_c1 nmdc:mga04h51_32865_c1_38_622 194
2298 3300050496 nmdc:mga07m45_265178_c1 nmdc:mga07m45_265178_c1_255_839 194
2299 3300050496 nmdc:mga07m45_28600_c1 nmdc:mga07m45_28600_c1_2338_2922 194
2300 3300050496 nmdc:mga07m45_348726_c1 nmdc:mga07m45_348726_c1_259_843 194
2301 3300050496 nmdc:mga07m45_56467_c1 nmdc:mga07m45_56467_c1_1395_1979 194
2302 3300050496 nmdc:mga07m45_97123_c1 nmdc:mga07m45_97123_c1_841_1425 194
2303 3300050507 nmdc:mga05p37_116860_c1 nmdc:mga05p37_116860_c1_323_907 194
2304 3300050507 nmdc:mga05p37_14669_c1 nmdc:mga05p37_14669_c1_8632_9216 194
2305 3300050507 nmdc:mga05p37_190945_c1 nmdc:mga05p37_190945_c1_110_694 194
2306 3300050507 nmdc:mga05p37_541593_c1 nmdc:mga05p37_541593_c1_277_861 194
2307 3300050508 nmdc:mga09592_579874_c1 nmdc:mga09592_579874_c1_363_947 194
2308 3300050510 nmdc:mga06r32_87339_c1 nmdc:mga06r32_87339_c1_1512_2096 194
2309 3300050511 nmdc:mga08y16_201463_c1 nmdc:mga08y16_201463_c1_1110_1694 194
2310 3300050512 nmdc:mga0n895_1170165_c1 nmdc:mga0n895_1170165_c1_137_721 194
2311 3300050512 nmdc:mga0n895_137076_c1 nmdc:mga0n895_137076_c1_1257_1841 194
2312 3300050512 nmdc:mga0n895_17804_c1 nmdc:mga0n895_17804_c1_1932_2516 194
2313 3300050512 nmdc:mga0n895_503889_c1 nmdc:mga0n895_503889_c1_360_944 194
2314 3300050512 nmdc:mga0n895_662_c1 nmdc:mga0n895_662_c1_15386_15970 194
2315 3300050512 nmdc:mga0n895_9753_c1 nmdc:mga0n895_9753_c1_5960_6544 194
2316 3300050513 nmdc:mga0rr50_10959_c1 nmdc:mga0rr50_10959_c1_2162_2746 194
2317 3300050513 nmdc:mga0rr50_17170_c1 nmdc:mga0rr50_17170_c1_1026_1610 194
2318 3300050513 nmdc:mga0rr50_55771_c1 nmdc:mga0rr50_55771_c1_2220_2804 194
2319 3300050513 nmdc:mga0rr50_65971_c1 nmdc:mga0rr50_65971_c1_1015_1599 194
2320 3300050514 nmdc:mga08x19_241247_c1 nmdc:mga08x19_241247_c1_117_701 194
2321 3300050514 nmdc:mga08x19_3966_c1 nmdc:mga08x19_3966_c1_1301_1885 194
2322 3300050514 nmdc:mga08x19_656913_c1 nmdc:mga08x19_656913_c1_62_646 194
2323 3300050514 nmdc:mga08x19_8013_c1 nmdc:mga08x19_8013_c1_3100_3684 194
2324 3300050515 nmdc:mga0a205_2883_c1 nmdc:mga0a205_2883_c1_9205_9789 194
2325 3300050515 nmdc:mga0a205_5062_c1 nmdc:mga0a205_5062_c1_7508_8092 194
2326 3300050515 nmdc:mga0a205_506819_c1 nmdc:mga0a205_506819_c1_337_921 194
2327 3300050516 nmdc:mga0sz30_113071_c1 nmdc:mga0sz30_113071_c1_254_838 194
2328 3300050516 nmdc:mga0sz30_33134_c1 nmdc:mga0sz30_33134_c1_343_927 194
2329 3300053077 Ga0495601_0012431 Ga0495601_0012431_2304_2888 194
2330 3300053077 Ga0495601_0038162 Ga0495601_0038162_578_1162 194
2331 3300053077 Ga0495601_0047689 Ga0495601_0047689_1273_1857 194
2332 3300053077 Ga0495601_0059658 Ga0495601_0059658_664_1248 194
2333 3300053077 Ga0495601_0292932 Ga0495601_0292932_296_880 194
2334 3300053078 Ga0495612_0015113 Ga0495612_0015113_1293_1877 194
2335 3300053078 Ga0495612_0016164 Ga0495612_0016164_1588_2172 194
2336 3300053079 Ga0500610_0228911 Ga0500610_0228911_23_607 194
2337 3300053080 Ga0500635_0001194 Ga0500635_0001194_4376_4960 194
2338 3300053080 Ga0500635_0001309 Ga0500635_0001309_1670_2254 194
2339 3300053080 Ga0500635_0056405 Ga0500635_0056405_606_1190 194
2340 3300053083 Ga0495655_0025140 Ga0495655_0025140_457_1041 194
2341 3300053083 Ga0495655_0051877 Ga0495655_0051877_262_846 194
2342 3300053084 Ga0495595_0006178 Ga0495595_0006178_2925_3509 194
2343 3300053084 Ga0495595_0013228 Ga0495595_0013228_2530_3114 194
2344 3300053084 Ga0495595_0092866 Ga0495595_0092866_655_1239 194
2345 3300053084 Ga0495595_0095942 Ga0495595_0095942_311_895 194
2346 3300053085 Ga0495619_0074586 Ga0495619_0074586_532_1116 194
2347 3300053085 Ga0495619_0136591 Ga0495619_0136591_994_1578 194
2348 3300053085 Ga0495619_0140224 Ga0495619_0140224_519_1103 194
2349 3300053085 Ga0495619_0225010 Ga0495619_0225010_500_1084 194
2350 3300053087 Ga0500643_000007 Ga0500643_000007_5405_5989 194
2351 3300053088 Ga0500644_0012070 Ga0500644_0012070_661_1245 194
2352 3300053090 Ga0500646_0074071 Ga0500646_0074071_135_719 194
2353 3300053090 Ga0500646_0163234 Ga0500646_0163234_100_684 194
2354 3300053090 Ga0500646_0174135 Ga0500646_0174135_101_685 194
2355 3300053091 Ga0500647_0006809 Ga0500647_0006809_3641_4225 194
2356 3300053092 Ga0500583_0297877 Ga0500583_0297877_88_672 194
2357 3300053092 Ga0500583_0354714 Ga0500583_0354714_28_612 194
2358 3300053093 Ga0500651_0011013 Ga0500651_0011013_2879_3463 194
2359 3300053094 Ga0500566_0000003 Ga0500566_0000003_126398_126982 194
2360 3300053094 Ga0500566_0001155 Ga0500566_0001155_1276_1860 194
2361 3300053094 Ga0500566_0039034 Ga0500566_0039034_971_1555 194
2362 3300053094 Ga0500566_0214652 Ga0500566_0214652_182_766 194
2363 3300053095 Ga0500640_000579 Ga0500640_000579_190_774 194
2364 3300053096 Ga0500641_0001798 Ga0500641_0001798_4574_5158 194
2365 3300053096 Ga0500641_0031420 Ga0500641_0031420_539_1123 194
2366 3300053096 Ga0500641_0035927 Ga0500641_0035927_1052_1636 194
2367 3300053097 Ga0500648_191769 Ga0500648_191769_23_607 194
2368 3300053098 Ga0500650_0244547 Ga0500650_0244547_58_642 194
2369 3300053102 Ga0500554_000816 Ga0500554_000816_145_729 194
2370 3300053103 Ga0500555_001725 Ga0500555_001725_1528_2112 194
2371 3300053103 Ga0500555_016907 Ga0500555_016907_456_1040 194
2372 3300053103 Ga0500555_044228 Ga0500555_044228_295_879 194
2373 3300053104 Ga0500556_0005578 Ga0500556_0005578_2325_2909 194
2374 3300053105 Ga0500557_000052 Ga0500557_000052_28319_28903 194
2375 3300053108 Ga0500562_030999 Ga0500562_030999_284_868 194
2376 3300053109 Ga0500569_045808 Ga0500569_045808_585_1169 194
2377 3300053111 Ga0500572_002602 Ga0500572_002602_1910_2494 194
2378 3300053111 Ga0500572_003949 Ga0500572_003949_1237_1821 194
2379 3300053111 Ga0500572_075652 Ga0500572_075652_300_884 194
2380 3300053115 Ga0500591_111664 Ga0500591_111664_32_616 194
2381 3300053118 Ga0500594_0223550 Ga0500594_0223550_25_609 194
2382 3300053119 Ga0500595_000395 Ga0500595_000395_7538_8122 194
2383 3300053119 Ga0500595_002313 Ga0500595_002313_1324_1908 194
2384 3300053119 Ga0500595_010388 Ga0500595_010388_1032_1616 194
2385 3300053119 Ga0500595_023883 Ga0500595_023883_1161_1745 194
2386 3300053119 Ga0500595_110998 Ga0500595_110998_71_655 194
2387 3300053121 Ga0500607_012093 Ga0500607_012093_4471_5055 194
2388 3300053122 Ga0500608_003401 Ga0500608_003401_3453_4037 194
2389 3300053122 Ga0500608_014443 Ga0500608_014443_1942_2526 194
2390 3300053123 Ga0500614_012420 Ga0500614_012420_787_1371 194
2391 3300053128 Ga0500626_163139 Ga0500626_163139_186_770 194
2392 3300053130 Ga0500642_0000306 Ga0500642_0000306_1282_1866 194
2393 3300053130 Ga0500642_0000414 Ga0500642_0000414_4059_4643 194
2394 3300053130 Ga0500642_0018796 Ga0500642_0018796_482_1066 194
2395 3300053130 Ga0500642_0055511 Ga0500642_0055511_653_1237 194
2396 3300053131 Ga0500652_181167 Ga0500652_181167_86_670 194
2397 3300053134 Ga0500658_0065368 Ga0500658_0065368_482_1066 194
2398 3300053134 Ga0500658_0093358 Ga0500658_0093358_127_711 194
2399 3300053136 Ga0500559_0001626 Ga0500559_0001626_6807_7391 194
2400 3300053136 Ga0500559_0002366 Ga0500559_0002366_6862_7446 194
2401 3300053136 Ga0500559_0013274 Ga0500559_0013274_2796_3380 194
2402 3300053136 Ga0500559_0013422 Ga0500559_0013422_2767_3351 194
2403 3300053136 Ga0500559_0042434 Ga0500559_0042434_1283_1867 194
2404 3300053136 Ga0500559_0051986 Ga0500559_0051986_91_675 194
2405 3300053139 Ga0500568_0088527 Ga0500568_0088527_240_824 194
2406 3300053139 Ga0500568_0236792 Ga0500568_0236792_40_624 194
2407 3300053140 Ga0500573_0065364 Ga0500573_0065364_107_691 194
2408 3300053140 Ga0500573_0198215 Ga0500573_0198215_354_938 194
2409 3300053142 Ga0500577_0030213 Ga0500577_0030213_655_1239 194
2410 3300053142 Ga0500577_0300642 Ga0500577_0300642_49_633 194
2411 3300053146 Ga0500588_0303384 Ga0500588_0303384_10_594 194
2412 3300053147 Ga0500589_131606 Ga0500589_131606_387_971 194
2413 3300053147 Ga0500589_185958 Ga0500589_185958_184_768 194
2414 3300053148 Ga0500590_131278 Ga0500590_131278_169_753 194
2415 3300053148 Ga0500590_174959 Ga0500590_174959_310_894 194
2416 3300053150 Ga0500603_000184 Ga0500603_000184_5317_5901 194
2417 3300053150 Ga0500603_002335 Ga0500603_002335_1610_2194 194
2418 3300053150 Ga0500603_091156 Ga0500603_091156_129_713 194
2419 3300053151 Ga0500604_0001384 Ga0500604_0001384_2923_3507 194
2420 3300053151 Ga0500604_0018792 Ga0500604_0018792_154_738 194
2421 3300053151 Ga0500604_0020084 Ga0500604_0020084_1171_1755 194
2422 3300053151 Ga0500604_0132721 Ga0500604_0132721_156_740 194
2423 3300053153 Ga0500616_0000997 Ga0500616_0000997_14195_14779 194
2424 3300053153 Ga0500616_0028617 Ga0500616_0028617_1021_1605 194
2425 3300053155 Ga0500620_085238 Ga0500620_085238_433_1017 194
2426 3300053156 Ga0500622_0023013 Ga0500622_0023013_701_1285 194
2427 3300053156 Ga0500622_0152746 Ga0500622_0152746_97_681 194
2428 3300053158 Ga0500627_0087461 Ga0500627_0087461_606_1190 194
2429 3300053158 Ga0500627_0102022 Ga0500627_0102022_662_1246 194
2430 3300053159 Ga0500630_001089 Ga0500630_001089_1351_1935 194
2431 3300053161 Ga0500634_0081961 Ga0500634_0081961_866_1450 194
2432 3300053162 Ga0500638_016718 Ga0500638_016718_571_1155 194
2433 3300053162 Ga0500638_088132 Ga0500638_088132_387_971 194
2434 3300053163 Ga0500639_000033 Ga0500639_000033_28665_29249 194
2435 3300053163 Ga0500639_036153 Ga0500639_036153_88_672 194
2436 3300053163 Ga0500639_181940 Ga0500639_181940_312_896 194
2437 3300053177 Ga0500636_0000042 Ga0500636_0000042_58606_59190 194
2438 3300053177 Ga0500636_0017069 Ga0500636_0017069_1380_1964 194
2439 3300053177 Ga0500636_0073613 Ga0500636_0073613_1051_1635 194
2440 3300053178 Ga0500637_0000026 Ga0500637_0000026_18340_18924 194
2441 3300053178 Ga0500637_0007084 Ga0500637_0007084_2008_2592 194
2442 3300053178 Ga0500637_0370156 Ga0500637_0370156_12_596 194
2443 3300053729 Ga0500625_000139 Ga0500625_000139_8501_9085 194
2444 3300053730 Ga0500645_028397 Ga0500645_028397_519_1103 194
2445 3300053730 Ga0500645_100990 Ga0500645_100990_31_615 194
2446 3300053731 Ga0500609_001833 Ga0500609_001833_1051_1635 194
2447 3300053731 Ga0500609_006897 Ga0500609_006897_66_650 194
2448 3300053731 Ga0500609_014847 Ga0500609_014847_397_981 194
2449 3300053731 Ga0500609_026818 Ga0500609_026818_166_750 194
2450 3300053735 Ga0500596_001686 Ga0500596_001686_2411_2995 194
2451 3300053735 Ga0500596_004563 Ga0500596_004563_155_739 194
2452 3300053736 Ga0500599_001249 Ga0500599_001249_207_791 194
2453 3300053737 Ga0500601_000553 Ga0500601_000553_2961_3545 194
2454 3300054114 Ga0501084_0010662 Ga0501084_0010662_2810_3394 194
2455 3300054114 Ga0501084_0020382 Ga0501084_0020382_4526_5110 194
2456 3300054114 Ga0501084_0098331 Ga0501084_0098331_1142_1726 194
2457 3300054114 Ga0501084_0355186 Ga0501084_0355186_465_1049 194
2458 3300055283 Ga0500661_002036 Ga0500661_002036_1630_2214 194
2459 3300055283 Ga0500661_009951 Ga0500661_009951_622_1206 194
2460 3300059423 Ga0590074_017657 Ga0590074_017657_109_693 194
2461 3300060353 Ga0501082_0002220 Ga0501082_0002220_10864_11448 194
2462 3300060353 Ga0501082_0014490 Ga0501082_0014490_1369_1953 194
2463 3300060353 Ga0501082_0018904 Ga0501082_0018904_3044_3628 194
2464 3300060353 Ga0501082_0510417 Ga0501082_0510417_245_829 194
2465 3300061719 Ga0466962_0100235 Ga0466962_0100235_261_845 194
2466 iso_pu_bacteria 2728368998 2728755512 194

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06684

AA_synth

Amino acid synthesis

9

184

1

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qtp-assembly1.cif.gz_A crystal structure of a duf1185 family protein (spo0826) from silicibacter pomeroyi dss-3 at 2.10 a resolution 0.9869 5 172
2qtp-assembly1.cif.gz_A crystal structure of a duf1185 family protein (spo0826) from silicibacter pomeroyi dss-3 at 2.10 a resolution 0.9736 5 172
3byq-assembly1.cif.gz_B crystal structure of a duf1185 family protein (bb2672) from bordetella bronchiseptica rb50 at 1.70 a resolution 0.9487 3 194
3byq-assembly1.cif.gz_B crystal structure of a duf1185 family protein (bb2672) from bordetella bronchiseptica rb50 at 1.70 a resolution 0.9298 3 194
4rh8-assembly4.cif.gz_D crystal structure of the outer membrane lipopolysaccharide transport protein lpte (rlpb) from escherichia coli in the tetragonal crystal form 0.7671 5 37
ID Description Score Start End Superfamily
2qtpA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;BB2672 0.9862 5 172 3.30.1330.110
2qtpA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;BB2672 0.9726 5 172 3.30.1330.110
3byqA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;BB2672 0.9332 1 194 3.30.1330.110
3byqA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;BB2672 0.9284 1 194 3.30.1330.110
5xd7A01 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain 0.6106 1 36 3.30.390.10
ID Description Score Start End GO Terms
AF-A0A2V7X634-F1-model_v4 Peptide synthetase 1.003 3 89
AF-A0A2V8XH66-F1-model_v4 Peptide synthetase 0.9918 1 146
AF-A0A7C3ZNL2-F1-model_v4 Amino acid synthesis family protein 0.9916 2 72
AF-A0A4Q5W4Q5-F1-model_v4 deleted 0.9901 3 167
AF-A0A661IP74-F1-model_v4 Amino acid synthesis family protein 0.9898 4 154

Feature Viewer

pLDDT pTM Quality
89.81 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map