F496779

General Info

Members Datasets Scaffolds Average Seq Length
2402 843 2159 278

Family's Representative Sequence

Representative Sequence 3300005354|Ga0070675_100326135|Ga0070675_1003261352
Length 314
Sequence MCAGDHPAGTGVDGYWTSNRCRVACKVKPWPLPVISTRRPAFIQMSETGYFHLHLVSDATGETLITVARAAAAQYANVSPVEHLYPMVRSKKQLDQALAEITESPGLVLYTLLEEDLIQLLEKKCRELGLPCMSVLGPVLRLFQSYLGAETIHRAGAQHVLNAEYFQRIDALNFTMLHDDGQHVEGLEEADVVLVGVSRTSKTPTSIYLANRGVKTGNVPLVPVEKLTRPLVVGLYASPERIVQIRENRLLGLKAHRDDDQYIDKTAVAEEVSFSRRLCARHNWPTIDVTRRSIEETAAAVMRLLSERRRHPVA

Samples

Sample ID Description Type Environment
1 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
4 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
5 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
6 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
7 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
8 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
9 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
10 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
11 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
12 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
13 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
14 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
15 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
16 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
17 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
18 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
19 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
20 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
21 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
22 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
23 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
24 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
25 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
26 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
27 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
28 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
29 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
30 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
31 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
32 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
33 2643221733 Bosea sp. Root381 Isolate Unclassified
34 2643221734 Bosea sp. Root670 Isolate Unclassified
35 2643221736 Bosea sp. Root483D1 Isolate Unclassified
36 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
37 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
38 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
39 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
40 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
41 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
42 2791355199
43 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
44 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
45 2818991467 Bosea vestrisii 3192 Isolate Unclassified
46 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
47 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
48 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
49 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
50 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
51 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
52 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
53 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
54 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
55 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
56 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
57 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
58 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
59 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
60 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
61 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
62 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
63 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
64 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
65 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
66 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
67 2841760612 Bosea sp. Tri-49 Isolate Nodule
68 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
69 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
70 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
71 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
72 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
73 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
74 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
75 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
76 2844104063 Bosea sp. Tri-39 Isolate Nodule
77 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
78 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
79 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
80 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
81 2851182111 Bosea sp. Tri-44 Isolate Nodule
82 2851246043 Bosea sp. Tri-54 Isolate Nodule
83 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
84 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
85 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
86 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
87 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
88 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
89 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
90 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
91 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
92 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
93 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
94 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
95 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
96 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
97 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
98 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
99 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
100 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
101 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
102 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
103 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
104 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
105 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
106 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
107 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
108 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
109 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
110 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
111 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
112 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
113 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
114 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
115 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
116 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
117 2904699407
118 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
119 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
120 2906610324
121 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
122 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
123 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
124 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
125 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
126 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
127 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
128 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
129 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
130 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
131 2922368715
132 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
133 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
134 2922425934
135 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
136 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
137 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
138 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
139 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
140 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
141 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
142 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
143 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
144 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
145 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
146 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
147 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
148 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
149 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
150 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
151 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
152 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
153 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
154 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
155 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
156 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
157 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
158 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
159 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
160 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
161 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
162 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
163 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
164 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
165 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
166 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
167 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
168 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
169 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
170 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
171 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
172 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
173 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
174 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
175 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
176 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
177 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
178 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
179 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
180 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
181 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
182 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
183 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
184 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
185 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
186 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
187 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
188 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
189 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
190 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
191 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
192 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
193 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
194 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
195 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
196 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
197 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
198 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
199 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
200 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
201 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
202 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
203 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
204 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
205 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
206 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
207 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
208 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
209 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
210 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
211 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
212 3300001430 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 Metagenome Rhizosphere
213 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
214 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
215 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
216 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
217 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
218 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
219 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
220 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
221 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
222 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
223 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
224 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
225 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
226 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
227 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
228 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
229 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
230 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
231 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
232 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
233 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
234 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
235 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
236 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
237 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
238 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
239 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
240 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
241 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
242 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
243 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
244 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
245 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
246 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
247 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
248 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
249 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
250 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
251 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
252 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
253 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
254 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
255 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
256 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
257 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
258 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
259 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
260 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
261 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
262 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
263 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
264 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
265 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
266 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
267 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
268 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
269 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
270 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
271 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
272 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
273 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
274 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
275 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
276 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
277 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
278 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
279 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
280 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
281 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
282 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
283 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
284 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
285 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
286 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
287 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
288 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
289 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
290 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
291 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
292 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
293 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
294 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
295 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
296 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
297 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
298 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
299 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
300 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
301 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
302 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
303 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
304 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
305 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
306 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
307 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
308 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
309 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
310 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
311 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
312 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
313 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
314 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
315 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
316 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
317 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
318 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
319 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
320 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
321 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
322 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
323 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
324 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
325 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
326 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
327 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
328 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
329 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
330 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
331 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
332 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
333 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
334 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
335 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
336 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
337 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
338 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
339 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
340 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
341 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
342 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
343 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
344 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
345 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
346 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
347 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
348 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
349 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
350 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
351 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
352 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
353 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
354 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
355 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
356 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
357 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
358 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
359 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
360 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
361 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
362 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
363 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
364 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
365 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
366 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
367 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
368 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
369 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
370 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
371 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
372 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
373 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
374 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
375 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
376 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
377 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
378 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
379 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
380 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
381 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
382 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
383 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
384 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
385 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
386 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
387 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
388 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
389 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
390 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
391 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
392 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
393 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
394 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
395 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
396 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
397 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
398 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
399 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
400 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
401 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
402 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
403 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
404 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
405 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
406 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
407 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
408 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
409 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
410 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
411 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
412 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
413 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
414 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
415 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
416 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
417 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
418 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
419 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
420 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
421 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
422 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
423 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
424 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
425 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
426 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
427 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
428 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
429 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
430 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
431 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
432 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
433 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
434 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
435 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
436 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
437 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
438 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
439 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
440 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
441 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
442 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
443 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
444 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
445 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
446 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
447 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
448 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
449 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
450 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
451 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
452 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
453 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
454 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
455 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
456 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
457 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
458 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
459 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
460 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
461 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
462 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
463 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
464 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
465 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
466 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
467 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
468 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
469 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
470 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
471 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
472 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
473 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
474 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
475 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
476 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
477 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
478 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
479 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
480 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
481 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
482 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
483 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
484 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
485 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
486 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
487 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
488 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
489 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
490 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
491 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
492 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
493 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
494 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
495 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
496 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
497 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
498 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
499 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
500 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
501 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
502 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
503 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
504 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
505 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
506 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
507 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
508 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
509 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
510 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
511 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
512 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
513 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
514 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
515 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
516 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
517 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
518 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
519 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
520 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
521 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
522 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
523 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
524 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
525 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
526 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
527 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
528 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
529 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
530 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
531 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
532 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
533 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
534 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
535 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
536 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
537 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
538 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
539 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
540 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
541 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
542 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
543 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
544 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
545 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
546 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
547 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
548 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
549 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
550 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
551 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
552 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
553 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
554 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
555 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
556 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
557 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
558 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
559 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
560 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
561 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
562 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
563 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
564 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
565 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
566 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
567 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
568 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
569 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
570 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
571 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
572 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
573 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
574 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
575 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
576 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
577 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
578 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
579 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
580 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
581 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
582 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
583 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
584 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
585 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
586 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
587 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
588 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
589 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
590 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
591 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
592 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
593 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
594 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
595 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
596 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
597 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
598 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
599 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
600 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
601 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
602 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
603 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
604 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
605 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
606 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
607 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
608 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
609 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
610 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
611 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
612 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
613 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
614 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
615 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
616 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
617 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
618 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
619 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
620 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
621 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
622 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
623 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
624 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
625 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
626 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
627 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
628 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
629 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
630 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
631 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
632 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
633 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
634 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
635 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
636 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
637 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
638 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
639 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
640 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
641 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
642 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
643 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
644 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
645 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
646 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
647 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
648 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
649 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
650 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
651 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
652 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
653 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
654 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
655 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
656 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
657 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
658 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
659 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
660 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
661 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
662 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
663 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
664 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
665 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
666 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
667 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
668 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
669 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
670 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
671 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
672 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
673 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
674 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
675 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
676 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
677 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
678 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
679 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
680 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
681 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
682 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
683 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
684 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
685 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
686 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
687 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
688 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
689 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
690 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
691 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
692 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
693 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
694 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
695 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
696 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
697 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
698 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
699 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
700 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
701 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
702 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
703 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
704 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
705 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
706 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
707 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
708 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
709 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
710 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
711 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
712 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
713 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
714 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
715 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
716 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
717 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
718 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
719 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
720 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
721 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
722 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
723 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
724 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
725 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
726 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
727 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
728 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
729 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
730 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
731 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
732 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
733 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
734 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
735 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
736 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
737 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
738 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
739 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
740 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
741 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
742 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
743 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
744 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
745 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
746 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
747 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
748 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
749 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
750 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
751 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
752 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
753 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
754 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
755 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
756 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
757 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
758 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
759 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
760 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
761 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
762 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
763 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
764 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
765 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
766 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
767 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
768 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
769 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
770 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
771 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
772 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
773 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
774 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
775 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
776 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
777 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
778 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
779 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
780 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
781 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
782 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
783 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
784 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
785 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
786 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
787 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
788 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
789 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
790 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
791 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
792 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
793 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
794 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
795 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
796 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
797 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
798 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
799 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
800 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
801 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
802 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
803 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
804 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
805 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
806 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
807 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
808 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
809 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
810 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
811 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
812 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
813 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
814 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
815 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
816 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
817 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
818 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
819 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
820 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
821 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
822 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
823 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
824 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
825 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
826 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
827 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
828 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
829 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
830 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
831 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
832 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
833 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
834 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
835 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
836 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
837 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
838 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
839 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
840 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
841 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
842 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule
843 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 90.07
Metatranscriptomes 0
Isolates 9.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.53
Nodule 7.79
Rhizoplane 6.24
Rhizosphere 70.11
Stem 0
Stem Tuber 0
Unclassified 7.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 RicEn_C4416 2010549000 Bacteria 1482
2 SwRhRL2b_contig_2417348 2162886007 Bacteria 1403
3 2214572730 2209111006 Bacteria 5756
4 ARcpr5oldR_c000196 3300000041 Bacteria 10309
5 ARSoilYngRDRAFT_c00195 3300000042 Bacteria 10197
6 ARcpr5yngRDRAFT_c000005 3300000043 Bacteria 45740
7 ARSoilOldRDRAFT_c000003 3300000044 Bacteria 63923
8 ARCol0oldRDRAFT_c00039 3300000045 Bacteria 10149
9 ARCol0yngRDRAFT_1000194 3300000652 Bacteria 10240
10 JGI24032J14994_100504 3300001430 Bacteria 2048
11 JGI24752J21851_1000622 3300001976 Bacteria 4729
12 JGI24740J21852_10000946 3300001979 Bacteria 12915
13 JGI24739J22299_10001072 3300001989 Bacteria 10181
14 JGI24739J22299_10003399 3300001989 Bacteria 6073
15 JGI24737J22298_10000349 3300001990 Bacteria 15515
16 JGI24737J22298_10000493 3300001990 Bacteria 13715
17 JGI24737J22298_10006737 3300001990 Bacteria 3907
18 JGI24743J22301_10004104 3300001991 Bacteria 2350
19 JGI24735J21928_10018703 3300002067 Bacteria 2135
20 JGI24735J21928_10069449 3300002067 Bacteria 1010
21 JGI24750J21931_1000659 3300002070 Bacteria 5131
22 JGI24738J21930_10000803 3300002075 Bacteria 9022
23 JGI24749J21850_1000742 3300002076 Bacteria 4710
24 JGI24744J21845_10003153 3300002077 Bacteria 3385
25 JGI24744J21845_10008881 3300002077 Bacteria 2065
26 JGI24035J26624_1000051 3300002126 Bacteria 8878
27 JGI25159J45721_1001633 3300002987 Bacteria 9117
28 JGI25406J46586_10000066 3300003203 Bacteria 48110
29 JGI25165J46597_1014054 3300003214 Bacteria 1093
30 JGI25153J46596_10001618 3300003215 Bacteria 13364
31 JGI25153J46596_10001829 3300003215 Bacteria 12618
32 JGI25153J46596_10002496 3300003215 Bacteria 10568
33 JGI25153J46596_10014159 3300003215 Bacteria 3332
34 JGI25160J50197_1003905 3300003354 Bacteria 6529
35 JGI25160J50197_1009567 3300003354 Bacteria 3581
36 JGI25404J52841_10005627 3300003659 Bacteria 2590
37 JGI25404J52841_10005730 3300003659 Bacteria 2571
38 JGI25404J52841_10026842 3300003659 Bacteria 1239
39 Ga0055539_1007755 3300003752 Bacteria 1351
40 Ga0055526_1014208 3300003771 Bacteria 3294
41 Ga0055531_10003199 3300003794 Bacteria 10519
42 Ga0065165_1000365 3300005262 Bacteria 74017
43 Ga0065165_1001133 3300005262 Bacteria 31291
44 Ga0065165_1001495 3300005262 Bacteria 24729
45 Ga0065717_1001964 3300005276 Bacteria 4771
46 Ga0065704_10073913 3300005289 Bacteria 6674
47 Ga0065712_10002282 3300005290 Bacteria 4699
48 Ga0065712_10162912 3300005290 Bacteria 1290
49 Ga0065715_10002794 3300005293 Bacteria 6802
50 Ga0065715_10089788 3300005293 Bacteria 8503
51 Ga0065707_10006094 3300005295 Bacteria 3922
52 Ga0065707_10086522 3300005295 Bacteria 5414
53 Ga0070658_10071586 3300005327 Bacteria 2840
54 Ga0070658_10072420 3300005327 Bacteria 2824
55 Ga0070658_10141574 3300005327 Bacteria 2009
56 Ga0070658_10188148 3300005327 Bacteria 1739
57 Ga0070676_10000360 3300005328 Bacteria 20914
58 Ga0070676_10064947 3300005328 Bacteria 2178
59 Ga0070676_10222755 3300005328 Bacteria 1247
60 Ga0070683_100003076 3300005329 Bacteria 13434
61 Ga0070683_100083038 3300005329 Bacteria 3001
62 Ga0070690_100002249 3300005330 Bacteria 10354
63 Ga0070690_100009502 3300005330 Bacteria 5636
64 Ga0070690_100012428 3300005330 Bacteria 5010
65 Ga0070690_100155829 3300005330 Bacteria 1561
66 Ga0070690_100300522 3300005330 Bacteria 1151
67 Ga0070670_100000827 3300005331 Bacteria 24178
68 Ga0070670_100229170 3300005331 Bacteria 1617
69 Ga0070670_100382741 3300005331 Bacteria 1240
70 Ga0070677_10003275 3300005333 Bacteria 5217
71 Ga0070677_10149087 3300005333 Bacteria 1087
72 Ga0068869_100000013 3300005334 Bacteria 73970
73 Ga0068869_100020918 3300005334 Bacteria 4495
74 Ga0070666_10001254 3300005335 Bacteria 15354
75 Ga0070666_10050409 3300005335 Bacteria 2799
76 Ga0070666_10242070 3300005335 Bacteria 1276
77 Ga0070680_100002249 3300005336 Bacteria 14255
78 Ga0070680_100002907 3300005336 Bacteria 12726
79 Ga0070680_100006151 3300005336 Bacteria 9105
80 Ga0070680_100011100 3300005336 Bacteria 6964
81 Ga0070680_100056958 3300005336 Bacteria 3194
82 Ga0070680_100090420 3300005336 Bacteria 2534
83 Ga0070680_100101410 3300005336 Bacteria 2389
84 Ga0070680_100231723 3300005336 Bacteria 1560
85 Ga0070680_100377583 3300005336 Bacteria 1207
86 Ga0070682_100015075 3300005337 Bacteria 4474
87 Ga0070682_100018296 3300005337 Bacteria 4093
88 Ga0068868_100006458 3300005338 Bacteria 8298
89 Ga0068868_100023763 3300005338 Bacteria 4642
90 Ga0068868_100086938 3300005338 Bacteria 2514
91 Ga0068868_100454103 3300005338 Bacteria 1115
92 Ga0070660_100001856 3300005339 Bacteria 14539
93 Ga0070660_100083861 3300005339 Bacteria 2504
94 Ga0070660_100282819 3300005339 Bacteria 1358
95 Ga0070689_100000474 3300005340 Bacteria 23677
96 Ga0070689_100002685 3300005340 Bacteria 11665
97 Ga0070689_100017774 3300005340 Bacteria 5229
98 Ga0070689_100385462 3300005340 Bacteria 1182
99 Ga0070691_10000101 3300005341 Bacteria 25190
100 Ga0070691_10147224 3300005341 Bacteria 1205
101 Ga0070687_100003699 3300005343 Bacteria 5984
102 Ga0070687_100003845 3300005343 Bacteria 5901
103 Ga0070661_100001285 3300005344 Bacteria 17639
104 Ga0070661_100067991 3300005344 Bacteria 2619
105 Ga0070692_10000014 3300005345 Bacteria 35936
106 Ga0070692_10014365 3300005345 Bacteria 3718
107 Ga0070668_100000629 3300005347 Bacteria 23731
108 Ga0070668_100015369 3300005347 Bacteria 5720
109 Ga0070668_100032431 3300005347 Bacteria 3975
110 Ga0070668_100283220 3300005347 Bacteria 1385
111 Ga0070668_100577958 3300005347 Bacteria 981
112 Ga0070669_100000289 3300005353 Bacteria 39576
113 Ga0070669_100008012 3300005353 Bacteria 7544
114 Ga0070669_100068834 3300005353 Bacteria 2613
115 Ga0070669_100137553 3300005353 Bacteria 1880
116 Ga0070669_100434353 3300005353 Bacteria 1080
117 Ga0070675_100000501 3300005354 Bacteria 26898
118 Ga0070675_100016974 3300005354 Bacteria 5784
119 Ga0070675_100326135 3300005354 Bacteria 1357
120 Ga0070671_100000142 3300005355 Bacteria 46386
121 Ga0070671_100012637 3300005355 Bacteria 6804
122 Ga0070671_100049595 3300005355 Bacteria 3492
123 Ga0070671_100090457 3300005355 Bacteria 2562
124 Ga0070671_100097781 3300005355 Bacteria 2462
125 Ga0070671_100123533 3300005355 Bacteria 2179
126 Ga0070674_100000392 3300005356 Bacteria 21972
127 Ga0070674_100007332 3300005356 Bacteria 6501
128 Ga0070674_100043742 3300005356 Bacteria 3048
129 Ga0070674_100228812 3300005356 Bacteria 1450
130 Ga0070674_100236966 3300005356 Bacteria 1427
131 Ga0070673_100001752 3300005364 Bacteria 12936
132 Ga0070673_100089955 3300005364 Bacteria 2507
133 Ga0070688_100000484 3300005365 Bacteria 20178
134 Ga0070688_100010100 3300005365 Bacteria 5191
135 Ga0070659_100001872 3300005366 Bacteria 15083
136 Ga0070659_100134448 3300005366 Bacteria 2011
137 Ga0070659_100250848 3300005366 Bacteria 1467
138 Ga0070659_100373467 3300005366 Bacteria 1200
139 Ga0070667_100002125 3300005367 Bacteria 17476
140 Ga0070667_100011934 3300005367 Bacteria 7189
141 Ga0070667_100016279 3300005367 Bacteria 6150
142 Ga0070667_100096889 3300005367 Bacteria 2544
143 Ga0070667_100101972 3300005367 Bacteria 2479
144 Ga0070667_100326109 3300005367 Bacteria 1386
145 Ga0070703_10001490 3300005406 Bacteria 7027
146 Ga0070709_10000584 3300005434 Bacteria 21359
147 Ga0070709_10015171 3300005434 Bacteria 4377
148 Ga0070709_10025948 3300005434 Bacteria 3467
149 Ga0070709_10044458 3300005434 Bacteria 2751
150 Ga0070709_10046391 3300005434 Bacteria 2701
151 Ga0070709_10150083 3300005434 Bacteria 1610
152 Ga0070714_100007186 3300005435 Bacteria 8642
153 Ga0070714_100014018 3300005435 Bacteria 6431
154 Ga0070714_100044926 3300005435 Bacteria 3741
155 Ga0070714_100051084 3300005435 Bacteria 3524
156 Ga0070714_100068153 3300005435 Bacteria 3070
157 Ga0070714_100068887 3300005435 Bacteria 3054
158 Ga0070714_100140603 3300005435 Bacteria 2167
159 Ga0070714_100161404 3300005435 Bacteria 2028
160 Ga0070714_100180023 3300005435 Bacteria 1923
161 Ga0070714_100322431 3300005435 Bacteria 1445
162 Ga0070713_100000749 3300005436 Bacteria 20796
163 Ga0070713_100001823 3300005436 Bacteria 13757
164 Ga0070713_100002764 3300005436 Bacteria 11471
165 Ga0070713_100012129 3300005436 Bacteria 6310
166 Ga0070713_100026964 3300005436 Bacteria 4518
167 Ga0070713_100040684 3300005436 Bacteria 3780
168 Ga0070713_100059036 3300005436 Bacteria 3202
169 Ga0070713_100100054 3300005436 Bacteria 2509
170 Ga0070713_100166548 3300005436 Bacteria 1971
171 Ga0070713_100294733 3300005436 Bacteria 1492
172 Ga0070710_10002956 3300005437 Bacteria 8071
173 Ga0070710_10007104 3300005437 Bacteria 5410
174 Ga0070710_10055167 3300005437 Bacteria 2244
175 Ga0070701_10000008 3300005438 Bacteria 53317
176 Ga0070701_10052668 3300005438 Bacteria 2115
177 Ga0070711_100003385 3300005439 Bacteria 9292
178 Ga0070711_100003792 3300005439 Bacteria 8870
179 Ga0070711_100014489 3300005439 Bacteria 4968
180 Ga0070711_100057105 3300005439 Bacteria 2701
181 Ga0070711_100064004 3300005439 Bacteria 2568
182 Ga0070711_100124881 3300005439 Bacteria 1909
183 Ga0070711_100370606 3300005439 Bacteria 1155
184 Ga0070711_100393791 3300005439 Bacteria 1123
185 Ga0070705_100004263 3300005440 Bacteria 6978
186 Ga0070705_100011791 3300005440 Bacteria 4423
187 Ga0070705_100152983 3300005440 Bacteria 1533
188 Ga0070700_100000486 3300005441 Bacteria 19940
189 Ga0070700_100011018 3300005441 Bacteria 4999
190 Ga0070694_100000463 3300005444 Bacteria 22164
191 Ga0070694_100043032 3300005444 Bacteria 3018
192 Ga0070708_100081054 3300005445 Bacteria 2938
193 Ga0070708_100104863 3300005445 Bacteria 2593
194 Ga0070663_100001666 3300005455 Bacteria 12295
195 Ga0070663_100015711 3300005455 Bacteria 4896
196 Ga0070663_100016155 3300005455 Bacteria 4838
197 Ga0070663_100017648 3300005455 Bacteria 4662
198 Ga0070663_100019740 3300005455 Bacteria 4450
199 Ga0070663_100060975 3300005455 Bacteria 2715
200 Ga0070663_100154659 3300005455 Bacteria 1761
201 Ga0070663_100160062 3300005455 Bacteria 1732
202 Ga0070678_100004520 3300005456 Bacteria 7898
203 Ga0070678_100020799 3300005456 Bacteria 4312
204 Ga0070678_100060733 3300005456 Bacteria 2783
205 Ga0070678_100070102 3300005456 Bacteria 2619
206 Ga0070678_100075882 3300005456 Bacteria 2530
207 Ga0070678_100271041 3300005456 Bacteria 1431
208 Ga0070662_100004371 3300005457 Bacteria 8928
209 Ga0070662_100023743 3300005457 Bacteria 4216
210 Ga0070681_10002062 3300005458 Bacteria 18223
211 Ga0070681_10024430 3300005458 Bacteria 6084
212 Ga0070681_10071633 3300005458 Bacteria 3430
213 Ga0070681_10083693 3300005458 Bacteria 3143
214 Ga0070681_10095970 3300005458 Bacteria 2913
215 Ga0070681_10112319 3300005458 Bacteria 2664
216 Ga0070681_10273193 3300005458 Bacteria 1601
217 Ga0070681_10389132 3300005458 Bacteria 1305
218 Ga0068867_100000303 3300005459 Bacteria 32425
219 Ga0068867_100122572 3300005459 Bacteria 2010
220 Ga0070685_10001725 3300005466 Bacteria 11480
221 Ga0070685_10002009 3300005466 Bacteria 10543
222 Ga0070685_10024058 3300005466 Bacteria 3342
223 Ga0070707_100093433 3300005468 Bacteria 2912
224 Ga0070707_100205808 3300005468 Bacteria 1918
225 Ga0070699_100245023 3300005518 Bacteria 1601
226 Ga0070699_100452046 3300005518 Bacteria 1165
227 Ga0070679_100005343 3300005530 Bacteria 11885
228 Ga0070679_100018483 3300005530 Bacteria 6765
229 Ga0070679_100018688 3300005530 Bacteria 6728
230 Ga0070679_100070784 3300005530 Bacteria 3479
231 Ga0070679_100082355 3300005530 Bacteria 3207
232 Ga0070679_100131887 3300005530 Bacteria 2479
233 Ga0070679_100162199 3300005530 Bacteria 2209
234 Ga0070679_100244491 3300005530 Bacteria 1751
235 Ga0070679_100282919 3300005530 Bacteria 1611
236 Ga0070684_100001519 3300005535 Bacteria 16786
237 Ga0070684_100013695 3300005535 Bacteria 6545
238 Ga0070684_100086326 3300005535 Bacteria 2785
239 Ga0070684_100144268 3300005535 Bacteria 2155
240 Ga0070697_100049187 3300005536 Bacteria 3421
241 Ga0070697_100186163 3300005536 Bacteria 1761
242 Ga0070697_100263673 3300005536 Bacteria 1475
243 Ga0068853_100000726 3300005539 Bacteria 22782
244 Ga0068853_100006442 3300005539 Bacteria 9329
245 Ga0068853_100052672 3300005539 Bacteria 3505
246 Ga0068853_100154249 3300005539 Bacteria 2069
247 Ga0068853_100168699 3300005539 Bacteria 1979
248 Ga0068853_100207810 3300005539 Bacteria 1784
249 Ga0068853_100208738 3300005539 Bacteria 1780
250 Ga0068853_100296470 3300005539 Bacteria 1493
251 Ga0068853_100300794 3300005539 Bacteria 1483
252 Ga0068853_100325291 3300005539 Bacteria 1426
253 Ga0068853_100426290 3300005539 Bacteria 1245
254 Ga0070672_100000469 3300005543 Bacteria 23426
255 Ga0070686_100004236 3300005544 Bacteria 7898
256 Ga0070686_100004861 3300005544 Bacteria 7417
257 Ga0070686_100011541 3300005544 Bacteria 5013
258 Ga0070686_100231901 3300005544 Bacteria 1340
259 Ga0070695_100001715 3300005545 Bacteria 12340
260 Ga0070696_100005271 3300005546 Bacteria 8631
261 Ga0070696_100093641 3300005546 Bacteria 2143
262 Ga0070693_100000411 3300005547 Bacteria 19398
263 Ga0070693_100044496 3300005547 Bacteria 2512
264 Ga0070693_100127094 3300005547 Bacteria 1588
265 Ga0070693_100224103 3300005547 Bacteria 1234
266 Ga0070693_100291477 3300005547 Bacteria 1096
267 Ga0070665_100032806 3300005548 Bacteria 5225
268 Ga0070665_100046518 3300005548 Bacteria 4358
269 Ga0070665_100126173 3300005548 Bacteria 2561
270 Ga0070665_100195837 3300005548 Bacteria 2021
271 Ga0070665_100467261 3300005548 Bacteria 1272
272 Ga0070704_100001671 3300005549 Bacteria 12037
273 Ga0070704_100006946 3300005549 Bacteria 6712
274 Ga0068855_100036647 3300005563 Bacteria 5835
275 Ga0068855_100056640 3300005563 Bacteria 4598
276 Ga0068855_100186449 3300005563 Bacteria 2343
277 Ga0068855_100193509 3300005563 Bacteria 2292
278 Ga0068855_100235288 3300005563 Bacteria 2049
279 Ga0068855_100294758 3300005563 Bacteria 1797
280 Ga0068855_100454147 3300005563 Bacteria 1398
281 Ga0068855_100620915 3300005563 Bacteria 1164
282 Ga0068855_100708758 3300005563 Bacteria 1076
283 Ga0070664_100001745 3300005564 Bacteria 17407
284 Ga0070664_100036564 3300005564 Bacteria 4126
285 Ga0070664_100049496 3300005564 Bacteria 3554
286 Ga0070664_100072515 3300005564 Bacteria 2953
287 Ga0070664_100179042 3300005564 Bacteria 1884
288 Ga0068857_100000307 3300005577 Bacteria 33926
289 Ga0068857_100005001 3300005577 Bacteria 11266
290 Ga0068857_100022934 3300005577 Bacteria 5491
291 Ga0068857_100050370 3300005577 Bacteria 3695
292 Ga0068857_100122189 3300005577 Bacteria 2345
293 Ga0068857_100248563 3300005577 Bacteria 1630
294 Ga0068854_100000761 3300005578 Bacteria 19144
295 Ga0068854_100050668 3300005578 Bacteria 2972
296 Ga0068854_100178224 3300005578 Bacteria 1658
297 Ga0068854_100205471 3300005578 Bacteria 1551
298 Ga0068856_100003904 3300005614 Bacteria 14952
299 Ga0068856_100005232 3300005614 Bacteria 12806
300 Ga0068856_100029052 3300005614 Bacteria 5402
301 Ga0068856_100057074 3300005614 Bacteria 3854
302 Ga0068856_100066450 3300005614 Bacteria 3563
303 Ga0068856_100084807 3300005614 Bacteria 3147
304 Ga0068856_100107475 3300005614 Bacteria 2785
305 Ga0068856_100281254 3300005614 Bacteria 1681
306 Ga0070702_100001142 3300005615 Bacteria 10662
307 Ga0068852_100000151 3300005616 Bacteria 46414
308 Ga0068852_100003053 3300005616 Bacteria 11648
309 Ga0068852_100032124 3300005616 Bacteria 4342
310 Ga0068852_100087068 3300005616 Bacteria 2786
311 Ga0068852_100098557 3300005616 Bacteria 2632
312 Ga0068852_100110172 3300005616 Bacteria 2501
313 Ga0068852_100194562 3300005616 Bacteria 1915
314 Ga0068852_100230986 3300005616 Bacteria 1763
315 Ga0068859_100001785 3300005617 Bacteria 21901
316 Ga0068859_100099537 3300005617 Bacteria 2963
317 Ga0068859_100105197 3300005617 Bacteria 2881
318 Ga0068859_100226866 3300005617 Bacteria 1956
319 Ga0068859_100361921 3300005617 Bacteria 1546
320 Ga0068859_100570405 3300005617 Bacteria 1225
321 Ga0068859_100571070 3300005617 Bacteria 1225
322 Ga0068859_100606988 3300005617 Bacteria 1187
323 Ga0068859_100638570 3300005617 Bacteria 1157
324 Ga0068864_100019467 3300005618 Bacteria 5675
325 Ga0068864_100195466 3300005618 Bacteria 1856
326 Ga0068864_100287428 3300005618 Bacteria 1536
327 Ga0068866_10000049 3300005718 Bacteria 45908
328 Ga0068866_10089680 3300005718 Bacteria 1672
329 Ga0068866_10117765 3300005718 Bacteria 1492
330 Ga0068861_100000471 3300005719 Bacteria 23427
331 Ga0068861_100034571 3300005719 Bacteria 3738
332 Ga0068851_10009214 3300005834 Bacteria 4582
333 Ga0068851_10011049 3300005834 Bacteria 4227
334 Ga0068870_10001002 3300005840 Bacteria 11150
335 Ga0068863_100000418 3300005841 Bacteria 43162
336 Ga0068863_100021397 3300005841 Bacteria 6173
337 Ga0068863_100478125 3300005841 Bacteria 1225
338 Ga0068858_100002238 3300005842 Bacteria 19549
339 Ga0068858_100070830 3300005842 Bacteria 3232
340 Ga0068858_100077479 3300005842 Bacteria 3088
341 Ga0068858_100401761 3300005842 Bacteria 1317
342 Ga0068858_100412031 3300005842 Bacteria 1299
343 Ga0068860_100002578 3300005843 Bacteria 18969
344 Ga0068860_100004221 3300005843 Bacteria 14730
345 Ga0068860_100116754 3300005843 Bacteria 2553
346 Ga0068862_100001613 3300005844 Bacteria 20538
347 Ga0068862_100122807 3300005844 Bacteria 2290
348 Ga0068862_100330497 3300005844 Bacteria 1409
349 Ga0081455_10000002 3300005937 Bacteria 460472
350 Ga0081455_10004129 3300005937 Bacteria 16422
351 Ga0081455_10014333 3300005937 Bacteria 7777
352 Ga0081455_10019448 3300005937 Bacteria 6424
353 Ga0081455_10041411 3300005937 Bacteria 4051
354 Ga0081455_10046329 3300005937 Bacteria 3774
355 Ga0081455_10054015 3300005937 Bacteria 3428
356 Ga0081455_10114225 3300005937 Bacteria 2140
357 Ga0081455_10128852 3300005937 Bacteria 1981
358 Ga0081455_10266931 3300005937 Bacteria 1244
359 Ga0081540_1000166 3300005983 Bacteria 68242
360 Ga0081540_1003867 3300005983 Bacteria 11686
361 Ga0081540_1005753 3300005983 Bacteria 9184
362 Ga0081540_1006025 3300005983 Bacteria 8920
363 Ga0081540_1011590 3300005983 Bacteria 5885
364 Ga0081540_1012484 3300005983 Bacteria 5587
365 Ga0081540_1012727 3300005983 Bacteria 5515
366 Ga0081540_1048028 3300005983 Bacteria 2141
367 Ga0081540_1048404 3300005983 Bacteria 2129
368 Ga0081539_10000064 3300005985 Bacteria 247020
369 Ga0081539_10005111 3300005985 Bacteria 13729
370 Ga0081539_10014339 3300005985 Bacteria 5871
371 Ga0081539_10059891 3300005985 Bacteria 2093
372 Ga0081539_10107882 3300005985 Bacteria 1407
373 Ga0070717_10000598 3300006028 Bacteria 23163
374 Ga0070717_10039944 3300006028 Bacteria 3819
375 Ga0070717_10061554 3300006028 Bacteria 3111
376 Ga0070717_10113288 3300006028 Bacteria 2316
377 Ga0070717_10137166 3300006028 Bacteria 2108
378 Ga0070717_10263088 3300006028 Bacteria 1526
379 Ga0075365_10024282 3300006038 Bacteria 3821
380 Ga0075365_10069733 3300006038 Bacteria 2363
381 Ga0075365_10086378 3300006038 Bacteria 2132
382 Ga0075365_10159173 3300006038 Bacteria 1573
383 Ga0075365_10173023 3300006038 Bacteria 1508
384 Ga0075368_10007115 3300006042 Bacteria 3939
385 Ga0075368_10073785 3300006042 Bacteria 1381
386 Ga0075363_100025684 3300006048 Bacteria 3007
387 Ga0075363_100027004 3300006048 Bacteria 2941
388 Ga0075363_100029115 3300006048 Bacteria 2848
389 Ga0075363_100068851 3300006048 Bacteria 1920
390 Ga0075363_100166683 3300006048 Bacteria 1249
391 Ga0075363_100209128 3300006048 Bacteria 1116
392 Ga0075364_10050606 3300006051 Bacteria 2712
393 Ga0075364_10112291 3300006051 Bacteria 1819
394 Ga0075364_10171548 3300006051 Bacteria 1466
395 Ga0075432_10014522 3300006058 Bacteria 2683
396 Ga0070715_10001417 3300006163 Bacteria 6938
397 Ga0070715_10001906 3300006163 Bacteria 6267
398 Ga0070715_10030043 3300006163 Bacteria 2193
399 Ga0070715_10077074 3300006163 Bacteria 1504
400 Ga0070715_10104125 3300006163 Bacteria 1329
401 Ga0070716_100000922 3300006173 Bacteria 12727
402 Ga0070716_100001657 3300006173 Bacteria 10041
403 Ga0070716_100029244 3300006173 Bacteria 2977
404 Ga0070716_100040719 3300006173 Bacteria 2586
405 Ga0070716_100182258 3300006173 Bacteria 1380
406 Ga0070712_100005171 3300006175 Bacteria 8072
407 Ga0070712_100005584 3300006175 Bacteria 7779
408 Ga0070712_100024546 3300006175 Bacteria 3997
409 Ga0070712_100034950 3300006175 Bacteria 3409
410 Ga0070712_100035030 3300006175 Bacteria 3405
411 Ga0070712_100097287 3300006175 Bacteria 2169
412 Ga0070712_100102172 3300006175 Bacteria 2123
413 Ga0070712_100177019 3300006175 Bacteria 1659
414 Ga0075362_10022233 3300006177 Bacteria 2670
415 Ga0075362_10190409 3300006177 Bacteria 996
416 Ga0075367_10007084 3300006178 Bacteria 5717
417 Ga0075367_10027915 3300006178 Bacteria 3215
418 Ga0075367_10036073 3300006178 Bacteria 2865
419 Ga0075369_10049718 3300006186 Bacteria 1812
420 Ga0075369_10091566 3300006186 Bacteria 1357
421 Ga0075427_10000365 3300006194 Bacteria 5002
422 Ga0075366_10011732 3300006195 Bacteria 4953
423 Ga0075366_10077040 3300006195 Bacteria 1990
424 Ga0075366_10122166 3300006195 Bacteria 1569
425 Ga0075366_10146185 3300006195 Bacteria 1430
426 Ga0097621_100000012 3300006237 Bacteria 105108
427 Ga0097621_100014206 3300006237 Bacteria 5954
428 Ga0097621_100234116 3300006237 Bacteria 1604
429 Ga0097621_100594897 3300006237 Bacteria 1010
430 Ga0075370_10020566 3300006353 Bacteria 3610
431 Ga0075370_10056481 3300006353 Bacteria 2231
432 Ga0075370_10094314 3300006353 Bacteria 1728
433 Ga0068871_100000611 3300006358 Bacteria 24571
434 Ga0075428_100166474 3300006844 Bacteria 2391
435 Ga0075428_100311376 3300006844 Bacteria 1692
436 Ga0075430_100015106 3300006846 Bacteria 6572
437 Ga0075433_10060417 3300006852 Bacteria 3318
438 Ga0075433_10117947 3300006852 Unclassified 2355
439 Ga0075434_100000193 3300006871 Bacteria 40605
440 Ga0075434_100000647 3300006871 Bacteria 26943
441 Ga0075434_100008129 3300006871 Bacteria 9728
442 Ga0075434_100053188 3300006871 Bacteria 4024
443 Ga0075434_100081344 3300006871 Bacteria 3236
444 Ga0075434_100082007 3300006871 Bacteria 3222
445 Ga0075434_100800901 3300006871 Bacteria 958
446 Ga0075429_100000451 3300006880 Bacteria 30628
447 Ga0075429_100386651 3300006880 Bacteria 1225
448 Ga0068865_100001539 3300006881 Bacteria 13451
449 Ga0068865_100010595 3300006881 Bacteria 5745
450 Ga0068865_100025848 3300006881 Bacteria 3866
451 Ga0068865_100031167 3300006881 Bacteria 3554
452 Ga0075436_100344269 3300006914 Bacteria 1074
453 Ga0097620_100001785 3300006931 Bacteria 21901
454 Ga0097620_100099536 3300006931 Bacteria 2963
455 Ga0097620_100105196 3300006931 Bacteria 2881
456 Ga0097620_100226863 3300006931 Bacteria 1956
457 Ga0097620_100361953 3300006931 Bacteria 1546
458 Ga0097620_100570424 3300006931 Bacteria 1225
459 Ga0097620_100571033 3300006931 Bacteria 1225
460 Ga0097620_100606988 3300006931 Bacteria 1187
461 Ga0097620_100638572 3300006931 Bacteria 1157
462 Ga0099824_1014228 3300006942 Bacteria 7980
463 Ga0099824_1026035 3300006942 Bacteria 3088
464 Ga0099822_1000827 3300006943 Bacteria 32648
465 Ga0075435_100003880 3300007076 Bacteria 10208
466 Ga0075435_100014928 3300007076 Bacteria 5826
467 Ga0099794_10006977 3300007265 Bacteria 4607
468 Ga0099795_10008993 3300007788 Bacteria 2879
469 Ga0105251_10048371 3300009011 Bacteria 2038
470 Ga0105250_10007496 3300009092 Bacteria 4683
471 Ga0105240_10003692 3300009093 Bacteria 23676
472 Ga0105240_10008228 3300009093 Bacteria 14944
473 Ga0105240_10025163 3300009093 Bacteria 7828
474 Ga0105240_10034925 3300009093 Bacteria 6482
475 Ga0105240_10043110 3300009093 Bacteria 5744
476 Ga0105240_10119042 3300009093 Bacteria 3182
477 Ga0105240_10334999 3300009093 Bacteria 1720
478 Ga0105240_10363048 3300009093 Bacteria 1640
479 Ga0105240_10377529 3300009093 Bacteria 1601
480 Ga0111539_10000679 3300009094 Bacteria 44034
481 Ga0111539_10000925 3300009094 Bacteria 38387
482 Ga0111539_10002056 3300009094 Bacteria 26910
483 Ga0111539_10192542 3300009094 Bacteria 2379
484 Ga0111539_10324879 3300009094 Bacteria 1791
485 Ga0111539_10515586 3300009094 Bacteria 1393
486 Ga0105245_10000090 3300009098 Bacteria 90378
487 Ga0105245_10089730 3300009098 Bacteria 2826
488 Ga0105245_10217136 3300009098 Bacteria 1843
489 Ga0105247_10001092 3300009101 Bacteria 20219
490 Ga0105247_10020697 3300009101 Bacteria 3954
491 Ga0105247_10024972 3300009101 Bacteria 3604
492 Ga0105247_10034333 3300009101 Bacteria 3089
493 Ga0105247_10152469 3300009101 Bacteria 1524
494 Ga0105247_10155419 3300009101 Bacteria 1510
495 Ga0114129_10006700 3300009147 Bacteria 16356
496 Ga0114129_10443248 3300009147 Bacteria 1704
497 Ga0105243_10002557 3300009148 Bacteria 15205
498 Ga0105243_10006084 3300009148 Bacteria 9330
499 Ga0105243_10006975 3300009148 Bacteria 8699
500 Ga0105243_10029257 3300009148 Bacteria 4236
501 Ga0105243_10077202 3300009148 Bacteria 2708
502 Ga0105241_10000053 3300009174 Bacteria 94578
503 Ga0105241_10090424 3300009174 Bacteria 2414
504 Ga0105241_10124355 3300009174 Bacteria 2081
505 Ga0105241_10132389 3300009174 Bacteria 2021
506 Ga0105241_10342329 3300009174 Bacteria 1296
507 Ga0105241_10677332 3300009174 Bacteria 939
508 Ga0105242_10000491 3300009176 Bacteria 31233
509 Ga0105242_10049041 3300009176 Bacteria 3434
510 Ga0105242_10245208 3300009176 Bacteria 1612
511 Ga0105248_10000964 3300009177 Bacteria 32048
512 Ga0105248_10003797 3300009177 Bacteria 16742
513 Ga0105248_10038276 3300009177 Bacteria 5368
514 Ga0105248_10153982 3300009177 Bacteria 2594
515 Ga0105248_10236684 3300009177 Bacteria 2055
516 Ga0105248_10281257 3300009177 Bacteria 1873
517 Ga0105248_10312566 3300009177 Bacteria 1770
518 Ga0105237_10008862 3300009545 Bacteria 10847
519 Ga0105237_10015141 3300009545 Bacteria 8036
520 Ga0105237_10027862 3300009545 Bacteria 5757
521 Ga0105237_10080675 3300009545 Bacteria 3244
522 Ga0105237_10080987 3300009545 Bacteria 3237
523 Ga0105237_10218579 3300009545 Bacteria 1906
524 Ga0105237_10223905 3300009545 Bacteria 1881
525 Ga0105238_10005518 3300009551 Bacteria 12492
526 Ga0105238_10008791 3300009551 Bacteria 10106
527 Ga0105238_10013990 3300009551 Bacteria 8115
528 Ga0105238_10034755 3300009551 Bacteria 5127
529 Ga0105238_10052809 3300009551 Bacteria 4085
530 Ga0105238_10097925 3300009551 Bacteria 2918
531 Ga0105238_10270541 3300009551 Bacteria 1680
532 Ga0105238_10287553 3300009551 Bacteria 1626
533 Ga0105238_10299735 3300009551 Bacteria 1591
534 Ga0105238_10321084 3300009551 Bacteria 1534
535 Ga0105238_10364014 3300009551 Bacteria 1436
536 Ga0105238_10461643 3300009551 Bacteria 1268
537 Ga0105238_10874522 3300009551 Bacteria 916
538 Ga0105249_10001085 3300009553 Bacteria 24172
539 Ga0105249_10106323 3300009553 Bacteria 2647
540 Ga0105249_10115854 3300009553 Bacteria 2540
541 Ga0105249_10247337 3300009553 Bacteria 1766
542 Ga0105249_10407766 3300009553 Bacteria 1391
543 Ga0099796_10016347 3300010159 Bacteria 2189
544 Ga0099796_10030093 3300010159 Bacteria 1758
545 Ga0105239_10002519 3300010375 Bacteria 23275
546 Ga0105239_10009940 3300010375 Bacteria 10682
547 Ga0105239_10012065 3300010375 Bacteria 9637
548 Ga0105239_10014833 3300010375 Bacteria 8642
549 Ga0105239_10053131 3300010375 Bacteria 4445
550 Ga0105239_10071090 3300010375 Bacteria 3823
551 Ga0105239_10093727 3300010375 Bacteria 3316
552 Ga0105239_10095287 3300010375 Bacteria 3288
553 Ga0105239_10124206 3300010375 Bacteria 2868
554 Ga0105239_10128073 3300010375 Bacteria 2822
555 Ga0105239_10232870 3300010375 Bacteria 2067
556 Ga0105239_10271752 3300010375 Bacteria 1907
557 Ga0105239_10313409 3300010375 Bacteria 1768
558 Ga0105239_10641834 3300010375 Bacteria 1212
559 Ga0105246_10000052 3300011119 Bacteria 46290
560 Ga0105246_10005044 3300011119 Bacteria 8027
561 Ga0105246_10043290 3300011119 Bacteria 3054
562 Ga0105246_10070799 3300011119 Bacteria 2454
563 Ga0105246_10148363 3300011119 Bacteria 1772
564 Ga0105246_10243181 3300011119 Bacteria 1424
565 Ga0157335_1001428 3300012492 Bacteria 1312
566 Ga0157341_1001939 3300012494 Bacteria 1310
567 Ga0157339_1000852 3300012505 Bacteria 1696
568 Ga0157373_10021395 3300013100 Bacteria 4699
569 Ga0157373_10138414 3300013100 Bacteria 1712
570 Ga0157373_10196245 3300013100 Bacteria 1423
571 Ga0157371_10003401 3300013102 Bacteria 14457
572 Ga0157371_10037614 3300013102 Bacteria 3463
573 Ga0157371_10241669 3300013102 Bacteria 1299
574 Ga0157371_10318295 3300013102 Bacteria 1129
575 Ga0157370_10023260 3300013104 Bacteria 6153
576 Ga0157370_10087018 3300013104 Bacteria 2935
577 Ga0157370_10089444 3300013104 Bacteria 2892
578 Ga0157370_10142585 3300013104 Bacteria 2232
579 Ga0157370_10327402 3300013104 Bacteria 1413
580 Ga0157370_10629700 3300013104 Bacteria 981
581 Ga0157369_10001511 3300013105 Bacteria 28540
582 Ga0157369_10159158 3300013105 Bacteria 2384
583 Ga0157369_10255370 3300013105 Bacteria 1829
584 Ga0157369_10417724 3300013105 Bacteria 1391
585 Ga0157369_10453675 3300013105 Bacteria 1328
586 Ga0157374_10001210 3300013296 Bacteria 22071
587 Ga0157374_10055607 3300013296 Bacteria 3694
588 Ga0157374_10064601 3300013296 Bacteria 3435
589 Ga0157374_10177581 3300013296 Bacteria 2079
590 Ga0157378_10002713 3300013297 Bacteria 15762
591 Ga0157378_10078751 3300013297 Bacteria 2974
592 Ga0157378_10201436 3300013297 Bacteria 1883
593 Ga0163162_10000308 3300013306 Bacteria 45253
594 Ga0163162_10041674 3300013306 Bacteria 4594
595 Ga0163162_10073674 3300013306 Bacteria 3471
596 Ga0163162_10079821 3300013306 Bacteria 3338
597 Ga0163162_10116570 3300013306 Bacteria 2772
598 Ga0163162_10321040 3300013306 Bacteria 1681
599 Ga0163162_10522399 3300013306 Bacteria 1317
600 Ga0163162_10558197 3300013306 Bacteria 1273
601 Ga0157372_10002370 3300013307 Bacteria 20397
602 Ga0157372_10040215 3300013307 Bacteria 5163
603 Ga0157372_10283795 3300013307 Bacteria 1925
604 Ga0157372_10609627 3300013307 Bacteria 1272
605 Ga0157375_10000414 3300013308 Bacteria 38778
606 Ga0157375_10039319 3300013308 Bacteria 4552
607 Ga0157375_10176028 3300013308 Bacteria 2289
608 Ga0157375_10225179 3300013308 Bacteria 2034
609 Ga0157375_10249642 3300013308 Bacteria 1935
610 Ga0157375_10487912 3300013308 Bacteria 1397
611 Ga0157375_10641958 3300013308 Bacteria 1218
612 Ga0163163_10002008 3300014325 Bacteria 17189
613 Ga0163163_10016496 3300014325 Bacteria 6868
614 Ga0163163_10022724 3300014325 Bacteria 5943
615 Ga0163163_10077402 3300014325 Bacteria 3321
616 Ga0163163_10120586 3300014325 Bacteria 2656
617 Ga0163163_10151049 3300014325 Bacteria 2366
618 Ga0163163_10158656 3300014325 Bacteria 2307
619 Ga0163163_10369133 3300014325 Bacteria 1492
620 Ga0163163_10448537 3300014325 Bacteria 1350
621 Ga0157380_10000122 3300014326 Bacteria 43303
622 Ga0157380_10495451 3300014326 Bacteria 1185
623 Ga0157377_10000688 3300014745 Bacteria 13982
624 Ga0157379_10000261 3300014968 Bacteria 41455
625 Ga0157379_10098068 3300014968 Bacteria 2631
626 Ga0157379_10309900 3300014968 Bacteria 1440
627 Ga0157376_10002538 3300014969 Bacteria 12376
628 Ga0157376_10053954 3300014969 Bacteria 3349
629 Ga0157376_10202573 3300014969 Bacteria 1827
630 Ga0163161_10000199 3300017792 Bacteria 55004
631 Ga0214544_1000016 3300021320 Bacteria 204278
632 Ga0214542_1000016 3300021321 Bacteria 210332
633 Ga0214545_1000008 3300021324 Bacteria 215190
634 Ga0214543_1001466 3300021327 Bacteria 45567
635 Ga0213873_10009795 3300021358 Bacteria 2001
636 Ga0213872_10028176 3300021361 Bacteria 2577
637 Ga0213872_10047754 3300021361 Bacteria 1946
638 Ga0213874_10006393 3300021377 Bacteria 2789
639 Ga0213876_10003239 3300021384 Bacteria 9341
640 Ga0213876_10112222 3300021384 Bacteria 1447
641 Ga0209563_105374 3300025230 Bacteria 2333
642 Ga0207425_1005837 3300025245 Bacteria 3448
643 Ga0209026_1009167 3300025250 Bacteria 1973
644 Ga0209677_100672 3300025253 Bacteria 17650
645 Ga0209677_104189 3300025253 Bacteria 4281
646 Ga0209148_1000282 3300025254 Bacteria 78016
647 Ga0209148_1007881 3300025254 Bacteria 2176
648 Ga0209233_1004421 3300025261 Bacteria 4784
649 Ga0209233_1010542 3300025261 Bacteria 2764
650 Ga0209233_1012168 3300025261 Bacteria 2504
651 Ga0207666_1000049 3300025271 Bacteria 23286
652 Ga0207666_1000597 3300025271 Bacteria 4335
653 Ga0209455_1001040 3300025272 Bacteria 13815
654 Ga0209455_1002709 3300025272 Bacteria 6657
655 Ga0209455_1008795 3300025272 Bacteria 2708
656 Ga0209673_1012007 3300025273 Bacteria 3524
657 Ga0209130_1000045 3300025284 Bacteria 240278
658 Ga0207673_1000439 3300025290 Bacteria 4308
659 Ga0209564_1000321 3300025295 Bacteria 93331
660 Ga0209564_1005785 3300025295 Bacteria 6902
661 Ga0209564_1006440 3300025295 Bacteria 6329
662 Ga0209564_1009846 3300025295 Bacteria 4485
663 Ga0209758_1000069 3300025297 Bacteria 286161
664 Ga0209758_1000635 3300025297 Bacteria 53736
665 Ga0209758_1000686 3300025297 Bacteria 50478
666 Ga0209758_1002443 3300025297 Bacteria 18966
667 Ga0209758_1005237 3300025297 Bacteria 10159
668 Ga0209758_1005561 3300025297 Bacteria 9602
669 Ga0209758_1008699 3300025297 Bacteria 6495
670 Ga0209758_1010679 3300025297 Bacteria 5453
671 Ga0209758_1030622 3300025297 Bacteria 2225
672 Ga0209256_1033836 3300025299 Bacteria 1369
673 Ga0207426_1000826 3300025302 Bacteria 33158
674 Ga0207426_1002082 3300025302 Bacteria 13833
675 Ga0207426_1018863 3300025302 Bacteria 2422
676 Ga0207426_1019837 3300025302 Bacteria 2345
677 Ga0207426_1047523 3300025302 Bacteria 1294
678 Ga0209257_1000473 3300025304 Bacteria 73323
679 Ga0209257_1018878 3300025304 Bacteria 2627
680 Ga0207697_10000335 3300025315 Bacteria 26204
681 Ga0207697_10025453 3300025315 Bacteria 2418
682 Ga0207656_10016962 3300025321 Bacteria 2845
683 Ga0207656_10038990 3300025321 Bacteria 2007
684 Ga0207656_10106192 3300025321 Bacteria 1293
685 Ga0207682_10000042 3300025893 Bacteria 52333
686 Ga0207682_10092512 3300025893 Bacteria 1313
687 Ga0207692_10016486 3300025898 Bacteria 3274
688 Ga0207692_10019032 3300025898 Bacteria 3095
689 Ga0207692_10020310 3300025898 Bacteria 3018
690 Ga0207692_10041703 3300025898 Bacteria 2274
691 Ga0207692_10235900 3300025898 Bacteria 1090
692 Ga0207642_10000065 3300025899 Bacteria 29318
693 Ga0207642_10087754 3300025899 Bacteria 1528
694 Ga0207642_10160839 3300025899 Bacteria 1205
695 Ga0207710_10000734 3300025900 Bacteria 18097
696 Ga0207710_10019877 3300025900 Bacteria 2867
697 Ga0207710_10022757 3300025900 Bacteria 2690
698 Ga0207710_10053801 3300025900 Bacteria 1812
699 Ga0207688_10000053 3300025901 Bacteria 41441
700 Ga0207688_10006140 3300025901 Bacteria 6539
701 Ga0207680_10044067 3300025903 Bacteria 2621
702 Ga0207680_10152265 3300025903 Bacteria 1543
703 Ga0207680_10242520 3300025903 Unclassified 1242
704 Ga0207647_10001150 3300025904 Bacteria 20374
705 Ga0207647_10002277 3300025904 Bacteria 14628
706 Ga0207647_10002930 3300025904 Bacteria 12849
707 Ga0207647_10057180 3300025904 Bacteria 2392
708 Ga0207647_10072916 3300025904 Bacteria 2070
709 Ga0207685_10012934 3300025905 Bacteria 2565
710 Ga0207685_10013733 3300025905 Bacteria 2514
711 Ga0207685_10042206 3300025905 Bacteria 1711
712 Ga0207685_10180580 3300025905 Bacteria 978
713 Ga0207699_10002977 3300025906 Bacteria 8054
714 Ga0207699_10003057 3300025906 Bacteria 7943
715 Ga0207699_10003164 3300025906 Bacteria 7824
716 Ga0207699_10044378 3300025906 Bacteria 2587
717 Ga0207699_10079993 3300025906 Bacteria 2024
718 Ga0207699_10146192 3300025906 Bacteria 1559
719 Ga0207645_10000090 3300025907 Bacteria 65569
720 Ga0207645_10011508 3300025907 Bacteria 6037
721 Ga0207645_10096477 3300025907 Bacteria 1905
722 Ga0207645_10166633 3300025907 Bacteria 1443
723 Ga0207645_10214065 3300025907 Bacteria 1270
724 Ga0207645_10216934 3300025907 Bacteria 1261
725 Ga0207643_10000082 3300025908 Bacteria 62322
726 Ga0207705_10018481 3300025909 Bacteria 4986
727 Ga0207705_10025377 3300025909 Bacteria 4231
728 Ga0207705_10131695 3300025909 Bacteria 1861
729 Ga0207654_10000058 3300025911 Bacteria 75628
730 Ga0207654_10004743 3300025911 Bacteria 6884
731 Ga0207654_10024310 3300025911 Bacteria 3255
732 Ga0207654_10247453 3300025911 Bacteria 1194
733 Ga0207654_10361339 3300025911 Bacteria 1002
734 Ga0207707_10000100 3300025912 Bacteria 85682
735 Ga0207707_10007842 3300025912 Bacteria 9283
736 Ga0207707_10020346 3300025912 Bacteria 5794
737 Ga0207707_10056938 3300025912 Bacteria 3402
738 Ga0207707_10170877 3300025912 Bacteria 1900
739 Ga0207707_10389487 3300025912 Bacteria 1197
740 Ga0207695_10000107 3300025913 Bacteria 252606
741 Ga0207695_10000453 3300025913 Bacteria 89314
742 Ga0207695_10070809 3300025913 Bacteria 3563
743 Ga0207695_10137509 3300025913 Bacteria 2395
744 Ga0207695_10196781 3300025913 Bacteria 1931
745 Ga0207695_10567094 3300025913 Bacteria 1017
746 Ga0207671_10006934 3300025914 Bacteria 9976
747 Ga0207671_10022867 3300025914 Bacteria 4720
748 Ga0207671_10039004 3300025914 Bacteria 3519
749 Ga0207671_10070331 3300025914 Bacteria 2609
750 Ga0207671_10075442 3300025914 Bacteria 2522
751 Ga0207671_10106543 3300025914 Bacteria 2128
752 Ga0207693_10000310 3300025915 Bacteria 45408
753 Ga0207693_10002221 3300025915 Bacteria 16903
754 Ga0207693_10002937 3300025915 Bacteria 14752
755 Ga0207693_10013676 3300025915 Bacteria 6537
756 Ga0207693_10016511 3300025915 Bacteria 5899
757 Ga0207693_10028589 3300025915 Bacteria 4406
758 Ga0207693_10045294 3300025915 Bacteria 3456
759 Ga0207693_10092818 3300025915 Bacteria 2366
760 Ga0207693_10309987 3300025915 Bacteria 1236
761 Ga0207663_10032061 3300025916 Bacteria 3116
762 Ga0207663_10033325 3300025916 Bacteria 3068
763 Ga0207663_10038220 3300025916 Bacteria 2900
764 Ga0207663_10063141 3300025916 Bacteria 2357
765 Ga0207663_10127397 3300025916 Bacteria 1753
766 Ga0207663_10166201 3300025916 Bacteria 1563
767 Ga0207663_10333825 3300025916 Bacteria 1143
768 Ga0207660_10000083 3300025917 Bacteria 50279
769 Ga0207660_10018837 3300025917 Bacteria 4608
770 Ga0207660_10023642 3300025917 Bacteria 4153
771 Ga0207660_10048720 3300025917 Bacteria 3000
772 Ga0207660_10052872 3300025917 Bacteria 2893
773 Ga0207660_10077983 3300025917 Bacteria 2427
774 Ga0207660_10080400 3300025917 Bacteria 2393
775 Ga0207660_10552665 3300025917 Bacteria 936
776 Ga0207662_10007146 3300025918 Bacteria 6072
777 Ga0207662_10017526 3300025918 Bacteria 4053
778 Ga0207662_10210360 3300025918 Bacteria 1262
779 Ga0207657_10001336 3300025919 Bacteria 26204
780 Ga0207657_10001686 3300025919 Bacteria 23826
781 Ga0207657_10014898 3300025919 Bacteria 7564
782 Ga0207657_10022984 3300025919 Bacteria 5817
783 Ga0207657_10057036 3300025919 Bacteria 3368
784 Ga0207657_10060102 3300025919 Bacteria 3262
785 Ga0207657_10175078 3300025919 Bacteria 1737
786 Ga0207649_10000643 3300025920 Bacteria 23321
787 Ga0207649_10036240 3300025920 Bacteria 2970
788 Ga0207649_10119077 3300025920 Bacteria 1777
789 Ga0207649_10194096 3300025920 Bacteria 1430
790 Ga0207652_10000557 3300025921 Bacteria 37611
791 Ga0207652_10026633 3300025921 Bacteria 4818
792 Ga0207652_10030893 3300025921 Bacteria 4492
793 Ga0207652_10040001 3300025921 Bacteria 3981
794 Ga0207652_10134241 3300025921 Bacteria 2209
795 Ga0207652_10189872 3300025921 Bacteria 1848
796 Ga0207652_10201882 3300025921 Bacteria 1789
797 Ga0207652_10493677 3300025921 Bacteria 1102
798 Ga0207646_10095001 3300025922 Bacteria 2670
799 Ga0207681_10000271 3300025923 Bacteria 38955
800 Ga0207681_10227791 3300025923 Bacteria 1445
801 Ga0207694_10001009 3300025924 Bacteria 24556
802 Ga0207694_10007667 3300025924 Bacteria 8175
803 Ga0207694_10038148 3300025924 Bacteria 3693
804 Ga0207694_10053306 3300025924 Bacteria 3136
805 Ga0207694_10094099 3300025924 Bacteria 2367
806 Ga0207694_10118044 3300025924 Bacteria 2116
807 Ga0207650_10032088 3300025925 Bacteria 3799
808 Ga0207650_10136231 3300025925 Bacteria 1926
809 Ga0207659_10000161 3300025926 Bacteria 39821
810 Ga0207659_10000460 3300025926 Bacteria 24451
811 Ga0207659_10144234 3300025926 Bacteria 1852
812 Ga0207687_10000063 3300025927 Bacteria 83105
813 Ga0207687_10012464 3300025927 Bacteria 5554
814 Ga0207687_10076079 3300025927 Bacteria 2410
815 Ga0207700_10001418 3300025928 Bacteria 13613
816 Ga0207700_10004421 3300025928 Bacteria 8285
817 Ga0207700_10010167 3300025928 Bacteria 5920
818 Ga0207700_10026056 3300025928 Bacteria 4072
819 Ga0207700_10030214 3300025928 Bacteria 3834
820 Ga0207700_10067717 3300025928 Bacteria 2734
821 Ga0207700_10076096 3300025928 Bacteria 2603
822 Ga0207700_10114116 3300025928 Bacteria 2179
823 Ga0207700_10119721 3300025928 Bacteria 2133
824 Ga0207700_10125666 3300025928 Bacteria 2086
825 Ga0207700_10327804 3300025928 Bacteria 1328
826 Ga0207664_10004485 3300025929 Bacteria 9460
827 Ga0207664_10019693 3300025929 Bacteria 4993
828 Ga0207664_10036266 3300025929 Bacteria 3811
829 Ga0207664_10048578 3300025929 Bacteria 3338
830 Ga0207664_10081559 3300025929 Bacteria 2632
831 Ga0207664_10180253 3300025929 Bacteria 1813
832 Ga0207664_10189317 3300025929 Bacteria 1770
833 Ga0207664_10500655 3300025929 Bacteria 1088
834 Ga0207644_10000591 3300025931 Bacteria 23144
835 Ga0207644_10011436 3300025931 Bacteria 5872
836 Ga0207644_10059212 3300025931 Bacteria 2770
837 Ga0207644_10060210 3300025931 Bacteria 2747
838 Ga0207644_10332617 3300025931 Bacteria 1230
839 Ga0207644_10554725 3300025931 Bacteria 951
840 Ga0207690_10000897 3300025932 Bacteria 19010
841 Ga0207690_10106097 3300025932 Bacteria 2015
842 Ga0207690_10132246 3300025932 Bacteria 1828
843 Ga0207690_10226025 3300025932 Bacteria 1434
844 Ga0207690_10264463 3300025932 Bacteria 1334
845 Ga0207690_10475570 3300025932 Bacteria 1008
846 Ga0207706_10001197 3300025933 Bacteria 26204
847 Ga0207706_10030254 3300025933 Bacteria 4831
848 Ga0207706_10039210 3300025933 Bacteria 4199
849 Ga0207706_10087334 3300025933 Bacteria 2742
850 Ga0207686_10000614 3300025934 Bacteria 22208
851 Ga0207686_10024638 3300025934 Bacteria 3489
852 Ga0207709_10000429 3300025935 Bacteria 40094
853 Ga0207709_10076079 3300025935 Bacteria 2148
854 Ga0207709_10238566 3300025935 Bacteria 1321
855 Ga0207670_10000485 3300025936 Bacteria 21952
856 Ga0207670_10006650 3300025936 Bacteria 6428
857 Ga0207670_10051762 3300025936 Bacteria 2759
858 Ga0207670_10091818 3300025936 Bacteria 2148
859 Ga0207670_10251871 3300025936 Bacteria 1365
860 Ga0207669_10000019 3300025937 Bacteria 111630
861 Ga0207669_10170314 3300025937 Bacteria 1549
862 Ga0207669_10317964 3300025937 Bacteria 1190
863 Ga0207704_10000552 3300025938 Bacteria 16651
864 Ga0207704_10123590 3300025938 Bacteria 1777
865 Ga0207665_10001734 3300025939 Bacteria 14668
866 Ga0207665_10006611 3300025939 Bacteria 7690
867 Ga0207665_10009684 3300025939 Bacteria 6325
868 Ga0207665_10118027 3300025939 Bacteria 1871
869 Ga0207665_10125262 3300025939 Bacteria 1819
870 Ga0207665_10127756 3300025939 Bacteria 1801
871 Ga0207691_10000987 3300025940 Bacteria 28275
872 Ga0207691_10040766 3300025940 Bacteria 4289
873 Ga0207691_10086631 3300025940 Bacteria 2810
874 Ga0207711_10011159 3300025941 Bacteria 7467
875 Ga0207711_10012997 3300025941 Bacteria 6916
876 Ga0207711_10071484 3300025941 Bacteria 3010
877 Ga0207711_10106207 3300025941 Bacteria 2491
878 Ga0207711_10192391 3300025941 Bacteria 1860
879 Ga0207711_10327793 3300025941 Bacteria 1416
880 Ga0207689_10000916 3300025942 Bacteria 28296
881 Ga0207689_10134681 3300025942 Unclassified 2034
882 Ga0207689_10159295 3300025942 Bacteria 1860
883 Ga0207689_10178399 3300025942 Bacteria 1752
884 Ga0207689_10283303 3300025942 Bacteria 1372
885 Ga0207661_10000281 3300025944 Bacteria 32639
886 Ga0207661_10063954 3300025944 Bacteria 2981
887 Ga0207661_10193687 3300025944 Bacteria 1783
888 Ga0207661_10383665 3300025944 Bacteria 1272
889 Ga0207679_10000026 3300025945 Bacteria 200073
890 Ga0207679_10090266 3300025945 Bacteria 2368
891 Ga0207679_10097234 3300025945 Bacteria 2293
892 Ga0207679_10269529 3300025945 Bacteria 1455
893 Ga0207667_10002324 3300025949 Bacteria 23814
894 Ga0207667_10004064 3300025949 Bacteria 17974
895 Ga0207667_10015224 3300025949 Bacteria 8745
896 Ga0207667_10022622 3300025949 Bacteria 6937
897 Ga0207667_10141261 3300025949 Bacteria 2479
898 Ga0207667_10240035 3300025949 Bacteria 1855
899 Ga0207667_10270516 3300025949 Bacteria 1737
900 Ga0207667_10607740 3300025949 Bacteria 1102
901 Ga0207651_10000101 3300025960 Bacteria 37898
902 Ga0207712_10000908 3300025961 Bacteria 21454
903 Ga0207712_10218803 3300025961 Bacteria 1521
904 Ga0207712_10239725 3300025961 Bacteria 1460
905 Ga0207668_10000726 3300025972 Bacteria 20155
906 Ga0207668_10054744 3300025972 Bacteria 2770
907 Ga0207668_10159236 3300025972 Bacteria 1757
908 Ga0207668_10224893 3300025972 Bacteria 1509
909 Ga0207668_10349247 3300025972 Bacteria 1236
910 Ga0207640_10000596 3300025981 Bacteria 21479
911 Ga0207640_10064044 3300025981 Bacteria 2446
912 Ga0207640_10129721 3300025981 Bacteria 1821
913 Ga0207640_10247627 3300025981 Bacteria 1381
914 Ga0207640_10314960 3300025981 Bacteria 1243
915 Ga0207658_10003725 3300025986 Bacteria 10734
916 Ga0207658_10118433 3300025986 Bacteria 2107
917 Ga0207677_10000651 3300026023 Bacteria 20869
918 Ga0207677_10079428 3300026023 Bacteria 2346
919 Ga0207677_10113338 3300026023 Bacteria 2024
920 Ga0207677_10250420 3300026023 Bacteria 1438
921 Ga0207677_10317108 3300026023 Bacteria 1294
922 Ga0207677_10450597 3300026023 Bacteria 1103
923 Ga0207703_10001717 3300026035 Bacteria 19677
924 Ga0207703_10028705 3300026035 Bacteria 4389
925 Ga0207703_10099895 3300026035 Bacteria 2457
926 Ga0207703_10108324 3300026035 Bacteria 2366
927 Ga0207703_10212977 3300026035 Bacteria 1724
928 Ga0207703_10268259 3300026035 Bacteria 1545
929 Ga0207639_10002317 3300026041 Bacteria 12780
930 Ga0207639_10008158 3300026041 Bacteria 7162
931 Ga0207639_10031138 3300026041 Bacteria 3918
932 Ga0207639_10147371 3300026041 Bacteria 1968
933 Ga0207639_10200353 3300026041 Bacteria 1712
934 Ga0207639_10418887 3300026041 Bacteria 1210
935 Ga0207678_10000831 3300026067 Bacteria 28276
936 Ga0207678_10004832 3300026067 Bacteria 12098
937 Ga0207678_10005663 3300026067 Bacteria 11166
938 Ga0207678_10031777 3300026067 Bacteria 4603
939 Ga0207678_10039914 3300026067 Bacteria 4072
940 Ga0207678_10045970 3300026067 Bacteria 3775
941 Ga0207678_10053719 3300026067 Bacteria 3471
942 Ga0207708_10002086 3300026075 Bacteria 14711
943 Ga0207708_10007188 3300026075 Bacteria 8232
944 Ga0207708_10021696 3300026075 Bacteria 4845
945 Ga0207708_10188098 3300026075 Bacteria 1642
946 Ga0207708_10198676 3300026075 Bacteria 1599
947 Ga0207702_10000004 3300026078 Bacteria 422182
948 Ga0207702_10001701 3300026078 Bacteria 21732
949 Ga0207702_10005168 3300026078 Bacteria 11483
950 Ga0207702_10082698 3300026078 Bacteria 2792
951 Ga0207702_10149669 3300026078 Bacteria 2122
952 Ga0207702_10152046 3300026078 Bacteria 2106
953 Ga0207702_10154503 3300026078 Bacteria 2090
954 Ga0207702_10217083 3300026078 Bacteria 1781
955 Ga0207702_10222725 3300026078 Bacteria 1758
956 Ga0207702_10279826 3300026078 Bacteria 1577
957 Ga0207702_10485388 3300026078 Bacteria 1203
958 Ga0207641_10002162 3300026088 Bacteria 18511
959 Ga0207641_10853150 3300026088 Bacteria 903
960 Ga0207648_10001440 3300026089 Bacteria 26204
961 Ga0207648_10027306 3300026089 Bacteria 5069
962 Ga0207648_10047658 3300026089 Bacteria 3755
963 Ga0207648_10122872 3300026089 Bacteria 2283
964 Ga0207676_10000563 3300026095 Bacteria 30791
965 Ga0207676_10026824 3300026095 Bacteria 4285
966 Ga0207676_10179576 3300026095 Bacteria 1852
967 Ga0207674_10000890 3300026116 Bacteria 39065
968 Ga0207674_10001207 3300026116 Bacteria 33673
969 Ga0207674_10002298 3300026116 Bacteria 24210
970 Ga0207674_10046110 3300026116 Bacteria 4478
971 Ga0207674_10050784 3300026116 Bacteria 4235
972 Ga0207674_10060579 3300026116 Bacteria 3827
973 Ga0207674_10074016 3300026116 Bacteria 3419
974 Ga0207675_100000983 3300026118 Bacteria 28277
975 Ga0207675_100034844 3300026118 Bacteria 4695
976 Ga0207675_100101390 3300026118 Bacteria 2712
977 Ga0207683_10000324 3300026121 Bacteria 43461
978 Ga0207683_10001459 3300026121 Bacteria 21325
979 Ga0207683_10037437 3300026121 Bacteria 4224
980 Ga0207683_10037847 3300026121 Bacteria 4203
981 Ga0207683_10063219 3300026121 Bacteria 3261
982 Ga0207683_10089829 3300026121 Bacteria 2735
983 Ga0207683_10358358 3300026121 Bacteria 1339
984 Ga0207683_10368755 3300026121 Bacteria 1319
985 Ga0207698_10000634 3300026142 Bacteria 20408
986 Ga0207698_10037553 3300026142 Bacteria 3569
987 Ga0207698_10066209 3300026142 Bacteria 2843
988 Ga0207698_10081718 3300026142 Bacteria 2609
989 Ga0207698_10129747 3300026142 Bacteria 2152
990 Ga0207698_10222866 3300026142 Bacteria 1706
991 Ga0207698_10261757 3300026142 Bacteria 1589
992 Ga0207698_10303068 3300026142 Bacteria 1488
993 Ga0209389_1000033 3300027296 Bacteria 131516
994 Ga0209389_1000182 3300027296 Bacteria 48705
995 Ga0209589_1000021 3300027357 Bacteria 186431
996 Ga0209589_1000040 3300027357 Bacteria 126550
997 Ga0209489_100028 3300027361 Bacteria 186431
998 Ga0209489_100045 3300027361 Bacteria 158225
999 Ga0209489_100209 3300027361 Bacteria 96349
1000 Ga0209700_100011 3300027363 Bacteria 362159
1001 Ga0209700_100037 3300027363 Bacteria 186431
1002 Ga0209995_1022537 3300027471 Bacteria 1045
1003 Ga0209968_1016151 3300027526 Bacteria 1184
1004 Ga0209588_1003941 3300027671 Bacteria 4150
1005 Ga0209971_1009877 3300027682 Bacteria 2258
1006 Ga0209998_10001212 3300027717 Bacteria 6329
1007 Ga0209813_10004390 3300027866 Bacteria 3366
1008 Ga0209974_10001144 3300027876 Bacteria 9440
1009 Ga0209974_10011378 3300027876 Bacteria 2988
1010 Ga0209974_10044083 3300027876 Bacteria 1487
1011 Ga0207428_10000130 3300027907 Bacteria 104457
1012 Ga0207428_10000180 3300027907 Bacteria 88557
1013 Ga0207428_10000286 3300027907 Bacteria 68250
1014 Ga0207428_10121991 3300027907 Bacteria 1998
1015 Ga0268266_10001190 3300028379 Bacteria 32120
1016 Ga0268266_10003966 3300028379 Bacteria 14358
1017 Ga0268266_10006553 3300028379 Bacteria 10645
1018 Ga0268266_10010790 3300028379 Bacteria 7959
1019 Ga0268266_10018702 3300028379 Bacteria 5903
1020 Ga0268266_10026048 3300028379 Bacteria 4974
1021 Ga0268266_10060942 3300028379 Bacteria 3253
1022 Ga0268266_10161936 3300028379 Bacteria 2025
1023 Ga0268266_10202084 3300028379 Bacteria 1819
1024 Ga0268265_10004798 3300028380 Bacteria 9319
1025 Ga0268264_10000062 3300028381 Bacteria 302110
1026 Ga0268264_10027250 3300028381 Bacteria 4666
1027 Ga0265337_1004948 3300028556 Bacteria 5419
1028 Ga0265326_10019560 3300028558 Bacteria 1944
1029 Ga0265334_10041598 3300028573 Bacteria 1796
1030 Ga0265334_10056600 3300028573 Bacteria 1488
1031 Ga0265323_10010254 3300028653 Bacteria 3802
1032 Ga0265336_10000561 3300028666 Bacteria 21059
1033 Ga0307517_10001338 3300028786 Bacteria 41372
1034 Ga0307515_10062859 3300028794 Bacteria 5232
1035 Ga0307515_10181770 3300028794 Bacteria 2050
1036 Ga0307515_10289619 3300028794 Bacteria 1335
1037 Ga0307515_10356527 3300028794 Bacteria 1106
1038 Ga0265338_10000598 3300028800 Bacteria 63497
1039 Ga0265338_10020386 3300028800 Bacteria 6975
1040 Ga0265338_10088359 3300028800 Bacteria 2572
1041 Ga0265324_10007924 3300029957 Bacteria 4261
1042 Ga0307511_10032499 3300030521 Bacteria 4634
1043 Ga0307511_10161439 3300030521 Bacteria 1257
1044 Ga0265330_10011313 3300031235 Bacteria 4189
1045 Ga0265330_10015500 3300031235 Bacteria 3525
1046 Ga0265330_10078748 3300031235 Bacteria 1421
1047 Ga0265332_10011743 3300031238 Bacteria 3890
1048 Ga0265332_10044345 3300031238 Bacteria 1918
1049 Ga0265325_10000011 3300031241 Bacteria 150631
1050 Ga0265325_10003966 3300031241 Bacteria 9472
1051 Ga0265325_10010784 3300031241 Bacteria 5272
1052 Ga0265325_10038989 3300031241 Bacteria 2504
1053 Ga0265325_10122320 3300031241 Bacteria 1253
1054 Ga0265340_10015122 3300031247 Bacteria 4015
1055 Ga0265340_10027823 3300031247 Bacteria 2848
1056 Ga0265340_10059770 3300031247 Bacteria 1827
1057 Ga0265339_10001062 3300031249 Bacteria 20880
1058 Ga0265339_10021072 3300031249 Bacteria 3800
1059 Ga0265339_10047184 3300031249 Bacteria 2366
1060 Ga0265331_10024816 3300031250 Bacteria 3029
1061 Ga0265316_10135766 3300031344 Bacteria 1851
1062 Ga0307513_10135414 3300031456 Bacteria 2400
1063 Ga0307513_10380870 3300031456 Bacteria 1150
1064 Ga0307513_10402072 3300031456 Bacteria 1104
1065 Ga0307509_10080587 3300031507 Bacteria 3366
1066 Ga0265313_10000008 3300031595 Bacteria 173405
1067 Ga0265313_10020196 3300031595 Bacteria 3681
1068 Ga0307508_10118780 3300031616 Bacteria 2246
1069 Ga0307508_10201682 3300031616 Bacteria 1589
1070 Ga0307508_10207705 3300031616 Bacteria 1559
1071 Ga0265314_10002746 3300031711 Bacteria 17598
1072 Ga0265314_10042090 3300031711 Bacteria 3262
1073 Ga0265342_10000625 3300031712 Bacteria 37152
1074 Ga0265342_10035856 3300031712 Bacteria 3032
1075 Ga0265342_10054134 3300031712 Bacteria 2386
1076 Ga0265342_10057548 3300031712 Bacteria 2300
1077 Ga0265342_10197901 3300031712 Bacteria 1093
1078 Ga0307516_10008308 3300031730 Bacteria 11766
1079 Ga0307516_10022504 3300031730 Bacteria 6470
1080 Ga0307516_10093671 3300031730 Bacteria 2829
1081 Ga0307516_10102284 3300031730 Bacteria 2680
1082 Ga0307516_10318436 3300031730 Bacteria 1227
1083 Ga0307516_10409265 3300031730 Bacteria 1015
1084 Ga0307405_10031045 3300031731 Bacteria 3141
1085 Ga0307410_10094066 3300031852 Bacteria 2134
1086 Ga0307406_10038341 3300031901 Bacteria 2966
1087 Ga0307412_10197313 3300031911 Bacteria 1526
1088 Ga0307416_100092107 3300032002 Bacteria 2606
1089 Ga0307416_100149616 3300032002 Bacteria 2139
1090 Ga0307416_100493536 3300032002 Bacteria 1287
1091 Ga0307411_10317908 3300032005 Bacteria 1256
1092 Ga0307507_10019178 3300033179 Bacteria 7716
1093 Ga0307510_10021983 3300033180 Bacteria 7418
1094 Ga0307510_10037056 3300033180 Bacteria 5418
1095 Ga0307510_10072508 3300033180 Bacteria 3421
1096 Ga0315911_1000008 3300033442 Bacteria 381285
1097 Ga0373930_0000103 3300034816 Bacteria 8807
1098 Ga0373930_0003413 3300034816 Bacteria 2518
1099 Ga0373930_0007086 3300034816 Bacteria 1917
1100 Ga0373930_0012448 3300034816 Bacteria 1552
1101 Ga0373948_0000862 3300034817 Bacteria 4039
1102 Ga0373950_0000731 3300034818 Bacteria 4077
1103 Ga0373950_0014963 3300034818 Unclassified 1311
1104 Ga0373958_0000037 3300034819 Bacteria 13403
1105 Ga0373959_0000941 3300034820 Bacteria 4889
1106 Ga0373959_0009861 3300034820 Bacteria 1657
1107 Ga0373938_0000190 3300034957 Bacteria 9113
1108 Ga0373938_0009528 3300034957 Bacteria 1762
1109 Ga0373926_0007441 3300035083 Bacteria 3646
1110 Ga0373926_0017993 3300035083 Bacteria 2428
1111 Ga0373928_0029080 3300035084 Bacteria 1213
1112 Ga0373929_0000503 3300035085 Bacteria 7457
1113 Ga0373929_0006273 3300035085 Bacteria 2147
1114 Ga0373929_0010781 3300035085 Bacteria 1714
1115 Ga0373929_0020115 3300035085 Bacteria 1343
1116 Ga0373934_0002347 3300035086 Bacteria 6965
1117 Ga0373940_0000178 3300035088 Bacteria 8521
1118 Ga0373951_0000165 3300035091 Bacteria 24248
1119 Ga0373951_0004364 3300035091 Bacteria 3363
1120 Ga0373951_0010273 3300035091 Bacteria 2102
1121 Ga0373952_0000829 3300035092 Bacteria 5590
1122 Ga0373923_0004419 3300035111 Bacteria 4662
1123 Ga0373923_0023286 3300035111 Bacteria 2435
1124 Ga0373923_0029991 3300035111 Bacteria 2185
1125 Ga0373923_0051538 3300035111 Bacteria 1727
1126 Ga0373923_0081219 3300035111 Bacteria 1406
1127 Ga0373923_0112538 3300035111 Bacteria 1210
1128 Ga0373932_0000221 3300035112 Bacteria 16961
1129 Ga0373932_0001308 3300035112 Bacteria 7020
1130 Ga0373932_0007946 3300035112 Bacteria 2533
1131 Ga0373936_0011829 3300035113 Bacteria 3311
1132 Ga0373936_0028137 3300035113 Bacteria 2208
1133 Ga0373939_0000178 3300035114 Bacteria 17639
1134 Ga0373939_0000211 3300035114 Bacteria 16115
1135 Ga0373941_0000085 3300035115 Bacteria 15179
1136 Ga0373941_0018807 3300035115 Bacteria 1914
1137 Ga0373945_0034128 3300035116 Bacteria 1811
1138 Ga0373945_0044384 3300035116 Bacteria 1616
1139 Ga0373953_0009436 3300035117 Bacteria 3358
1140 Ga0373954_0000883 3300035118 Bacteria 11661
1141 Ga0373954_0016379 3300035118 Bacteria 3317
1142 Ga0373956_0018845 3300035119 Bacteria 2924
1143 Ga0373956_0085815 3300035119 Bacteria 1448
1144 Ga0373957_0001330 3300035120 Bacteria 6639
1145 Ga0373957_0007368 3300035120 Bacteria 3519
1146 Ga0373957_0049500 3300035120 Bacteria 1604
1147 Ga0373957_0070742 3300035120 Bacteria 1364
1148 Ga0373960_0001587 3300035121 Bacteria 5072
1149 Ga0373960_0009749 3300035121 Bacteria 2333
1150 Ga0373943_0009325 3300035170 Bacteria 4400
1151 Ga0373943_0058528 3300035170 Bacteria 1918
1152 Ga0373943_0060330 3300035170 Bacteria 1893
1153 Ga0373946_0002144 3300035171 Bacteria 6923
1154 Ga0373946_0006651 3300035171 Bacteria 4199
1155 Ga0373946_0013913 3300035171 Bacteria 3030
1156 Ga0373955_0001067 3300035172 Bacteria 11681
1157 Ga0373955_0002823 3300035172 Bacteria 7630
1158 Ga0373955_0006562 3300035172 Bacteria 5307
1159 Ga0373955_0012669 3300035172 Bacteria 4057
1160 Ga0373955_0021359 3300035172 Bacteria 3267
1161 Ga0373955_0022947 3300035172 Bacteria 3173
1162 Ga0373942_0001835 3300035207 Bacteria 5368
1163 Ga0373942_0004182 3300035207 Bacteria 3362
1164 Ga0373942_0031734 3300035207 Bacteria 1399
1165 Ga0373961_0001088 3300035241 Bacteria 8657
1166 Ga0373961_0020525 3300035241 Bacteria 1749
1167 Ga0373962_0000271 3300035242 Bacteria 11153
1168 Ga0373924_0005686 3300035410 Bacteria 4425
1169 Ga0373924_0026792 3300035410 Bacteria 2289
1170 Ga0373924_0030107 3300035410 Bacteria 2174
1171 Ga0373924_0082472 3300035410 Bacteria 1369
1172 Ga0373924_0107917 3300035410 Bacteria 1201
1173 Ga0373931_0000854 3300035691 Bacteria 12844
1174 Ga0373931_0004670 3300035691 Bacteria 6269
1175 Ga0373931_0007821 3300035691 Bacteria 5052
1176 Ga0373931_0020376 3300035691 Bacteria 3318
1177 Ga0373935_0000953 3300035692 Bacteria 15634
1178 Ga0373935_0009363 3300035692 Bacteria 5861
1179 Ga0373935_0375082 3300035692 Bacteria 1018
1180 Ga0373935_0405554 3300035692 Bacteria 980
1181 Ga0373927_0001486 3300035695 Bacteria 17658
1182 Ga0373927_0016979 3300035695 Bacteria 4797
1183 Ga0373927_0020336 3300035695 Bacteria 4354
1184 Ga0373927_0020725 3300035695 Bacteria 4311
1185 Ga0373927_0047148 3300035695 Bacteria 2787
1186 Ga0373927_0085319 3300035695 Bacteria 2049
1187 Ga0373927_0210585 3300035695 Bacteria 1277
1188 Ga0373927_0210852 3300035695 Bacteria 1276
1189 Ga0373927_0231919 3300035695 Bacteria 1213
1190 Ga0373927_0370168 3300035695 Bacteria 945
1191 Ga0373933_0000031 3300035724 Bacteria 85038
1192 Ga0373933_0001638 3300035724 Bacteria 13046
1193 Ga0373933_0004073 3300035724 Bacteria 8051
1194 Ga0373933_0009095 3300035724 Bacteria 5421
1195 Ga0373933_0046875 3300035724 Bacteria 2568
1196 Ga0373933_0275632 3300035724 Unclassified 1086
1197 Ga0373933_0283029 3300035724 Bacteria 1071
1198 Ga0373947_0016744 3300035725 Bacteria 4212
1199 Ga0373947_0034928 3300035725 Bacteria 2975
1200 Ga0373947_0108866 3300035725 Bacteria 1748
1201 Ga0373947_0125159 3300035725 Bacteria 1636
1202 Ga0373947_0136574 3300035725 Bacteria 1569
1203 Ga0373937_0022664 3300036401 Bacteria 5648
1204 Ga0373937_0024864 3300036401 Bacteria 5406
1205 Ga0373937_0035182 3300036401 Bacteria 4558
1206 Ga0373937_0063798 3300036401 Bacteria 3388
1207 Ga0373937_0185374 3300036401 Bacteria 1954
1208 Ga0373937_0245399 3300036401 Bacteria 1688
1209 Ga0373937_0342089 3300036401 Bacteria 1417
1210 Ga0373925_0001713 3300037068 Bacteria 18492
1211 Ga0373925_0011017 3300037068 Bacteria 6566
1212 Ga0373925_0012057 3300037068 Bacteria 6259
1213 Ga0373925_0021659 3300037068 Bacteria 4685
1214 Ga0373925_0061385 3300037068 Bacteria 2823
1215 Ga0373925_0061914 3300037068 Bacteria 2812
1216 Ga0373925_0065920 3300037068 Bacteria 2729
1217 Ga0395899_0032437 3300037312 Bacteria 3923
1218 Ga0395899_0095919 3300037312 Bacteria 2145
1219 Ga0395900_0003383 3300037418 Bacteria 17226
1220 Ga0395900_0034932 3300037418 Bacteria 5178
1221 Ga0395900_0040360 3300037418 Bacteria 4810
1222 Ga0395900_0128808 3300037418 Bacteria 2594
1223 Ga0395898_0042666 3300037466 Bacteria 4474
1224 Ga0395898_0071806 3300037466 Bacteria 3344
1225 Ga0395898_0149786 3300037466 Bacteria 2233
1226 Ga0395898_0214916 3300037466 Bacteria 1834
1227 Ga0395898_0238773 3300037466 Bacteria 1733
1228 Ga0395898_0253695 3300037466 Bacteria 1677
1229 Ga0395905_0206657 3300037471 Bacteria 1840
1230 Ga0436364_0096232 3300037853 Bacteria 2164
1231 Ga0395901_0161555 3300038443 Bacteria 2353
1232 Ga0395901_0230847 3300038443 Bacteria 1932
1233 Ga0395901_0250229 3300038443 Bacteria 1846
1234 Ga0395901_0272541 3300038443 Bacteria 1760
1235 Ga0395901_0434709 3300038443 Bacteria 1344
1236 Ga0395901_0486977 3300038443 Bacteria 1257
1237 Ga0436365_0221825 3300039437 Bacteria 1693
1238 Ga0436365_0946034 3300039437 Bacteria 9968
1239 Ga0436365_0949897 3300039437 Bacteria 15199
1240 Ga0436365_1714553 3300039437 Bacteria 1591
1241 Ga0436360_0780899 3300039438 Bacteria 2054
1242 Ga0436361_0333730 3300039447 Bacteria 2348
1243 Ga0436363_0863782 3300039450 Bacteria 5485
1244 Ga0436363_0926778 3300039450 Bacteria 971
1245 Ga0436363_1148766 3300039450 Bacteria 3575
1246 Ga0436362_0112883 3300039453 Bacteria 1833
1247 Ga0436362_0546439 3300039453 Bacteria 2270
1248 Ga0436362_0693408 3300039453 Bacteria 1453
1249 Ga0439453_0006962 3300041408 Bacteria 1777
1250 Ga0451797_1160655 3300041453 Bacteria 1433
1251 Ga0451802_0544973 3300041460 Bacteria 1559
1252 Ga0439443_004964 3300042003 Bacteria 1760
1253 Ga0439459_0024175 3300042438 Bacteria 1190
1254 Ga0439460_0007890 3300042461 Bacteria 2675
1255 Ga0451577_0274370 3300042876 Bacteria 1527
1256 Ga0466969_0030685 3300044656 Bacteria 2739
1257 Ga0466969_0118977 3300044656 Bacteria 1231
1258 Ga0466972_0000119 3300044658 Bacteria 66620
1259 Ga0466972_0023237 3300044658 Bacteria 3083
1260 Ga0466972_0120032 3300044658 Bacteria 1240
1261 Ga0453683_0027898 3300044673 Bacteria 3578
1262 Ga0466965_0029278 3300044683 Bacteria 2679
1263 Ga0466965_0036005 3300044683 Bacteria 2427
1264 Ga0466966_0001462 3300044684 Bacteria 15200
1265 Ga0466966_0064168 3300044684 Bacteria 2313
1266 Ga0466966_0142339 3300044684 Bacteria 1465
1267 Ga0466961_0000139 3300044693 Bacteria 48781
1268 Ga0466961_0119230 3300044693 Bacteria 1657
1269 Ga0466963_0021631 3300044694 Bacteria 4061
1270 Ga0466964_0106147 3300044706 Bacteria 1246
1271 Ga0466964_0145203 3300044706 Bacteria 1095
1272 Ga0453684_0033092 3300044712 Bacteria 7214
1273 Ga0466968_0033860 3300044735 Bacteria 2130
1274 Ga0466968_0064073 3300044735 Bacteria 1589
1275 Ga0466957_0109451 3300044842 Bacteria 1751
1276 Ga0466960_0056971 3300044901 Bacteria 1904
1277 Ga0466959_0084047 3300045049 Bacteria 2291
1278 Ga0466959_0161266 3300045049 Bacteria 1576
1279 Ga0466959_0209189 3300045049 Bacteria 1356
1280 Ga0451576_0044873 3300045051 Bacteria 4657
1281 Ga0466958_0031880 3300045836 Bacteria 3133
1282 Ga0466967_0083690 3300045976 Bacteria 2886
1283 Ga0466967_0105726 3300045976 Bacteria 2579
1284 Ga0466967_0225224 3300045976 Bacteria 1783
1285 Ga0466967_0361534 3300045976 Bacteria 1406
1286 Ga0495617_033033 3300046452 Bacteria 1737
1287 Ga0495592_0003085 3300046454 Bacteria 11889
1288 Ga0495592_0024684 3300046454 Bacteria 4570
1289 Ga0495592_0036398 3300046454 Bacteria 3708
1290 Ga0495592_0115227 3300046454 Bacteria 1897
1291 Ga0495603_0000047 3300046455 Bacteria 53081
1292 Ga0495603_0020465 3300046455 Bacteria 4010
1293 Ga0495603_0022882 3300046455 Bacteria 3782
1294 Ga0495603_0029746 3300046455 Bacteria 3293
1295 Ga0495603_0041392 3300046455 Bacteria 2755
1296 Ga0495603_0062555 3300046455 Bacteria 2197
1297 Ga0495603_0162744 3300046455 Bacteria 1294
1298 Ga0495603_0212020 3300046455 Bacteria 1118
1299 Ga0495590_0061027 3300046457 Bacteria 1320
1300 Ga0495629_0000320 3300046459 Bacteria 41151
1301 Ga0495629_0000588 3300046459 Bacteria 29503
1302 Ga0495629_0001972 3300046459 Bacteria 15994
1303 Ga0495629_0112059 3300046459 Bacteria 1902
1304 Ga0495629_0138131 3300046459 Bacteria 1696
1305 Ga0495629_0169058 3300046459 Bacteria 1518
1306 Ga0495638_0001094 3300046460 Bacteria 26401
1307 Ga0495638_0040689 3300046460 Bacteria 2944
1308 Ga0495638_0054969 3300046460 Bacteria 2473
1309 Ga0495641_0008426 3300046461 Bacteria 6288
1310 Ga0495641_0015004 3300046461 Bacteria 4166
1311 Ga0495641_0064684 3300046461 Bacteria 1647
1312 Ga0495651_0011341 3300046462 Bacteria 6848
1313 Ga0495651_0016592 3300046462 Bacteria 5703
1314 Ga0495651_0027555 3300046462 Bacteria 4426
1315 Ga0495651_0066310 3300046462 Bacteria 2756
1316 Ga0495651_0116423 3300046462 Bacteria 1969
1317 Ga0495651_0196007 3300046462 Bacteria 1417
1318 Ga0495653_0002188 3300046463 Bacteria 15461
1319 Ga0495653_0016106 3300046463 Bacteria 6091
1320 Ga0495653_0022979 3300046463 Bacteria 5042
1321 Ga0495653_0144596 3300046463 Bacteria 1668
1322 Ga0495650_0062027 3300046471 Bacteria 1495
1323 Ga0495650_0095507 3300046471 Bacteria 1124
1324 Ga0495580_0005073 3300046472 Bacteria 10969
1325 Ga0495580_0046436 3300046472 Bacteria 3081
1326 Ga0495580_0290614 3300046472 Bacteria 1114
1327 Ga0495582_0000043 3300046473 Bacteria 63647
1328 Ga0495582_0006066 3300046473 Bacteria 6732
1329 Ga0495639_0000091 3300046475 Bacteria 44027
1330 Ga0495639_0007375 3300046475 Bacteria 4720
1331 Ga0495639_0030682 3300046475 Bacteria 2390
1332 Ga0495639_0083615 3300046475 Bacteria 1489
1333 Ga0495662_0000128 3300046476 Bacteria 28645
1334 Ga0495664_0027103 3300046477 Bacteria 3340
1335 Ga0495664_0039757 3300046477 Bacteria 2780
1336 Ga0495664_0053277 3300046477 Bacteria 2406
1337 Ga0495584_0002387 3300046491 Bacteria 10658
1338 Ga0495584_0048578 3300046491 Bacteria 2139
1339 Ga0495584_0074191 3300046491 Bacteria 1710
1340 Ga0495584_0161793 3300046491 Bacteria 1138
1341 Ga0495585_0008207 3300046492 Bacteria 6341
1342 Ga0495594_0000453 3300046499 Bacteria 20836
1343 Ga0495594_0003274 3300046499 Bacteria 8388
1344 Ga0495594_0155911 3300046499 Bacteria 1297
1345 Ga0495607_0010697 3300046501 Bacteria 6149
1346 Ga0495583_0024679 3300046506 Bacteria 3016
1347 Ga0495606_0000252 3300046507 Bacteria 94511
1348 Ga0495606_0020289 3300046507 Bacteria 4905
1349 Ga0495606_0257391 3300046507 Bacteria 965
1350 Ga0495608_0030843 3300046511 Bacteria 3626
1351 Ga0495608_0048520 3300046511 Bacteria 2821
1352 Ga0495608_0062600 3300046511 Bacteria 2444
1353 Ga0495608_0229182 3300046511 Bacteria 1163
1354 Ga0495618_0013046 3300046514 Bacteria 5050
1355 Ga0495618_0024256 3300046514 Bacteria 3755
1356 Ga0495618_0063716 3300046514 Bacteria 2341
1357 Ga0495618_0182599 3300046514 Bacteria 1333
1358 Ga0495618_0218758 3300046514 Bacteria 1202
1359 Ga0495620_0038307 3300046515 Bacteria 2129
1360 Ga0495620_0059303 3300046515 Bacteria 1600
1361 Ga0495620_0064024 3300046515 Bacteria 1522
1362 Ga0495628_0000249 3300046516 Bacteria 47492
1363 Ga0495628_0020336 3300046516 Bacteria 5478
1364 Ga0495628_0052492 3300046516 Bacteria 3220
1365 Ga0495628_0059445 3300046516 Bacteria 3000
1366 Ga0495628_0113838 3300046516 Bacteria 2079
1367 Ga0495628_0127194 3300046516 Bacteria 1951
1368 Ga0495630_0044580 3300046517 Bacteria 3314
1369 Ga0495630_0079935 3300046517 Bacteria 2466
1370 Ga0495630_0123621 3300046517 Bacteria 1963
1371 Ga0495632_0079408 3300046519 Bacteria 1566
1372 Ga0495637_0069636 3300046520 Bacteria 1423
1373 Ga0495637_0110247 3300046520 Bacteria 1067
1374 Ga0495643_0004740 3300046522 Bacteria 9408
1375 Ga0495643_0057943 3300046522 Bacteria 2063
1376 Ga0495644_0001475 3300046523 Bacteria 9593
1377 Ga0495648_0000286 3300046524 Bacteria 57430
1378 Ga0495648_0010274 3300046524 Bacteria 7148
1379 Ga0495648_0086311 3300046524 Bacteria 1770
1380 Ga0495666_0035220 3300046526 Bacteria 2441
1381 Ga0495666_0043942 3300046526 Bacteria 2158
1382 Ga0495666_0085973 3300046526 Bacteria 1485
1383 Ga0495652_0013367 3300046529 Bacteria 7389
1384 Ga0495652_0018347 3300046529 Bacteria 6239
1385 Ga0495652_0043484 3300046529 Bacteria 3868
1386 Ga0495652_0064883 3300046529 Bacteria 3070
1387 Ga0495652_0162932 3300046529 Bacteria 1729
1388 Ga0495652_0272445 3300046529 Bacteria 1243
1389 Ga0495652_0327226 3300046529 Bacteria 1105
1390 Ga0495654_0006037 3300046530 Bacteria 6951
1391 Ga0495665_0001635 3300046531 Bacteria 11999
1392 Ga0495665_0074226 3300046531 Bacteria 1791
1393 Ga0495640_0007459 3300046533 Bacteria 8592
1394 Ga0495640_0039130 3300046533 Bacteria 3330
1395 Ga0495640_0059727 3300046533 Bacteria 2595
1396 Ga0495640_0090769 3300046533 Bacteria 2016
1397 Ga0495640_0112306 3300046533 Bacteria 1779
1398 Ga0495586_0070330 3300046535 Bacteria 1911
1399 Ga0495587_0023867 3300046536 Bacteria 3754
1400 Ga0495587_0049923 3300046536 Bacteria 2476
1401 Ga0495587_0113807 3300046536 Bacteria 1552
1402 Ga0495587_0133906 3300046536 Bacteria 1416
1403 Ga0495587_0194911 3300046536 Bacteria 1146
1404 Ga0495587_0199522 3300046536 Bacteria 1132
1405 Ga0495598_0032901 3300046537 Bacteria 1468
1406 Ga0495609_0060397 3300046538 Bacteria 1676
1407 Ga0495645_0001006 3300046543 Bacteria 19191
1408 Ga0495645_0035369 3300046543 Bacteria 3642
1409 Ga0495645_0042219 3300046543 Bacteria 3325
1410 Ga0495645_0146956 3300046543 Bacteria 1641
1411 Ga0495645_0212630 3300046543 Bacteria 1305
1412 Ga0495622_0010031 3300046557 Bacteria 4381
1413 Ga0495622_0013370 3300046557 Bacteria 3807
1414 Ga0495622_0018113 3300046557 Bacteria 3280
1415 Ga0495622_0021427 3300046557 Bacteria 3008
1416 Ga0495622_0055495 3300046557 Bacteria 1837
1417 Ga0495622_0093736 3300046557 Bacteria 1378
1418 Ga0495622_0125151 3300046557 Bacteria 1173
1419 Ga0495633_0006799 3300046558 Bacteria 6706
1420 Ga0495667_0002652 3300046559 Bacteria 11945
1421 Ga0495667_0011278 3300046559 Bacteria 6047
1422 Ga0495667_0045323 3300046559 Bacteria 2912
1423 Ga0495667_0123867 3300046559 Bacteria 1668
1424 Ga0495667_0246146 3300046559 Bacteria 1138
1425 Ga0495656_0000123 3300046615 Bacteria 29630
1426 Ga0495668_0036116 3300046616 Bacteria 2770
1427 Ga0495668_0048118 3300046616 Bacteria 2366
1428 Ga0495634_0021849 3300046642 Bacteria 4516
1429 Ga0495634_0044652 3300046642 Bacteria 2998
1430 Ga0495634_0065147 3300046642 Bacteria 2415
1431 Ga0495634_0142117 3300046642 Bacteria 1523
1432 Ga0495611_0170607 3300046648 Bacteria 1017
1433 Ga0495625_0056335 3300046660 Bacteria 2799
1434 Ga0495625_0094790 3300046660 Bacteria 2058
1435 Ga0495625_0284297 3300046660 Bacteria 1063
1436 Ga0495635_0001078 3300046663 Bacteria 18109
1437 Ga0495635_0001788 3300046663 Bacteria 14525
1438 Ga0495635_0003088 3300046663 Bacteria 11458
1439 Ga0495635_0005472 3300046663 Bacteria 8833
1440 Ga0495635_0006182 3300046663 Bacteria 8344
1441 Ga0495635_0147977 3300046663 Bacteria 1599
1442 Ga0495659_0000648 3300046664 Bacteria 12635
1443 Ga0495661_0155342 3300046665 Bacteria 1232
1444 Ga0495661_0191664 3300046665 Bacteria 1076
1445 Ga0495588_0008121 3300046674 Bacteria 4800
1446 Ga0495588_0024864 3300046674 Bacteria 2979
1447 Ga0495588_0156479 3300046674 Bacteria 1205
1448 Ga0495657_0010052 3300046675 Bacteria 7134
1449 Ga0495657_0012323 3300046675 Bacteria 6354
1450 Ga0495657_0016857 3300046675 Bacteria 5313
1451 Ga0495657_0058547 3300046675 Bacteria 2558
1452 Ga0495657_0089349 3300046675 Bacteria 1980
1453 Ga0495657_0125671 3300046675 Bacteria 1611
1454 Ga0495599_0001153 3300046678 Bacteria 14977
1455 Ga0495599_0012093 3300046678 Bacteria 5312
1456 Ga0495599_0016129 3300046678 Bacteria 4637
1457 Ga0495599_0050500 3300046678 Bacteria 2606
1458 Ga0495623_0004489 3300046679 Bacteria 9167
1459 Ga0495623_0016469 3300046679 Bacteria 4775
1460 Ga0495623_0046940 3300046679 Bacteria 2741
1461 Ga0495623_0093678 3300046679 Bacteria 1838
1462 Ga0495646_0004178 3300046680 Bacteria 9076
1463 Ga0495646_0006980 3300046680 Bacteria 7170
1464 Ga0495646_0230262 3300046680 Bacteria 999
1465 Ga0495647_0002969 3300046681 Bacteria 5388
1466 Ga0495647_0011225 3300046681 Bacteria 3066
1467 Ga0495647_0021856 3300046681 Bacteria 2308
1468 Ga0495647_0072507 3300046681 Bacteria 1381
1469 Ga0495658_0000601 3300046683 Bacteria 19735
1470 Ga0495658_0002995 3300046683 Bacteria 8449
1471 Ga0495658_0207842 3300046683 Bacteria 1222
1472 Ga0495669_0190309 3300046684 Unclassified 979
1473 Ga0495613_0001794 3300046689 Bacteria 16314
1474 Ga0495613_0138626 3300046689 Bacteria 1739
1475 Ga0495613_0147899 3300046689 Bacteria 1676
1476 Ga0495624_0000694 3300046690 Bacteria 26424
1477 Ga0495624_0074674 3300046690 Bacteria 2106
1478 Ga0495671_0083319 3300046692 Bacteria 1567
1479 Ga0495671_0171568 3300046692 Bacteria 1054
1480 Ga0495649_0022117 3300046694 Bacteria 3559
1481 Ga0495589_0038643 3300046794 Bacteria 2388
1482 Ga0495589_0042748 3300046794 Bacteria 2258
1483 Ga0495600_0002039 3300046809 Bacteria 11375
1484 Ga0495600_0016286 3300046809 Bacteria 4715
1485 Ga0495600_0019222 3300046809 Bacteria 4360
1486 Ga0495600_0072547 3300046809 Bacteria 2249
1487 Ga0495600_0088862 3300046809 Bacteria 2015
1488 Ga0495660_0052752 3300046810 Bacteria 2209
1489 Ga0495581_0000486 3300047315 Bacteria 20240
1490 Ga0495581_0003184 3300047315 Bacteria 9395
1491 Ga0495581_0052214 3300047315 Bacteria 2361
1492 Ga0495581_0094007 3300047315 Bacteria 1740
1493 Ga0495581_0095658 3300047315 Bacteria 1725
1494 Ga0495581_0134214 3300047315 Bacteria 1442
1495 Ga0495604_0005947 3300047317 Bacteria 9680
1496 Ga0495604_0009217 3300047317 Bacteria 7814
1497 Ga0495604_0010825 3300047317 Bacteria 7244
1498 Ga0495604_0029213 3300047317 Bacteria 4385
1499 Ga0495604_0055664 3300047317 Bacteria 3048
1500 Ga0495604_0221682 3300047317 Bacteria 1302
1501 Ga0495674_0003925 3300047319 Bacteria 14430
1502 Ga0495674_0010066 3300047319 Bacteria 8964
1503 Ga0495674_0037870 3300047319 Bacteria 4332
1504 Ga0495674_0058274 3300047319 Bacteria 3377
1505 Ga0495674_0089440 3300047319 Bacteria 2632
1506 Ga0495674_0094357 3300047319 Bacteria 2552
1507 Ga0495674_0104383 3300047319 Bacteria 2409
1508 Ga0495674_0159539 3300047319 Bacteria 1887
1509 Ga0495672_0025202 3300047320 Bacteria 3813
1510 Ga0495676_0075429 3300047321 Bacteria 2579
1511 Ga0495676_0079376 3300047321 Bacteria 2495
1512 Ga0495676_0084508 3300047321 Bacteria 2394
1513 Ga0495676_0091661 3300047321 Bacteria 2271
1514 Ga0495676_0151317 3300047321 Bacteria 1651
1515 Ga0495680_0000689 3300047322 Bacteria 37846
1516 Ga0495680_0009034 3300047322 Bacteria 9004
1517 Ga0495680_0013096 3300047322 Bacteria 7249
1518 Ga0495680_0015853 3300047322 Bacteria 6486
1519 Ga0495680_0019326 3300047322 Bacteria 5753
1520 Ga0495680_0168515 3300047322 Bacteria 1586
1521 Ga0495683_0020152 3300047323 Bacteria 3441
1522 Ga0495683_0074095 3300047323 Bacteria 1669
1523 Ga0495687_007102 3300047443 Bacteria 6681
1524 Ga0495675_0001437 3300047444 Bacteria 14419
1525 Ga0495675_0009835 3300047444 Bacteria 5963
1526 Ga0495675_0015422 3300047444 Bacteria 4832
1527 Ga0495675_0031708 3300047444 Bacteria 3374
1528 Ga0495677_0098608 3300047445 Bacteria 1105
1529 Ga0495677_0099909 3300047445 Bacteria 1098
1530 Ga0495679_044824 3300047446 Bacteria 1353
1531 Ga0495673_0045161 3300047469 Bacteria 1960
1532 Ga0495673_0084624 3300047469 Bacteria 1307
1533 Ga0495681_0019926 3300047470 Bacteria 3649
1534 Ga0495681_0122274 3300047470 Bacteria 1116
1535 Ga0495684_0000313 3300047471 Bacteria 39705
1536 Ga0495684_0002684 3300047471 Bacteria 14089
1537 Ga0495684_0020400 3300047471 Bacteria 5107
1538 Ga0495686_0075227 3300047472 Bacteria 2071
1539 Ga0495593_0000005 3300047673 Bacteria 93984
1540 Ga0495593_0000693 3300047673 Bacteria 19452
1541 Ga0495593_0013264 3300047673 Bacteria 4704
1542 Ga0495593_0064383 3300047673 Bacteria 1914
1543 Ga0495602_0002384 3300048088 Bacteria 19072
1544 Ga0495602_0007244 3300048088 Bacteria 11614
1545 Ga0495602_0011207 3300048088 Bacteria 9270
1546 Ga0495602_0037524 3300048088 Bacteria 4495
1547 Ga0495602_0053983 3300048088 Bacteria 3552
1548 Ga0495602_0124770 3300048088 Bacteria 2065
1549 Ga0495602_0270260 3300048088 Bacteria 1257
1550 Ga0495614_0007962 3300048089 Bacteria 4710
1551 Ga0496100_0001453 3300048903 Bacteria 11609
1552 Ga0496100_0004117 3300048903 Bacteria 7668
1553 Ga0496100_0008582 3300048903 Bacteria 5704
1554 Ga0496100_0011507 3300048903 Bacteria 5039
1555 Ga0496100_0048602 3300048903 Bacteria 2739
1556 Ga0496100_0212649 3300048903 Bacteria 1415
1557 Ga0496100_0354832 3300048903 Bacteria 1108
1558 Ga0496101_0000468 3300048904 Bacteria 25464
1559 Ga0496101_0006584 3300048904 Bacteria 7485
1560 Ga0496101_0043343 3300048904 Bacteria 3216
1561 Ga0496101_0105796 3300048904 Bacteria 2112
1562 Ga0496101_0145379 3300048904 Bacteria 1810
1563 Ga0496102_0001314 3300048905 Bacteria 22298
1564 Ga0496102_0021069 3300048905 Bacteria 5765
1565 Ga0496102_0028200 3300048905 Bacteria 5014
1566 Ga0496102_0038433 3300048905 Bacteria 4319
1567 Ga0496102_0093823 3300048905 Bacteria 2780
1568 Ga0496102_0095293 3300048905 Bacteria 2758
1569 Ga0496102_0169651 3300048905 Bacteria 2054
1570 Ga0496102_0328692 3300048905 Bacteria 1440
1571 Ga0496102_0366786 3300048905 Unclassified 1355
1572 Ga0496102_0455458 3300048905 Bacteria 1200
1573 Ga0496102_0483605 3300048905 Bacteria 1160
1574 Ga0496103_0008659 3300048906 Bacteria 6041
1575 Ga0496103_0013281 3300048906 Bacteria 4881
1576 Ga0496103_0014273 3300048906 Bacteria 4716
1577 Ga0496103_0159200 3300048906 Bacteria 1448
1578 Ga0496103_0307451 3300048906 Bacteria 1020
1579 Ga0496104_0000239 3300048907 Bacteria 48386
1580 Ga0496104_0012293 3300048907 Bacteria 7695
1581 Ga0496104_0012475 3300048907 Bacteria 7643
1582 Ga0496104_0072639 3300048907 Bacteria 3272
1583 Ga0496104_0081494 3300048907 Bacteria 3086
1584 Ga0496104_0199393 3300048907 Bacteria 1913
1585 Ga0496104_0214949 3300048907 Bacteria 1834
1586 Ga0496104_0240495 3300048907 Bacteria 1722
1587 Ga0496104_0297575 3300048907 Bacteria 1526
1588 Ga0496104_0491072 3300048907 Bacteria 1139
1589 Ga0496104_0573957 3300048907 Bacteria 1038
1590 Ga0496105_0000398 3300048908 Bacteria 28619
1591 Ga0496105_0000935 3300048908 Bacteria 19915
1592 Ga0496105_0012329 3300048908 Bacteria 6768
1593 Ga0496105_0012763 3300048908 Bacteria 6654
1594 Ga0496105_0025256 3300048908 Bacteria 4835
1595 Ga0496105_0083297 3300048908 Bacteria 2641
1596 Ga0496105_0163562 3300048908 Bacteria 1826
1597 Ga0496105_0206808 3300048908 Bacteria 1601
1598 Ga0496105_0519852 3300048908 Bacteria 932
1599 Ga0496106_0000236 3300048909 Bacteria 38678
1600 Ga0496106_0001014 3300048909 Bacteria 20581
1601 Ga0496106_0067463 3300048909 Bacteria 2727
1602 Ga0496106_0074650 3300048909 Bacteria 2596
1603 Ga0496106_0088327 3300048909 Bacteria 2389
1604 Ga0496106_0159746 3300048909 Bacteria 1782
1605 Ga0496106_0172713 3300048909 Bacteria 1714
1606 Ga0496106_0181364 3300048909 Bacteria 1671
1607 Ga0496106_0326600 3300048909 Unclassified 1231
1608 Ga0496106_0560483 3300048909 Bacteria 916
1609 Ga0496107_0000965 3300048910 Bacteria 17064
1610 Ga0496107_0006262 3300048910 Bacteria 8180
1611 Ga0496107_0010146 3300048910 Bacteria 6533
1612 Ga0496107_0011653 3300048910 Bacteria 6127
1613 Ga0496107_0014083 3300048910 Bacteria 5598
1614 Ga0496107_0020391 3300048910 Bacteria 4681
1615 Ga0496107_0023024 3300048910 Bacteria 4404
1616 Ga0496107_0035286 3300048910 Bacteria 3585
1617 Ga0496107_0074003 3300048910 Bacteria 2478
1618 Ga0496107_0144002 3300048910 Bacteria 1761
1619 Ga0496107_0163028 3300048910 Bacteria 1653
1620 Ga0496107_0223620 3300048910 Bacteria 1400
1621 Ga0496107_0427517 3300048910 Bacteria 985
1622 Ga0496108_0000849 3300048911 Bacteria 23796
1623 Ga0496108_0001543 3300048911 Bacteria 18244
1624 Ga0496108_0005663 3300048911 Bacteria 10116
1625 Ga0496108_0012923 3300048911 Bacteria 6803
1626 Ga0496108_0055454 3300048911 Bacteria 3328
1627 Ga0496108_0062393 3300048911 Bacteria 3138
1628 Ga0496108_0104083 3300048911 Bacteria 2422
1629 Ga0496108_0125766 3300048911 Bacteria 2201
1630 Ga0496108_0351988 3300048911 Bacteria 1285
1631 Ga0496108_0544743 3300048911 Bacteria 1012
1632 Ga0496109_0000224 3300048912 Bacteria 55854
1633 Ga0496109_0000414 3300048912 Bacteria 37873
1634 Ga0496109_0004282 3300048912 Bacteria 11922
1635 Ga0496109_0026221 3300048912 Bacteria 5196
1636 Ga0496109_0075500 3300048912 Bacteria 3099
1637 Ga0496109_0077160 3300048912 Bacteria 3066
1638 Ga0496109_0103281 3300048912 Bacteria 2645
1639 Ga0496109_0112207 3300048912 Bacteria 2535
1640 Ga0496109_0142097 3300048912 Bacteria 2245
1641 Ga0496109_0146234 3300048912 Bacteria 2211
1642 Ga0496109_0410607 3300048912 Bacteria 1279
1643 Ga0496109_0618655 3300048912 Bacteria 1019
1644 Ga0496110_0012677 3300048913 Bacteria 6937
1645 Ga0496110_0025638 3300048913 Bacteria 5041
1646 Ga0496110_0044581 3300048913 Bacteria 3873
1647 Ga0496110_0055104 3300048913 Bacteria 3498
1648 Ga0496110_0093478 3300048913 Bacteria 2692
1649 Ga0496110_0177587 3300048913 Bacteria 1933
1650 Ga0496110_0230176 3300048913 Bacteria 1685
1651 Ga0496110_0330972 3300048913 Unclassified 1387
1652 Ga0496110_0348751 3300048913 Bacteria 1348
1653 Ga0496111_0001884 3300048914 Bacteria 12408
1654 Ga0496111_0031987 3300048914 Bacteria 3749
1655 Ga0496111_0032982 3300048914 Bacteria 3693
1656 Ga0496111_0035701 3300048914 Bacteria 3554
1657 Ga0496111_0193174 3300048914 Bacteria 1513
1658 Ga0496111_0207838 3300048914 Bacteria 1454
1659 Ga0496111_0223339 3300048914 Bacteria 1399
1660 Ga0496111_0245379 3300048914 Bacteria 1330
1661 Ga0496111_0428158 3300048914 Bacteria 977
1662 Ga0496112_0000020 3300048915 Bacteria 169373
1663 Ga0496112_0001044 3300048915 Bacteria 20400
1664 Ga0496112_0055429 3300048915 Bacteria 3898
1665 Ga0496112_0060236 3300048915 Bacteria 3740
1666 Ga0496112_0085759 3300048915 Bacteria 3115
1667 Ga0496112_0135786 3300048915 Bacteria 2430
1668 Ga0496112_0212285 3300048915 Bacteria 1892
1669 Ga0496112_0342485 3300048915 Bacteria 1438
1670 Ga0496113_0008868 3300048916 Bacteria 6576
1671 Ga0496113_0009598 3300048916 Bacteria 6352
1672 Ga0496113_0025475 3300048916 Bacteria 4216
1673 Ga0496113_0026173 3300048916 Bacteria 4168
1674 Ga0496113_0026913 3300048916 Bacteria 4116
1675 Ga0496113_0036756 3300048916 Bacteria 3590
1676 Ga0496113_0060373 3300048916 Bacteria 2858
1677 Ga0496113_0092954 3300048916 Bacteria 2327
1678 Ga0496113_0110860 3300048916 Bacteria 2136
1679 Ga0496113_0129462 3300048916 Bacteria 1979
1680 Ga0496113_0186433 3300048916 Bacteria 1646
1681 Ga0496114_0005384 3300048917 Bacteria 10007
1682 Ga0496114_0021424 3300048917 Bacteria 5260
1683 Ga0496114_0022004 3300048917 Bacteria 5191
1684 Ga0496114_0023821 3300048917 Bacteria 4995
1685 Ga0496114_0050674 3300048917 Bacteria 3456
1686 Ga0496114_0059281 3300048917 Bacteria 3197
1687 Ga0496114_0659677 3300048917 Bacteria 920
1688 Ga0496115_0003980 3300048918 Bacteria 10658
1689 Ga0496115_0006071 3300048918 Bacteria 8821
1690 Ga0496115_0008492 3300048918 Bacteria 7598
1691 Ga0496115_0047342 3300048918 Bacteria 3438
1692 Ga0496115_0105976 3300048918 Bacteria 2307
1693 Ga0496115_0108631 3300048918 Bacteria 2277
1694 Ga0496115_0144741 3300048918 Bacteria 1961
1695 Ga0496115_0198209 3300048918 Bacteria 1659
1696 Ga0496115_0231335 3300048918 Bacteria 1524
1697 Ga0496116_0050598 3300048919 Bacteria 2767
1698 Ga0496116_0126522 3300048919 Bacteria 1467
1699 Ga0496117_0017224 3300048920 Bacteria 6045
1700 Ga0496117_0027455 3300048920 Bacteria 4436
1701 Ga0496117_0033893 3300048920 Bacteria 3856
1702 Ga0496117_0219061 3300048920 Bacteria 1061
1703 Ga0496118_0003026 3300048921 Bacteria 21707
1704 Ga0496118_0014494 3300048921 Bacteria 7378
1705 Ga0496118_0025699 3300048921 Bacteria 5040
1706 Ga0496118_0035791 3300048921 Bacteria 4024
1707 Ga0496118_0154748 3300048921 Bacteria 1428
1708 Ga0496119_0025923 3300048922 Bacteria 4080
1709 Ga0496119_0035726 3300048922 Bacteria 3251
1710 Ga0496120_0083845 3300048923 Bacteria 1720
1711 Ga0496120_0086205 3300048923 Bacteria 1689
1712 Ga0496120_0093327 3300048923 Bacteria 1604
1713 Ga0496121_0000270 3300048924 Bacteria 108787
1714 Ga0496121_0000370 3300048924 Bacteria 92397
1715 Ga0496121_0001039 3300048924 Bacteria 49470
1716 Ga0496121_0011522 3300048924 Bacteria 9798
1717 Ga0496121_0019165 3300048924 Bacteria 6856
1718 Ga0496121_0030770 3300048924 Bacteria 4923
1719 Ga0496121_0046170 3300048924 Bacteria 3731
1720 Ga0496121_0070234 3300048924 Bacteria 2822
1721 Ga0496121_0129567 3300048924 Bacteria 1891
1722 Ga0496121_0154562 3300048924 Bacteria 1684
1723 Ga0496121_0314580 3300048924 Bacteria 1057
1724 Ga0496121_0380837 3300048924 Bacteria 930
1725 Ga0496122_0028108 3300048925 Bacteria 4785
1726 Ga0496122_0049845 3300048925 Bacteria 3199
1727 Ga0496122_0071551 3300048925 Bacteria 2471
1728 Ga0496122_0077351 3300048925 Bacteria 2337
1729 Ga0496122_0093455 3300048925 Bacteria 2040
1730 Ga0496122_0116276 3300048925 Bacteria 1740
1731 Ga0496123_0010549 3300048926 Bacteria 8145
1732 Ga0496123_0041585 3300048926 Bacteria 3183
1733 Ga0496123_0041888 3300048926 Bacteria 3168
1734 Ga0496123_0194316 3300048926 Bacteria 1046
1735 Ga0496124_0036402 3300048927 Bacteria 4294
1736 Ga0496124_0057421 3300048927 Bacteria 3279
1737 Ga0496124_0092914 3300048927 Bacteria 2457
1738 Ga0496124_0104184 3300048927 Bacteria 2294
1739 Ga0496124_0191797 3300048927 Bacteria 1563
1740 Ga0496124_0274037 3300048927 Bacteria 1234
1741 Ga0496124_0304603 3300048927 Bacteria 1149
1742 Ga0496125_0000328 3300048928 Bacteria 91806
1743 Ga0496125_0000407 3300048928 Bacteria 80570
1744 Ga0496125_0023759 3300048928 Bacteria 5651
1745 Ga0496125_0026887 3300048928 Bacteria 5226
1746 Ga0496125_0052055 3300048928 Bacteria 3370
1747 Ga0496125_0057775 3300048928 Bacteria 3139
1748 Ga0496125_0093298 3300048928 Bacteria 2247
1749 Ga0496125_0183626 3300048928 Bacteria 1390
1750 Ga0496126_0002944 3300048929 Bacteria 22128
1751 Ga0496126_0015944 3300048929 Bacteria 7536
1752 Ga0496126_0022058 3300048929 Bacteria 6204
1753 Ga0496126_0026314 3300048929 Bacteria 5580
1754 Ga0496126_0033530 3300048929 Bacteria 4829
1755 Ga0496126_0069770 3300048929 Bacteria 3133
1756 Ga0496126_0073081 3300048929 Bacteria 3049
1757 Ga0496126_0084695 3300048929 Bacteria 2796
1758 Ga0496126_0086187 3300048929 Bacteria 2768
1759 Ga0496126_0119982 3300048929 Bacteria 2282
1760 Ga0496126_0181126 3300048929 Bacteria 1790
1761 Ga0496126_0200307 3300048929 Bacteria 1686
1762 Ga0496126_0216838 3300048929 Bacteria 1609
1763 Ga0496126_0279367 3300048929 Bacteria 1384
1764 Ga0496126_0320487 3300048929 Bacteria 1274
1765 Ga0496126_0391559 3300048929 Bacteria 1129
1766 Ga0496126_0395003 3300048929 Bacteria 1123
1767 Ga0496126_0422013 3300048929 Bacteria 1078
1768 Ga0495682_0027899 3300049460 Bacteria 2093
1769 Ga0501031_0019691 3300049568 Bacteria 4396
1770 Ga0501031_0036126 3300049568 Bacteria 3223
1771 Ga0501032_0000475 3300049569 Bacteria 32423
1772 Ga0501032_0008230 3300049569 Bacteria 7602
1773 Ga0501032_0047597 3300049569 Bacteria 2895
1774 Ga0501032_0077047 3300049569 Bacteria 2220
1775 Ga0501032_0083346 3300049569 Bacteria 2126
1776 Ga0501032_0204455 3300049569 Bacteria 1288
1777 Ga0501032_0225404 3300049569 Bacteria 1219
1778 Ga0501032_0233681 3300049569 Bacteria 1195
1779 Ga0501033_0000440 3300049570 Bacteria 39822
1780 Ga0501033_0001499 3300049570 Bacteria 20673
1781 Ga0501033_0015169 3300049570 Bacteria 5847
1782 Ga0501033_0055525 3300049570 Bacteria 2928
1783 Ga0501033_0089360 3300049570 Bacteria 2253
1784 Ga0501033_0100724 3300049570 Bacteria 2108
1785 Ga0501033_0108247 3300049570 Bacteria 2024
1786 Ga0501033_0110542 3300049570 Bacteria 2000
1787 Ga0501033_0181846 3300049570 Bacteria 1507
1788 Ga0501033_0183877 3300049570 Bacteria 1497
1789 Ga0501033_0232590 3300049570 Bacteria 1309
1790 Ga0501034_0000250 3300049571 Bacteria 99407
1791 Ga0501034_0000286 3300049571 Bacteria 90126
1792 Ga0501034_0016008 3300049571 Bacteria 7698
1793 Ga0501034_0017998 3300049571 Bacteria 7248
1794 Ga0501034_0086116 3300049571 Bacteria 3143
1795 Ga0501034_0282544 3300049571 Bacteria 1599
1796 Ga0501034_0317717 3300049571 Bacteria 1491
1797 Ga0501036_0000098 3300049572 Bacteria 54252
1798 Ga0501036_0000118 3300049572 Bacteria 49383
1799 Ga0501036_0039965 3300049572 Bacteria 3968
1800 Ga0501036_0041038 3300049572 Bacteria 3916
1801 Ga0501036_0056697 3300049572 Bacteria 3319
1802 Ga0501036_0061100 3300049572 Bacteria 3191
1803 Ga0501036_0118974 3300049572 Bacteria 2231
1804 Ga0501036_0138010 3300049572 Bacteria 2058
1805 Ga0501037_0000092 3300049573 Bacteria 83924
1806 Ga0501037_0006812 3300049573 Bacteria 8353
1807 Ga0501037_0010464 3300049573 Bacteria 6812
1808 Ga0501037_0038799 3300049573 Bacteria 3508
1809 Ga0501037_0045631 3300049573 Bacteria 3216
1810 Ga0501037_0105157 3300049573 Bacteria 2034
1811 Ga0501037_0173603 3300049573 Bacteria 1531
1812 Ga0501037_0191107 3300049573 Bacteria 1449
1813 Ga0501038_0000059 3300049574 Bacteria 92319
1814 Ga0501038_0003448 3300049574 Bacteria 14742
1815 Ga0501038_0006869 3300049574 Bacteria 10512
1816 Ga0501038_0045822 3300049574 Bacteria 3794
1817 Ga0501038_0053622 3300049574 Bacteria 3470
1818 Ga0501038_0073971 3300049574 Bacteria 2883
1819 Ga0501038_0245348 3300049574 Bacteria 1420
1820 Ga0501038_0389701 3300049574 Bacteria 1079
1821 Ga0501038_0446136 3300049574 Bacteria 995
1822 Ga0501039_0000085 3300049575 Bacteria 70306
1823 Ga0501039_0031807 3300049575 Bacteria 4068
1824 Ga0501039_0039138 3300049575 Bacteria 3662
1825 Ga0501039_0041308 3300049575 Bacteria 3561
1826 Ga0501039_0056725 3300049575 Bacteria 3034
1827 Ga0501039_0087620 3300049575 Bacteria 2425
1828 Ga0501042_0023911 3300049578 Bacteria 4280
1829 Ga0501042_0063966 3300049578 Bacteria 2629
1830 Ga0501042_0493882 3300049578 Bacteria 889
1831 Ga0501043_0001889 3300049579 Bacteria 17947
1832 Ga0501043_0004952 3300049579 Bacteria 10775
1833 Ga0501043_0012702 3300049579 Bacteria 6584
1834 Ga0501043_0022014 3300049579 Bacteria 5000
1835 Ga0501043_0035424 3300049579 Bacteria 3926
1836 Ga0501043_0057515 3300049579 Bacteria 3053
1837 Ga0501043_0093310 3300049579 Bacteria 2366
1838 Ga0501043_0103540 3300049579 Bacteria 2236
1839 Ga0501043_0127740 3300049579 Bacteria 1993
1840 Ga0501043_0140231 3300049579 Bacteria 1893
1841 Ga0501043_0160047 3300049579 Bacteria 1759
1842 Ga0501043_0195367 3300049579 Bacteria 1572
1843 Ga0501043_0352222 3300049579 Bacteria 1118
1844 Ga0501043_0473485 3300049579 Bacteria 939
1845 Ga0501046_0000483 3300049580 Bacteria 39806
1846 Ga0501046_0050847 3300049580 Bacteria 3272
1847 Ga0501046_0075433 3300049580 Bacteria 2614
1848 Ga0501046_0101818 3300049580 Bacteria 2202
1849 Ga0501046_0173337 3300049580 Bacteria 1617
1850 Ga0501046_0233967 3300049580 Bacteria 1356
1851 Ga0501046_0450610 3300049580 Bacteria 925
1852 Ga0501047_0000022 3300049581 Bacteria 249062
1853 Ga0501047_0000097 3300049581 Bacteria 107310
1854 Ga0501047_0035421 3300049581 Bacteria 4822
1855 Ga0501047_0082864 3300049581 Bacteria 3083
1856 Ga0501047_0094732 3300049581 Bacteria 2864
1857 Ga0501047_0105578 3300049581 Bacteria 2697
1858 Ga0501047_0126511 3300049581 Bacteria 2436
1859 Ga0501047_0197121 3300049581 Bacteria 1875
1860 Ga0501047_0197426 3300049581 Bacteria 1874
1861 Ga0501047_0199409 3300049581 Bacteria 1862
1862 Ga0501047_0301859 3300049581 Bacteria 1443
1863 Ga0501047_0338192 3300049581 Bacteria 1343
1864 Ga0501047_0472768 3300049581 Bacteria 1081
1865 Ga0501048_0000522 3300049582 Bacteria 26987
1866 Ga0501048_0000821 3300049582 Bacteria 22904
1867 Ga0501048_0004230 3300049582 Bacteria 10938
1868 Ga0501048_0333172 3300049582 Bacteria 1081
1869 Ga0501067_0000510 3300049583 Bacteria 21249
1870 Ga0501067_0014598 3300049583 Bacteria 4348
1871 Ga0501067_0047604 3300049583 Bacteria 2378
1872 Ga0501067_0093305 3300049583 Unclassified 1671
1873 Ga0501067_0094982 3300049583 Bacteria 1655
1874 Ga0501067_0095935 3300049583 Bacteria 1647
1875 Ga0501067_0255904 3300049583 Bacteria 975
1876 Ga0501068_0001239 3300049584 Bacteria 13551
1877 Ga0501068_0006616 3300049584 Bacteria 6397
1878 Ga0501068_0025351 3300049584 Bacteria 3488
1879 Ga0501068_0045541 3300049584 Bacteria 2643
1880 Ga0501068_0097120 3300049584 Bacteria 1823
1881 Ga0501069_0000707 3300049585 Bacteria 15581
1882 Ga0501069_0040743 3300049585 Bacteria 2567
1883 Ga0501070_0005840 3300049586 Bacteria 10495
1884 Ga0501070_0037509 3300049586 Bacteria 4045
1885 Ga0501070_0039631 3300049586 Bacteria 3929
1886 Ga0501070_0055323 3300049586 Bacteria 3288
1887 Ga0501070_0065590 3300049586 Bacteria 3006
1888 Ga0501070_0067214 3300049586 Bacteria 2968
1889 Ga0501070_0104832 3300049586 Bacteria 2338
1890 Ga0501070_0210199 3300049586 Bacteria 1597
1891 Ga0501070_0212749 3300049586 Bacteria 1586
1892 Ga0501070_0221258 3300049586 Bacteria 1552
1893 Ga0501070_0252643 3300049586 Bacteria 1442
1894 Ga0501070_0345001 3300049586 Bacteria 1209
1895 Ga0501070_0469856 3300049586 Bacteria 1012
1896 Ga0501070_0484606 3300049586 Bacteria 994
1897 Ga0501071_0015263 3300049587 Bacteria 5271
1898 Ga0501071_0102548 3300049587 Bacteria 2110
1899 Ga0501071_0108813 3300049587 Bacteria 2047
1900 Ga0501071_0179113 3300049587 Bacteria 1588
1901 Ga0501071_0293036 3300049587 Bacteria 1233
1902 Ga0501072_0001923 3300049588 Bacteria 15457
1903 Ga0501072_0043896 3300049588 Bacteria 3515
1904 Ga0501072_0314070 3300049588 Bacteria 1245
1905 Ga0501073_0000955 3300049589 Bacteria 20800
1906 Ga0501073_0031647 3300049589 Bacteria 3774
1907 Ga0501073_0072009 3300049589 Bacteria 2407
1908 Ga0501073_0202072 3300049589 Bacteria 1374
1909 Ga0501073_0343440 3300049589 Bacteria 1030
1910 Ga0501074_0002275 3300049590 Bacteria 13361
1911 Ga0501074_0006843 3300049590 Bacteria 8236
1912 Ga0501074_0028474 3300049590 Bacteria 4049
1913 Ga0501074_0031430 3300049590 Bacteria 3846
1914 Ga0501074_0042683 3300049590 Bacteria 3281
1915 Ga0501074_0059730 3300049590 Bacteria 2747
1916 Ga0501074_0061940 3300049590 Bacteria 2695
1917 Ga0501076_0224081 3300049592 Bacteria 1537
1918 Ga0501076_0574203 3300049592 Bacteria 930
1919 Ga0501077_0103504 3300049593 Bacteria 1804
1920 Ga0501079_0003103 3300049741 Bacteria 12169
1921 Ga0501079_0055474 3300049741 Bacteria 3058
1922 Ga0501079_0199560 3300049741 Bacteria 1562
1923 Ga0501079_0242586 3300049741 Bacteria 1408
1924 Ga0501080_0000047 3300049742 Bacteria 76956
1925 Ga0501080_0009878 3300049742 Bacteria 8717
1926 Ga0501080_0022030 3300049742 Bacteria 5902
1927 Ga0501080_0031264 3300049742 Bacteria 4960
1928 Ga0501080_0037799 3300049742 Bacteria 4507
1929 Ga0501080_0049324 3300049742 Bacteria 3919
1930 Ga0501080_0065376 3300049742 Bacteria 3383
1931 Ga0501080_0075608 3300049742 Bacteria 3133
1932 Ga0501080_0079680 3300049742 Bacteria 3045
1933 Ga0501080_0123108 3300049742 Bacteria 2402
1934 Ga0501080_0203918 3300049742 Bacteria 1815
1935 Ga0501081_0055518 3300049743 Bacteria 2737
1936 Ga0501081_0241692 3300049743 Bacteria 1317
1937 Ga0501081_0330208 3300049743 Bacteria 1122
1938 Ga0501083_0000808 3300049744 Bacteria 20535
1939 Ga0501083_0007229 3300049744 Bacteria 7884
1940 Ga0501083_0013360 3300049744 Bacteria 5741
1941 Ga0501083_0045709 3300049744 Bacteria 2961
1942 Ga0501083_0059138 3300049744 Bacteria 2564
1943 Ga0501083_0063302 3300049744 Bacteria 2467
1944 Ga0501083_0135591 3300049744 Bacteria 1613
1945 Ga0501083_0157872 3300049744 Bacteria 1484
1946 Ga0501083_0208181 3300049744 Bacteria 1275
1947 Ga0501035_0000240 3300049822 Bacteria 65635
1948 Ga0501035_0001276 3300049822 Bacteria 26011
1949 Ga0501035_0005844 3300049822 Bacteria 11604
1950 Ga0501035_0008993 3300049822 Bacteria 9289
1951 Ga0501035_0080808 3300049822 Bacteria 2870
1952 Ga0501035_0167522 3300049822 Bacteria 1899
1953 Ga0501035_0211585 3300049822 Bacteria 1658
1954 Ga0501035_0258695 3300049822 Bacteria 1476
1955 Ga0501035_0333829 3300049822 Bacteria 1271
1956 Ga0501044_0000072 3300049823 Bacteria 124143
1957 Ga0501044_0000122 3300049823 Bacteria 93246
1958 Ga0501044_0025318 3300049823 Bacteria 6288
1959 Ga0501044_0047773 3300049823 Bacteria 4426
1960 Ga0501044_0056754 3300049823 Bacteria 4020
1961 Ga0501044_0058319 3300049823 Bacteria 3959
1962 Ga0501044_0065427 3300049823 Bacteria 3707
1963 Ga0501044_0097979 3300049823 Bacteria 2952
1964 Ga0501044_0187642 3300049823 Bacteria 2031
1965 Ga0501044_0193433 3300049823 Bacteria 1995
1966 Ga0501044_0278162 3300049823 Bacteria 1608
1967 Ga0501044_0282993 3300049823 Bacteria 1591
1968 Ga0501044_0392472 3300049823 Bacteria 1301
1969 Ga0501045_0027715 3300049824 Bacteria 4084
1970 Ga0501045_0165744 3300049824 Bacteria 1646
1971 Ga0501045_0276571 3300049824 Bacteria 1250
1972 nmdc:mga03683_163888_c1 3300050489 Bacteria 1008
1973 nmdc:mga03683_42133_c1 3300050489 Bacteria 1877
1974 nmdc:mga03683_57061_c1 3300050489 Bacteria 1643
1975 nmdc:mga03683_79303_c1 3300050489 Bacteria 1415
1976 nmdc:mga03n38_19891_c1 3300050490 Bacteria 2676
1977 nmdc:mga03n38_42929_c1 3300050490 Bacteria 1979
1978 nmdc:mga03n38_5778_c1 3300050490 Bacteria 4246
1979 nmdc:mga00v17_15563_c1 3300050491 Bacteria 4270
1980 nmdc:mga00v17_36286_c1 3300050491 Bacteria 2937
1981 nmdc:mga0yw44_147214_c1 3300050492 Bacteria 1534
1982 nmdc:mga0yw44_2639_c1 3300050492 Bacteria 7723
1983 nmdc:mga0yw44_46826_c1 3300050492 Bacteria 2599
1984 nmdc:mga0yw44_95715_c1 3300050492 Bacteria 1884
1985 nmdc:mga0k408_21946_c1 3300050493 Bacteria 3591
1986 nmdc:mga0k408_252332_c1 3300050493 Bacteria 1053
1987 nmdc:mga0k408_261781_c1 3300050493 Bacteria 1033
1988 nmdc:mga0k408_30659_c1 3300050493 Bacteria 3067
1989 nmdc:mga0k408_39149_c1 3300050493 Bacteria 2723
1990 nmdc:mga0k408_59277_c1 3300050493 Bacteria 2224
1991 nmdc:mga06z11_160880_c1 3300050494 Bacteria 1283
1992 nmdc:mga06z11_2466_c1 3300050494 Bacteria 7069
1993 nmdc:mga04h51_14665_c1 3300050495 Bacteria 2244
1994 nmdc:mga07m45_15602_c1 3300050496 Bacteria 4057
1995 nmdc:mga07m45_31423_c1 3300050496 Bacteria 2943
1996 nmdc:mga07m45_32616_c1 3300050496 Bacteria 2888
1997 nmdc:mga07m45_35038_c1 3300050496 Bacteria 2791
1998 nmdc:mga07m45_43662_c1 3300050496 Bacteria 2514
1999 nmdc:mga07m45_68239_c1 3300050496 Bacteria 2021
2000 nmdc:mga05p37_10573_c1 3300050507 Bacteria 10943
2001 nmdc:mga05p37_151024_c1 3300050507 Bacteria 2841
2002 nmdc:mga05p37_36662_c1 3300050507 Bacteria 6014
2003 nmdc:mga05p37_863_c1 3300050507 Bacteria 34108
2004 nmdc:mga09592_1701_c1 3300050508 Bacteria 17738
2005 nmdc:mga0qj67_1189_c1 3300050509 Bacteria 18042
2006 nmdc:mga0qj67_445_c1 3300050509 Bacteria 28226
2007 nmdc:mga06r32_6584_c1 3300050510 Bacteria 10438
2008 nmdc:mga08y16_128308_c1 3300050511 Unclassified 2638
2009 nmdc:mga08y16_13856_c1 3300050511 Bacteria 8486
2010 nmdc:mga08y16_179101_c1 3300050511 Bacteria 2201
2011 nmdc:mga08y16_2133_c1 3300050511 Bacteria 20270
2012 nmdc:mga08y16_21765_c1 3300050511 Bacteria 6766
2013 nmdc:mga08y16_644738_c1 3300050511 Bacteria 1064
2014 nmdc:mga08y16_78483_c1 3300050511 Bacteria 3442
2015 nmdc:mga0n895_26341_c1 3300050512 Bacteria 5505
2016 nmdc:mga0n895_2738_c1 3300050512 Bacteria 8288
2017 nmdc:mga0n895_332932_c1 3300050512 Bacteria 1538
2018 nmdc:mga0n895_427_c1 3300050512 Bacteria 28261
2019 nmdc:mga0n895_55_c1 3300050512 Bacteria 66529
2020 nmdc:mga0rr50_15797_c1 3300050513 Bacteria 4994
2021 nmdc:mga0rr50_272144_c1 3300050513 Bacteria 1412
2022 nmdc:mga0rr50_81453_c1 3300050513 Bacteria 2498
2023 nmdc:mga0a205_2491_c1 3300050515 Bacteria 16230
2024 nmdc:mga0a205_62861_c1 3300050515 Bacteria 3587
2025 nmdc:mga0sz30_58435_c1 3300050516 Bacteria 1323
2026 Ga0495601_0001987 3300053077 Bacteria 11450
2027 Ga0495601_0002133 3300053077 Bacteria 11131
2028 Ga0495601_0017401 3300053077 Bacteria 4362
2029 Ga0495601_0018323 3300053077 Bacteria 4259
2030 Ga0495601_0023764 3300053077 Bacteria 3768
2031 Ga0495601_0035959 3300053077 Bacteria 3093
2032 Ga0495601_0079528 3300053077 Bacteria 2102
2033 Ga0495601_0315763 3300053077 Bacteria 1017
2034 Ga0495612_0000243 3300053078 Bacteria 22586
2035 Ga0495612_0004160 3300053078 Bacteria 5997
2036 Ga0495612_0108765 3300053078 Bacteria 1185
2037 Ga0500610_0149213 3300053079 Bacteria 1173
2038 Ga0495595_0003024 3300053084 Bacteria 6650
2039 Ga0495595_0008950 3300053084 Bacteria 4128
2040 Ga0495595_0009151 3300053084 Bacteria 4092
2041 Ga0495595_0010093 3300053084 Bacteria 3920
2042 Ga0495595_0023372 3300053084 Bacteria 2720
2043 Ga0495595_0034011 3300053084 Bacteria 2303
2044 Ga0495595_0145200 3300053084 Bacteria 1165
2045 Ga0495619_0000139 3300053085 Bacteria 54165
2046 Ga0495619_0000330 3300053085 Bacteria 33168
2047 Ga0495619_0001222 3300053085 Bacteria 16829
2048 Ga0495619_0001830 3300053085 Bacteria 14136
2049 Ga0495619_0012438 3300053085 Bacteria 5360
2050 Ga0495619_0028591 3300053085 Bacteria 3597
2051 Ga0495619_0038733 3300053085 Bacteria 3110
2052 Ga0495619_0056307 3300053085 Bacteria 2606
2053 Ga0495619_0143799 3300053085 Bacteria 1643
2054 Ga0495619_0201845 3300053085 Bacteria 1377
2055 Ga0500643_000063 3300053087 Bacteria 122135
2056 Ga0500644_0108270 3300053088 Bacteria 1066
2057 Ga0500581_090861 3300053089 Bacteria 1513
2058 Ga0500646_0007427 3300053090 Bacteria 2802
2059 Ga0500647_0028092 3300053091 Bacteria 2661
2060 Ga0500583_0030333 3300053092 Bacteria 2367
2061 Ga0500651_0005704 3300053093 Bacteria 7129
2062 Ga0500651_0007402 3300053093 Bacteria 6409
2063 Ga0500651_0094553 3300053093 Bacteria 1837
2064 Ga0500566_0000151 3300053094 Bacteria 35674
2065 Ga0500566_0000236 3300053094 Bacteria 29461
2066 Ga0500566_0000247 3300053094 Bacteria 28953
2067 Ga0500566_0015485 3300053094 Bacteria 4476
2068 Ga0500641_0006119 3300053096 Bacteria 4264
2069 Ga0500641_0011386 3300053096 Bacteria 3226
2070 Ga0500641_0018450 3300053096 Bacteria 2624
2071 Ga0500641_0021622 3300053096 Bacteria 2455
2072 Ga0500641_0218273 3300053096 Bacteria 809
2073 Ga0500650_0004779 3300053098 Bacteria 4953
2074 Ga0500650_0097644 3300053098 Bacteria 1376
2075 Ga0500650_0101342 3300053098 Bacteria 1347
2076 Ga0500650_0106935 3300053098 Bacteria 1307
2077 Ga0500554_002974 3300053102 Bacteria 3403
2078 Ga0500554_110457 3300053102 Bacteria 924
2079 Ga0500556_0000006 3300053104 Bacteria 453982
2080 Ga0500557_000037 3300053105 Bacteria 71114
2081 Ga0500569_004907 3300053109 Bacteria 2843
2082 Ga0500569_030594 3300053109 Bacteria 1508
2083 Ga0500569_090435 3300053109 Bacteria 991
2084 Ga0500572_001270 3300053111 Bacteria 7065
2085 Ga0500592_000189 3300053116 Bacteria 11829
2086 Ga0500592_008283 3300053116 Bacteria 1650
2087 Ga0500593_022901 3300053117 Bacteria 2761
2088 Ga0500595_005148 3300053119 Bacteria 5739
2089 Ga0500595_006181 3300053119 Bacteria 5123
2090 Ga0500595_007015 3300053119 Bacteria 4718
2091 Ga0500595_012681 3300053119 Bacteria 3250
2092 Ga0500595_013452 3300053119 Bacteria 3133
2093 Ga0500595_013641 3300053119 Bacteria 3109
2094 Ga0500595_023699 3300053119 Bacteria 2153
2095 Ga0500607_023497 3300053121 Bacteria 3453
2096 Ga0500607_026533 3300053121 Bacteria 3220
2097 Ga0500608_004120 3300053122 Bacteria 5573
2098 Ga0500608_017789 3300053122 Bacteria 3234
2099 Ga0500608_021338 3300053122 Bacteria 2992
2100 Ga0500642_0000004 3300053130 Bacteria 433122
2101 Ga0500642_0000062 3300053130 Bacteria 58970
2102 Ga0500642_0003645 3300053130 Bacteria 4687
2103 Ga0500652_000555 3300053131 Bacteria 13010
2104 Ga0500652_007548 3300053131 Bacteria 3567
2105 Ga0500655_037189 3300053133 Bacteria 949
2106 Ga0500658_0063629 3300053134 Bacteria 1541
2107 Ga0500559_0000179 3300053136 Bacteria 50232
2108 Ga0500559_0006133 3300053136 Bacteria 5442
2109 Ga0500559_0015873 3300053136 Bacteria 3179
2110 Ga0500568_0003071 3300053139 Bacteria 9536
2111 Ga0500568_0014034 3300053139 Bacteria 3631
2112 Ga0500568_0016646 3300053139 Bacteria 3262
2113 Ga0500568_0024462 3300053139 Bacteria 2557
2114 Ga0500568_0030451 3300053139 Bacteria 2234
2115 Ga0500568_0039632 3300053139 Bacteria 1900
2116 Ga0500573_0112425 3300053140 Bacteria 1522
2117 Ga0500577_0000470 3300053142 Bacteria 10444
2118 Ga0500577_0080270 3300053142 Bacteria 1299
2119 Ga0500586_002011 3300053145 Bacteria 4468
2120 Ga0500588_0018770 3300053146 Bacteria 1828
2121 Ga0500588_0023611 3300053146 Bacteria 1688
2122 Ga0500588_0094409 3300053146 Bacteria 1022
2123 Ga0500590_032675 3300053148 Bacteria 2698
2124 Ga0500616_0000022 3300053153 Bacteria 460463
2125 Ga0500616_0003813 3300053153 Bacteria 11186
2126 Ga0500616_0073671 3300053153 Bacteria 1733
2127 Ga0500620_010224 3300053155 Bacteria 2459
2128 Ga0500622_0025609 3300053156 Bacteria 3116
2129 Ga0500622_0033524 3300053156 Bacteria 2692
2130 Ga0500622_0063226 3300053156 Bacteria 1884
2131 Ga0500627_0007472 3300053158 Bacteria 3808
2132 Ga0500627_0037129 3300053158 Bacteria 2078
2133 Ga0500627_0130371 3300053158 Bacteria 1135
2134 Ga0500634_0018999 3300053161 Bacteria 3697
2135 Ga0500634_0175359 3300053161 Bacteria 971
2136 Ga0500638_000539 3300053162 Bacteria 9511
2137 Ga0500638_058426 3300053162 Bacteria 1857
2138 Ga0500639_182872 3300053163 Bacteria 923
2139 Ga0500636_0000349 3300053177 Bacteria 25486
2140 Ga0500636_0002876 3300053177 Bacteria 9627
2141 Ga0500637_0023445 3300053178 Bacteria 3375
2142 Ga0500637_0083261 3300053178 Bacteria 1849
2143 Ga0500625_001277 3300053729 Bacteria 8427
2144 Ga0500609_005039 3300053731 Bacteria 1808
2145 Ga0500596_000909 3300053735 Bacteria 5920
2146 Ga0500596_004995 3300053735 Bacteria 2377
2147 Ga0500601_000601 3300053737 Bacteria 5134
2148 Ga0501084_0026071 3300054114 Bacteria 4876
2149 Ga0501084_0064354 3300054114 Bacteria 3069
2150 Ga0501084_0854191 3300054114 Bacteria 766
2151 Ga0500661_000348 3300055283 Bacteria 8437
2152 Ga0501082_0001185 3300060353 Bacteria 22911
2153 Ga0501082_0018750 3300060353 Bacteria 5962
2154 Ga0501082_0074667 3300060353 Bacteria 2920
2155 Ga0501082_0098506 3300060353 Bacteria 2528
2156 Ga0501082_0198013 3300060353 Bacteria 1748
2157 Ga0501082_0494549 3300060353 Bacteria 1069
2158 Ga0466962_0081670 3300061719 Bacteria 1546
2159 Ga0466962_0083641 3300061719 Bacteria 1527

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300054114 Ga0501084_0854191 Ga0501084_0854191_19_753 244
2 3300053096 Ga0500641_0218273 Ga0500641_0218273_10_750 245
3 3300049592 Ga0501076_0574203 Ga0501076_0574203_135_911 246
4 3300006846 Ga0075430_100015106 Ga0075430_1000151067 255
5 3300050509 nmdc:mga0qj67_445_c1 nmdc:mga0qj67_445_c1_19805_20644 255
6 3300035695 Ga0373927_0231919 Ga0373927_0231919_393_1169 258
7 3300046459 Ga0495629_0138131 Ga0495629_0138131_33_809 258
8 3300048918 Ga0496115_0231335 Ga0496115_0231335_568_1410 258
9 3300006177 Ga0075362_10190409 Ga0075362_101904091 260
10 3300006844 Ga0075428_100166474 Ga0075428_1001664743 260
11 3300006880 Ga0075429_100386651 Ga0075429_1003866511 260
12 3300050489 nmdc:mga03683_163888_c1 nmdc:mga03683_163888_c1_140_979 260
13 3300050507 nmdc:mga05p37_151024_c1 nmdc:mga05p37_151024_c1_252_1091 260
14 3300050516 nmdc:mga0sz30_58435_c1 nmdc:mga0sz30_58435_c1_120_962 260
15 3300005548 Ga0070665_100467261 Ga0070665_1004672612 261
16 3300028379 Ga0268266_10161936 Ga0268266_101619362 261
17 3300039450 Ga0436363_0926778 Ga0436363_0926778_46_855 265
18 3300039453 Ga0436362_0693408 Ga0436362_0693408_32_838 266
19 3300053084 Ga0495595_0010093 Ga0495595_0010093_260_1093 266
20 3300049586 Ga0501070_0252643 Ga0501070_0252643_461_1321 267
21 3300049742 Ga0501080_0049324 Ga0501080_0049324_701_1561 267
22 3300049744 Ga0501083_0135591 Ga0501083_0135591_545_1405 267
23 3300053085 Ga0495619_0038733 Ga0495619_0038733_2288_3091 267
24 3300037068 Ga0373925_0021659 Ga0373925_0021659_3116_3922 268
25 3300037312 Ga0395899_0032437 Ga0395899_0032437_2380_3186 268
26 3300037418 Ga0395900_0128808 Ga0395900_0128808_989_1795 268
27 3300037466 Ga0395898_0238773 Ga0395898_0238773_697_1503 268
28 3300038443 Ga0395901_0250229 Ga0395901_0250229_203_1009 268
29 3300039437 Ga0436365_1714553 Ga0436365_1714553_201_1007 268
30 3300049570 Ga0501033_0181846 Ga0501033_0181846_124_930 268
31 3300049570 Ga0501033_0232590 Ga0501033_0232590_400_1206 268
32 3300049571 Ga0501034_0317717 Ga0501034_0317717_213_1019 268
33 3300049572 Ga0501036_0118974 Ga0501036_0118974_237_1043 268
34 3300049574 Ga0501038_0003448 Ga0501038_0003448_7581_8411 268
35 3300049589 Ga0501073_0072009 Ga0501073_0072009_650_1459 268
36 3300060353 Ga0501082_0198013 Ga0501082_0198013_188_1027 268
37 iso_pu_bacteria 2643221733 2644730968 268
38 iso_pu_bacteria 2643221734 2644734838 268
39 iso_pu_bacteria 2643221736 2644746486 268
40 iso_pu_bacteria 2818991467 2819722257 268
41 iso_pu_bacteria 2841760612 2841765000 268
42 iso_pu_bacteria 2844104063 2844107552 268
43 iso_pu_bacteria 2851182111 2851183701 268
44 iso_pu_bacteria 2851246043 2851249658 268
45 iso_pu_bacteria 2917699015 2917703041 268
46 iso_pu_bacteria 8057529695 8057532968 268
47 3300050489 nmdc:mga03683_42133_c1 nmdc:mga03683_42133_c1_479_1288 269
48 3300050493 nmdc:mga0k408_21946_c1 nmdc:mga0k408_21946_c1_2628_3437 269
49 3300005295 Ga0065707_10006094 Ga0065707_100060943 270
50 3300005330 Ga0070690_100012428 Ga0070690_1000124287 270
51 3300005335 Ga0070666_10001254 Ga0070666_100012547 270
52 3300005339 Ga0070660_100282819 Ga0070660_1002828191 270
53 3300005340 Ga0070689_100017774 Ga0070689_1000177743 270
54 3300005354 Ga0070675_100326135 Ga0070675_1003261352 270
55 3300005355 Ga0070671_100090457 Ga0070671_1000904572 270
56 3300005367 Ga0070667_100011934 Ga0070667_1000119342 270
57 3300005434 Ga0070709_10046391 Ga0070709_100463913 270
58 3300005435 Ga0070714_100014018 Ga0070714_1000140187 270
59 3300005435 Ga0070714_100140603 Ga0070714_1001406032 270
60 3300005436 Ga0070713_100000749 Ga0070713_1000007497 270
61 3300005437 Ga0070710_10007104 Ga0070710_100071043 270
62 3300005445 Ga0070708_100104863 Ga0070708_1001048633 270
63 3300005466 Ga0070685_10002009 Ga0070685_100020092 270
64 3300005544 Ga0070686_100004861 Ga0070686_1000048611 270
65 3300005547 Ga0070693_100044496 Ga0070693_1000444963 270
66 3300005564 Ga0070664_100072515 Ga0070664_1000725153 270
67 3300005937 Ga0081455_10014333 Ga0081455_100143337 270
68 3300005983 Ga0081540_1048404 Ga0081540_10484042 270
69 3300006028 Ga0070717_10039944 Ga0070717_100399443 270
70 3300006028 Ga0070717_10263088 Ga0070717_102630882 270
71 3300006163 Ga0070715_10001906 Ga0070715_100019062 270
72 3300006173 Ga0070716_100001657 Ga0070716_1000016575 270
73 3300006175 Ga0070712_100024546 Ga0070712_1000245462 270
74 3300006194 Ga0075427_10000365 Ga0075427_100003652 270
75 3300006237 Ga0097621_100014206 Ga0097621_1000142064 270
76 3300006852 Ga0075433_10117947 Ga0075433_101179472 270
77 3300006871 Ga0075434_100000647 Ga0075434_10000064721 270
78 3300006871 Ga0075434_100081344 Ga0075434_1000813441 270
79 3300006871 Ga0075434_100082007 Ga0075434_1000820072 270
80 3300006880 Ga0075429_100000451 Ga0075429_10000045120 270
81 3300006881 Ga0068865_100010595 Ga0068865_1000105958 270
82 3300007076 Ga0075435_100003880 Ga0075435_10000388011 270
83 3300009011 Ga0105251_10048371 Ga0105251_100483711 270
84 3300009094 Ga0111539_10002056 Ga0111539_100020569 270
85 3300009147 Ga0114129_10006700 Ga0114129_100067002 270
86 3300009148 Ga0105243_10006975 Ga0105243_100069755 270
87 3300009176 Ga0105242_10049041 Ga0105242_100490412 270
88 3300009177 Ga0105248_10038276 Ga0105248_100382762 270
89 3300009545 Ga0105237_10223905 Ga0105237_102239053 270
90 3300009551 Ga0105238_10097925 Ga0105238_100979254 270
91 3300009553 Ga0105249_10115854 Ga0105249_101158543 270
92 3300013297 Ga0157378_10078751 Ga0157378_100787514 270
93 3300014325 Ga0163163_10158656 Ga0163163_101586562 270
94 3300025898 Ga0207692_10019032 Ga0207692_100190322 270
95 3300025900 Ga0207710_10000734 Ga0207710_1000073421 270
96 3300025905 Ga0207685_10013733 Ga0207685_100137331 270
97 3300025906 Ga0207699_10002977 Ga0207699_100029774 270
98 3300025907 Ga0207645_10011508 Ga0207645_100115084 270
99 3300025915 Ga0207693_10002937 Ga0207693_1000293710 270
100 3300025919 Ga0207657_10057036 Ga0207657_100570362 270
101 3300025928 Ga0207700_10010167 Ga0207700_100101672 270
102 3300025929 Ga0207664_10048578 Ga0207664_100485782 270
103 3300025929 Ga0207664_10081559 Ga0207664_100815592 270
104 3300025931 Ga0207644_10011436 Ga0207644_100114368 270
105 3300025934 Ga0207686_10024638 Ga0207686_100246381 270
106 3300025941 Ga0207711_10011159 Ga0207711_100111594 270
107 3300025942 Ga0207689_10134681 Ga0207689_101346812 270
108 3300025944 Ga0207661_10193687 Ga0207661_101936872 270
109 3300026023 Ga0207677_10079428 Ga0207677_100794282 270
110 3300026075 Ga0207708_10021696 Ga0207708_100216961 270
111 3300026089 Ga0207648_10122872 Ga0207648_101228722 270
112 3300026095 Ga0207676_10026824 Ga0207676_100268242 270
113 3300026121 Ga0207683_10001459 Ga0207683_1000145913 270
114 3300027907 Ga0207428_10000180 Ga0207428_1000018066 270
115 3300028379 Ga0268266_10006553 Ga0268266_100065532 270
116 3300034816 Ga0373930_0003413 Ga0373930_0003413_1241_2074 270
117 3300035083 Ga0373926_0007441 Ga0373926_0007441_697_1530 270
118 3300035084 Ga0373928_0029080 Ga0373928_0029080_146_979 270
119 3300035085 Ga0373929_0010781 Ga0373929_0010781_63_896 270
120 3300035111 Ga0373923_0023286 Ga0373923_0023286_1549_2382 270
121 3300035112 Ga0373932_0007946 Ga0373932_0007946_1484_2317 270
122 3300035171 Ga0373946_0002144 Ga0373946_0002144_1754_2587 270
123 3300035171 Ga0373946_0013913 Ga0373946_0013913_1621_2454 270
124 3300035207 Ga0373942_0031734 Ga0373942_0031734_403_1236 270
125 3300035241 Ga0373961_0020525 Ga0373961_0020525_635_1468 270
126 3300035410 Ga0373924_0107917 Ga0373924_0107917_222_1055 270
127 3300035691 Ga0373931_0007821 Ga0373931_0007821_535_1368 270
128 3300035695 Ga0373927_0016979 Ga0373927_0016979_1801_2634 270
129 3300035725 Ga0373947_0136574 Ga0373947_0136574_121_954 270
130 3300037068 Ga0373925_0061385 Ga0373925_0061385_1032_1865 270
131 3300046452 Ga0495617_033033 Ga0495617_033033_339_1172 270
132 3300046459 Ga0495629_0000588 Ga0495629_0000588_27245_28078 270
133 3300046472 Ga0495580_0046436 Ga0495580_0046436_337_1170 270
134 3300046473 Ga0495582_0006066 Ga0495582_0006066_1589_2422 270
135 3300046475 Ga0495639_0007375 Ga0495639_0007375_169_1002 270
136 3300046491 Ga0495584_0002387 Ga0495584_0002387_345_1178 270
137 3300046492 Ga0495585_0008207 Ga0495585_0008207_3380_4213 270
138 3300046499 Ga0495594_0003274 Ga0495594_0003274_4839_5672 270
139 3300046501 Ga0495607_0010697 Ga0495607_0010697_2513_3346 270
140 3300046516 Ga0495628_0127194 Ga0495628_0127194_1099_1932 270
141 3300046517 Ga0495630_0044580 Ga0495630_0044580_1208_2041 270
142 3300046520 Ga0495637_0110247 Ga0495637_0110247_13_846 270
143 3300046523 Ga0495644_0001475 Ga0495644_0001475_886_1719 270
144 3300046526 Ga0495666_0085973 Ga0495666_0085973_332_1165 270
145 3300046536 Ga0495587_0049923 Ga0495587_0049923_1207_2040 270
146 3300046537 Ga0495598_0032901 Ga0495598_0032901_467_1300 270
147 3300046538 Ga0495609_0060397 Ga0495609_0060397_669_1502 270
148 3300046543 Ga0495645_0212630 Ga0495645_0212630_386_1219 270
149 3300046557 Ga0495622_0013370 Ga0495622_0013370_145_978 270
150 3300046558 Ga0495633_0006799 Ga0495633_0006799_2734_3567 270
151 3300046615 Ga0495656_0000123 Ga0495656_0000123_19053_19886 270
152 3300046664 Ga0495659_0000648 Ga0495659_0000648_10095_10928 270
153 3300046674 Ga0495588_0008121 Ga0495588_0008121_2480_3313 270
154 3300046680 Ga0495646_0006980 Ga0495646_0006980_2627_3460 270
155 3300046681 Ga0495647_0002969 Ga0495647_0002969_4343_5176 270
156 3300046683 Ga0495658_0000601 Ga0495658_0000601_4061_4894 270
157 3300047315 Ga0495581_0003184 Ga0495581_0003184_2547_3380 270
158 3300047315 Ga0495581_0052214 Ga0495581_0052214_427_1260 270
159 3300047317 Ga0495604_0010825 Ga0495604_0010825_5332_6165 270
160 3300047321 Ga0495676_0084508 Ga0495676_0084508_1185_2018 270
161 3300047322 Ga0495680_0019326 Ga0495680_0019326_3503_4336 270
162 3300047446 Ga0495679_044824 Ga0495679_044824_12_845 270
163 3300047673 Ga0495593_0064383 Ga0495593_0064383_923_1756 270
164 3300048903 Ga0496100_0008582 Ga0496100_0008582_2572_3405 270
165 3300048905 Ga0496102_0093823 Ga0496102_0093823_708_1541 270
166 3300048906 Ga0496103_0013281 Ga0496103_0013281_522_1355 270
167 3300048907 Ga0496104_0012293 Ga0496104_0012293_2318_3151 270
168 3300048909 Ga0496106_0088327 Ga0496106_0088327_534_1367 270
169 3300048910 Ga0496107_0144002 Ga0496107_0144002_179_1012 270
170 3300048910 Ga0496107_0223620 Ga0496107_0223620_78_911 270
171 3300048911 Ga0496108_0055454 Ga0496108_0055454_1083_1916 270
172 3300048912 Ga0496109_0112207 Ga0496109_0112207_123_956 270
173 3300048914 Ga0496111_0031987 Ga0496111_0031987_465_1298 270
174 3300048916 Ga0496113_0026913 Ga0496113_0026913_2046_2879 270
175 3300048917 Ga0496114_0005384 Ga0496114_0005384_680_1513 270
176 3300048918 Ga0496115_0108631 Ga0496115_0108631_50_883 270
177 3300050507 nmdc:mga05p37_10573_c1 nmdc:mga05p37_10573_c1_219_1052 270
178 3300050507 nmdc:mga05p37_863_c1 nmdc:mga05p37_863_c1_18316_19149 270
179 3300050508 nmdc:mga09592_1701_c1 nmdc:mga09592_1701_c1_14960_15793 270
180 3300050509 nmdc:mga0qj67_1189_c1 nmdc:mga0qj67_1189_c1_3039_3872 270
181 3300050510 nmdc:mga06r32_6584_c1 nmdc:mga06r32_6584_c1_1528_2361 270
182 3300050511 nmdc:mga08y16_2133_c1 nmdc:mga08y16_2133_c1_6093_6926 270
183 3300050512 nmdc:mga0n895_427_c1 nmdc:mga0n895_427_c1_11246_12079 270
184 3300050513 nmdc:mga0rr50_15797_c1 nmdc:mga0rr50_15797_c1_718_1551 270
185 3300050513 nmdc:mga0rr50_81453_c1 nmdc:mga0rr50_81453_c1_393_1226 270
186 3300050515 nmdc:mga0a205_2491_c1 nmdc:mga0a205_2491_c1_315_1148 270
187 3300053085 Ga0495619_0001222 Ga0495619_0001222_13942_14775 270
188 3300028794 Ga0307515_10356527 Ga0307515_103565271 271
189 3300037312 Ga0395899_0095919 Ga0395899_0095919_853_1668 271
190 3300048916 Ga0496113_0186433 Ga0496113_0186433_41_871 271
191 3300048925 Ga0496122_0049845 Ga0496122_0049845_63_893 271
192 3300048925 Ga0496122_0077351 Ga0496122_0077351_493_1323 271
193 3300048926 Ga0496123_0010549 Ga0496123_0010549_6768_7598 271
194 3300048926 Ga0496123_0194316 Ga0496123_0194316_154_984 271
195 3300048927 Ga0496124_0191797 Ga0496124_0191797_134_964 271
196 3300048929 Ga0496126_0084695 Ga0496126_0084695_159_989 271
197 3300049583 Ga0501067_0047604 Ga0501067_0047604_1136_1966 271
198 3300049584 Ga0501068_0097120 Ga0501068_0097120_160_990 271
199 3300049586 Ga0501070_0055323 Ga0501070_0055323_1550_2380 271
200 3300049590 Ga0501074_0042683 Ga0501074_0042683_2321_3151 271
201 3300049742 Ga0501080_0037799 Ga0501080_0037799_1118_1948 271
202 3300053156 Ga0500622_0025609 Ga0500622_0025609_1514_2344 271
203 3300044656 Ga0466969_0118977 Ga0466969_0118977_291_1124 272
204 3300044684 Ga0466966_0064168 Ga0466966_0064168_1234_2067 272
205 3300044693 Ga0466961_0119230 Ga0466961_0119230_789_1622 272
206 3300045049 Ga0466959_0084047 Ga0466959_0084047_1412_2245 272
207 3300045836 Ga0466958_0031880 Ga0466958_0031880_286_1119 272
208 3300061719 Ga0466962_0083641 Ga0466962_0083641_177_1010 272
209 iso_pu_bacteria 2643221547 2643757991 273
210 3300002987 JGI25159J45721_1001633 JGI25159J45721_10016334 274
211 3300005262 Ga0065165_1001133 Ga0065165_100113312 274
212 3300005366 Ga0070659_100134448 Ga0070659_1001344482 274
213 3300025284 Ga0209130_1000045 Ga0209130_1000045213 274
214 3300046529 Ga0495652_0162932 Ga0495652_0162932_706_1557 274
215 3300046557 Ga0495622_0018113 Ga0495622_0018113_123_974 274
216 3300053119 Ga0500595_023699 Ga0500595_023699_1248_2099 274
217 iso_pu_bacteria 2513237096 2513658806 274
218 iso_pu_bacteria 2513237137 2513860813 274
219 iso_pu_bacteria 2513237145 2513921070 274
220 iso_pu_bacteria 2517572143 2517888835 274
221 iso_pu_bacteria 2524023228 2524537061 274
222 iso_pu_bacteria 2667528175 2671119951 274
223 iso_pu_bacteria 2728368998 2728754982 274
224 iso_pu_bacteria 2791355197 2793072923 274
225 iso_pu_bacteria 2874628541 2874628802 274
226 iso_pu_bacteria 2885374607 2885376147 274
227 iso_pu_bacteria 2903748898 2903748962 274
228 iso_pu_bacteria 2904690495 2904691198 274
229 iso_pu_bacteria 2904699407 2904708817 274
230 iso_pu_bacteria 2906610324 2906613866 274
231 iso_pu_bacteria 2906635258 2906642340 274
232 iso_pu_bacteria 2906660503 2906667368 274
233 iso_pu_bacteria 2908739725 2908747436 274
234 iso_pu_bacteria 2908756301 2908756594 274
235 iso_pu_bacteria 2922425934 2922434232 274
236 iso_pu_bacteria 2935630451 2935635519 274
237 iso_pu_bacteria 2941507105 2941512184 274
238 iso_pu_bacteria 2941515067 2941519886 274
239 iso_pu_bacteria 2941523033 2941528173 274
240 iso_pu_bacteria 3005474847 3005475054 274
241 iso_pu_bacteria 8006933436 8006936242 274
242 iso_pu_bacteria 8006973647 8006976187 274
243 iso_pu_bacteria 8019555841 8019562402 274
244 iso_pu_bacteria 8019565922 8019572472 274
245 iso_pu_bacteria 8056689827 8056690951 274
246 3300013105 Ga0157369_10255370 Ga0157369_102553701 275
247 3300049571 Ga0501034_0000286 Ga0501034_0000286_50496_51323 275
248 3300053139 Ga0500568_0014034 Ga0500568_0014034_627_1466 275
249 iso_pu_bacteria 2507262055 2507505238 275
250 iso_pu_bacteria 2508501009 2508539159 275
251 iso_pu_bacteria 2508501042 2508695477 275
252 iso_pu_bacteria 2508501128 2509152626 275
253 iso_pu_bacteria 2511231028 2511395425 275
254 iso_pu_bacteria 2513237092 2513625338 275
255 iso_pu_bacteria 2513237094 2513644157 275
256 iso_pu_bacteria 2513237095 2513651523 275
257 iso_pu_bacteria 2513237098 2513674595 275
258 iso_pu_bacteria 2513237101 2513695103 275
259 iso_pu_bacteria 2513237104 2513720311 275
260 iso_pu_bacteria 2513237139 2513873535 275
261 iso_pu_bacteria 2513237141 2513888759 275
262 iso_pu_bacteria 2513237161 2514012478 275
263 iso_pu_bacteria 2515154112 2515627435 275
264 iso_pu_bacteria 2517093001 2517107718 275
265 iso_pu_bacteria 2524023205 2524440897 275
266 iso_pu_bacteria 2524023210 2524467841 275
267 iso_pu_bacteria 2528768022 2528852930 275
268 iso_pu_bacteria 2617270735 2617352391 275
269 iso_pu_bacteria 2721755755 2723841635 275
270 iso_pu_bacteria 2744054633 2745081681 275
271 iso_pu_bacteria 2791355196 2793062035 275
272 iso_pu_bacteria 2791355199 2793082757 275
273 iso_pu_bacteria 2802429603 2805915619 275
274 iso_pu_bacteria 2816332527 2818237642 275
275 iso_pu_bacteria 2824600985 2824604592 275
276 iso_pu_bacteria 2824609381 2824612317 275
277 iso_pu_bacteria 2824653114 2824655182 275
278 iso_pu_bacteria 2824661429 2824669694 275
279 iso_pu_bacteria 2824671348 2824676632 275
280 iso_pu_bacteria 2824679649 2824684067 275
281 iso_pu_bacteria 2824687955 2824694694 275
282 iso_pu_bacteria 2824696289 2824703826 275
283 iso_pu_bacteria 2824704595 2824708936 275
284 iso_pu_bacteria 2824753945 2824759963 275
285 iso_pu_bacteria 2824763712 2824770397 275
286 iso_pu_bacteria 2824773399 2824775529 275
287 iso_pu_bacteria 2838122688 2838124506 275
288 iso_pu_bacteria 2841941048 2841945192 275
289 iso_pu_bacteria 2841949485 2841951974 275
290 iso_pu_bacteria 2841966195 2841970631 275
291 iso_pu_bacteria 2841974524 2841979980 275
292 iso_pu_bacteria 2841983080 2841985159 275
293 iso_pu_bacteria 2842038055 2842043517 275
294 iso_pu_bacteria 2842045827 2842052493 275
295 iso_pu_bacteria 2847930680 2847931065 275
296 iso_pu_bacteria 2847939898 2847942148 275
297 iso_pu_bacteria 2849076700 2849083028 275
298 iso_pu_bacteria 2857509624 2857511917 275
299 iso_pu_bacteria 2874590934 2874594438 275
300 iso_pu_bacteria 2874604998 2874608071 275
301 iso_pu_bacteria 2874612657 2874613443 275
302 iso_pu_bacteria 2874620515 2874624774 275
303 iso_pu_bacteria 2874645413 2874649811 275
304 iso_pu_bacteria 2876761206 2876768920 275
305 iso_pu_bacteria 2876771140 2876773930 275
306 iso_pu_bacteria 2876808645 2876815512 275
307 iso_pu_bacteria 2876818435 2876821810 275
308 iso_pu_bacteria 2879074833 2879078346 275
309 iso_pu_bacteria 2879083081 2879085899 275
310 iso_pu_bacteria 2879099564 2879108556 275
311 iso_pu_bacteria 2879110137 2879112164 275
312 iso_pu_bacteria 2879127579 2879130607 275
313 iso_pu_bacteria 2879142872 2879147116 275
314 iso_pu_bacteria 2881665667 2881668192 275
315 iso_pu_bacteria 2885366525 2885371035 275
316 iso_pu_bacteria 2885383462 2885388836 275
317 iso_pu_bacteria 2885409591 2885411669 275
318 iso_pu_bacteria 2888378607 2888379601 275
319 iso_pu_bacteria 2888388044 2888390689 275
320 iso_pu_bacteria 2888419890 2888420314 275
321 iso_pu_bacteria 2889033259 2889035498 275
322 iso_pu_bacteria 2903768456 2903770769 275
323 iso_pu_bacteria 2904666416 2904670271 275
324 iso_pu_bacteria 2904711408 2904713171 275
325 iso_pu_bacteria 2906626472 2906628964 275
326 iso_pu_bacteria 2906643746 2906649386 275
327 iso_pu_bacteria 2922361189 2922364007 275
328 iso_pu_bacteria 2922368715 2922368944 275
329 iso_pu_bacteria 2922386360 2922392559 275
330 iso_pu_bacteria 2922393267 2922394232 275
331 iso_pu_bacteria 2929615660 2929618593 275
332 iso_pu_bacteria 2929624759 2929628722 275
333 iso_pu_bacteria 2932784394 2932792915 275
334 iso_pu_bacteria 2932794094 2932794324 275
335 iso_pu_bacteria 2932801729 2932808082 275
336 iso_pu_bacteria 2932809354 2932812174 275
337 iso_pu_bacteria 2932818245 2932823164 275
338 iso_pu_bacteria 2932828146 2932836080 275
339 iso_pu_bacteria 2933577622 2933580695 275
340 iso_pu_bacteria 2935608549 2935615733 275
341 iso_pu_bacteria 2935616580 2935618513 275
342 iso_pu_bacteria 2935638405 2935641086 275
343 iso_pu_bacteria 2935648319 2935653649 275
344 iso_pu_bacteria 2935656913 2935662398 275
345 iso_pu_bacteria 2935665750 2935670002 275
346 iso_pu_bacteria 2935675223 2935679149 275
347 iso_pu_bacteria 2935684952 2935690016 275
348 iso_pu_bacteria 2935694250 2935698536 275
349 iso_pu_bacteria 2935703347 2935711472 275
350 iso_pu_bacteria 2935713505 2935717535 275
351 iso_pu_bacteria 2935722832 2935723795 275
352 iso_pu_bacteria 2935732158 2935740004 275
353 iso_pu_bacteria 2935741537 2935749267 275
354 iso_pu_bacteria 2935750917 2935757370 275
355 iso_pu_bacteria 2935760218 2935763544 275
356 iso_pu_bacteria 2935769743 2935773051 275
357 iso_pu_bacteria 2935777560 2935782994 275
358 iso_pu_bacteria 2935785616 2935787960 275
359 iso_pu_bacteria 2935793552 2935796464 275
360 iso_pu_bacteria 2935801545 2935809966 275
361 iso_pu_bacteria 2935810662 2935816272 275
362 iso_pu_bacteria 2935819856 2935825469 275
363 iso_pu_bacteria 2935827899 2935835665 275
364 iso_pu_bacteria 2935837841 2935844616 275
365 iso_pu_bacteria 2935847175 2935853258 275
366 iso_pu_bacteria 2935855204 2935862938 275
367 iso_pu_bacteria 2935864058 2935866680 275
368 iso_pu_bacteria 2935873716 2935874987 275
369 iso_pu_bacteria 2935883170 2935890142 275
370 iso_pu_bacteria 2935908558 2935914731 275
371 iso_pu_bacteria 2935916978 2935918707 275
372 iso_pu_bacteria 2935926038 2935931576 275
373 iso_pu_bacteria 2935934488 2935940173 275
374 iso_pu_bacteria 2935942939 2935947480 275
375 iso_pu_bacteria 2935951376 2935956252 275
376 iso_pu_bacteria 2935959822 2935962629 275
377 iso_pu_bacteria 2935967501 2935973045 275
378 iso_pu_bacteria 2935975950 2935980711 275
379 iso_pu_bacteria 2935984226 2935985135 275
380 iso_pu_bacteria 2935992306 2935999737 275
381 iso_pu_bacteria 2936002035 2936010565 275
382 iso_pu_bacteria 2936011229 2936016700 275
383 iso_pu_bacteria 2936019824 2936025333 275
384 iso_pu_bacteria 2936028420 2936034175 275
385 iso_pu_bacteria 2936037263 2936041277 275
386 iso_pu_bacteria 2936046547 2936052232 275
387 iso_pu_bacteria 2936055302 2936056307 275
388 iso_pu_bacteria 2940556831 2940563283 275
389 iso_pu_bacteria 2941531003 2941535522 275
390 iso_pu_bacteria 2941538514 2941543199 275
391 iso_pu_bacteria 3005506211 3005509167 275
392 iso_pu_bacteria 3005710791 3005710991 275
393 iso_pu_bacteria 8006926726 8006927883 275
394 iso_pu_bacteria 8006964411 8006969353 275
395 iso_pu_bacteria 8006984368 8006990915 275
396 iso_pu_bacteria 8006994254 8006996518 275
397 iso_pu_bacteria 8016511872 8016518191 275
398 iso_pu_bacteria 8016522445 8016526130 275
399 iso_pu_bacteria 8016530956 8016539742 275
400 iso_pu_bacteria 8016539877 8016544046 275
401 iso_pu_bacteria 8016548790 8016549261 275
402 iso_pu_bacteria 8016557553 8016557686 275
403 iso_pu_bacteria 8016566248 8016569450 275
404 iso_pu_bacteria 8016575299 8016582064 275
405 iso_pu_bacteria 8016595262 8016595719 275
406 iso_pu_bacteria 8016603502 8016606575 275
407 iso_pu_bacteria 8016613128 8016618476 275
408 iso_pu_bacteria 8016622563 8016623168 275
409 iso_pu_bacteria 8016630954 8016635637 275
410 iso_pu_bacteria 8017057580 8017058457 275
411 iso_pu_bacteria 8019530166 8019531018 275
412 iso_pu_bacteria 8019538911 8019540563 275
413 iso_pu_bacteria 8019547302 8019550184 275
414 iso_pu_bacteria 8019576017 8019577239 275
415 iso_pu_bacteria 8019586578 8019595319 275
416 iso_pu_bacteria 8019597564 8019606439 275
417 iso_pu_bacteria 8019608314 8019612088 275
418 iso_pu_bacteria 8019619141 8019622962 275
419 iso_pu_bacteria 8019638758 8019640467 275
420 iso_pu_bacteria 8019659431 8019666978 275
421 iso_pu_bacteria 8019668869 8019676735 275
422 iso_pu_bacteria 8019678201 8019679256 275
423 iso_pu_bacteria 8019687851 8019696249 275
424 iso_pu_bacteria 8055742211 8055742443 275
425 iso_pu_bacteria 8056673599 8056675736 275
426 iso_pu_bacteria 8056681323 8056687401 275
427 3300031595 Ga0265313_10000008 Ga0265313_10000008172 276
428 3300035115 Ga0373941_0018807 Ga0373941_0018807_230_1060 276
429 3300049568 Ga0501031_0036126 Ga0501031_0036126_2228_3058 276
430 3300049569 Ga0501032_0047597 Ga0501032_0047597_1844_2674 276
431 3300049569 Ga0501032_0225404 Ga0501032_0225404_23_853 276
432 3300049570 Ga0501033_0015169 Ga0501033_0015169_4459_5289 276
433 3300049570 Ga0501033_0110542 Ga0501033_0110542_145_975 276
434 3300049571 Ga0501034_0016008 Ga0501034_0016008_5107_5937 276
435 3300049571 Ga0501034_0017998 Ga0501034_0017998_6208_7038 276
436 3300049572 Ga0501036_0000118 Ga0501036_0000118_19264_20094 276
437 3300049572 Ga0501036_0041038 Ga0501036_0041038_1421_2251 276
438 3300049572 Ga0501036_0056697 Ga0501036_0056697_211_1041 276
439 3300049573 Ga0501037_0038799 Ga0501037_0038799_2518_3348 276
440 3300049573 Ga0501037_0191107 Ga0501037_0191107_312_1142 276
441 3300049574 Ga0501038_0446136 Ga0501038_0446136_36_977 276
442 3300049575 Ga0501039_0039138 Ga0501039_0039138_34_864 276
443 3300049579 Ga0501043_0004952 Ga0501043_0004952_905_1735 276
444 3300049579 Ga0501043_0160047 Ga0501043_0160047_694_1635 276
445 3300049579 Ga0501043_0195367 Ga0501043_0195367_529_1359 276
446 3300049579 Ga0501043_0352222 Ga0501043_0352222_125_1066 276
447 3300049580 Ga0501046_0101818 Ga0501046_0101818_480_1310 276
448 3300049580 Ga0501046_0233967 Ga0501046_0233967_449_1279 276
449 3300049581 Ga0501047_0000097 Ga0501047_0000097_50680_51510 276
450 3300049581 Ga0501047_0035421 Ga0501047_0035421_1326_2156 276
451 3300049581 Ga0501047_0472768 Ga0501047_0472768_82_1023 276
452 3300049582 Ga0501048_0000522 Ga0501048_0000522_9456_10286 276
453 3300049585 Ga0501069_0040743 Ga0501069_0040743_413_1243 276
454 3300049586 Ga0501070_0039631 Ga0501070_0039631_1073_1903 276
455 3300049586 Ga0501070_0065590 Ga0501070_0065590_2080_2910 276
456 3300049586 Ga0501070_0067214 Ga0501070_0067214_1386_2216 276
457 3300049586 Ga0501070_0212749 Ga0501070_0212749_197_1027 276
458 3300049586 Ga0501070_0469856 Ga0501070_0469856_95_925 276
459 3300049586 Ga0501070_0484606 Ga0501070_0484606_119_949 276
460 3300049587 Ga0501071_0108813 Ga0501071_0108813_784_1614 276
461 3300049588 Ga0501072_0043896 Ga0501072_0043896_2185_3015 276
462 3300049589 Ga0501073_0202072 Ga0501073_0202072_57_887 276
463 3300049589 Ga0501073_0343440 Ga0501073_0343440_41_871 276
464 3300049590 Ga0501074_0028474 Ga0501074_0028474_1003_1833 276
465 3300049590 Ga0501074_0061940 Ga0501074_0061940_1785_2615 276
466 3300049741 Ga0501079_0199560 Ga0501079_0199560_490_1320 276
467 3300049741 Ga0501079_0242586 Ga0501079_0242586_413_1243 276
468 3300049742 Ga0501080_0000047 Ga0501080_0000047_28650_29480 276
469 3300049742 Ga0501080_0031264 Ga0501080_0031264_1914_2855 276
470 3300049742 Ga0501080_0065376 Ga0501080_0065376_866_1696 276
471 3300049743 Ga0501081_0055518 Ga0501081_0055518_1788_2618 276
472 3300049744 Ga0501083_0007229 Ga0501083_0007229_3591_4421 276
473 3300049744 Ga0501083_0059138 Ga0501083_0059138_468_1298 276
474 3300049744 Ga0501083_0063302 Ga0501083_0063302_1231_2061 276
475 3300049822 Ga0501035_0001276 Ga0501035_0001276_16922_17752 276
476 3300049822 Ga0501035_0008993 Ga0501035_0008993_7259_8089 276
477 3300049822 Ga0501035_0333829 Ga0501035_0333829_116_1057 276
478 3300049823 Ga0501044_0065427 Ga0501044_0065427_2666_3496 276
479 3300049823 Ga0501044_0187642 Ga0501044_0187642_61_1002 276
480 3300049823 Ga0501044_0278162 Ga0501044_0278162_547_1377 276
481 3300049823 Ga0501044_0392472 Ga0501044_0392472_308_1138 276
482 3300049824 Ga0501045_0165744 Ga0501045_0165744_107_937 276
483 3300049824 Ga0501045_0276571 Ga0501045_0276571_54_995 276
484 3300060353 Ga0501082_0018750 Ga0501082_0018750_1724_2554 276
485 iso_pu_bacteria 2602042107 2603858518 276
486 iso_pu_bacteria 2857524615 2857526360 276
487 iso_pu_bacteria 2893066018 2893067370 276
488 iso_pu_bacteria 2919073203 2919073792 276
489 2162886007 SwRhRL2b_contig_2417348 SwRhRL2b_0166.00003340 277
490 2209111006 2214572730 2213616080 277
491 3300000041 ARcpr5oldR_c000196 ARcpr5oldR_0001968 277
492 3300000042 ARSoilYngRDRAFT_c00195 ARSoilYngRDRAFT_001955 277
493 3300000043 ARcpr5yngRDRAFT_c000005 ARcpr5yngRDRAFT_0000055 277
494 3300000044 ARSoilOldRDRAFT_c000003 ARSoilOldRDRAFT_0000035 277
495 3300000045 ARCol0oldRDRAFT_c00039 ARCol0oldRDRAFT_000398 277
496 3300000652 ARCol0yngRDRAFT_1000194 ARCol0yngRDRAFT_10001948 277
497 3300001430 JGI24032J14994_100504 JGI24032J14994_1005042 277
498 3300001976 JGI24752J21851_1000622 JGI24752J21851_10006224 277
499 3300001989 JGI24739J22299_10001072 JGI24739J22299_100010727 277
500 3300001990 JGI24737J22298_10000349 JGI24737J22298_1000034911 277
501 3300001990 JGI24737J22298_10006737 JGI24737J22298_100067372 277
502 3300001991 JGI24743J22301_10004104 JGI24743J22301_100041042 277
503 3300002070 JGI24750J21931_1000659 JGI24750J21931_10006595 277
504 3300002075 JGI24738J21930_10000803 JGI24738J21930_100008036 277
505 3300002076 JGI24749J21850_1000742 JGI24749J21850_10007424 277
506 3300002077 JGI24744J21845_10003153 JGI24744J21845_100031532 277
507 3300002126 JGI24035J26624_1000051 JGI24035J26624_10000518 277
508 3300005276 Ga0065717_1001964 Ga0065717_10019646 277
509 3300005289 Ga0065704_10073913 Ga0065704_100739136 277
510 3300005290 Ga0065712_10002282 Ga0065712_100022821 277
511 3300005290 Ga0065712_10162912 Ga0065712_101629122 277
512 3300005293 Ga0065715_10002794 Ga0065715_100027943 277
513 3300005293 Ga0065715_10089788 Ga0065715_100897883 277
514 3300005295 Ga0065707_10086522 Ga0065707_100865226 277
515 3300005327 Ga0070658_10072420 Ga0070658_100724202 277
516 3300005327 Ga0070658_10188148 Ga0070658_101881482 277
517 3300005328 Ga0070676_10000360 Ga0070676_100003609 277
518 3300005328 Ga0070676_10064947 Ga0070676_100649473 277
519 3300005329 Ga0070683_100003076 Ga0070683_10000307619 277
520 3300005329 Ga0070683_100083038 Ga0070683_1000830383 277
521 3300005330 Ga0070690_100002249 Ga0070690_1000022497 277
522 3300005330 Ga0070690_100009502 Ga0070690_1000095021 277
523 3300005331 Ga0070670_100000827 Ga0070670_10000082716 277
524 3300005331 Ga0070670_100229170 Ga0070670_1002291702 277
525 3300005333 Ga0070677_10003275 Ga0070677_100032755 277
526 3300005334 Ga0068869_100000013 Ga0068869_10000001321 277
527 3300005335 Ga0070666_10050409 Ga0070666_100504094 277
528 3300005336 Ga0070680_100002249 Ga0070680_10000224919 277
529 3300005336 Ga0070680_100002907 Ga0070680_1000029078 277
530 3300005336 Ga0070680_100056958 Ga0070680_1000569583 277
531 3300005336 Ga0070680_100090420 Ga0070680_1000904203 277
532 3300005336 Ga0070680_100231723 Ga0070680_1002317232 277
533 3300005336 Ga0070680_100377583 Ga0070680_1003775831 277
534 3300005337 Ga0070682_100015075 Ga0070682_1000150754 277
535 3300005338 Ga0068868_100023763 Ga0068868_1000237633 277
536 3300005339 Ga0070660_100001856 Ga0070660_10000185618 277
537 3300005339 Ga0070660_100083861 Ga0070660_1000838613 277
538 3300005340 Ga0070689_100000474 Ga0070689_1000004748 277
539 3300005340 Ga0070689_100002685 Ga0070689_1000026859 277
540 3300005341 Ga0070691_10000101 Ga0070691_1000010123 277
541 3300005343 Ga0070687_100003699 Ga0070687_1000036996 277
542 3300005343 Ga0070687_100003845 Ga0070687_1000038451 277
543 3300005344 Ga0070661_100001285 Ga0070661_1000012851 277
544 3300005344 Ga0070661_100067991 Ga0070661_1000679912 277
545 3300005345 Ga0070692_10000014 Ga0070692_1000001422 277
546 3300005345 Ga0070692_10014365 Ga0070692_100143653 277
547 3300005347 Ga0070668_100000629 Ga0070668_10000062921 277
548 3300005353 Ga0070669_100000289 Ga0070669_10000028920 277
549 3300005353 Ga0070669_100008012 Ga0070669_1000080126 277
550 3300005353 Ga0070669_100434353 Ga0070669_1004343532 277
551 3300005354 Ga0070675_100000501 Ga0070675_10000050113 277
552 3300005354 Ga0070675_100016974 Ga0070675_1000169741 277
553 3300005355 Ga0070671_100000142 Ga0070671_1000001428 277
554 3300005355 Ga0070671_100012637 Ga0070671_1000126378 277
555 3300005355 Ga0070671_100123533 Ga0070671_1001235331 277
556 3300005356 Ga0070674_100000392 Ga0070674_1000003921 277
557 3300005364 Ga0070673_100001752 Ga0070673_10000175218 277
558 3300005365 Ga0070688_100000484 Ga0070688_10000048417 277
559 3300005366 Ga0070659_100001872 Ga0070659_10000187220 277
560 3300005366 Ga0070659_100373467 Ga0070659_1003734671 277
561 3300005367 Ga0070667_100002125 Ga0070667_1000021254 277
562 3300005367 Ga0070667_100016279 Ga0070667_1000162793 277
563 3300005367 Ga0070667_100326109 Ga0070667_1003261092 277
564 3300005406 Ga0070703_10001490 Ga0070703_100014901 277
565 3300005434 Ga0070709_10025948 Ga0070709_100259482 277
566 3300005434 Ga0070709_10044458 Ga0070709_100444582 277
567 3300005435 Ga0070714_100044926 Ga0070714_1000449264 277
568 3300005435 Ga0070714_100180023 Ga0070714_1001800232 277
569 3300005436 Ga0070713_100001823 Ga0070713_10000182315 277
570 3300005436 Ga0070713_100100054 Ga0070713_1001000542 277
571 3300005438 Ga0070701_10000008 Ga0070701_1000000829 277
572 3300005438 Ga0070701_10052668 Ga0070701_100526683 277
573 3300005439 Ga0070711_100057105 Ga0070711_1000571051 277
574 3300005439 Ga0070711_100064004 Ga0070711_1000640044 277
575 3300005440 Ga0070705_100004263 Ga0070705_1000042634 277
576 3300005440 Ga0070705_100011791 Ga0070705_1000117915 277
577 3300005440 Ga0070705_100152983 Ga0070705_1001529832 277
578 3300005441 Ga0070700_100000486 Ga0070700_10000048622 277
579 3300005441 Ga0070700_100011018 Ga0070700_1000110183 277
580 3300005444 Ga0070694_100000463 Ga0070694_1000004631 277
581 3300005444 Ga0070694_100043032 Ga0070694_1000430324 277
582 3300005455 Ga0070663_100015711 Ga0070663_1000157115 277
583 3300005455 Ga0070663_100154659 Ga0070663_1001546593 277
584 3300005456 Ga0070678_100004520 Ga0070678_10000452010 277
585 3300005456 Ga0070678_100060733 Ga0070678_1000607332 277
586 3300005457 Ga0070662_100004371 Ga0070662_1000043715 277
587 3300005457 Ga0070662_100023743 Ga0070662_1000237432 277
588 3300005458 Ga0070681_10002062 Ga0070681_1000206222 277
589 3300005458 Ga0070681_10071633 Ga0070681_100716334 277
590 3300005458 Ga0070681_10083693 Ga0070681_100836934 277
591 3300005458 Ga0070681_10112319 Ga0070681_101123192 277
592 3300005458 Ga0070681_10273193 Ga0070681_102731931 277
593 3300005458 Ga0070681_10389132 Ga0070681_103891322 277
594 3300005459 Ga0068867_100000303 Ga0068867_10000030322 277
595 3300005466 Ga0070685_10001725 Ga0070685_100017256 277
596 3300005466 Ga0070685_10024058 Ga0070685_100240583 277
597 3300005518 Ga0070699_100245023 Ga0070699_1002450233 277
598 3300005530 Ga0070679_100005343 Ga0070679_10000534316 277
599 3300005530 Ga0070679_100070784 Ga0070679_1000707845 277
600 3300005530 Ga0070679_100082355 Ga0070679_1000823552 277
601 3300005530 Ga0070679_100162199 Ga0070679_1001621993 277
602 3300005530 Ga0070679_100244491 Ga0070679_1002444912 277
603 3300005535 Ga0070684_100001519 Ga0070684_10000151914 277
604 3300005535 Ga0070684_100086326 Ga0070684_1000863262 277
605 3300005536 Ga0070697_100186163 Ga0070697_1001861632 277
606 3300005539 Ga0068853_100000726 Ga0068853_10000072619 277
607 3300005539 Ga0068853_100052672 Ga0068853_1000526724 277
608 3300005539 Ga0068853_100325291 Ga0068853_1003252912 277
609 3300005543 Ga0070672_100000469 Ga0070672_1000004696 277
610 3300005544 Ga0070686_100004236 Ga0070686_1000042361 277
611 3300005544 Ga0070686_100011541 Ga0070686_1000115415 277
612 3300005545 Ga0070695_100001715 Ga0070695_1000017153 277
613 3300005546 Ga0070696_100005271 Ga0070696_1000052717 277
614 3300005546 Ga0070696_100093641 Ga0070696_1000936412 277
615 3300005547 Ga0070693_100000411 Ga0070693_1000004111 277
616 3300005547 Ga0070693_100127094 Ga0070693_1001270941 277
617 3300005547 Ga0070693_100291477 Ga0070693_1002914771 277
618 3300005549 Ga0070704_100001671 Ga0070704_1000016717 277
619 3300005549 Ga0070704_100006946 Ga0070704_1000069466 277
620 3300005563 Ga0068855_100036647 Ga0068855_1000366476 277
621 3300005563 Ga0068855_100193509 Ga0068855_1001935092 277
622 3300005563 Ga0068855_100235288 Ga0068855_1002352883 277
623 3300005564 Ga0070664_100001745 Ga0070664_10000174522 277
624 3300005564 Ga0070664_100036564 Ga0070664_1000365642 277
625 3300005564 Ga0070664_100049496 Ga0070664_1000494965 277
626 3300005577 Ga0068857_100000307 Ga0068857_10000030714 277
627 3300005578 Ga0068854_100000761 Ga0068854_1000007614 277
628 3300005614 Ga0068856_100003904 Ga0068856_10000390417 277
629 3300005614 Ga0068856_100057074 Ga0068856_1000570742 277
630 3300005615 Ga0070702_100001142 Ga0070702_1000011425 277
631 3300005616 Ga0068852_100000151 Ga0068852_10000015125 277
632 3300005616 Ga0068852_100032124 Ga0068852_1000321243 277
633 3300005616 Ga0068852_100110172 Ga0068852_1001101723 277
634 3300005617 Ga0068859_100001785 Ga0068859_1000017857 277
635 3300005617 Ga0068859_100105197 Ga0068859_1001051972 277
636 3300005617 Ga0068859_100606988 Ga0068859_1006069881 277
637 3300005618 Ga0068864_100019467 Ga0068864_1000194675 277
638 3300005718 Ga0068866_10000049 Ga0068866_1000004914 277
639 3300005718 Ga0068866_10089680 Ga0068866_100896803 277
640 3300005719 Ga0068861_100000471 Ga0068861_1000004716 277
641 3300005719 Ga0068861_100034571 Ga0068861_1000345713 277
642 3300005840 Ga0068870_10001002 Ga0068870_1000100215 277
643 3300005841 Ga0068863_100000418 Ga0068863_10000041822 277
644 3300005841 Ga0068863_100478125 Ga0068863_1004781251 277
645 3300005842 Ga0068858_100002238 Ga0068858_10000223823 277
646 3300005842 Ga0068858_100077479 Ga0068858_1000774792 277
647 3300005843 Ga0068860_100002578 Ga0068860_10000257823 277
648 3300005843 Ga0068860_100116754 Ga0068860_1001167544 277
649 3300005844 Ga0068862_100001613 Ga0068862_10000161322 277
650 3300005844 Ga0068862_100122807 Ga0068862_1001228072 277
651 3300005937 Ga0081455_10000002 Ga0081455_10000002279 277
652 3300006028 Ga0070717_10137166 Ga0070717_101371663 277
653 3300006048 Ga0075363_100029115 Ga0075363_1000291153 277
654 3300006048 Ga0075363_100166683 Ga0075363_1001666831 277
655 3300006163 Ga0070715_10030043 Ga0070715_100300433 277
656 3300006175 Ga0070712_100034950 Ga0070712_1000349504 277
657 3300006175 Ga0070712_100177019 Ga0070712_1001770192 277
658 3300006177 Ga0075362_10022233 Ga0075362_100222333 277
659 3300006195 Ga0075366_10077040 Ga0075366_100770402 277
660 3300006237 Ga0097621_100000012 Ga0097621_10000001213 277
661 3300006237 Ga0097621_100594897 Ga0097621_1005948972 277
662 3300006358 Ga0068871_100000611 Ga0068871_10000061123 277
663 3300006852 Ga0075433_10060417 Ga0075433_100604173 277
664 3300006871 Ga0075434_100000193 Ga0075434_10000019323 277
665 3300006871 Ga0075434_100053188 Ga0075434_1000531883 277
666 3300006881 Ga0068865_100001539 Ga0068865_1000015398 277
667 3300006881 Ga0068865_100025848 Ga0068865_1000258484 277
668 3300006914 Ga0075436_100344269 Ga0075436_1003442692 277
669 3300006931 Ga0097620_100001785 Ga0097620_10000178518 277
670 3300006931 Ga0097620_100105196 Ga0097620_1001051962 277
671 3300006931 Ga0097620_100606988 Ga0097620_1006069881 277
672 3300007076 Ga0075435_100014928 Ga0075435_1000149284 277
673 3300009092 Ga0105250_10007496 Ga0105250_100074964 277
674 3300009093 Ga0105240_10043110 Ga0105240_100431104 277
675 3300009093 Ga0105240_10377529 Ga0105240_103775292 277
676 3300009094 Ga0111539_10000679 Ga0111539_1000067923 277
677 3300009094 Ga0111539_10000925 Ga0111539_1000092514 277
678 3300009098 Ga0105245_10000090 Ga0105245_1000009045 277
679 3300009101 Ga0105247_10001092 Ga0105247_1000109219 277
680 3300009101 Ga0105247_10024972 Ga0105247_100249722 277
681 3300009148 Ga0105243_10002557 Ga0105243_100025575 277
682 3300009148 Ga0105243_10006084 Ga0105243_100060845 277
683 3300009174 Ga0105241_10000053 Ga0105241_1000005394 277
684 3300009174 Ga0105241_10132389 Ga0105241_101323891 277
685 3300009176 Ga0105242_10000491 Ga0105242_1000049123 277
686 3300009176 Ga0105242_10245208 Ga0105242_102452081 277
687 3300009177 Ga0105248_10000964 Ga0105248_100009646 277
688 3300009177 Ga0105248_10003797 Ga0105248_1000379721 277
689 3300009177 Ga0105248_10312566 Ga0105248_103125662 277
690 3300009545 Ga0105237_10008862 Ga0105237_100088629 277
691 3300009545 Ga0105237_10027862 Ga0105237_100278624 277
692 3300009551 Ga0105238_10034755 Ga0105238_100347552 277
693 3300009551 Ga0105238_10287553 Ga0105238_102875531 277
694 3300009553 Ga0105249_10001085 Ga0105249_100010857 277
695 3300009553 Ga0105249_10106323 Ga0105249_101063234 277
696 3300010375 Ga0105239_10012065 Ga0105239_100120656 277
697 3300010375 Ga0105239_10095287 Ga0105239_100952872 277
698 3300010375 Ga0105239_10641834 Ga0105239_106418341 277
699 3300011119 Ga0105246_10000052 Ga0105246_1000005217 277
700 3300011119 Ga0105246_10148363 Ga0105246_101483631 277
701 3300012492 Ga0157335_1001428 Ga0157335_10014282 277
702 3300012494 Ga0157341_1001939 Ga0157341_10019392 277
703 3300012505 Ga0157339_1000852 Ga0157339_10008523 277
704 3300013100 Ga0157373_10021395 Ga0157373_100213954 277
705 3300013100 Ga0157373_10138414 Ga0157373_101384141 277
706 3300013102 Ga0157371_10003401 Ga0157371_1000340118 277
707 3300013102 Ga0157371_10241669 Ga0157371_102416691 277
708 3300013102 Ga0157371_10318295 Ga0157371_103182952 277
709 3300013104 Ga0157370_10089444 Ga0157370_100894442 277
710 3300013104 Ga0157370_10142585 Ga0157370_101425853 277
711 3300013105 Ga0157369_10417724 Ga0157369_104177241 277
712 3300013105 Ga0157369_10453675 Ga0157369_104536752 277
713 3300013296 Ga0157374_10001210 Ga0157374_1000121022 277
714 3300013296 Ga0157374_10064601 Ga0157374_100646013 277
715 3300013297 Ga0157378_10002713 Ga0157378_1000271319 277
716 3300013306 Ga0163162_10000308 Ga0163162_1000030822 277
717 3300013306 Ga0163162_10073674 Ga0163162_100736743 277
718 3300013307 Ga0157372_10002370 Ga0157372_1000237021 277
719 3300013307 Ga0157372_10609627 Ga0157372_106096271 277
720 3300013308 Ga0157375_10000414 Ga0157375_1000041415 277
721 3300013308 Ga0157375_10225179 Ga0157375_102251792 277
722 3300013308 Ga0157375_10249642 Ga0157375_102496423 277
723 3300014325 Ga0163163_10002008 Ga0163163_100020083 277
724 3300014325 Ga0163163_10077402 Ga0163163_100774023 277
725 3300014326 Ga0157380_10000122 Ga0157380_1000012223 277
726 3300014745 Ga0157377_10000688 Ga0157377_100006888 277
727 3300014968 Ga0157379_10000261 Ga0157379_1000026126 277
728 3300014968 Ga0157379_10309900 Ga0157379_103099002 277
729 3300014969 Ga0157376_10002538 Ga0157376_100025387 277
730 3300014969 Ga0157376_10202573 Ga0157376_102025732 277
731 3300017792 Ga0163161_10000199 Ga0163161_1000019941 277
732 3300021384 Ga0213876_10003239 Ga0213876_100032399 277
733 3300025271 Ga0207666_1000049 Ga0207666_10000492 277
734 3300025271 Ga0207666_1000597 Ga0207666_10005975 277
735 3300025290 Ga0207673_1000439 Ga0207673_10004395 277
736 3300025315 Ga0207697_10000335 Ga0207697_100003353 277
737 3300025315 Ga0207697_10025453 Ga0207697_100254533 277
738 3300025893 Ga0207682_10000042 Ga0207682_1000004233 277
739 3300025898 Ga0207692_10041703 Ga0207692_100417032 277
740 3300025899 Ga0207642_10000065 Ga0207642_1000006519 277
741 3300025899 Ga0207642_10087754 Ga0207642_100877541 277
742 3300025900 Ga0207710_10019877 Ga0207710_100198772 277
743 3300025901 Ga0207688_10000053 Ga0207688_1000005322 277
744 3300025901 Ga0207688_10006140 Ga0207688_100061405 277
745 3300025903 Ga0207680_10044067 Ga0207680_100440674 277
746 3300025903 Ga0207680_10242520 Ga0207680_102425202 277
747 3300025904 Ga0207647_10002930 Ga0207647_100029303 277
748 3300025904 Ga0207647_10072916 Ga0207647_100729161 277
749 3300025906 Ga0207699_10146192 Ga0207699_101461922 277
750 3300025907 Ga0207645_10000090 Ga0207645_100000903 277
751 3300025907 Ga0207645_10096477 Ga0207645_100964773 277
752 3300025908 Ga0207643_10000082 Ga0207643_1000008222 277
753 3300025909 Ga0207705_10018481 Ga0207705_100184812 277
754 3300025909 Ga0207705_10025377 Ga0207705_100253771 277
755 3300025911 Ga0207654_10004743 Ga0207654_100047432 277
756 3300025912 Ga0207707_10007842 Ga0207707_100078428 277
757 3300025912 Ga0207707_10389487 Ga0207707_103894871 277
758 3300025913 Ga0207695_10070809 Ga0207695_100708093 277
759 3300025913 Ga0207695_10137509 Ga0207695_101375091 277
760 3300025914 Ga0207671_10022867 Ga0207671_100228673 277
761 3300025915 Ga0207693_10002221 Ga0207693_1000222116 277
762 3300025915 Ga0207693_10045294 Ga0207693_100452944 277
763 3300025915 Ga0207693_10309987 Ga0207693_103099871 277
764 3300025916 Ga0207663_10038220 Ga0207663_100382204 277
765 3300025917 Ga0207660_10000083 Ga0207660_1000008331 277
766 3300025917 Ga0207660_10052872 Ga0207660_100528723 277
767 3300025917 Ga0207660_10080400 Ga0207660_100804001 277
768 3300025918 Ga0207662_10007146 Ga0207662_100071462 277
769 3300025918 Ga0207662_10017526 Ga0207662_100175263 277
770 3300025919 Ga0207657_10001336 Ga0207657_100013363 277
771 3300025919 Ga0207657_10014898 Ga0207657_100148984 277
772 3300025919 Ga0207657_10022984 Ga0207657_100229843 277
773 3300025920 Ga0207649_10000643 Ga0207649_100006436 277
774 3300025920 Ga0207649_10036240 Ga0207649_100362404 277
775 3300025920 Ga0207649_10119077 Ga0207649_101190772 277
776 3300025921 Ga0207652_10000557 Ga0207652_1000055736 277
777 3300025921 Ga0207652_10040001 Ga0207652_100400012 277
778 3300025921 Ga0207652_10189872 Ga0207652_101898722 277
779 3300025921 Ga0207652_10201882 Ga0207652_102018822 277
780 3300025923 Ga0207681_10000271 Ga0207681_1000027127 277
781 3300025924 Ga0207694_10038148 Ga0207694_100381482 277
782 3300025924 Ga0207694_10118044 Ga0207694_101180442 277
783 3300025925 Ga0207650_10032088 Ga0207650_100320883 277
784 3300025925 Ga0207650_10136231 Ga0207650_101362312 277
785 3300025926 Ga0207659_10000161 Ga0207659_1000016137 277
786 3300025926 Ga0207659_10000460 Ga0207659_1000046022 277
787 3300025927 Ga0207687_10000063 Ga0207687_1000006336 277
788 3300025928 Ga0207700_10004421 Ga0207700_100044214 277
789 3300025928 Ga0207700_10114116 Ga0207700_101141162 277
790 3300025929 Ga0207664_10180253 Ga0207664_101802532 277
791 3300025931 Ga0207644_10000591 Ga0207644_1000059126 277
792 3300025931 Ga0207644_10059212 Ga0207644_100592122 277
793 3300025931 Ga0207644_10332617 Ga0207644_103326171 277
794 3300025932 Ga0207690_10000897 Ga0207690_1000089721 277
795 3300025932 Ga0207690_10106097 Ga0207690_101060973 277
796 3300025932 Ga0207690_10132246 Ga0207690_101322462 277
797 3300025933 Ga0207706_10001197 Ga0207706_1000119725 277
798 3300025933 Ga0207706_10030254 Ga0207706_100302544 277
799 3300025933 Ga0207706_10039210 Ga0207706_100392102 277
800 3300025934 Ga0207686_10000614 Ga0207686_1000061422 277
801 3300025935 Ga0207709_10000429 Ga0207709_1000042937 277
802 3300025936 Ga0207670_10000485 Ga0207670_100004855 277
803 3300025936 Ga0207670_10051762 Ga0207670_100517622 277
804 3300025937 Ga0207669_10000019 Ga0207669_1000001920 277
805 3300025937 Ga0207669_10317964 Ga0207669_103179642 277
806 3300025938 Ga0207704_10000552 Ga0207704_1000055211 277
807 3300025939 Ga0207665_10118027 Ga0207665_101180271 277
808 3300025940 Ga0207691_10000987 Ga0207691_100009877 277
809 3300025941 Ga0207711_10012997 Ga0207711_100129975 277
810 3300025941 Ga0207711_10106207 Ga0207711_101062073 277
811 3300025941 Ga0207711_10192391 Ga0207711_101923912 277
812 3300025942 Ga0207689_10000916 Ga0207689_100009163 277
813 3300025942 Ga0207689_10178399 Ga0207689_101783992 277
814 3300025944 Ga0207661_10000281 Ga0207661_1000028123 277
815 3300025944 Ga0207661_10383665 Ga0207661_103836651 277
816 3300025945 Ga0207679_10000026 Ga0207679_1000002623 277
817 3300025945 Ga0207679_10090266 Ga0207679_100902662 277
818 3300025949 Ga0207667_10004064 Ga0207667_1000406420 277
819 3300025949 Ga0207667_10022622 Ga0207667_100226227 277
820 3300025949 Ga0207667_10270516 Ga0207667_102705161 277
821 3300025949 Ga0207667_10607740 Ga0207667_106077401 277
822 3300025960 Ga0207651_10000101 Ga0207651_1000010127 277
823 3300025961 Ga0207712_10000908 Ga0207712_100009087 277
824 3300025961 Ga0207712_10239725 Ga0207712_102397252 277
825 3300025972 Ga0207668_10000726 Ga0207668_100007263 277
826 3300025981 Ga0207640_10000596 Ga0207640_100005967 277
827 3300025981 Ga0207640_10129721 Ga0207640_101297212 277
828 3300025986 Ga0207658_10003725 Ga0207658_100037251 277
829 3300025986 Ga0207658_10118433 Ga0207658_101184332 277
830 3300026023 Ga0207677_10000651 Ga0207677_1000065122 277
831 3300026035 Ga0207703_10001717 Ga0207703_1000171723 277
832 3300026035 Ga0207703_10028705 Ga0207703_100287052 277
833 3300026035 Ga0207703_10108324 Ga0207703_101083242 277
834 3300026035 Ga0207703_10268259 Ga0207703_102682591 277
835 3300026041 Ga0207639_10008158 Ga0207639_100081582 277
836 3300026041 Ga0207639_10200353 Ga0207639_102003532 277
837 3300026067 Ga0207678_10000831 Ga0207678_1000083125 277
838 3300026067 Ga0207678_10031777 Ga0207678_100317773 277
839 3300026075 Ga0207708_10002086 Ga0207708_100020863 277
840 3300026075 Ga0207708_10007188 Ga0207708_100071883 277
841 3300026078 Ga0207702_10005168 Ga0207702_100051687 277
842 3300026078 Ga0207702_10149669 Ga0207702_101496691 277
843 3300026078 Ga0207702_10152046 Ga0207702_101520462 277
844 3300026078 Ga0207702_10222725 Ga0207702_102227251 277
845 3300026088 Ga0207641_10002162 Ga0207641_1000216223 277
846 3300026089 Ga0207648_10001440 Ga0207648_1000144025 277
847 3300026089 Ga0207648_10047658 Ga0207648_100476582 277
848 3300026095 Ga0207676_10000563 Ga0207676_1000056331 277
849 3300026116 Ga0207674_10001207 Ga0207674_1000120725 277
850 3300026116 Ga0207674_10060579 Ga0207674_100605791 277
851 3300026118 Ga0207675_100000983 Ga0207675_1000009837 277
852 3300026118 Ga0207675_100034844 Ga0207675_1000348443 277
853 3300026121 Ga0207683_10000324 Ga0207683_1000032422 277
854 3300026121 Ga0207683_10089829 Ga0207683_100898292 277
855 3300026142 Ga0207698_10000634 Ga0207698_100006346 277
856 3300027471 Ga0209995_1022537 Ga0209995_10225371 277
857 3300027526 Ga0209968_1016151 Ga0209968_10161512 277
858 3300027682 Ga0209971_1009877 Ga0209971_10098772 277
859 3300027717 Ga0209998_10001212 Ga0209998_100012125 277
860 3300027876 Ga0209974_10001144 Ga0209974_100011442 277
861 3300027876 Ga0209974_10011378 Ga0209974_100113783 277
862 3300027876 Ga0209974_10044083 Ga0209974_100440832 277
863 3300027907 Ga0207428_10000130 Ga0207428_1000013023 277
864 3300027907 Ga0207428_10000286 Ga0207428_1000028611 277
865 3300028379 Ga0268266_10018702 Ga0268266_100187021 277
866 3300028380 Ga0268265_10004798 Ga0268265_100047988 277
867 3300028381 Ga0268264_10027250 Ga0268264_100272502 277
868 3300028556 Ga0265337_1004948 Ga0265337_10049484 277
869 3300028573 Ga0265334_10041598 Ga0265334_100415982 277
870 3300028800 Ga0265338_10020386 Ga0265338_100203862 277
871 3300028800 Ga0265338_10088359 Ga0265338_100883592 277
872 3300031235 Ga0265330_10011313 Ga0265330_100113133 277
873 3300031241 Ga0265325_10000011 Ga0265325_1000001199 277
874 3300031241 Ga0265325_10003966 Ga0265325_100039667 277
875 3300031241 Ga0265325_10038989 Ga0265325_100389892 277
876 3300031241 Ga0265325_10122320 Ga0265325_101223201 277
877 3300031247 Ga0265340_10059770 Ga0265340_100597701 277
878 3300031249 Ga0265339_10047184 Ga0265339_100471841 277
879 3300031250 Ga0265331_10024816 Ga0265331_100248162 277
880 3300031595 Ga0265313_10020196 Ga0265313_100201964 277
881 3300031711 Ga0265314_10002746 Ga0265314_100027466 277
882 3300031712 Ga0265342_10000625 Ga0265342_100006254 277
883 3300031712 Ga0265342_10035856 Ga0265342_100358562 277
884 3300034816 Ga0373930_0000103 Ga0373930_0000103_4718_5551 277
885 3300034817 Ga0373948_0000862 Ga0373948_0000862_2962_3795 277
886 3300034818 Ga0373950_0000731 Ga0373950_0000731_272_1105 277
887 3300034818 Ga0373950_0014963 Ga0373950_0014963_343_1176 277
888 3300034819 Ga0373958_0000037 Ga0373958_0000037_4414_5247 277
889 3300034820 Ga0373959_0000941 Ga0373959_0000941_3556_4389 277
890 3300034820 Ga0373959_0009861 Ga0373959_0009861_185_1018 277
891 3300034957 Ga0373938_0000190 Ga0373938_0000190_6570_7403 277
892 3300035083 Ga0373926_0017993 Ga0373926_0017993_752_1585 277
893 3300035085 Ga0373929_0000503 Ga0373929_0000503_6563_7396 277
894 3300035085 Ga0373929_0006273 Ga0373929_0006273_208_1041 277
895 3300035088 Ga0373940_0000178 Ga0373940_0000178_5062_5895 277
896 3300035091 Ga0373951_0000165 Ga0373951_0000165_9903_10736 277
897 3300035091 Ga0373951_0004364 Ga0373951_0004364_805_1638 277
898 3300035092 Ga0373952_0000829 Ga0373952_0000829_775_1608 277
899 3300035111 Ga0373923_0029991 Ga0373923_0029991_39_872 277
900 3300035111 Ga0373923_0081219 Ga0373923_0081219_255_1088 277
901 3300035111 Ga0373923_0112538 Ga0373923_0112538_267_1100 277
902 3300035112 Ga0373932_0000221 Ga0373932_0000221_2627_3460 277
903 3300035112 Ga0373932_0001308 Ga0373932_0001308_4009_4842 277
904 3300035114 Ga0373939_0000178 Ga0373939_0000178_5927_6760 277
905 3300035114 Ga0373939_0000211 Ga0373939_0000211_6578_7411 277
906 3300035115 Ga0373941_0000085 Ga0373941_0000085_13692_14525 277
907 3300035116 Ga0373945_0034128 Ga0373945_0034128_110_943 277
908 3300035118 Ga0373954_0016379 Ga0373954_0016379_242_1075 277
909 3300035120 Ga0373957_0007368 Ga0373957_0007368_951_1784 277
910 3300035120 Ga0373957_0049500 Ga0373957_0049500_496_1329 277
911 3300035121 Ga0373960_0001587 Ga0373960_0001587_3625_4458 277
912 3300035121 Ga0373960_0009749 Ga0373960_0009749_1479_2312 277
913 3300035170 Ga0373943_0058528 Ga0373943_0058528_825_1658 277
914 3300035172 Ga0373955_0002823 Ga0373955_0002823_4582_5415 277
915 3300035172 Ga0373955_0006562 Ga0373955_0006562_1917_2750 277
916 3300035172 Ga0373955_0021359 Ga0373955_0021359_829_1662 277
917 3300035207 Ga0373942_0001835 Ga0373942_0001835_3345_4178 277
918 3300035207 Ga0373942_0004182 Ga0373942_0004182_1447_2280 277
919 3300035241 Ga0373961_0001088 Ga0373961_0001088_6566_7399 277
920 3300035242 Ga0373962_0000271 Ga0373962_0000271_5798_6631 277
921 3300035410 Ga0373924_0026792 Ga0373924_0026792_918_1751 277
922 3300035410 Ga0373924_0082472 Ga0373924_0082472_288_1121 277
923 3300035691 Ga0373931_0000854 Ga0373931_0000854_7723_8556 277
924 3300035692 Ga0373935_0009363 Ga0373935_0009363_2850_3683 277
925 3300035724 Ga0373933_0004073 Ga0373933_0004073_2452_3285 277
926 3300035724 Ga0373933_0009095 Ga0373933_0009095_2612_3445 277
927 3300035724 Ga0373933_0046875 Ga0373933_0046875_162_995 277
928 3300035724 Ga0373933_0275632 Ga0373933_0275632_178_1011 277
929 3300035725 Ga0373947_0108866 Ga0373947_0108866_845_1678 277
930 3300035725 Ga0373947_0125159 Ga0373947_0125159_683_1516 277
931 3300036401 Ga0373937_0024864 Ga0373937_0024864_3606_4439 277
932 3300036401 Ga0373937_0185374 Ga0373937_0185374_787_1620 277
933 3300037068 Ga0373925_0011017 Ga0373925_0011017_4473_5306 277
934 3300037068 Ga0373925_0012057 Ga0373925_0012057_4244_5077 277
935 3300037418 Ga0395900_0034932 Ga0395900_0034932_1443_2276 277
936 3300037466 Ga0395898_0071806 Ga0395898_0071806_2458_3291 277
937 3300038443 Ga0395901_0230847 Ga0395901_0230847_240_1073 277
938 3300039437 Ga0436365_0946034 Ga0436365_0946034_7842_8678 277
939 3300041408 Ga0439453_0006962 Ga0439453_0006962_274_1113 277
940 3300042003 Ga0439443_004964 Ga0439443_004964_839_1678 277
941 3300042461 Ga0439460_0007890 Ga0439460_0007890_769_1602 277
942 3300042876 Ga0451577_0274370 Ga0451577_0274370_633_1466 277
943 3300044673 Ga0453683_0027898 Ga0453683_0027898_28_861 277
944 3300044712 Ga0453684_0033092 Ga0453684_0033092_4560_5393 277
945 3300045051 Ga0451576_0044873 Ga0451576_0044873_1045_1878 277
946 3300046454 Ga0495592_0024684 Ga0495592_0024684_590_1423 277
947 3300046455 Ga0495603_0029746 Ga0495603_0029746_1907_2740 277
948 3300046461 Ga0495641_0015004 Ga0495641_0015004_1104_1937 277
949 3300046461 Ga0495641_0064684 Ga0495641_0064684_96_929 277
950 3300046462 Ga0495651_0011341 Ga0495651_0011341_3650_4483 277
951 3300046462 Ga0495651_0196007 Ga0495651_0196007_288_1121 277
952 3300046463 Ga0495653_0016106 Ga0495653_0016106_1623_2456 277
953 3300046463 Ga0495653_0022979 Ga0495653_0022979_1020_1853 277
954 3300046475 Ga0495639_0083615 Ga0495639_0083615_535_1368 277
955 3300046477 Ga0495664_0027103 Ga0495664_0027103_1147_1980 277
956 3300046491 Ga0495584_0048578 Ga0495584_0048578_740_1573 277
957 3300046491 Ga0495584_0161793 Ga0495584_0161793_66_899 277
958 3300046511 Ga0495608_0062600 Ga0495608_0062600_25_858 277
959 3300046514 Ga0495618_0013046 Ga0495618_0013046_365_1198 277
960 3300046514 Ga0495618_0063716 Ga0495618_0063716_1488_2321 277
961 3300046516 Ga0495628_0000249 Ga0495628_0000249_4882_5715 277
962 3300046517 Ga0495630_0079935 Ga0495630_0079935_1462_2295 277
963 3300046517 Ga0495630_0123621 Ga0495630_0123621_92_925 277
964 3300046526 Ga0495666_0035220 Ga0495666_0035220_648_1481 277
965 3300046529 Ga0495652_0013367 Ga0495652_0013367_4374_5207 277
966 3300046529 Ga0495652_0272445 Ga0495652_0272445_169_1002 277
967 3300046535 Ga0495586_0070330 Ga0495586_0070330_309_1142 277
968 3300046536 Ga0495587_0113807 Ga0495587_0113807_249_1082 277
969 3300046543 Ga0495645_0001006 Ga0495645_0001006_1342_2175 277
970 3300046557 Ga0495622_0125151 Ga0495622_0125151_295_1143 277
971 3300046559 Ga0495667_0011278 Ga0495667_0011278_4993_5826 277
972 3300046559 Ga0495667_0045323 Ga0495667_0045323_1500_2333 277
973 3300046663 Ga0495635_0003088 Ga0495635_0003088_9654_10487 277
974 3300046663 Ga0495635_0006182 Ga0495635_0006182_2831_3664 277
975 3300046663 Ga0495635_0147977 Ga0495635_0147977_553_1386 277
976 3300046675 Ga0495657_0016857 Ga0495657_0016857_627_1460 277
977 3300046675 Ga0495657_0089349 Ga0495657_0089349_44_877 277
978 3300046678 Ga0495599_0012093 Ga0495599_0012093_570_1403 277
979 3300046679 Ga0495623_0004489 Ga0495623_0004489_5386_6219 277
980 3300046680 Ga0495646_0230262 Ga0495646_0230262_40_873 277
981 3300046681 Ga0495647_0072507 Ga0495647_0072507_368_1201 277
982 3300046683 Ga0495658_0207842 Ga0495658_0207842_360_1193 277
983 3300046684 Ga0495669_0190309 Ga0495669_0190309_38_871 277
984 3300046689 Ga0495613_0138626 Ga0495613_0138626_21_854 277
985 3300046809 Ga0495600_0002039 Ga0495600_0002039_9465_10298 277
986 3300046809 Ga0495600_0019222 Ga0495600_0019222_1586_2419 277
987 3300046809 Ga0495600_0072547 Ga0495600_0072547_1372_2205 277
988 3300047315 Ga0495581_0134214 Ga0495581_0134214_358_1191 277
989 3300047317 Ga0495604_0005947 Ga0495604_0005947_1598_2431 277
990 3300047317 Ga0495604_0221682 Ga0495604_0221682_153_986 277
991 3300047319 Ga0495674_0037870 Ga0495674_0037870_2220_3053 277
992 3300047319 Ga0495674_0058274 Ga0495674_0058274_2271_3104 277
993 3300047319 Ga0495674_0094357 Ga0495674_0094357_209_1042 277
994 3300047319 Ga0495674_0159539 Ga0495674_0159539_18_851 277
995 3300047320 Ga0495672_0025202 Ga0495672_0025202_428_1264 277
996 3300047321 Ga0495676_0075429 Ga0495676_0075429_957_1790 277
997 3300047322 Ga0495680_0009034 Ga0495680_0009034_1898_2731 277
998 3300047322 Ga0495680_0013096 Ga0495680_0013096_516_1349 277
999 3300047322 Ga0495680_0168515 Ga0495680_0168515_244_1077 277
1000 3300047444 Ga0495675_0009835 Ga0495675_0009835_3368_4201 277
1001 3300047444 Ga0495675_0015422 Ga0495675_0015422_2513_3346 277
1002 3300047471 Ga0495684_0002684 Ga0495684_0002684_701_1534 277
1003 3300047673 Ga0495593_0013264 Ga0495593_0013264_2952_3785 277
1004 3300048088 Ga0495602_0007244 Ga0495602_0007244_7833_8666 277
1005 3300048088 Ga0495602_0011207 Ga0495602_0011207_8376_9209 277
1006 3300048088 Ga0495602_0124770 Ga0495602_0124770_112_945 277
1007 3300048088 Ga0495602_0270260 Ga0495602_0270260_178_1011 277
1008 3300048089 Ga0495614_0007962 Ga0495614_0007962_798_1631 277
1009 3300048903 Ga0496100_0001453 Ga0496100_0001453_98_931 277
1010 3300048903 Ga0496100_0212649 Ga0496100_0212649_208_1041 277
1011 3300048904 Ga0496101_0000468 Ga0496101_0000468_8310_9143 277
1012 3300048904 Ga0496101_0043343 Ga0496101_0043343_1484_2317 277
1013 3300048905 Ga0496102_0095293 Ga0496102_0095293_1296_2129 277
1014 3300048905 Ga0496102_0366786 Ga0496102_0366786_226_1059 277
1015 3300048906 Ga0496103_0014273 Ga0496103_0014273_226_1059 277
1016 3300048907 Ga0496104_0000239 Ga0496104_0000239_10947_11780 277
1017 3300048907 Ga0496104_0072639 Ga0496104_0072639_2250_3083 277
1018 3300048908 Ga0496105_0000398 Ga0496105_0000398_26616_27449 277
1019 3300048908 Ga0496105_0163562 Ga0496105_0163562_753_1586 277
1020 3300048909 Ga0496106_0067463 Ga0496106_0067463_1063_1896 277
1021 3300048909 Ga0496106_0181364 Ga0496106_0181364_557_1390 277
1022 3300048909 Ga0496106_0326600 Ga0496106_0326600_173_1006 277
1023 3300048910 Ga0496107_0000965 Ga0496107_0000965_3786_4619 277
1024 3300048910 Ga0496107_0023024 Ga0496107_0023024_1783_2616 277
1025 3300048910 Ga0496107_0035286 Ga0496107_0035286_2009_2842 277
1026 3300048910 Ga0496107_0074003 Ga0496107_0074003_1188_2021 277
1027 3300048911 Ga0496108_0001543 Ga0496108_0001543_2043_2876 277
1028 3300048911 Ga0496108_0005663 Ga0496108_0005663_210_1043 277
1029 3300048912 Ga0496109_0000414 Ga0496109_0000414_31038_31871 277
1030 3300048912 Ga0496109_0004282 Ga0496109_0004282_10735_11568 277
1031 3300048912 Ga0496109_0142097 Ga0496109_0142097_511_1344 277
1032 3300048913 Ga0496110_0330972 Ga0496110_0330972_225_1058 277
1033 3300048914 Ga0496111_0245379 Ga0496111_0245379_398_1231 277
1034 3300048915 Ga0496112_0055429 Ga0496112_0055429_1649_2482 277
1035 3300048915 Ga0496112_0060236 Ga0496112_0060236_2743_3576 277
1036 3300048916 Ga0496113_0009598 Ga0496113_0009598_5280_6113 277
1037 3300048916 Ga0496113_0110860 Ga0496113_0110860_765_1598 277
1038 3300048917 Ga0496114_0050674 Ga0496114_0050674_201_1034 277
1039 3300048917 Ga0496114_0059281 Ga0496114_0059281_653_1486 277
1040 3300048918 Ga0496115_0003980 Ga0496115_0003980_2291_3124 277
1041 3300048918 Ga0496115_0047342 Ga0496115_0047342_2047_2880 277
1042 3300048918 Ga0496115_0105976 Ga0496115_0105976_470_1303 277
1043 3300049570 Ga0501033_0055525 Ga0501033_0055525_1595_2434 277
1044 3300049580 Ga0501046_0450610 Ga0501046_0450610_47_886 277
1045 3300049581 Ga0501047_0082864 Ga0501047_0082864_492_1325 277
1046 3300049581 Ga0501047_0105578 Ga0501047_0105578_740_1579 277
1047 3300049581 Ga0501047_0199409 Ga0501047_0199409_254_1087 277
1048 3300049583 Ga0501067_0093305 Ga0501067_0093305_167_1000 277
1049 3300049586 Ga0501070_0104832 Ga0501070_0104832_517_1356 277
1050 3300049586 Ga0501070_0345001 Ga0501070_0345001_263_1096 277
1051 3300049587 Ga0501071_0015263 Ga0501071_0015263_4012_4845 277
1052 3300049590 Ga0501074_0031430 Ga0501074_0031430_1000_1833 277
1053 3300049743 Ga0501081_0241692 Ga0501081_0241692_50_883 277
1054 3300049744 Ga0501083_0157872 Ga0501083_0157872_225_1061 277
1055 3300049823 Ga0501044_0047773 Ga0501044_0047773_1115_1948 277
1056 3300050489 nmdc:mga03683_57061_c1 nmdc:mga03683_57061_c1_212_1048 277
1057 3300050490 nmdc:mga03n38_42929_c1 nmdc:mga03n38_42929_c1_398_1231 277
1058 3300050491 nmdc:mga00v17_15563_c1 nmdc:mga00v17_15563_c1_513_1349 277
1059 3300050511 nmdc:mga08y16_128308_c1 nmdc:mga08y16_128308_c1_578_1411 277
1060 3300050511 nmdc:mga08y16_13856_c1 nmdc:mga08y16_13856_c1_6971_7804 277
1061 3300050511 nmdc:mga08y16_21765_c1 nmdc:mga08y16_21765_c1_98_931 277
1062 3300050512 nmdc:mga0n895_26341_c1 nmdc:mga0n895_26341_c1_2369_3202 277
1063 3300050512 nmdc:mga0n895_55_c1 nmdc:mga0n895_55_c1_45358_46191 277
1064 3300050513 nmdc:mga0rr50_272144_c1 nmdc:mga0rr50_272144_c1_533_1366 277
1065 3300050515 nmdc:mga0a205_62861_c1 nmdc:mga0a205_62861_c1_1378_2211 277
1066 3300053077 Ga0495601_0001987 Ga0495601_0001987_6731_7564 277
1067 3300053077 Ga0495601_0002133 Ga0495601_0002133_1639_2472 277
1068 3300053077 Ga0495601_0017401 Ga0495601_0017401_3368_4201 277
1069 3300053077 Ga0495601_0079528 Ga0495601_0079528_391_1224 277
1070 3300053077 Ga0495601_0315763 Ga0495601_0315763_18_851 277
1071 3300053078 Ga0495612_0000243 Ga0495612_0000243_3111_3944 277
1072 3300053078 Ga0495612_0004160 Ga0495612_0004160_907_1740 277
1073 3300053078 Ga0495612_0108765 Ga0495612_0108765_173_1006 277
1074 3300053084 Ga0495595_0003024 Ga0495595_0003024_697_1530 277
1075 3300053084 Ga0495595_0008950 Ga0495595_0008950_2208_3041 277
1076 3300053084 Ga0495595_0009151 Ga0495595_0009151_166_999 277
1077 3300053084 Ga0495595_0034011 Ga0495595_0034011_1201_2034 277
1078 3300053085 Ga0495619_0000139 Ga0495619_0000139_36162_36995 277
1079 3300053085 Ga0495619_0001830 Ga0495619_0001830_2120_2953 277
1080 3300053085 Ga0495619_0028591 Ga0495619_0028591_1021_1854 277
1081 3300053098 Ga0500650_0106935 Ga0500650_0106935_151_984 277
1082 3300061719 Ga0466962_0081670 Ga0466962_0081670_647_1480 277
1083 iso_pu_bacteria 2513237102 2513706029 277
1084 iso_pu_bacteria 2617270741 2617373753 277
1085 iso_pu_bacteria 2824617872 2824624492 277
1086 iso_pu_bacteria 2824626560 2824633407 277
1087 iso_pu_bacteria 2824635225 2824640296 277
1088 iso_pu_bacteria 2824644064 2824647270 277
1089 iso_pu_bacteria 2824714736 2824717414 277
1090 iso_pu_bacteria 2824723954 2824727623 277
1091 iso_pu_bacteria 2824732956 2824739858 277
1092 iso_pu_bacteria 2824746037 2824752551 277
1093 iso_pu_bacteria 2841957949 2841965427 277
1094 iso_pu_bacteria 2844315083 2844315329 277
1095 iso_pu_bacteria 2881364244 2881365325 277
1096 iso_pu_bacteria 2903727486 2903732190 277
1097 iso_pu_bacteria 2906602504 2906604267 277
1098 iso_pu_bacteria 2908775508 2908776270 277
1099 iso_pu_bacteria 3005483717 3005489077 277
1100 iso_pu_bacteria 3005587118 3005592218 277
1101 iso_pu_bacteria 3005594810 3005595043 277
1102 iso_pu_bacteria 3005718088 3005718296 277
1103 iso_pu_bacteria 8056967851 8056971281 277
1104 3300005335 Ga0070666_10242070 Ga0070666_102420702 278
1105 3300005336 Ga0070680_100006151 Ga0070680_1000061514 278
1106 3300005338 Ga0068868_100454103 Ga0068868_1004541031 278
1107 3300005340 Ga0070689_100385462 Ga0070689_1003854621 278
1108 3300005347 Ga0070668_100283220 Ga0070668_1002832201 278
1109 3300005353 Ga0070669_100068834 Ga0070669_1000688341 278
1110 3300005356 Ga0070674_100007332 Ga0070674_1000073323 278
1111 3300005356 Ga0070674_100228812 Ga0070674_1002288121 278
1112 3300005364 Ga0070673_100089955 Ga0070673_1000899552 278
1113 3300005365 Ga0070688_100010100 Ga0070688_1000101004 278
1114 3300005434 Ga0070709_10015171 Ga0070709_100151713 278
1115 3300005435 Ga0070714_100007186 Ga0070714_1000071867 278
1116 3300005436 Ga0070713_100040684 Ga0070713_1000406843 278
1117 3300005436 Ga0070713_100059036 Ga0070713_1000590362 278
1118 3300005436 Ga0070713_100166548 Ga0070713_1001665482 278
1119 3300005437 Ga0070710_10002956 Ga0070710_100029565 278
1120 3300005439 Ga0070711_100014489 Ga0070711_1000144893 278
1121 3300005439 Ga0070711_100370606 Ga0070711_1003706061 278
1122 3300005456 Ga0070678_100020799 Ga0070678_1000207992 278
1123 3300005456 Ga0070678_100070102 Ga0070678_1000701022 278
1124 3300005530 Ga0070679_100018688 Ga0070679_1000186884 278
1125 3300005548 Ga0070665_100195837 Ga0070665_1001958373 278
1126 3300005617 Ga0068859_100571070 Ga0068859_1005710702 278
1127 3300005718 Ga0068866_10117765 Ga0068866_101177652 278
1128 3300005841 Ga0068863_100021397 Ga0068863_1000213976 278
1129 3300005937 Ga0081455_10114225 Ga0081455_101142252 278
1130 3300005983 Ga0081540_1000166 Ga0081540_100016633 278
1131 3300006042 Ga0075368_10007115 Ga0075368_100071156 278
1132 3300006048 Ga0075363_100068851 Ga0075363_1000688512 278
1133 3300006048 Ga0075363_100209128 Ga0075363_1002091282 278
1134 3300006163 Ga0070715_10001417 Ga0070715_100014173 278
1135 3300006173 Ga0070716_100000922 Ga0070716_1000009224 278
1136 3300006175 Ga0070712_100035030 Ga0070712_1000350303 278
1137 3300006175 Ga0070712_100102172 Ga0070712_1001021723 278
1138 3300006178 Ga0075367_10007084 Ga0075367_100070843 278
1139 3300006186 Ga0075369_10049718 Ga0075369_100497182 278
1140 3300006195 Ga0075366_10146185 Ga0075366_101461852 278
1141 3300006237 Ga0097621_100234116 Ga0097621_1002341162 278
1142 3300006353 Ga0075370_10020566 Ga0075370_100205661 278
1143 3300006353 Ga0075370_10094314 Ga0075370_100943141 278
1144 3300006844 Ga0075428_100311376 Ga0075428_1003113762 278
1145 3300006931 Ga0097620_100571033 Ga0097620_1005710332 278
1146 3300006942 Ga0099824_1014228 Ga0099824_10142284 278
1147 3300006943 Ga0099822_1000827 Ga0099822_100082711 278
1148 3300009093 Ga0105240_10119042 Ga0105240_101190422 278
1149 3300009094 Ga0111539_10324879 Ga0111539_103248793 278
1150 3300009094 Ga0111539_10515586 Ga0111539_105155862 278
1151 3300009101 Ga0105247_10152469 Ga0105247_101524692 278
1152 3300009147 Ga0114129_10443248 Ga0114129_104432482 278
1153 3300009148 Ga0105243_10029257 Ga0105243_100292576 278
1154 3300009551 Ga0105238_10461643 Ga0105238_104616431 278
1155 3300009553 Ga0105249_10247337 Ga0105249_102473372 278
1156 3300010159 Ga0099796_10030093 Ga0099796_100300932 278
1157 3300010375 Ga0105239_10271752 Ga0105239_102717521 278
1158 3300011119 Ga0105246_10070799 Ga0105246_100707991 278
1159 3300013104 Ga0157370_10629700 Ga0157370_106297001 278
1160 3300013306 Ga0163162_10041674 Ga0163162_100416744 278
1161 3300013306 Ga0163162_10321040 Ga0163162_103210402 278
1162 3300013306 Ga0163162_10522399 Ga0163162_105223992 278
1163 3300013306 Ga0163162_10558197 Ga0163162_105581972 278
1164 3300014325 Ga0163163_10022724 Ga0163163_100227247 278
1165 3300014325 Ga0163163_10151049 Ga0163163_101510493 278
1166 3300021377 Ga0213874_10006393 Ga0213874_100063934 278
1167 3300025297 Ga0209758_1000686 Ga0209758_100068628 278
1168 3300025302 Ga0207426_1047523 Ga0207426_10475232 278
1169 3300025898 Ga0207692_10016486 Ga0207692_100164862 278
1170 3300025899 Ga0207642_10160839 Ga0207642_101608391 278
1171 3300025903 Ga0207680_10152265 Ga0207680_101522652 278
1172 3300025905 Ga0207685_10012934 Ga0207685_100129342 278
1173 3300025905 Ga0207685_10180580 Ga0207685_101805801 278
1174 3300025906 Ga0207699_10003057 Ga0207699_100030576 278
1175 3300025906 Ga0207699_10044378 Ga0207699_100443784 278
1176 3300025907 Ga0207645_10166633 Ga0207645_101666332 278
1177 3300025912 Ga0207707_10170877 Ga0207707_101708772 278
1178 3300025914 Ga0207671_10075442 Ga0207671_100754421 278
1179 3300025915 Ga0207693_10000310 Ga0207693_1000031042 278
1180 3300025916 Ga0207663_10063141 Ga0207663_100631412 278
1181 3300025916 Ga0207663_10333825 Ga0207663_103338251 278
1182 3300025917 Ga0207660_10048720 Ga0207660_100487203 278
1183 3300025921 Ga0207652_10030893 Ga0207652_100308933 278
1184 3300025926 Ga0207659_10144234 Ga0207659_101442342 278
1185 3300025928 Ga0207700_10026056 Ga0207700_100260565 278
1186 3300025928 Ga0207700_10067717 Ga0207700_100677172 278
1187 3300025928 Ga0207700_10119721 Ga0207700_101197213 278
1188 3300025928 Ga0207700_10327804 Ga0207700_103278042 278
1189 3300025931 Ga0207644_10554725 Ga0207644_105547251 278
1190 3300025935 Ga0207709_10238566 Ga0207709_102385661 278
1191 3300025936 Ga0207670_10006650 Ga0207670_100066504 278
1192 3300025936 Ga0207670_10091818 Ga0207670_100918182 278
1193 3300025939 Ga0207665_10001734 Ga0207665_100017343 278
1194 3300025939 Ga0207665_10125262 Ga0207665_101252623 278
1195 3300025939 Ga0207665_10127756 Ga0207665_101277562 278
1196 3300025941 Ga0207711_10071484 Ga0207711_100714842 278
1197 3300025972 Ga0207668_10349247 Ga0207668_103492472 278
1198 3300026023 Ga0207677_10450597 Ga0207677_104505971 278
1199 3300026035 Ga0207703_10099895 Ga0207703_100998952 278
1200 3300026075 Ga0207708_10188098 Ga0207708_101880981 278
1201 3300026078 Ga0207702_10485388 Ga0207702_104853881 278
1202 3300026121 Ga0207683_10037437 Ga0207683_100374372 278
1203 3300026121 Ga0207683_10037847 Ga0207683_100378474 278
1204 3300027357 Ga0209589_1000021 Ga0209589_1000021127 278
1205 3300027361 Ga0209489_100028 Ga0209489_100028127 278
1206 3300027363 Ga0209700_100037 Ga0209700_100037127 278
1207 3300027671 Ga0209588_1003941 Ga0209588_10039412 278
1208 3300027866 Ga0209813_10004390 Ga0209813_100043904 278
1209 3300028379 Ga0268266_10202084 Ga0268266_102020841 278
1210 3300028794 Ga0307515_10062859 Ga0307515_100628593 278
1211 3300031247 Ga0265340_10015122 Ga0265340_100151224 278
1212 3300031247 Ga0265340_10027823 Ga0265340_100278232 278
1213 3300031249 Ga0265339_10021072 Ga0265339_100210721 278
1214 3300031456 Ga0307513_10135414 Ga0307513_101354143 278
1215 3300031456 Ga0307513_10380870 Ga0307513_103808701 278
1216 3300031616 Ga0307508_10118780 Ga0307508_101187802 278
1217 3300031616 Ga0307508_10201682 Ga0307508_102016821 278
1218 3300031616 Ga0307508_10207705 Ga0307508_102077051 278
1219 3300031712 Ga0265342_10057548 Ga0265342_100575484 278
1220 3300033442 Ga0315911_1000008 Ga0315911_1000008316 278
1221 3300034816 Ga0373930_0012448 Ga0373930_0012448_104_943 278
1222 3300034957 Ga0373938_0009528 Ga0373938_0009528_797_1636 278
1223 3300035091 Ga0373951_0010273 Ga0373951_0010273_356_1195 278
1224 3300035111 Ga0373923_0051538 Ga0373923_0051538_420_1256 278
1225 3300035113 Ga0373936_0011829 Ga0373936_0011829_1920_2756 278
1226 3300035116 Ga0373945_0044384 Ga0373945_0044384_757_1593 278
1227 3300035119 Ga0373956_0085815 Ga0373956_0085815_331_1167 278
1228 3300035120 Ga0373957_0070742 Ga0373957_0070742_75_911 278
1229 3300035170 Ga0373943_0009325 Ga0373943_0009325_1710_2546 278
1230 3300035171 Ga0373946_0006651 Ga0373946_0006651_1841_2677 278
1231 3300035172 Ga0373955_0012669 Ga0373955_0012669_442_1278 278
1232 3300035172 Ga0373955_0022947 Ga0373955_0022947_1543_2379 278
1233 3300035410 Ga0373924_0030107 Ga0373924_0030107_83_919 278
1234 3300035691 Ga0373931_0020376 Ga0373931_0020376_2178_3017 278
1235 3300035692 Ga0373935_0000953 Ga0373935_0000953_10698_11534 278
1236 3300035692 Ga0373935_0375082 Ga0373935_0375082_26_865 278
1237 3300035692 Ga0373935_0405554 Ga0373935_0405554_67_903 278
1238 3300035695 Ga0373927_0001486 Ga0373927_0001486_15219_16055 278
1239 3300035695 Ga0373927_0047148 Ga0373927_0047148_105_944 278
1240 3300035695 Ga0373927_0085319 Ga0373927_0085319_289_1128 278
1241 3300035724 Ga0373933_0283029 Ga0373933_0283029_100_936 278
1242 3300035725 Ga0373947_0016744 Ga0373947_0016744_702_1541 278
1243 3300036401 Ga0373937_0035182 Ga0373937_0035182_413_1252 278
1244 3300036401 Ga0373937_0063798 Ga0373937_0063798_2533_3369 278
1245 3300036401 Ga0373937_0342089 Ga0373937_0342089_109_948 278
1246 3300037068 Ga0373925_0001713 Ga0373925_0001713_13302_14138 278
1247 3300037068 Ga0373925_0065920 Ga0373925_0065920_1542_2381 278
1248 3300039450 Ga0436363_1148766 Ga0436363_1148766_2556_3395 278
1249 3300044684 Ga0466966_0142339 Ga0466966_0142339_436_1272 278
1250 3300045049 Ga0466959_0209189 Ga0466959_0209189_86_922 278
1251 3300046454 Ga0495592_0036398 Ga0495592_0036398_2612_3448 278
1252 3300046454 Ga0495592_0115227 Ga0495592_0115227_988_1824 278
1253 3300046455 Ga0495603_0000047 Ga0495603_0000047_27776_28612 278
1254 3300046459 Ga0495629_0000320 Ga0495629_0000320_27751_28587 278
1255 3300046459 Ga0495629_0169058 Ga0495629_0169058_346_1182 278
1256 3300046460 Ga0495638_0040689 Ga0495638_0040689_1815_2657 278
1257 3300046461 Ga0495641_0008426 Ga0495641_0008426_1805_2641 278
1258 3300046462 Ga0495651_0116423 Ga0495651_0116423_65_901 278
1259 3300046463 Ga0495653_0144596 Ga0495653_0144596_759_1595 278
1260 3300046472 Ga0495580_0005073 Ga0495580_0005073_1390_2226 278
1261 3300046473 Ga0495582_0000043 Ga0495582_0000043_47797_48633 278
1262 3300046475 Ga0495639_0000091 Ga0495639_0000091_23389_24225 278
1263 3300046476 Ga0495662_0000128 Ga0495662_0000128_22374_23210 278
1264 3300046477 Ga0495664_0053277 Ga0495664_0053277_1303_2139 278
1265 3300046491 Ga0495584_0074191 Ga0495584_0074191_350_1189 278
1266 3300046499 Ga0495594_0000453 Ga0495594_0000453_17609_18445 278
1267 3300046511 Ga0495608_0229182 Ga0495608_0229182_194_1030 278
1268 3300046514 Ga0495618_0218758 Ga0495618_0218758_92_928 278
1269 3300046516 Ga0495628_0020336 Ga0495628_0020336_4629_5465 278
1270 3300046516 Ga0495628_0052492 Ga0495628_0052492_1271_2107 278
1271 3300046526 Ga0495666_0043942 Ga0495666_0043942_662_1498 278
1272 3300046529 Ga0495652_0043484 Ga0495652_0043484_2579_3415 278
1273 3300046531 Ga0495665_0001635 Ga0495665_0001635_957_1793 278
1274 3300046531 Ga0495665_0074226 Ga0495665_0074226_465_1304 278
1275 3300046533 Ga0495640_0007459 Ga0495640_0007459_3835_4671 278
1276 3300046533 Ga0495640_0112306 Ga0495640_0112306_851_1687 278
1277 3300046543 Ga0495645_0042219 Ga0495645_0042219_228_1064 278
1278 3300046557 Ga0495622_0010031 Ga0495622_0010031_2970_3806 278
1279 3300046559 Ga0495667_0123867 Ga0495667_0123867_624_1460 278
1280 3300046642 Ga0495634_0044652 Ga0495634_0044652_1747_2583 278
1281 3300046663 Ga0495635_0001788 Ga0495635_0001788_13450_14289 278
1282 3300046675 Ga0495657_0058547 Ga0495657_0058547_1015_1851 278
1283 3300046678 Ga0495599_0016129 Ga0495599_0016129_2579_3415 278
1284 3300046679 Ga0495623_0093678 Ga0495623_0093678_398_1234 278
1285 3300046681 Ga0495647_0011225 Ga0495647_0011225_1907_2743 278
1286 3300046683 Ga0495658_0002995 Ga0495658_0002995_2416_3252 278
1287 3300046689 Ga0495613_0001794 Ga0495613_0001794_1031_1867 278
1288 3300046690 Ga0495624_0000694 Ga0495624_0000694_23329_24165 278
1289 3300047315 Ga0495581_0000486 Ga0495581_0000486_9326_10162 278
1290 3300047317 Ga0495604_0055664 Ga0495604_0055664_1243_2079 278
1291 3300047319 Ga0495674_0003925 Ga0495674_0003925_3516_4352 278
1292 3300047319 Ga0495674_0010066 Ga0495674_0010066_7151_7987 278
1293 3300047321 Ga0495676_0091661 Ga0495676_0091661_1024_1860 278
1294 3300047321 Ga0495676_0151317 Ga0495676_0151317_551_1390 278
1295 3300047471 Ga0495684_0020400 Ga0495684_0020400_3400_4236 278
1296 3300047673 Ga0495593_0000005 Ga0495593_0000005_11341_12177 278
1297 3300048088 Ga0495602_0053983 Ga0495602_0053983_2454_3290 278
1298 3300048903 Ga0496100_0011507 Ga0496100_0011507_3955_4794 278
1299 3300048903 Ga0496100_0048602 Ga0496100_0048602_349_1185 278
1300 3300048904 Ga0496101_0006584 Ga0496101_0006584_731_1570 278
1301 3300048905 Ga0496102_0028200 Ga0496102_0028200_2309_3148 278
1302 3300048905 Ga0496102_0455458 Ga0496102_0455458_163_999 278
1303 3300048906 Ga0496103_0159200 Ga0496103_0159200_38_874 278
1304 3300048907 Ga0496104_0012475 Ga0496104_0012475_1231_2067 278
1305 3300048907 Ga0496104_0240495 Ga0496104_0240495_283_1122 278
1306 3300048908 Ga0496105_0012329 Ga0496105_0012329_5647_6486 278
1307 3300048908 Ga0496105_0025256 Ga0496105_0025256_567_1403 278
1308 3300048909 Ga0496106_0074650 Ga0496106_0074650_1191_2030 278
1309 3300048909 Ga0496106_0159746 Ga0496106_0159746_685_1521 278
1310 3300048910 Ga0496107_0010146 Ga0496107_0010146_83_922 278
1311 3300048910 Ga0496107_0427517 Ga0496107_0427517_46_885 278
1312 3300048911 Ga0496108_0104083 Ga0496108_0104083_925_1764 278
1313 3300048912 Ga0496109_0103281 Ga0496109_0103281_608_1447 278
1314 3300048912 Ga0496109_0146234 Ga0496109_0146234_242_1081 278
1315 3300048912 Ga0496109_0410607 Ga0496109_0410607_432_1268 278
1316 3300048913 Ga0496110_0012677 Ga0496110_0012677_246_1082 278
1317 3300048913 Ga0496110_0055104 Ga0496110_0055104_608_1447 278
1318 3300048914 Ga0496111_0001884 Ga0496111_0001884_4870_5709 278
1319 3300048916 Ga0496113_0026173 Ga0496113_0026173_3179_4018 278
1320 3300048917 Ga0496114_0023821 Ga0496114_0023821_419_1258 278
1321 3300048918 Ga0496115_0008492 Ga0496115_0008492_6289_7128 278
1322 3300048924 Ga0496121_0000270 Ga0496121_0000270_9011_9847 278
1323 3300048924 Ga0496121_0129567 Ga0496121_0129567_764_1606 278
1324 3300048929 Ga0496126_0026314 Ga0496126_0026314_2526_3380 278
1325 3300048929 Ga0496126_0216838 Ga0496126_0216838_376_1215 278
1326 3300048929 Ga0496126_0279367 Ga0496126_0279367_503_1357 278
1327 3300048929 Ga0496126_0391559 Ga0496126_0391559_171_1010 278
1328 3300049569 Ga0501032_0204455 Ga0501032_0204455_147_986 278
1329 3300049570 Ga0501033_0100724 Ga0501033_0100724_816_1655 278
1330 3300049570 Ga0501033_0108247 Ga0501033_0108247_781_1620 278
1331 3300049570 Ga0501033_0183877 Ga0501033_0183877_352_1191 278
1332 3300049571 Ga0501034_0282544 Ga0501034_0282544_650_1489 278
1333 3300049572 Ga0501036_0061100 Ga0501036_0061100_1639_2478 278
1334 3300049573 Ga0501037_0010464 Ga0501037_0010464_4925_5776 278
1335 3300049573 Ga0501037_0045631 Ga0501037_0045631_1708_2547 278
1336 3300049574 Ga0501038_0389701 Ga0501038_0389701_195_1034 278
1337 3300049578 Ga0501042_0063966 Ga0501042_0063966_1750_2589 278
1338 3300049579 Ga0501043_0057515 Ga0501043_0057515_11_850 278
1339 3300049579 Ga0501043_0093310 Ga0501043_0093310_747_1586 278
1340 3300049579 Ga0501043_0473485 Ga0501043_0473485_51_893 278
1341 3300049580 Ga0501046_0173337 Ga0501046_0173337_367_1206 278
1342 3300049581 Ga0501047_0094732 Ga0501047_0094732_785_1624 278
1343 3300049581 Ga0501047_0197426 Ga0501047_0197426_107_946 278
1344 3300049581 Ga0501047_0301859 Ga0501047_0301859_255_1094 278
1345 3300049581 Ga0501047_0338192 Ga0501047_0338192_285_1127 278
1346 3300049582 Ga0501048_0333172 Ga0501048_0333172_132_971 278
1347 3300049583 Ga0501067_0094982 Ga0501067_0094982_396_1235 278
1348 3300049584 Ga0501068_0045541 Ga0501068_0045541_127_966 278
1349 3300049586 Ga0501070_0221258 Ga0501070_0221258_624_1463 278
1350 3300049587 Ga0501071_0179113 Ga0501071_0179113_649_1488 278
1351 3300049742 Ga0501080_0075608 Ga0501080_0075608_1344_2183 278
1352 3300049742 Ga0501080_0123108 Ga0501080_0123108_483_1322 278
1353 3300049744 Ga0501083_0045709 Ga0501083_0045709_1031_1873 278
1354 3300049744 Ga0501083_0208181 Ga0501083_0208181_417_1256 278
1355 3300049822 Ga0501035_0258695 Ga0501035_0258695_171_1013 278
1356 3300049823 Ga0501044_0000122 Ga0501044_0000122_72370_73209 278
1357 3300049823 Ga0501044_0025318 Ga0501044_0025318_4905_5756 278
1358 3300049823 Ga0501044_0193433 Ga0501044_0193433_779_1618 278
1359 3300050490 nmdc:mga03n38_19891_c1 nmdc:mga03n38_19891_c1_1156_1992 278
1360 3300050493 nmdc:mga0k408_252332_c1 nmdc:mga0k408_252332_c1_14_853 278
1361 3300050493 nmdc:mga0k408_261781_c1 nmdc:mga0k408_261781_c1_146_985 278
1362 3300050495 nmdc:mga04h51_14665_c1 nmdc:mga04h51_14665_c1_1114_1956 278
1363 3300050496 nmdc:mga07m45_43662_c1 nmdc:mga07m45_43662_c1_1665_2504 278
1364 3300050496 nmdc:mga07m45_68239_c1 nmdc:mga07m45_68239_c1_231_1073 278
1365 3300050511 nmdc:mga08y16_644738_c1 nmdc:mga08y16_644738_c1_22_939 278
1366 3300053077 Ga0495601_0023764 Ga0495601_0023764_2437_3273 278
1367 3300053084 Ga0495595_0145200 Ga0495595_0145200_185_1024 278
1368 3300053085 Ga0495619_0012438 Ga0495619_0012438_1363_2199 278
1369 3300053085 Ga0495619_0143799 Ga0495619_0143799_733_1569 278
1370 3300053085 Ga0495619_0201845 Ga0495619_0201845_54_899 278
1371 3300053098 Ga0500650_0097644 Ga0500650_0097644_231_1073 278
1372 3300053119 Ga0500595_005148 Ga0500595_005148_1365_2204 278
1373 3300053119 Ga0500595_013452 Ga0500595_013452_1152_1988 278
1374 3300053119 Ga0500595_013641 Ga0500595_013641_2003_2839 278
1375 3300053134 Ga0500658_0063629 Ga0500658_0063629_613_1455 278
1376 3300053139 Ga0500568_0003071 Ga0500568_0003071_298_1134 278
1377 3300053139 Ga0500568_0016646 Ga0500568_0016646_1178_2020 278
1378 3300053153 Ga0500616_0073671 Ga0500616_0073671_224_1063 278
1379 3300060353 Ga0501082_0098506 Ga0501082_0098506_1368_2207 278
1380 3300060353 Ga0501082_0494549 Ga0501082_0494549_17_856 278
1381 3300001979 JGI24740J21852_10000946 JGI24740J21852_100009462 279
1382 3300001989 JGI24739J22299_10003399 JGI24739J22299_100033996 279
1383 3300001990 JGI24737J22298_10000493 JGI24737J22298_1000049311 279
1384 3300002067 JGI24735J21928_10018703 JGI24735J21928_100187032 279
1385 3300002067 JGI24735J21928_10069449 JGI24735J21928_100694491 279
1386 3300002077 JGI24744J21845_10008881 JGI24744J21845_100088811 279
1387 3300003203 JGI25406J46586_10000066 JGI25406J46586_1000006633 279
1388 3300003214 JGI25165J46597_1014054 JGI25165J46597_10140541 279
1389 3300003215 JGI25153J46596_10001618 JGI25153J46596_100016183 279
1390 3300003215 JGI25153J46596_10001829 JGI25153J46596_100018299 279
1391 3300003215 JGI25153J46596_10002496 JGI25153J46596_1000249610 279
1392 3300003215 JGI25153J46596_10014159 JGI25153J46596_100141594 279
1393 3300003354 JGI25160J50197_1003905 JGI25160J50197_10039056 279
1394 3300003354 JGI25160J50197_1009567 JGI25160J50197_10095673 279
1395 3300003659 JGI25404J52841_10005627 JGI25404J52841_100056272 279
1396 3300003659 JGI25404J52841_10005730 JGI25404J52841_100057304 279
1397 3300003659 JGI25404J52841_10026842 JGI25404J52841_100268422 279
1398 3300003752 Ga0055539_1007755 Ga0055539_10077551 279
1399 3300003771 Ga0055526_1014208 Ga0055526_10142083 279
1400 3300003794 Ga0055531_10003199 Ga0055531_100031996 279
1401 3300005262 Ga0065165_1000365 Ga0065165_100036513 279
1402 3300005262 Ga0065165_1001495 Ga0065165_100149512 279
1403 3300005327 Ga0070658_10071586 Ga0070658_100715862 279
1404 3300005327 Ga0070658_10141574 Ga0070658_101415743 279
1405 3300005328 Ga0070676_10222755 Ga0070676_102227552 279
1406 3300005330 Ga0070690_100155829 Ga0070690_1001558291 279
1407 3300005330 Ga0070690_100300522 Ga0070690_1003005221 279
1408 3300005331 Ga0070670_100382741 Ga0070670_1003827412 279
1409 3300005333 Ga0070677_10149087 Ga0070677_101490871 279
1410 3300005334 Ga0068869_100020918 Ga0068869_1000209182 279
1411 3300005336 Ga0070680_100011100 Ga0070680_1000111005 279
1412 3300005336 Ga0070680_100101410 Ga0070680_1001014103 279
1413 3300005337 Ga0070682_100018296 Ga0070682_1000182964 279
1414 3300005338 Ga0068868_100006458 Ga0068868_1000064583 279
1415 3300005338 Ga0068868_100086938 Ga0068868_1000869384 279
1416 3300005341 Ga0070691_10147224 Ga0070691_101472241 279
1417 3300005347 Ga0070668_100015369 Ga0070668_1000153696 279
1418 3300005347 Ga0070668_100032431 Ga0070668_1000324312 279
1419 3300005347 Ga0070668_100577958 Ga0070668_1005779581 279
1420 3300005353 Ga0070669_100137553 Ga0070669_1001375532 279
1421 3300005355 Ga0070671_100049595 Ga0070671_1000495953 279
1422 3300005355 Ga0070671_100097781 Ga0070671_1000977813 279
1423 3300005356 Ga0070674_100043742 Ga0070674_1000437424 279
1424 3300005356 Ga0070674_100236966 Ga0070674_1002369662 279
1425 3300005366 Ga0070659_100250848 Ga0070659_1002508482 279
1426 3300005367 Ga0070667_100096889 Ga0070667_1000968892 279
1427 3300005367 Ga0070667_100101972 Ga0070667_1001019723 279
1428 3300005434 Ga0070709_10000584 Ga0070709_100005848 279
1429 3300005434 Ga0070709_10150083 Ga0070709_101500832 279
1430 3300005435 Ga0070714_100051084 Ga0070714_1000510843 279
1431 3300005435 Ga0070714_100068153 Ga0070714_1000681534 279
1432 3300005435 Ga0070714_100068887 Ga0070714_1000688874 279
1433 3300005435 Ga0070714_100161404 Ga0070714_1001614042 279
1434 3300005435 Ga0070714_100322431 Ga0070714_1003224312 279
1435 3300005436 Ga0070713_100002764 Ga0070713_1000027648 279
1436 3300005436 Ga0070713_100012129 Ga0070713_1000121293 279
1437 3300005436 Ga0070713_100026964 Ga0070713_1000269646 279
1438 3300005436 Ga0070713_100294733 Ga0070713_1002947331 279
1439 3300005437 Ga0070710_10055167 Ga0070710_100551671 279
1440 3300005439 Ga0070711_100003385 Ga0070711_1000033854 279
1441 3300005439 Ga0070711_100003792 Ga0070711_1000037927 279
1442 3300005439 Ga0070711_100124881 Ga0070711_1001248812 279
1443 3300005439 Ga0070711_100393791 Ga0070711_1003937911 279
1444 3300005445 Ga0070708_100081054 Ga0070708_1000810543 279
1445 3300005455 Ga0070663_100001666 Ga0070663_10000166614 279
1446 3300005455 Ga0070663_100016155 Ga0070663_1000161553 279
1447 3300005455 Ga0070663_100017648 Ga0070663_1000176485 279
1448 3300005455 Ga0070663_100019740 Ga0070663_1000197402 279
1449 3300005455 Ga0070663_100060975 Ga0070663_1000609754 279
1450 3300005455 Ga0070663_100160062 Ga0070663_1001600622 279
1451 3300005456 Ga0070678_100075882 Ga0070678_1000758822 279
1452 3300005456 Ga0070678_100271041 Ga0070678_1002710412 279
1453 3300005458 Ga0070681_10024430 Ga0070681_100244307 279
1454 3300005458 Ga0070681_10095970 Ga0070681_100959702 279
1455 3300005459 Ga0068867_100122572 Ga0068867_1001225722 279
1456 3300005468 Ga0070707_100093433 Ga0070707_1000934331 279
1457 3300005468 Ga0070707_100205808 Ga0070707_1002058082 279
1458 3300005518 Ga0070699_100452046 Ga0070699_1004520461 279
1459 3300005530 Ga0070679_100018483 Ga0070679_1000184835 279
1460 3300005530 Ga0070679_100131887 Ga0070679_1001318873 279
1461 3300005530 Ga0070679_100282919 Ga0070679_1002829192 279
1462 3300005535 Ga0070684_100013695 Ga0070684_1000136956 279
1463 3300005535 Ga0070684_100144268 Ga0070684_1001442682 279
1464 3300005536 Ga0070697_100049187 Ga0070697_1000491873 279
1465 3300005536 Ga0070697_100263673 Ga0070697_1002636732 279
1466 3300005539 Ga0068853_100006442 Ga0068853_1000064427 279
1467 3300005539 Ga0068853_100154249 Ga0068853_1001542493 279
1468 3300005539 Ga0068853_100168699 Ga0068853_1001686993 279
1469 3300005539 Ga0068853_100207810 Ga0068853_1002078101 279
1470 3300005539 Ga0068853_100208738 Ga0068853_1002087382 279
1471 3300005539 Ga0068853_100296470 Ga0068853_1002964701 279
1472 3300005539 Ga0068853_100300794 Ga0068853_1003007943 279
1473 3300005539 Ga0068853_100426290 Ga0068853_1004262902 279
1474 3300005544 Ga0070686_100231901 Ga0070686_1002319011 279
1475 3300005547 Ga0070693_100224103 Ga0070693_1002241031 279
1476 3300005548 Ga0070665_100032806 Ga0070665_1000328065 279
1477 3300005548 Ga0070665_100046518 Ga0070665_1000465183 279
1478 3300005548 Ga0070665_100126173 Ga0070665_1001261734 279
1479 3300005563 Ga0068855_100056640 Ga0068855_1000566406 279
1480 3300005563 Ga0068855_100186449 Ga0068855_1001864493 279
1481 3300005563 Ga0068855_100294758 Ga0068855_1002947583 279
1482 3300005563 Ga0068855_100454147 Ga0068855_1004541471 279
1483 3300005563 Ga0068855_100620915 Ga0068855_1006209152 279
1484 3300005563 Ga0068855_100708758 Ga0068855_1007087581 279
1485 3300005564 Ga0070664_100179042 Ga0070664_1001790422 279
1486 3300005577 Ga0068857_100005001 Ga0068857_1000050017 279
1487 3300005577 Ga0068857_100022934 Ga0068857_1000229346 279
1488 3300005577 Ga0068857_100050370 Ga0068857_1000503705 279
1489 3300005577 Ga0068857_100122189 Ga0068857_1001221893 279
1490 3300005577 Ga0068857_100248563 Ga0068857_1002485632 279
1491 3300005578 Ga0068854_100050668 Ga0068854_1000506682 279
1492 3300005578 Ga0068854_100178224 Ga0068854_1001782242 279
1493 3300005578 Ga0068854_100205471 Ga0068854_1002054712 279
1494 3300005614 Ga0068856_100005232 Ga0068856_1000052326 279
1495 3300005614 Ga0068856_100029052 Ga0068856_1000290523 279
1496 3300005614 Ga0068856_100066450 Ga0068856_1000664504 279
1497 3300005614 Ga0068856_100084807 Ga0068856_1000848074 279
1498 3300005614 Ga0068856_100107475 Ga0068856_1001074752 279
1499 3300005614 Ga0068856_100281254 Ga0068856_1002812542 279
1500 3300005616 Ga0068852_100003053 Ga0068852_10000305311 279
1501 3300005616 Ga0068852_100087068 Ga0068852_1000870683 279
1502 3300005616 Ga0068852_100098557 Ga0068852_1000985573 279
1503 3300005616 Ga0068852_100194562 Ga0068852_1001945622 279
1504 3300005616 Ga0068852_100230986 Ga0068852_1002309862 279
1505 3300005617 Ga0068859_100099537 Ga0068859_1000995374 279
1506 3300005617 Ga0068859_100226866 Ga0068859_1002268662 279
1507 3300005617 Ga0068859_100361921 Ga0068859_1003619211 279
1508 3300005617 Ga0068859_100570405 Ga0068859_1005704052 279
1509 3300005617 Ga0068859_100638570 Ga0068859_1006385702 279
1510 3300005618 Ga0068864_100195466 Ga0068864_1001954661 279
1511 3300005618 Ga0068864_100287428 Ga0068864_1002874282 279
1512 3300005834 Ga0068851_10009214 Ga0068851_100092144 279
1513 3300005834 Ga0068851_10011049 Ga0068851_100110494 279
1514 3300005842 Ga0068858_100070830 Ga0068858_1000708304 279
1515 3300005842 Ga0068858_100401761 Ga0068858_1004017612 279
1516 3300005842 Ga0068858_100412031 Ga0068858_1004120312 279
1517 3300005843 Ga0068860_100004221 Ga0068860_10000422111 279
1518 3300005844 Ga0068862_100330497 Ga0068862_1003304972 279
1519 3300005937 Ga0081455_10004129 Ga0081455_1000412912 279
1520 3300005937 Ga0081455_10019448 Ga0081455_100194483 279
1521 3300005937 Ga0081455_10041411 Ga0081455_100414114 279
1522 3300005937 Ga0081455_10046329 Ga0081455_100463293 279
1523 3300005937 Ga0081455_10054015 Ga0081455_100540153 279
1524 3300005937 Ga0081455_10128852 Ga0081455_101288522 279
1525 3300005937 Ga0081455_10266931 Ga0081455_102669312 279
1526 3300005983 Ga0081540_1003867 Ga0081540_10038678 279
1527 3300005983 Ga0081540_1005753 Ga0081540_10057532 279
1528 3300005983 Ga0081540_1006025 Ga0081540_10060251 279
1529 3300005983 Ga0081540_1011590 Ga0081540_10115906 279
1530 3300005983 Ga0081540_1012484 Ga0081540_10124844 279
1531 3300005983 Ga0081540_1012727 Ga0081540_10127273 279
1532 3300005983 Ga0081540_1048028 Ga0081540_10480282 279
1533 3300005985 Ga0081539_10000064 Ga0081539_1000006459 279
1534 3300005985 Ga0081539_10005111 Ga0081539_100051118 279
1535 3300005985 Ga0081539_10014339 Ga0081539_100143396 279
1536 3300005985 Ga0081539_10059891 Ga0081539_100598911 279
1537 3300005985 Ga0081539_10107882 Ga0081539_101078821 279
1538 3300006028 Ga0070717_10000598 Ga0070717_100005984 279
1539 3300006028 Ga0070717_10061554 Ga0070717_100615544 279
1540 3300006028 Ga0070717_10113288 Ga0070717_101132882 279
1541 3300006038 Ga0075365_10024282 Ga0075365_100242824 279
1542 3300006038 Ga0075365_10069733 Ga0075365_100697333 279
1543 3300006038 Ga0075365_10086378 Ga0075365_100863782 279
1544 3300006038 Ga0075365_10159173 Ga0075365_101591732 279
1545 3300006038 Ga0075365_10173023 Ga0075365_101730232 279
1546 3300006042 Ga0075368_10073785 Ga0075368_100737852 279
1547 3300006048 Ga0075363_100025684 Ga0075363_1000256842 279
1548 3300006048 Ga0075363_100027004 Ga0075363_1000270042 279
1549 3300006051 Ga0075364_10050606 Ga0075364_100506062 279
1550 3300006051 Ga0075364_10112291 Ga0075364_101122912 279
1551 3300006051 Ga0075364_10171548 Ga0075364_101715482 279
1552 3300006058 Ga0075432_10014522 Ga0075432_100145223 279
1553 3300006163 Ga0070715_10077074 Ga0070715_100770742 279
1554 3300006163 Ga0070715_10104125 Ga0070715_101041252 279
1555 3300006173 Ga0070716_100029244 Ga0070716_1000292444 279
1556 3300006173 Ga0070716_100040719 Ga0070716_1000407191 279
1557 3300006173 Ga0070716_100182258 Ga0070716_1001822582 279
1558 3300006175 Ga0070712_100005171 Ga0070712_1000051714 279
1559 3300006175 Ga0070712_100005584 Ga0070712_1000055844 279
1560 3300006175 Ga0070712_100097287 Ga0070712_1000972875 279
1561 3300006178 Ga0075367_10027915 Ga0075367_100279154 279
1562 3300006178 Ga0075367_10036073 Ga0075367_100360734 279
1563 3300006186 Ga0075369_10091566 Ga0075369_100915662 279
1564 3300006195 Ga0075366_10011732 Ga0075366_100117326 279
1565 3300006195 Ga0075366_10122166 Ga0075366_101221661 279
1566 3300006353 Ga0075370_10056481 Ga0075370_100564811 279
1567 3300006871 Ga0075434_100008129 Ga0075434_1000081293 279
1568 3300006871 Ga0075434_100800901 Ga0075434_1008009011 279
1569 3300006881 Ga0068865_100031167 Ga0068865_1000311673 279
1570 3300006931 Ga0097620_100099536 Ga0097620_1000995364 279
1571 3300006931 Ga0097620_100226863 Ga0097620_1002268632 279
1572 3300006931 Ga0097620_100361953 Ga0097620_1003619531 279
1573 3300006931 Ga0097620_100570424 Ga0097620_1005704242 279
1574 3300006931 Ga0097620_100638572 Ga0097620_1006385722 279
1575 3300006942 Ga0099824_1026035 Ga0099824_10260352 279
1576 3300007265 Ga0099794_10006977 Ga0099794_100069771 279
1577 3300007788 Ga0099795_10008993 Ga0099795_100089931 279
1578 3300009093 Ga0105240_10003692 Ga0105240_1000369224 279
1579 3300009093 Ga0105240_10008228 Ga0105240_100082286 279
1580 3300009093 Ga0105240_10025163 Ga0105240_100251636 279
1581 3300009093 Ga0105240_10034925 Ga0105240_100349251 279
1582 3300009093 Ga0105240_10363048 Ga0105240_103630482 279
1583 3300009094 Ga0111539_10192542 Ga0111539_101925422 279
1584 3300009098 Ga0105245_10089730 Ga0105245_100897302 279
1585 3300009098 Ga0105245_10217136 Ga0105245_102171362 279
1586 3300009101 Ga0105247_10020697 Ga0105247_100206975 279
1587 3300009101 Ga0105247_10034333 Ga0105247_100343333 279
1588 3300009101 Ga0105247_10155419 Ga0105247_101554191 279
1589 3300009148 Ga0105243_10077202 Ga0105243_100772024 279
1590 3300009174 Ga0105241_10090424 Ga0105241_100904242 279
1591 3300009174 Ga0105241_10124355 Ga0105241_101243552 279
1592 3300009174 Ga0105241_10342329 Ga0105241_103423291 279
1593 3300009174 Ga0105241_10677332 Ga0105241_106773321 279
1594 3300009177 Ga0105248_10153982 Ga0105248_101539821 279
1595 3300009177 Ga0105248_10236684 Ga0105248_102366842 279
1596 3300009177 Ga0105248_10281257 Ga0105248_102812572 279
1597 3300009545 Ga0105237_10015141 Ga0105237_100151414 279
1598 3300009545 Ga0105237_10080675 Ga0105237_100806754 279
1599 3300009545 Ga0105237_10080987 Ga0105237_100809873 279
1600 3300009545 Ga0105237_10218579 Ga0105237_102185792 279
1601 3300009551 Ga0105238_10005518 Ga0105238_100055189 279
1602 3300009551 Ga0105238_10008791 Ga0105238_100087918 279
1603 3300009551 Ga0105238_10013990 Ga0105238_100139907 279
1604 3300009551 Ga0105238_10052809 Ga0105238_100528092 279
1605 3300009551 Ga0105238_10270541 Ga0105238_102705412 279
1606 3300009551 Ga0105238_10299735 Ga0105238_102997351 279
1607 3300009551 Ga0105238_10321084 Ga0105238_103210842 279
1608 3300009551 Ga0105238_10364014 Ga0105238_103640142 279
1609 3300009551 Ga0105238_10874522 Ga0105238_108745221 279
1610 3300009553 Ga0105249_10407766 Ga0105249_104077661 279
1611 3300010159 Ga0099796_10016347 Ga0099796_100163472 279
1612 3300010375 Ga0105239_10002519 Ga0105239_1000251915 279
1613 3300010375 Ga0105239_10009940 Ga0105239_100099407 279
1614 3300010375 Ga0105239_10014833 Ga0105239_1001483312 279
1615 3300010375 Ga0105239_10053131 Ga0105239_100531313 279
1616 3300010375 Ga0105239_10071090 Ga0105239_100710903 279
1617 3300010375 Ga0105239_10093727 Ga0105239_100937274 279
1618 3300010375 Ga0105239_10124206 Ga0105239_101242063 279
1619 3300010375 Ga0105239_10128073 Ga0105239_101280733 279
1620 3300010375 Ga0105239_10232870 Ga0105239_102328702 279
1621 3300010375 Ga0105239_10313409 Ga0105239_103134091 279
1622 3300011119 Ga0105246_10005044 Ga0105246_100050441 279
1623 3300011119 Ga0105246_10043290 Ga0105246_100432903 279
1624 3300011119 Ga0105246_10243181 Ga0105246_102431812 279
1625 3300013100 Ga0157373_10196245 Ga0157373_101962451 279
1626 3300013102 Ga0157371_10037614 Ga0157371_100376142 279
1627 3300013104 Ga0157370_10023260 Ga0157370_100232602 279
1628 3300013104 Ga0157370_10087018 Ga0157370_100870184 279
1629 3300013104 Ga0157370_10327402 Ga0157370_103274023 279
1630 3300013105 Ga0157369_10001511 Ga0157369_1000151129 279
1631 3300013105 Ga0157369_10159158 Ga0157369_101591582 279
1632 3300013296 Ga0157374_10055607 Ga0157374_100556074 279
1633 3300013296 Ga0157374_10177581 Ga0157374_101775813 279
1634 3300013297 Ga0157378_10201436 Ga0157378_102014362 279
1635 3300013306 Ga0163162_10079821 Ga0163162_100798213 279
1636 3300013306 Ga0163162_10116570 Ga0163162_101165701 279
1637 3300013307 Ga0157372_10040215 Ga0157372_100402152 279
1638 3300013307 Ga0157372_10283795 Ga0157372_102837952 279
1639 3300013308 Ga0157375_10039319 Ga0157375_100393194 279
1640 3300013308 Ga0157375_10176028 Ga0157375_101760283 279
1641 3300013308 Ga0157375_10487912 Ga0157375_104879121 279
1642 3300013308 Ga0157375_10641958 Ga0157375_106419581 279
1643 3300014325 Ga0163163_10016496 Ga0163163_100164963 279
1644 3300014325 Ga0163163_10120586 Ga0163163_101205864 279
1645 3300014325 Ga0163163_10369133 Ga0163163_103691332 279
1646 3300014325 Ga0163163_10448537 Ga0163163_104485372 279
1647 3300014326 Ga0157380_10495451 Ga0157380_104954512 279
1648 3300014968 Ga0157379_10098068 Ga0157379_100980683 279
1649 3300014969 Ga0157376_10053954 Ga0157376_100539543 279
1650 3300021358 Ga0213873_10009795 Ga0213873_100097952 279
1651 3300021361 Ga0213872_10028176 Ga0213872_100281764 279
1652 3300021361 Ga0213872_10047754 Ga0213872_100477543 279
1653 3300021384 Ga0213876_10112222 Ga0213876_101122221 279
1654 3300025230 Ga0209563_105374 Ga0209563_1053742 279
1655 3300025245 Ga0207425_1005837 Ga0207425_10058374 279
1656 3300025250 Ga0209026_1009167 Ga0209026_10091672 279
1657 3300025253 Ga0209677_100672 Ga0209677_10067212 279
1658 3300025253 Ga0209677_104189 Ga0209677_1041894 279
1659 3300025254 Ga0209148_1007881 Ga0209148_10078812 279
1660 3300025261 Ga0209233_1004421 Ga0209233_10044213 279
1661 3300025261 Ga0209233_1010542 Ga0209233_10105421 279
1662 3300025272 Ga0209455_1001040 Ga0209455_10010405 279
1663 3300025272 Ga0209455_1002709 Ga0209455_10027094 279
1664 3300025273 Ga0209673_1012007 Ga0209673_10120075 279
1665 3300025295 Ga0209564_1000321 Ga0209564_100032145 279
1666 3300025295 Ga0209564_1005785 Ga0209564_10057854 279
1667 3300025295 Ga0209564_1006440 Ga0209564_10064406 279
1668 3300025295 Ga0209564_1009846 Ga0209564_10098465 279
1669 3300025297 Ga0209758_1000069 Ga0209758_100006945 279
1670 3300025297 Ga0209758_1000635 Ga0209758_100063534 279
1671 3300025297 Ga0209758_1002443 Ga0209758_10024435 279
1672 3300025297 Ga0209758_1005237 Ga0209758_10052372 279
1673 3300025297 Ga0209758_1005561 Ga0209758_10055616 279
1674 3300025297 Ga0209758_1008699 Ga0209758_10086995 279
1675 3300025297 Ga0209758_1010679 Ga0209758_10106794 279
1676 3300025297 Ga0209758_1030622 Ga0209758_10306222 279
1677 3300025299 Ga0209256_1033836 Ga0209256_10338362 279
1678 3300025302 Ga0207426_1000826 Ga0207426_100082634 279
1679 3300025302 Ga0207426_1002082 Ga0207426_100208210 279
1680 3300025302 Ga0207426_1018863 Ga0207426_10188632 279
1681 3300025302 Ga0207426_1019837 Ga0207426_10198372 279
1682 3300025304 Ga0209257_1000473 Ga0209257_100047334 279
1683 3300025304 Ga0209257_1018878 Ga0209257_10188782 279
1684 3300025321 Ga0207656_10016962 Ga0207656_100169624 279
1685 3300025321 Ga0207656_10038990 Ga0207656_100389903 279
1686 3300025321 Ga0207656_10106192 Ga0207656_101061922 279
1687 3300025893 Ga0207682_10092512 Ga0207682_100925121 279
1688 3300025898 Ga0207692_10020310 Ga0207692_100203103 279
1689 3300025898 Ga0207692_10235900 Ga0207692_102359002 279
1690 3300025900 Ga0207710_10022757 Ga0207710_100227572 279
1691 3300025900 Ga0207710_10053801 Ga0207710_100538012 279
1692 3300025904 Ga0207647_10001150 Ga0207647_100011508 279
1693 3300025904 Ga0207647_10002277 Ga0207647_1000227717 279
1694 3300025904 Ga0207647_10057180 Ga0207647_100571802 279
1695 3300025905 Ga0207685_10042206 Ga0207685_100422062 279
1696 3300025906 Ga0207699_10003164 Ga0207699_100031645 279
1697 3300025906 Ga0207699_10079993 Ga0207699_100799932 279
1698 3300025907 Ga0207645_10214065 Ga0207645_102140652 279
1699 3300025907 Ga0207645_10216934 Ga0207645_102169341 279
1700 3300025909 Ga0207705_10131695 Ga0207705_101316952 279
1701 3300025911 Ga0207654_10000058 Ga0207654_1000005864 279
1702 3300025911 Ga0207654_10024310 Ga0207654_100243103 279
1703 3300025911 Ga0207654_10247453 Ga0207654_102474531 279
1704 3300025911 Ga0207654_10361339 Ga0207654_103613391 279
1705 3300025912 Ga0207707_10000100 Ga0207707_100001001 279
1706 3300025912 Ga0207707_10020346 Ga0207707_100203462 279
1707 3300025912 Ga0207707_10056938 Ga0207707_100569381 279
1708 3300025913 Ga0207695_10000107 Ga0207695_10000107217 279
1709 3300025913 Ga0207695_10000453 Ga0207695_1000045349 279
1710 3300025913 Ga0207695_10196781 Ga0207695_101967812 279
1711 3300025913 Ga0207695_10567094 Ga0207695_105670941 279
1712 3300025914 Ga0207671_10006934 Ga0207671_100069344 279
1713 3300025914 Ga0207671_10039004 Ga0207671_100390043 279
1714 3300025914 Ga0207671_10070331 Ga0207671_100703312 279
1715 3300025914 Ga0207671_10106543 Ga0207671_101065432 279
1716 3300025915 Ga0207693_10013676 Ga0207693_100136764 279
1717 3300025915 Ga0207693_10016511 Ga0207693_100165114 279
1718 3300025915 Ga0207693_10028589 Ga0207693_100285894 279
1719 3300025915 Ga0207693_10092818 Ga0207693_100928182 279
1720 3300025916 Ga0207663_10032061 Ga0207663_100320613 279
1721 3300025916 Ga0207663_10033325 Ga0207663_100333254 279
1722 3300025916 Ga0207663_10127397 Ga0207663_101273972 279
1723 3300025916 Ga0207663_10166201 Ga0207663_101662012 279
1724 3300025917 Ga0207660_10018837 Ga0207660_100188374 279
1725 3300025917 Ga0207660_10023642 Ga0207660_100236425 279
1726 3300025917 Ga0207660_10077983 Ga0207660_100779834 279
1727 3300025917 Ga0207660_10552665 Ga0207660_105526651 279
1728 3300025918 Ga0207662_10210360 Ga0207662_102103601 279
1729 3300025919 Ga0207657_10001686 Ga0207657_100016863 279
1730 3300025919 Ga0207657_10060102 Ga0207657_100601023 279
1731 3300025919 Ga0207657_10175078 Ga0207657_101750782 279
1732 3300025920 Ga0207649_10194096 Ga0207649_101940962 279
1733 3300025921 Ga0207652_10026633 Ga0207652_100266333 279
1734 3300025921 Ga0207652_10134241 Ga0207652_101342412 279
1735 3300025921 Ga0207652_10493677 Ga0207652_104936771 279
1736 3300025922 Ga0207646_10095001 Ga0207646_100950011 279
1737 3300025923 Ga0207681_10227791 Ga0207681_102277911 279
1738 3300025924 Ga0207694_10001009 Ga0207694_100010091 279
1739 3300025924 Ga0207694_10007667 Ga0207694_100076676 279
1740 3300025924 Ga0207694_10053306 Ga0207694_100533064 279
1741 3300025924 Ga0207694_10094099 Ga0207694_100940992 279
1742 3300025927 Ga0207687_10012464 Ga0207687_100124641 279
1743 3300025927 Ga0207687_10076079 Ga0207687_100760791 279
1744 3300025928 Ga0207700_10001418 Ga0207700_100014187 279
1745 3300025928 Ga0207700_10030214 Ga0207700_100302143 279
1746 3300025928 Ga0207700_10076096 Ga0207700_100760961 279
1747 3300025928 Ga0207700_10125666 Ga0207700_101256662 279
1748 3300025929 Ga0207664_10004485 Ga0207664_100044857 279
1749 3300025929 Ga0207664_10019693 Ga0207664_100196935 279
1750 3300025929 Ga0207664_10036266 Ga0207664_100362663 279
1751 3300025929 Ga0207664_10189317 Ga0207664_101893172 279
1752 3300025929 Ga0207664_10500655 Ga0207664_105006552 279
1753 3300025931 Ga0207644_10060210 Ga0207644_100602103 279
1754 3300025932 Ga0207690_10226025 Ga0207690_102260252 279
1755 3300025932 Ga0207690_10264463 Ga0207690_102644632 279
1756 3300025932 Ga0207690_10475570 Ga0207690_104755701 279
1757 3300025933 Ga0207706_10087334 Ga0207706_100873342 279
1758 3300025935 Ga0207709_10076079 Ga0207709_100760791 279
1759 3300025936 Ga0207670_10251871 Ga0207670_102518711 279
1760 3300025937 Ga0207669_10170314 Ga0207669_101703142 279
1761 3300025938 Ga0207704_10123590 Ga0207704_101235902 279
1762 3300025939 Ga0207665_10006611 Ga0207665_100066119 279
1763 3300025939 Ga0207665_10009684 Ga0207665_100096843 279
1764 3300025940 Ga0207691_10040766 Ga0207691_100407663 279
1765 3300025940 Ga0207691_10086631 Ga0207691_100866311 279
1766 3300025941 Ga0207711_10327793 Ga0207711_103277931 279
1767 3300025942 Ga0207689_10159295 Ga0207689_101592952 279
1768 3300025942 Ga0207689_10283303 Ga0207689_102833031 279
1769 3300025944 Ga0207661_10063954 Ga0207661_100639542 279
1770 3300025945 Ga0207679_10097234 Ga0207679_100972343 279
1771 3300025945 Ga0207679_10269529 Ga0207679_102695292 279
1772 3300025949 Ga0207667_10002324 Ga0207667_1000232424 279
1773 3300025949 Ga0207667_10015224 Ga0207667_100152244 279
1774 3300025949 Ga0207667_10141261 Ga0207667_101412614 279
1775 3300025949 Ga0207667_10240035 Ga0207667_102400351 279
1776 3300025961 Ga0207712_10218803 Ga0207712_102188032 279
1777 3300025972 Ga0207668_10054744 Ga0207668_100547443 279
1778 3300025972 Ga0207668_10159236 Ga0207668_101592363 279
1779 3300025972 Ga0207668_10224893 Ga0207668_102248932 279
1780 3300025981 Ga0207640_10064044 Ga0207640_100640442 279
1781 3300025981 Ga0207640_10247627 Ga0207640_102476272 279
1782 3300025981 Ga0207640_10314960 Ga0207640_103149602 279
1783 3300026023 Ga0207677_10113338 Ga0207677_101133382 279
1784 3300026023 Ga0207677_10250420 Ga0207677_102504202 279
1785 3300026023 Ga0207677_10317108 Ga0207677_103171081 279
1786 3300026035 Ga0207703_10212977 Ga0207703_102129772 279
1787 3300026041 Ga0207639_10002317 Ga0207639_100023178 279
1788 3300026041 Ga0207639_10031138 Ga0207639_100311383 279
1789 3300026041 Ga0207639_10147371 Ga0207639_101473711 279
1790 3300026041 Ga0207639_10418887 Ga0207639_104188872 279
1791 3300026067 Ga0207678_10004832 Ga0207678_100048323 279
1792 3300026067 Ga0207678_10005663 Ga0207678_100056634 279
1793 3300026067 Ga0207678_10039914 Ga0207678_100399145 279
1794 3300026067 Ga0207678_10045970 Ga0207678_100459701 279
1795 3300026067 Ga0207678_10053719 Ga0207678_100537193 279
1796 3300026075 Ga0207708_10198676 Ga0207708_101986761 279
1797 3300026078 Ga0207702_10000004 Ga0207702_10000004247 279
1798 3300026078 Ga0207702_10001701 Ga0207702_1000170113 279
1799 3300026078 Ga0207702_10082698 Ga0207702_100826983 279
1800 3300026078 Ga0207702_10154503 Ga0207702_101545033 279
1801 3300026078 Ga0207702_10217083 Ga0207702_102170832 279
1802 3300026078 Ga0207702_10279826 Ga0207702_102798262 279
1803 3300026088 Ga0207641_10853150 Ga0207641_108531501 279
1804 3300026089 Ga0207648_10027306 Ga0207648_100273062 279
1805 3300026095 Ga0207676_10179576 Ga0207676_101795762 279
1806 3300026116 Ga0207674_10000890 Ga0207674_100008909 279
1807 3300026116 Ga0207674_10002298 Ga0207674_100022983 279
1808 3300026116 Ga0207674_10046110 Ga0207674_100461106 279
1809 3300026116 Ga0207674_10050784 Ga0207674_100507841 279
1810 3300026116 Ga0207674_10074016 Ga0207674_100740164 279
1811 3300026118 Ga0207675_100101390 Ga0207675_1001013903 279
1812 3300026121 Ga0207683_10063219 Ga0207683_100632192 279
1813 3300026121 Ga0207683_10358358 Ga0207683_103583581 279
1814 3300026121 Ga0207683_10368755 Ga0207683_103687551 279
1815 3300026142 Ga0207698_10037553 Ga0207698_100375534 279
1816 3300026142 Ga0207698_10066209 Ga0207698_100662092 279
1817 3300026142 Ga0207698_10081718 Ga0207698_100817182 279
1818 3300026142 Ga0207698_10129747 Ga0207698_101297472 279
1819 3300026142 Ga0207698_10222866 Ga0207698_102228662 279
1820 3300026142 Ga0207698_10261757 Ga0207698_102617571 279
1821 3300026142 Ga0207698_10303068 Ga0207698_103030682 279
1822 3300027296 Ga0209389_1000033 Ga0209389_100003324 279
1823 3300027296 Ga0209389_1000182 Ga0209389_100018238 279
1824 3300027357 Ga0209589_1000040 Ga0209589_100004024 279
1825 3300027361 Ga0209489_100045 Ga0209489_10004536 279
1826 3300027361 Ga0209489_100209 Ga0209489_10020938 279
1827 3300027363 Ga0209700_100011 Ga0209700_100011191 279
1828 3300027907 Ga0207428_10121991 Ga0207428_101219911 279
1829 3300028379 Ga0268266_10001190 Ga0268266_1000119013 279
1830 3300028379 Ga0268266_10003966 Ga0268266_1000396616 279
1831 3300028379 Ga0268266_10010790 Ga0268266_100107903 279
1832 3300028379 Ga0268266_10026048 Ga0268266_100260484 279
1833 3300028379 Ga0268266_10060942 Ga0268266_100609423 279
1834 3300028381 Ga0268264_10000062 Ga0268264_1000006211 279
1835 3300028558 Ga0265326_10019560 Ga0265326_100195602 279
1836 3300028573 Ga0265334_10056600 Ga0265334_100566001 279
1837 3300028653 Ga0265323_10010254 Ga0265323_100102545 279
1838 3300028666 Ga0265336_10000561 Ga0265336_1000056115 279
1839 3300028786 Ga0307517_10001338 Ga0307517_1000133827 279
1840 3300028794 Ga0307515_10181770 Ga0307515_101817701 279
1841 3300028794 Ga0307515_10289619 Ga0307515_102896192 279
1842 3300028800 Ga0265338_10000598 Ga0265338_1000059823 279
1843 3300029957 Ga0265324_10007924 Ga0265324_100079244 279
1844 3300030521 Ga0307511_10032499 Ga0307511_100324992 279
1845 3300030521 Ga0307511_10161439 Ga0307511_101614391 279
1846 3300031235 Ga0265330_10015500 Ga0265330_100155003 279
1847 3300031235 Ga0265330_10078748 Ga0265330_100787482 279
1848 3300031238 Ga0265332_10011743 Ga0265332_100117435 279
1849 3300031238 Ga0265332_10044345 Ga0265332_100443453 279
1850 3300031241 Ga0265325_10010784 Ga0265325_100107847 279
1851 3300031249 Ga0265339_10001062 Ga0265339_100010623 279
1852 3300031344 Ga0265316_10135766 Ga0265316_101357661 279
1853 3300031456 Ga0307513_10402072 Ga0307513_104020721 279
1854 3300031507 Ga0307509_10080587 Ga0307509_100805875 279
1855 3300031711 Ga0265314_10042090 Ga0265314_100420904 279
1856 3300031712 Ga0265342_10054134 Ga0265342_100541342 279
1857 3300031712 Ga0265342_10197901 Ga0265342_101979011 279
1858 3300031730 Ga0307516_10008308 Ga0307516_100083085 279
1859 3300031730 Ga0307516_10022504 Ga0307516_100225047 279
1860 3300031730 Ga0307516_10093671 Ga0307516_100936714 279
1861 3300031730 Ga0307516_10102284 Ga0307516_101022843 279
1862 3300031730 Ga0307516_10318436 Ga0307516_103184362 279
1863 3300031730 Ga0307516_10409265 Ga0307516_104092651 279
1864 3300031731 Ga0307405_10031045 Ga0307405_100310455 279
1865 3300031852 Ga0307410_10094066 Ga0307410_100940661 279
1866 3300031901 Ga0307406_10038341 Ga0307406_100383414 279
1867 3300031911 Ga0307412_10197313 Ga0307412_101973132 279
1868 3300032002 Ga0307416_100092107 Ga0307416_1000921071 279
1869 3300032002 Ga0307416_100149616 Ga0307416_1001496162 279
1870 3300032002 Ga0307416_100493536 Ga0307416_1004935361 279
1871 3300032005 Ga0307411_10317908 Ga0307411_103179081 279
1872 3300033179 Ga0307507_10019178 Ga0307507_100191781 279
1873 3300033180 Ga0307510_10021983 Ga0307510_100219834 279
1874 3300033180 Ga0307510_10037056 Ga0307510_100370566 279
1875 3300033180 Ga0307510_10072508 Ga0307510_100725084 279
1876 3300034816 Ga0373930_0007086 Ga0373930_0007086_614_1456 279
1877 3300035085 Ga0373929_0020115 Ga0373929_0020115_210_1049 279
1878 3300035086 Ga0373934_0002347 Ga0373934_0002347_4351_5190 279
1879 3300035111 Ga0373923_0004419 Ga0373923_0004419_737_1576 279
1880 3300035113 Ga0373936_0028137 Ga0373936_0028137_559_1401 279
1881 3300035117 Ga0373953_0009436 Ga0373953_0009436_1006_1845 279
1882 3300035118 Ga0373954_0000883 Ga0373954_0000883_3975_4814 279
1883 3300035119 Ga0373956_0018845 Ga0373956_0018845_984_1823 279
1884 3300035120 Ga0373957_0001330 Ga0373957_0001330_1358_2197 279
1885 3300035170 Ga0373943_0060330 Ga0373943_0060330_426_1268 279
1886 3300035172 Ga0373955_0001067 Ga0373955_0001067_6437_7276 279
1887 3300035410 Ga0373924_0005686 Ga0373924_0005686_1794_2633 279
1888 3300035691 Ga0373931_0004670 Ga0373931_0004670_397_1239 279
1889 3300035695 Ga0373927_0020336 Ga0373927_0020336_2416_3258 279
1890 3300035695 Ga0373927_0020725 Ga0373927_0020725_2628_3470 279
1891 3300035695 Ga0373927_0210585 Ga0373927_0210585_413_1252 279
1892 3300035695 Ga0373927_0210852 Ga0373927_0210852_83_925 279
1893 3300035695 Ga0373927_0370168 Ga0373927_0370168_80_919 279
1894 3300035724 Ga0373933_0000031 Ga0373933_0000031_39218_40057 279
1895 3300035724 Ga0373933_0001638 Ga0373933_0001638_11473_12312 279
1896 3300035725 Ga0373947_0034928 Ga0373947_0034928_1368_2210 279
1897 3300036401 Ga0373937_0022664 Ga0373937_0022664_3040_3879 279
1898 3300036401 Ga0373937_0245399 Ga0373937_0245399_156_998 279
1899 3300037068 Ga0373925_0061914 Ga0373925_0061914_1907_2746 279
1900 3300037418 Ga0395900_0040360 Ga0395900_0040360_1380_2231 279
1901 3300037466 Ga0395898_0042666 Ga0395898_0042666_1175_2017 279
1902 3300037466 Ga0395898_0149786 Ga0395898_0149786_498_1337 279
1903 3300037466 Ga0395898_0214916 Ga0395898_0214916_416_1267 279
1904 3300037471 Ga0395905_0206657 Ga0395905_0206657_342_1181 279
1905 3300037853 Ga0436364_0096232 Ga0436364_0096232_401_1240 279
1906 3300038443 Ga0395901_0161555 Ga0395901_0161555_1231_2070 279
1907 3300038443 Ga0395901_0272541 Ga0395901_0272541_399_1241 279
1908 3300038443 Ga0395901_0486977 Ga0395901_0486977_153_1001 279
1909 3300039437 Ga0436365_0221825 Ga0436365_0221825_250_1089 279
1910 3300039437 Ga0436365_0949897 Ga0436365_0949897_8638_9477 279
1911 3300039438 Ga0436360_0780899 Ga0436360_0780899_1086_1925 279
1912 3300039447 Ga0436361_0333730 Ga0436361_0333730_1095_1934 279
1913 3300039450 Ga0436363_0863782 Ga0436363_0863782_988_1827 279
1914 3300039453 Ga0436362_0112883 Ga0436362_0112883_669_1508 279
1915 3300039453 Ga0436362_0546439 Ga0436362_0546439_1193_2032 279
1916 3300041453 Ga0451797_1160655 Ga0451797_1160655_286_1125 279
1917 3300041460 Ga0451802_0544973 Ga0451802_0544973_146_988 279
1918 3300042438 Ga0439459_0024175 Ga0439459_0024175_287_1126 279
1919 3300044656 Ga0466969_0030685 Ga0466969_0030685_1605_2444 279
1920 3300044658 Ga0466972_0000119 Ga0466972_0000119_39613_40452 279
1921 3300044658 Ga0466972_0023237 Ga0466972_0023237_1150_1989 279
1922 3300044683 Ga0466965_0029278 Ga0466965_0029278_858_1697 279
1923 3300044683 Ga0466965_0036005 Ga0466965_0036005_369_1208 279
1924 3300044706 Ga0466964_0106147 Ga0466964_0106147_106_945 279
1925 3300044706 Ga0466964_0145203 Ga0466964_0145203_39_884 279
1926 3300044735 Ga0466968_0064073 Ga0466968_0064073_298_1137 279
1927 3300044901 Ga0466960_0056971 Ga0466960_0056971_927_1766 279
1928 3300045049 Ga0466959_0161266 Ga0466959_0161266_288_1127 279
1929 3300045976 Ga0466967_0083690 Ga0466967_0083690_1258_2097 279
1930 3300045976 Ga0466967_0105726 Ga0466967_0105726_60_908 279
1931 3300045976 Ga0466967_0361534 Ga0466967_0361534_464_1309 279
1932 3300046454 Ga0495592_0003085 Ga0495592_0003085_3686_4525 279
1933 3300046455 Ga0495603_0020465 Ga0495603_0020465_547_1386 279
1934 3300046455 Ga0495603_0022882 Ga0495603_0022882_2385_3224 279
1935 3300046455 Ga0495603_0041392 Ga0495603_0041392_1828_2670 279
1936 3300046455 Ga0495603_0062555 Ga0495603_0062555_1064_1903 279
1937 3300046455 Ga0495603_0162744 Ga0495603_0162744_46_891 279
1938 3300046455 Ga0495603_0212020 Ga0495603_0212020_196_1035 279
1939 3300046457 Ga0495590_0061027 Ga0495590_0061027_91_930 279
1940 3300046459 Ga0495629_0001972 Ga0495629_0001972_1790_2629 279
1941 3300046459 Ga0495629_0112059 Ga0495629_0112059_184_1023 279
1942 3300046460 Ga0495638_0001094 Ga0495638_0001094_8942_9781 279
1943 3300046460 Ga0495638_0054969 Ga0495638_0054969_549_1391 279
1944 3300046462 Ga0495651_0016592 Ga0495651_0016592_1242_2081 279
1945 3300046462 Ga0495651_0027555 Ga0495651_0027555_1951_2790 279
1946 3300046462 Ga0495651_0066310 Ga0495651_0066310_301_1143 279
1947 3300046463 Ga0495653_0002188 Ga0495653_0002188_2055_2894 279
1948 3300046471 Ga0495650_0062027 Ga0495650_0062027_259_1098 279
1949 3300046471 Ga0495650_0095507 Ga0495650_0095507_34_873 279
1950 3300046472 Ga0495580_0290614 Ga0495580_0290614_85_927 279
1951 3300046475 Ga0495639_0030682 Ga0495639_0030682_797_1639 279
1952 3300046477 Ga0495664_0039757 Ga0495664_0039757_120_959 279
1953 3300046499 Ga0495594_0155911 Ga0495594_0155911_408_1247 279
1954 3300046506 Ga0495583_0024679 Ga0495583_0024679_312_1151 279
1955 3300046507 Ga0495606_0000252 Ga0495606_0000252_63724_64566 279
1956 3300046507 Ga0495606_0020289 Ga0495606_0020289_2728_3567 279
1957 3300046507 Ga0495606_0257391 Ga0495606_0257391_87_926 279
1958 3300046511 Ga0495608_0030843 Ga0495608_0030843_2009_2848 279
1959 3300046511 Ga0495608_0048520 Ga0495608_0048520_1485_2324 279
1960 3300046514 Ga0495618_0024256 Ga0495618_0024256_1805_2644 279
1961 3300046514 Ga0495618_0182599 Ga0495618_0182599_147_986 279
1962 3300046515 Ga0495620_0038307 Ga0495620_0038307_1107_1946 279
1963 3300046515 Ga0495620_0059303 Ga0495620_0059303_138_977 279
1964 3300046515 Ga0495620_0064024 Ga0495620_0064024_278_1117 279
1965 3300046516 Ga0495628_0059445 Ga0495628_0059445_921_1760 279
1966 3300046516 Ga0495628_0113838 Ga0495628_0113838_702_1541 279
1967 3300046519 Ga0495632_0079408 Ga0495632_0079408_14_853 279
1968 3300046520 Ga0495637_0069636 Ga0495637_0069636_170_1009 279
1969 3300046522 Ga0495643_0004740 Ga0495643_0004740_4367_5206 279
1970 3300046522 Ga0495643_0057943 Ga0495643_0057943_610_1449 279
1971 3300046524 Ga0495648_0000286 Ga0495648_0000286_24979_25818 279
1972 3300046524 Ga0495648_0010274 Ga0495648_0010274_985_1824 279
1973 3300046524 Ga0495648_0086311 Ga0495648_0086311_439_1278 279
1974 3300046529 Ga0495652_0018347 Ga0495652_0018347_1962_2801 279
1975 3300046529 Ga0495652_0064883 Ga0495652_0064883_115_954 279
1976 3300046529 Ga0495652_0327226 Ga0495652_0327226_92_931 279
1977 3300046530 Ga0495654_0006037 Ga0495654_0006037_2454_3296 279
1978 3300046533 Ga0495640_0039130 Ga0495640_0039130_1442_2281 279
1979 3300046533 Ga0495640_0059727 Ga0495640_0059727_687_1526 279
1980 3300046533 Ga0495640_0090769 Ga0495640_0090769_34_873 279
1981 3300046536 Ga0495587_0023867 Ga0495587_0023867_123_962 279
1982 3300046536 Ga0495587_0133906 Ga0495587_0133906_299_1138 279
1983 3300046536 Ga0495587_0194911 Ga0495587_0194911_286_1125 279
1984 3300046536 Ga0495587_0199522 Ga0495587_0199522_78_917 279
1985 3300046543 Ga0495645_0035369 Ga0495645_0035369_959_1798 279
1986 3300046543 Ga0495645_0146956 Ga0495645_0146956_532_1371 279
1987 3300046557 Ga0495622_0021427 Ga0495622_0021427_162_1001 279
1988 3300046557 Ga0495622_0055495 Ga0495622_0055495_415_1254 279
1989 3300046557 Ga0495622_0093736 Ga0495622_0093736_491_1330 279
1990 3300046559 Ga0495667_0002652 Ga0495667_0002652_3390_4229 279
1991 3300046559 Ga0495667_0246146 Ga0495667_0246146_237_1079 279
1992 3300046616 Ga0495668_0036116 Ga0495668_0036116_634_1476 279
1993 3300046616 Ga0495668_0048118 Ga0495668_0048118_1063_1902 279
1994 3300046642 Ga0495634_0021849 Ga0495634_0021849_1813_2652 279
1995 3300046642 Ga0495634_0065147 Ga0495634_0065147_1184_2023 279
1996 3300046642 Ga0495634_0142117 Ga0495634_0142117_283_1122 279
1997 3300046648 Ga0495611_0170607 Ga0495611_0170607_91_930 279
1998 3300046660 Ga0495625_0056335 Ga0495625_0056335_1396_2235 279
1999 3300046660 Ga0495625_0094790 Ga0495625_0094790_444_1286 279
2000 3300046660 Ga0495625_0284297 Ga0495625_0284297_108_947 279
2001 3300046663 Ga0495635_0001078 Ga0495635_0001078_3390_4229 279
2002 3300046663 Ga0495635_0005472 Ga0495635_0005472_960_1799 279
2003 3300046665 Ga0495661_0155342 Ga0495661_0155342_326_1168 279
2004 3300046665 Ga0495661_0191664 Ga0495661_0191664_91_930 279
2005 3300046674 Ga0495588_0024864 Ga0495588_0024864_1389_2228 279
2006 3300046674 Ga0495588_0156479 Ga0495588_0156479_134_973 279
2007 3300046675 Ga0495657_0010052 Ga0495657_0010052_2906_3745 279
2008 3300046675 Ga0495657_0012323 Ga0495657_0012323_1191_2030 279
2009 3300046675 Ga0495657_0125671 Ga0495657_0125671_562_1401 279
2010 3300046678 Ga0495599_0001153 Ga0495599_0001153_749_1588 279
2011 3300046678 Ga0495599_0050500 Ga0495599_0050500_1062_1901 279
2012 3300046679 Ga0495623_0016469 Ga0495623_0016469_2009_2848 279
2013 3300046679 Ga0495623_0046940 Ga0495623_0046940_1628_2467 279
2014 3300046680 Ga0495646_0004178 Ga0495646_0004178_6287_7126 279
2015 3300046681 Ga0495647_0021856 Ga0495647_0021856_335_1174 279
2016 3300046689 Ga0495613_0147899 Ga0495613_0147899_607_1446 279
2017 3300046690 Ga0495624_0074674 Ga0495624_0074674_989_1828 279
2018 3300046692 Ga0495671_0083319 Ga0495671_0083319_97_936 279
2019 3300046692 Ga0495671_0171568 Ga0495671_0171568_187_1029 279
2020 3300046694 Ga0495649_0022117 Ga0495649_0022117_1509_2348 279
2021 3300046794 Ga0495589_0038643 Ga0495589_0038643_326_1165 279
2022 3300046794 Ga0495589_0042748 Ga0495589_0042748_879_1721 279
2023 3300046809 Ga0495600_0016286 Ga0495600_0016286_3576_4415 279
2024 3300046809 Ga0495600_0088862 Ga0495600_0088862_115_954 279
2025 3300046810 Ga0495660_0052752 Ga0495660_0052752_181_1020 279
2026 3300047315 Ga0495581_0094007 Ga0495581_0094007_670_1509 279
2027 3300047315 Ga0495581_0095658 Ga0495581_0095658_331_1170 279
2028 3300047317 Ga0495604_0009217 Ga0495604_0009217_5778_6617 279
2029 3300047317 Ga0495604_0029213 Ga0495604_0029213_754_1593 279
2030 3300047319 Ga0495674_0089440 Ga0495674_0089440_1481_2320 279
2031 3300047319 Ga0495674_0104383 Ga0495674_0104383_474_1313 279
2032 3300047321 Ga0495676_0079376 Ga0495676_0079376_275_1114 279
2033 3300047322 Ga0495680_0000689 Ga0495680_0000689_20496_21335 279
2034 3300047322 Ga0495680_0015853 Ga0495680_0015853_2814_3653 279
2035 3300047323 Ga0495683_0020152 Ga0495683_0020152_1320_2159 279
2036 3300047323 Ga0495683_0074095 Ga0495683_0074095_152_991 279
2037 3300047443 Ga0495687_007102 Ga0495687_007102_1066_1905 279
2038 3300047444 Ga0495675_0001437 Ga0495675_0001437_10922_11761 279
2039 3300047444 Ga0495675_0031708 Ga0495675_0031708_1946_2785 279
2040 3300047445 Ga0495677_0098608 Ga0495677_0098608_235_1077 279
2041 3300047445 Ga0495677_0099909 Ga0495677_0099909_239_1078 279
2042 3300047469 Ga0495673_0045161 Ga0495673_0045161_528_1367 279
2043 3300047469 Ga0495673_0084624 Ga0495673_0084624_115_954 279
2044 3300047470 Ga0495681_0019926 Ga0495681_0019926_1302_2144 279
2045 3300047470 Ga0495681_0122274 Ga0495681_0122274_22_864 279
2046 3300047471 Ga0495684_0000313 Ga0495684_0000313_6674_7513 279
2047 3300047472 Ga0495686_0075227 Ga0495686_0075227_278_1117 279
2048 3300047673 Ga0495593_0000693 Ga0495593_0000693_18187_19026 279
2049 3300048088 Ga0495602_0002384 Ga0495602_0002384_1928_2767 279
2050 3300048088 Ga0495602_0037524 Ga0495602_0037524_1897_2736 279
2051 3300048903 Ga0496100_0004117 Ga0496100_0004117_4275_5114 279
2052 3300048903 Ga0496100_0354832 Ga0496100_0354832_174_1016 279
2053 3300048904 Ga0496101_0105796 Ga0496101_0105796_385_1224 279
2054 3300048904 Ga0496101_0145379 Ga0496101_0145379_412_1254 279
2055 3300048905 Ga0496102_0001314 Ga0496102_0001314_18643_19482 279
2056 3300048905 Ga0496102_0021069 Ga0496102_0021069_4675_5517 279
2057 3300048905 Ga0496102_0038433 Ga0496102_0038433_1838_2677 279
2058 3300048905 Ga0496102_0169651 Ga0496102_0169651_578_1417 279
2059 3300048905 Ga0496102_0328692 Ga0496102_0328692_514_1353 279
2060 3300048905 Ga0496102_0483605 Ga0496102_0483605_218_1057 279
2061 3300048906 Ga0496103_0008659 Ga0496103_0008659_1917_2756 279
2062 3300048906 Ga0496103_0307451 Ga0496103_0307451_137_976 279
2063 3300048907 Ga0496104_0081494 Ga0496104_0081494_312_1151 279
2064 3300048907 Ga0496104_0199393 Ga0496104_0199393_192_1031 279
2065 3300048907 Ga0496104_0214949 Ga0496104_0214949_829_1668 279
2066 3300048907 Ga0496104_0297575 Ga0496104_0297575_346_1185 279
2067 3300048907 Ga0496104_0491072 Ga0496104_0491072_268_1107 279
2068 3300048907 Ga0496104_0573957 Ga0496104_0573957_69_908 279
2069 3300048908 Ga0496105_0000935 Ga0496105_0000935_9133_9972 279
2070 3300048908 Ga0496105_0012763 Ga0496105_0012763_769_1608 279
2071 3300048908 Ga0496105_0083297 Ga0496105_0083297_276_1115 279
2072 3300048908 Ga0496105_0206808 Ga0496105_0206808_399_1238 279
2073 3300048908 Ga0496105_0519852 Ga0496105_0519852_28_867 279
2074 3300048909 Ga0496106_0000236 Ga0496106_0000236_37693_38532 279
2075 3300048909 Ga0496106_0001014 Ga0496106_0001014_18533_19375 279
2076 3300048909 Ga0496106_0172713 Ga0496106_0172713_720_1562 279
2077 3300048909 Ga0496106_0560483 Ga0496106_0560483_19_858 279
2078 3300048910 Ga0496107_0006262 Ga0496107_0006262_3177_4016 279
2079 3300048910 Ga0496107_0011653 Ga0496107_0011653_4199_5038 279
2080 3300048910 Ga0496107_0014083 Ga0496107_0014083_4019_4858 279
2081 3300048910 Ga0496107_0020391 Ga0496107_0020391_2273_3115 279
2082 3300048910 Ga0496107_0163028 Ga0496107_0163028_230_1069 279
2083 3300048911 Ga0496108_0000849 Ga0496108_0000849_9009_9848 279
2084 3300048911 Ga0496108_0012923 Ga0496108_0012923_1120_1959 279
2085 3300048911 Ga0496108_0062393 Ga0496108_0062393_1763_2602 279
2086 3300048911 Ga0496108_0125766 Ga0496108_0125766_413_1252 279
2087 3300048911 Ga0496108_0351988 Ga0496108_0351988_363_1202 279
2088 3300048911 Ga0496108_0544743 Ga0496108_0544743_62_901 279
2089 3300048912 Ga0496109_0000224 Ga0496109_0000224_10793_11632 279
2090 3300048912 Ga0496109_0026221 Ga0496109_0026221_330_1169 279
2091 3300048912 Ga0496109_0075500 Ga0496109_0075500_487_1326 279
2092 3300048912 Ga0496109_0077160 Ga0496109_0077160_40_879 279
2093 3300048912 Ga0496109_0618655 Ga0496109_0618655_21_860 279
2094 3300048913 Ga0496110_0025638 Ga0496110_0025638_1954_2793 279
2095 3300048913 Ga0496110_0044581 Ga0496110_0044581_1367_2206 279
2096 3300048913 Ga0496110_0093478 Ga0496110_0093478_33_872 279
2097 3300048913 Ga0496110_0177587 Ga0496110_0177587_888_1727 279
2098 3300048913 Ga0496110_0230176 Ga0496110_0230176_321_1160 279
2099 3300048913 Ga0496110_0348751 Ga0496110_0348751_306_1145 279
2100 3300048914 Ga0496111_0032982 Ga0496111_0032982_80_919 279
2101 3300048914 Ga0496111_0035701 Ga0496111_0035701_726_1568 279
2102 3300048914 Ga0496111_0193174 Ga0496111_0193174_529_1371 279
2103 3300048914 Ga0496111_0207838 Ga0496111_0207838_166_1005 279
2104 3300048914 Ga0496111_0223339 Ga0496111_0223339_232_1071 279
2105 3300048914 Ga0496111_0428158 Ga0496111_0428158_11_850 279
2106 3300048915 Ga0496112_0000020 Ga0496112_0000020_64521_65363 279
2107 3300048915 Ga0496112_0001044 Ga0496112_0001044_13479_14318 279
2108 3300048915 Ga0496112_0085759 Ga0496112_0085759_725_1564 279
2109 3300048915 Ga0496112_0135786 Ga0496112_0135786_1528_2367 279
2110 3300048915 Ga0496112_0212285 Ga0496112_0212285_482_1321 279
2111 3300048915 Ga0496112_0342485 Ga0496112_0342485_162_1001 279
2112 3300048916 Ga0496113_0008868 Ga0496113_0008868_1518_2357 279
2113 3300048916 Ga0496113_0025475 Ga0496113_0025475_1705_2547 279
2114 3300048916 Ga0496113_0036756 Ga0496113_0036756_1668_2507 279
2115 3300048916 Ga0496113_0060373 Ga0496113_0060373_321_1160 279
2116 3300048916 Ga0496113_0092954 Ga0496113_0092954_1288_2127 279
2117 3300048916 Ga0496113_0129462 Ga0496113_0129462_353_1192 279
2118 3300048917 Ga0496114_0021424 Ga0496114_0021424_258_1097 279
2119 3300048917 Ga0496114_0022004 Ga0496114_0022004_1547_2389 279
2120 3300048917 Ga0496114_0659677 Ga0496114_0659677_70_909 279
2121 3300048918 Ga0496115_0006071 Ga0496115_0006071_748_1587 279
2122 3300048918 Ga0496115_0144741 Ga0496115_0144741_338_1180 279
2123 3300048918 Ga0496115_0198209 Ga0496115_0198209_507_1346 279
2124 3300048919 Ga0496116_0050598 Ga0496116_0050598_544_1386 279
2125 3300048919 Ga0496116_0126522 Ga0496116_0126522_412_1251 279
2126 3300048920 Ga0496117_0017224 Ga0496117_0017224_5018_5857 279
2127 3300048920 Ga0496117_0027455 Ga0496117_0027455_2713_3555 279
2128 3300048920 Ga0496117_0033893 Ga0496117_0033893_556_1395 279
2129 3300048920 Ga0496117_0219061 Ga0496117_0219061_172_1014 279
2130 3300048921 Ga0496118_0003026 Ga0496118_0003026_14408_15247 279
2131 3300048921 Ga0496118_0014494 Ga0496118_0014494_2673_3512 279
2132 3300048921 Ga0496118_0025699 Ga0496118_0025699_3397_4239 279
2133 3300048921 Ga0496118_0035791 Ga0496118_0035791_1710_2549 279
2134 3300048921 Ga0496118_0154748 Ga0496118_0154748_65_907 279
2135 3300048922 Ga0496119_0025923 Ga0496119_0025923_739_1578 279
2136 3300048922 Ga0496119_0035726 Ga0496119_0035726_1618_2457 279
2137 3300048923 Ga0496120_0083845 Ga0496120_0083845_664_1503 279
2138 3300048923 Ga0496120_0086205 Ga0496120_0086205_324_1163 279
2139 3300048923 Ga0496120_0093327 Ga0496120_0093327_538_1377 279
2140 3300048924 Ga0496121_0000370 Ga0496121_0000370_4741_5580 279
2141 3300048924 Ga0496121_0001039 Ga0496121_0001039_2932_3774 279
2142 3300048924 Ga0496121_0011522 Ga0496121_0011522_2672_3511 279
2143 3300048924 Ga0496121_0019165 Ga0496121_0019165_4040_4882 279
2144 3300048924 Ga0496121_0030770 Ga0496121_0030770_3981_4820 279
2145 3300048924 Ga0496121_0046170 Ga0496121_0046170_719_1561 279
2146 3300048924 Ga0496121_0070234 Ga0496121_0070234_1030_1869 279
2147 3300048924 Ga0496121_0154562 Ga0496121_0154562_481_1320 279
2148 3300048924 Ga0496121_0314580 Ga0496121_0314580_172_1014 279
2149 3300048924 Ga0496121_0380837 Ga0496121_0380837_41_880 279
2150 3300048925 Ga0496122_0028108 Ga0496122_0028108_2278_3120 279
2151 3300048925 Ga0496122_0071551 Ga0496122_0071551_246_1085 279
2152 3300048925 Ga0496122_0093455 Ga0496122_0093455_91_933 279
2153 3300048925 Ga0496122_0116276 Ga0496122_0116276_142_981 279
2154 3300048926 Ga0496123_0041585 Ga0496123_0041585_1742_2584 279
2155 3300048926 Ga0496123_0041888 Ga0496123_0041888_528_1370 279
2156 3300048927 Ga0496124_0036402 Ga0496124_0036402_1121_1960 279
2157 3300048927 Ga0496124_0057421 Ga0496124_0057421_1868_2707 279
2158 3300048927 Ga0496124_0092914 Ga0496124_0092914_392_1234 279
2159 3300048927 Ga0496124_0104184 Ga0496124_0104184_216_1058 279
2160 3300048927 Ga0496124_0274037 Ga0496124_0274037_352_1191 279
2161 3300048927 Ga0496124_0304603 Ga0496124_0304603_164_1003 279
2162 3300048928 Ga0496125_0000328 Ga0496125_0000328_36357_37199 279
2163 3300048928 Ga0496125_0000407 Ga0496125_0000407_73466_74308 279
2164 3300048928 Ga0496125_0023759 Ga0496125_0023759_2491_3330 279
2165 3300048928 Ga0496125_0026887 Ga0496125_0026887_3375_4217 279
2166 3300048928 Ga0496125_0052055 Ga0496125_0052055_2512_3351 279
2167 3300048928 Ga0496125_0057775 Ga0496125_0057775_646_1485 279
2168 3300048928 Ga0496125_0093298 Ga0496125_0093298_133_972 279
2169 3300048928 Ga0496125_0183626 Ga0496125_0183626_494_1333 279
2170 3300048929 Ga0496126_0002944 Ga0496126_0002944_21245_22084 279
2171 3300048929 Ga0496126_0015944 Ga0496126_0015944_5917_6756 279
2172 3300048929 Ga0496126_0022058 Ga0496126_0022058_1016_1855 279
2173 3300048929 Ga0496126_0033530 Ga0496126_0033530_2608_3447 279
2174 3300048929 Ga0496126_0073081 Ga0496126_0073081_45_884 279
2175 3300048929 Ga0496126_0086187 Ga0496126_0086187_337_1179 279
2176 3300048929 Ga0496126_0119982 Ga0496126_0119982_833_1672 279
2177 3300048929 Ga0496126_0181126 Ga0496126_0181126_415_1254 279
2178 3300048929 Ga0496126_0200307 Ga0496126_0200307_785_1627 279
2179 3300048929 Ga0496126_0320487 Ga0496126_0320487_34_879 279
2180 3300048929 Ga0496126_0395003 Ga0496126_0395003_32_874 279
2181 3300048929 Ga0496126_0422013 Ga0496126_0422013_164_1003 279
2182 3300049460 Ga0495682_0027899 Ga0495682_0027899_360_1199 279
2183 3300049568 Ga0501031_0019691 Ga0501031_0019691_1263_2105 279
2184 3300049569 Ga0501032_0000475 Ga0501032_0000475_23935_24777 279
2185 3300049569 Ga0501032_0008230 Ga0501032_0008230_5740_6582 279
2186 3300049569 Ga0501032_0077047 Ga0501032_0077047_1195_2046 279
2187 3300049569 Ga0501032_0083346 Ga0501032_0083346_696_1538 279
2188 3300049569 Ga0501032_0233681 Ga0501032_0233681_346_1185 279
2189 3300049570 Ga0501033_0000440 Ga0501033_0000440_13072_13914 279
2190 3300049570 Ga0501033_0001499 Ga0501033_0001499_15093_15935 279
2191 3300049570 Ga0501033_0089360 Ga0501033_0089360_149_991 279
2192 3300049571 Ga0501034_0000250 Ga0501034_0000250_33140_33982 279
2193 3300049571 Ga0501034_0086116 Ga0501034_0086116_1167_2009 279
2194 3300049572 Ga0501036_0000098 Ga0501036_0000098_11884_12726 279
2195 3300049572 Ga0501036_0039965 Ga0501036_0039965_2201_3043 279
2196 3300049572 Ga0501036_0138010 Ga0501036_0138010_386_1225 279
2197 3300049573 Ga0501037_0000092 Ga0501037_0000092_61655_62497 279
2198 3300049573 Ga0501037_0006812 Ga0501037_0006812_1802_2644 279
2199 3300049573 Ga0501037_0105157 Ga0501037_0105157_892_1734 279
2200 3300049573 Ga0501037_0173603 Ga0501037_0173603_90_932 279
2201 3300049574 Ga0501038_0000059 Ga0501038_0000059_32691_33533 279
2202 3300049574 Ga0501038_0006869 Ga0501038_0006869_3304_4155 279
2203 3300049574 Ga0501038_0045822 Ga0501038_0045822_742_1593 279
2204 3300049574 Ga0501038_0053622 Ga0501038_0053622_512_1354 279
2205 3300049574 Ga0501038_0073971 Ga0501038_0073971_1157_1999 279
2206 3300049574 Ga0501038_0245348 Ga0501038_0245348_198_1037 279
2207 3300049575 Ga0501039_0000085 Ga0501039_0000085_63545_64387 279
2208 3300049575 Ga0501039_0031807 Ga0501039_0031807_2499_3341 279
2209 3300049575 Ga0501039_0041308 Ga0501039_0041308_2291_3133 279
2210 3300049575 Ga0501039_0056725 Ga0501039_0056725_1968_2810 279
2211 3300049575 Ga0501039_0087620 Ga0501039_0087620_1198_2037 279
2212 3300049578 Ga0501042_0023911 Ga0501042_0023911_2712_3554 279
2213 3300049578 Ga0501042_0493882 Ga0501042_0493882_28_870 279
2214 3300049579 Ga0501043_0001889 Ga0501043_0001889_362_1204 279
2215 3300049579 Ga0501043_0012702 Ga0501043_0012702_1990_2832 279
2216 3300049579 Ga0501043_0022014 Ga0501043_0022014_2500_3351 279
2217 3300049579 Ga0501043_0035424 Ga0501043_0035424_348_1187 279
2218 3300049579 Ga0501043_0103540 Ga0501043_0103540_1167_2009 279
2219 3300049579 Ga0501043_0127740 Ga0501043_0127740_926_1765 279
2220 3300049579 Ga0501043_0140231 Ga0501043_0140231_480_1331 279
2221 3300049580 Ga0501046_0000483 Ga0501046_0000483_18034_18876 279
2222 3300049580 Ga0501046_0050847 Ga0501046_0050847_1539_2381 279
2223 3300049580 Ga0501046_0075433 Ga0501046_0075433_899_1741 279
2224 3300049581 Ga0501047_0000022 Ga0501047_0000022_139173_140015 279
2225 3300049581 Ga0501047_0126511 Ga0501047_0126511_213_1052 279
2226 3300049581 Ga0501047_0197121 Ga0501047_0197121_149_991 279
2227 3300049582 Ga0501048_0000821 Ga0501048_0000821_1324_2166 279
2228 3300049582 Ga0501048_0004230 Ga0501048_0004230_3066_3908 279
2229 3300049583 Ga0501067_0000510 Ga0501067_0000510_3303_4145 279
2230 3300049583 Ga0501067_0014598 Ga0501067_0014598_2743_3585 279
2231 3300049583 Ga0501067_0095935 Ga0501067_0095935_261_1103 279
2232 3300049583 Ga0501067_0255904 Ga0501067_0255904_106_948 279
2233 3300049584 Ga0501068_0001239 Ga0501068_0001239_1869_2711 279
2234 3300049584 Ga0501068_0006616 Ga0501068_0006616_2621_3463 279
2235 3300049584 Ga0501068_0025351 Ga0501068_0025351_1776_2615 279
2236 3300049585 Ga0501069_0000707 Ga0501069_0000707_4528_5370 279
2237 3300049586 Ga0501070_0005840 Ga0501070_0005840_9255_10097 279
2238 3300049586 Ga0501070_0037509 Ga0501070_0037509_2927_3769 279
2239 3300049586 Ga0501070_0210199 Ga0501070_0210199_570_1409 279
2240 3300049587 Ga0501071_0102548 Ga0501071_0102548_88_930 279
2241 3300049587 Ga0501071_0293036 Ga0501071_0293036_185_1024 279
2242 3300049588 Ga0501072_0001923 Ga0501072_0001923_11703_12545 279
2243 3300049588 Ga0501072_0314070 Ga0501072_0314070_317_1159 279
2244 3300049589 Ga0501073_0000955 Ga0501073_0000955_6114_6956 279
2245 3300049589 Ga0501073_0031647 Ga0501073_0031647_1884_2726 279
2246 3300049590 Ga0501074_0002275 Ga0501074_0002275_10034_10876 279
2247 3300049590 Ga0501074_0006843 Ga0501074_0006843_6254_7096 279
2248 3300049590 Ga0501074_0059730 Ga0501074_0059730_87_926 279
2249 3300049592 Ga0501076_0224081 Ga0501076_0224081_607_1446 279
2250 3300049593 Ga0501077_0103504 Ga0501077_0103504_853_1695 279
2251 3300049741 Ga0501079_0003103 Ga0501079_0003103_4538_5380 279
2252 3300049741 Ga0501079_0055474 Ga0501079_0055474_1372_2214 279
2253 3300049742 Ga0501080_0009878 Ga0501080_0009878_2949_3791 279
2254 3300049742 Ga0501080_0022030 Ga0501080_0022030_3780_4622 279
2255 3300049742 Ga0501080_0079680 Ga0501080_0079680_424_1266 279
2256 3300049742 Ga0501080_0203918 Ga0501080_0203918_554_1393 279
2257 3300049743 Ga0501081_0330208 Ga0501081_0330208_30_872 279
2258 3300049744 Ga0501083_0000808 Ga0501083_0000808_1332_2174 279
2259 3300049744 Ga0501083_0013360 Ga0501083_0013360_2813_3655 279
2260 3300049822 Ga0501035_0000240 Ga0501035_0000240_6323_7165 279
2261 3300049822 Ga0501035_0005844 Ga0501035_0005844_2572_3414 279
2262 3300049822 Ga0501035_0080808 Ga0501035_0080808_1659_2498 279
2263 3300049822 Ga0501035_0167522 Ga0501035_0167522_763_1605 279
2264 3300049822 Ga0501035_0211585 Ga0501035_0211585_589_1431 279
2265 3300049823 Ga0501044_0000072 Ga0501044_0000072_25770_26612 279
2266 3300049823 Ga0501044_0056754 Ga0501044_0056754_2755_3597 279
2267 3300049823 Ga0501044_0058319 Ga0501044_0058319_301_1143 279
2268 3300049823 Ga0501044_0097979 Ga0501044_0097979_1739_2578 279
2269 3300049823 Ga0501044_0282993 Ga0501044_0282993_45_896 279
2270 3300049824 Ga0501045_0027715 Ga0501045_0027715_2889_3731 279
2271 3300050489 nmdc:mga03683_79303_c1 nmdc:mga03683_79303_c1_299_1138 279
2272 3300050490 nmdc:mga03n38_5778_c1 nmdc:mga03n38_5778_c1_202_1041 279
2273 3300050491 nmdc:mga00v17_36286_c1 nmdc:mga00v17_36286_c1_759_1598 279
2274 3300050492 nmdc:mga0yw44_147214_c1 nmdc:mga0yw44_147214_c1_458_1297 279
2275 3300050492 nmdc:mga0yw44_2639_c1 nmdc:mga0yw44_2639_c1_5390_6229 279
2276 3300050492 nmdc:mga0yw44_46826_c1 nmdc:mga0yw44_46826_c1_1487_2326 279
2277 3300050492 nmdc:mga0yw44_95715_c1 nmdc:mga0yw44_95715_c1_530_1372 279
2278 3300050493 nmdc:mga0k408_30659_c1 nmdc:mga0k408_30659_c1_2038_2877 279
2279 3300050493 nmdc:mga0k408_39149_c1 nmdc:mga0k408_39149_c1_1244_2083 279
2280 3300050493 nmdc:mga0k408_59277_c1 nmdc:mga0k408_59277_c1_686_1525 279
2281 3300050494 nmdc:mga06z11_160880_c1 nmdc:mga06z11_160880_c1_145_987 279
2282 3300050494 nmdc:mga06z11_2466_c1 nmdc:mga06z11_2466_c1_1999_2838 279
2283 3300050496 nmdc:mga07m45_15602_c1 nmdc:mga07m45_15602_c1_1495_2334 279
2284 3300050496 nmdc:mga07m45_31423_c1 nmdc:mga07m45_31423_c1_1785_2624 279
2285 3300050496 nmdc:mga07m45_32616_c1 nmdc:mga07m45_32616_c1_1221_2063 279
2286 3300050496 nmdc:mga07m45_35038_c1 nmdc:mga07m45_35038_c1_1470_2309 279
2287 3300050507 nmdc:mga05p37_36662_c1 nmdc:mga05p37_36662_c1_4559_5398 279
2288 3300050511 nmdc:mga08y16_179101_c1 nmdc:mga08y16_179101_c1_76_915 279
2289 3300050511 nmdc:mga08y16_78483_c1 nmdc:mga08y16_78483_c1_786_1628 279
2290 3300050512 nmdc:mga0n895_2738_c1 nmdc:mga0n895_2738_c1_6239_7078 279
2291 3300050512 nmdc:mga0n895_332932_c1 nmdc:mga0n895_332932_c1_21_863 279
2292 3300053077 Ga0495601_0018323 Ga0495601_0018323_1186_2025 279
2293 3300053077 Ga0495601_0035959 Ga0495601_0035959_759_1601 279
2294 3300053079 Ga0500610_0149213 Ga0500610_0149213_131_970 279
2295 3300053084 Ga0495595_0023372 Ga0495595_0023372_1241_2080 279
2296 3300053085 Ga0495619_0000330 Ga0495619_0000330_9368_10207 279
2297 3300053085 Ga0495619_0056307 Ga0495619_0056307_1370_2212 279
2298 3300053087 Ga0500643_000063 Ga0500643_000063_43339_44178 279
2299 3300053088 Ga0500644_0108270 Ga0500644_0108270_75_917 279
2300 3300053089 Ga0500581_090861 Ga0500581_090861_233_1072 279
2301 3300053090 Ga0500646_0007427 Ga0500646_0007427_1467_2309 279
2302 3300053091 Ga0500647_0028092 Ga0500647_0028092_823_1665 279
2303 3300053092 Ga0500583_0030333 Ga0500583_0030333_312_1151 279
2304 3300053093 Ga0500651_0005704 Ga0500651_0005704_257_1099 279
2305 3300053093 Ga0500651_0007402 Ga0500651_0007402_4359_5201 279
2306 3300053093 Ga0500651_0094553 Ga0500651_0094553_914_1756 279
2307 3300053094 Ga0500566_0000151 Ga0500566_0000151_32648_33490 279
2308 3300053094 Ga0500566_0000236 Ga0500566_0000236_1729_2568 279
2309 3300053094 Ga0500566_0000247 Ga0500566_0000247_5214_6056 279
2310 3300053096 Ga0500641_0006119 Ga0500641_0006119_1136_1978 279
2311 3300053096 Ga0500641_0011386 Ga0500641_0011386_1122_1964 279
2312 3300053096 Ga0500641_0018450 Ga0500641_0018450_626_1468 279
2313 3300053096 Ga0500641_0021622 Ga0500641_0021622_819_1661 279
2314 3300053098 Ga0500650_0004779 Ga0500650_0004779_2979_3821 279
2315 3300053098 Ga0500650_0101342 Ga0500650_0101342_379_1218 279
2316 3300053102 Ga0500554_002974 Ga0500554_002974_723_1562 279
2317 3300053102 Ga0500554_110457 Ga0500554_110457_38_880 279
2318 3300053104 Ga0500556_0000006 Ga0500556_0000006_343526_344368 279
2319 3300053105 Ga0500557_000037 Ga0500557_000037_56529_57368 279
2320 3300053109 Ga0500569_004907 Ga0500569_004907_66_908 279
2321 3300053109 Ga0500569_030594 Ga0500569_030594_43_882 279
2322 3300053109 Ga0500569_090435 Ga0500569_090435_56_895 279
2323 3300053111 Ga0500572_001270 Ga0500572_001270_1221_2060 279
2324 3300053116 Ga0500592_000189 Ga0500592_000189_5363_6205 279
2325 3300053116 Ga0500592_008283 Ga0500592_008283_683_1525 279
2326 3300053117 Ga0500593_022901 Ga0500593_022901_1852_2694 279
2327 3300053119 Ga0500595_006181 Ga0500595_006181_2296_3138 279
2328 3300053119 Ga0500595_007015 Ga0500595_007015_1183_2025 279
2329 3300053121 Ga0500607_023497 Ga0500607_023497_1581_2420 279
2330 3300053121 Ga0500607_026533 Ga0500607_026533_1322_2164 279
2331 3300053122 Ga0500608_004120 Ga0500608_004120_2068_2910 279
2332 3300053122 Ga0500608_017789 Ga0500608_017789_1391_2230 279
2333 3300053122 Ga0500608_021338 Ga0500608_021338_1851_2693 279
2334 3300053130 Ga0500642_0000004 Ga0500642_0000004_143145_143987 279
2335 3300053130 Ga0500642_0000062 Ga0500642_0000062_38714_39553 279
2336 3300053130 Ga0500642_0003645 Ga0500642_0003645_2476_3318 279
2337 3300053131 Ga0500652_000555 Ga0500652_000555_1772_2614 279
2338 3300053131 Ga0500652_007548 Ga0500652_007548_1205_2044 279
2339 3300053133 Ga0500655_037189 Ga0500655_037189_19_858 279
2340 3300053136 Ga0500559_0000179 Ga0500559_0000179_37066_37938 279
2341 3300053136 Ga0500559_0006133 Ga0500559_0006133_2459_3301 279
2342 3300053136 Ga0500559_0015873 Ga0500559_0015873_1717_2556 279
2343 3300053139 Ga0500568_0024462 Ga0500568_0024462_1157_1999 279
2344 3300053139 Ga0500568_0030451 Ga0500568_0030451_884_1726 279
2345 3300053139 Ga0500568_0039632 Ga0500568_0039632_779_1618 279
2346 3300053140 Ga0500573_0112425 Ga0500573_0112425_77_916 279
2347 3300053142 Ga0500577_0000470 Ga0500577_0000470_7682_8530 279
2348 3300053142 Ga0500577_0080270 Ga0500577_0080270_370_1212 279
2349 3300053145 Ga0500586_002011 Ga0500586_002011_1740_2582 279
2350 3300053146 Ga0500588_0018770 Ga0500588_0018770_238_1077 279
2351 3300053146 Ga0500588_0023611 Ga0500588_0023611_521_1360 279
2352 3300053146 Ga0500588_0094409 Ga0500588_0094409_56_898 279
2353 3300053148 Ga0500590_032675 Ga0500590_032675_273_1112 279
2354 3300053153 Ga0500616_0000022 Ga0500616_0000022_339309_340151 279
2355 3300053153 Ga0500616_0003813 Ga0500616_0003813_2555_3394 279
2356 3300053155 Ga0500620_010224 Ga0500620_010224_1348_2187 279
2357 3300053156 Ga0500622_0033524 Ga0500622_0033524_214_1053 279
2358 3300053156 Ga0500622_0063226 Ga0500622_0063226_596_1435 279
2359 3300053158 Ga0500627_0007472 Ga0500627_0007472_2040_2879 279
2360 3300053158 Ga0500627_0037129 Ga0500627_0037129_929_1768 279
2361 3300053158 Ga0500627_0130371 Ga0500627_0130371_33_875 279
2362 3300053161 Ga0500634_0018999 Ga0500634_0018999_269_1111 279
2363 3300053161 Ga0500634_0175359 Ga0500634_0175359_53_895 279
2364 3300053162 Ga0500638_058426 Ga0500638_058426_140_979 279
2365 3300053163 Ga0500639_182872 Ga0500639_182872_31_873 279
2366 3300053177 Ga0500636_0000349 Ga0500636_0000349_9933_10772 279
2367 3300053177 Ga0500636_0002876 Ga0500636_0002876_1096_1938 279
2368 3300053178 Ga0500637_0023445 Ga0500637_0023445_1461_2300 279
2369 3300053178 Ga0500637_0083261 Ga0500637_0083261_11_853 279
2370 3300053729 Ga0500625_001277 Ga0500625_001277_1665_2504 279
2371 3300053731 Ga0500609_005039 Ga0500609_005039_755_1594 279
2372 3300053735 Ga0500596_000909 Ga0500596_000909_3827_4669 279
2373 3300053735 Ga0500596_004995 Ga0500596_004995_496_1335 279
2374 3300053737 Ga0500601_000601 Ga0500601_000601_2417_3256 279
2375 3300054114 Ga0501084_0026071 Ga0501084_0026071_2896_3738 279
2376 3300054114 Ga0501084_0064354 Ga0501084_0064354_766_1608 279
2377 3300060353 Ga0501082_0001185 Ga0501082_0001185_13067_13909 279
2378 3300060353 Ga0501082_0074667 Ga0501082_0074667_1126_1968 279
2379 3300037418 Ga0395900_0003383 Ga0395900_0003383_7394_8236 280
2380 3300037466 Ga0395898_0253695 Ga0395898_0253695_530_1372 280
2381 3300038443 Ga0395901_0434709 Ga0395901_0434709_450_1292 280
2382 2010549000 RicEn_C4416 RicEn_78740 281
2383 3300009093 Ga0105240_10334999 Ga0105240_103349992 281
2384 3300021320 Ga0214544_1000016 Ga0214544_1000016176 281
2385 3300021321 Ga0214542_1000016 Ga0214542_100001626 281
2386 3300021324 Ga0214545_1000008 Ga0214545_100000832 281
2387 3300021327 Ga0214543_1001466 Ga0214543_100146626 281
2388 3300025254 Ga0209148_1000282 Ga0209148_100028214 281
2389 3300025261 Ga0209233_1012168 Ga0209233_10121683 281
2390 3300025272 Ga0209455_1008795 Ga0209455_10087952 281
2391 3300044658 Ga0466972_0120032 Ga0466972_0120032_21_866 281
2392 3300044684 Ga0466966_0001462 Ga0466966_0001462_5896_6741 281
2393 3300044693 Ga0466961_0000139 Ga0466961_0000139_11961_12806 281
2394 3300044694 Ga0466963_0021631 Ga0466963_0021631_912_1757 281
2395 3300044735 Ga0466968_0033860 Ga0466968_0033860_1270_2115 281
2396 3300044842 Ga0466957_0109451 Ga0466957_0109451_492_1337 281
2397 3300045976 Ga0466967_0225224 Ga0466967_0225224_467_1312 281
2398 3300048929 Ga0496126_0069770 Ga0496126_0069770_360_1214 281
2399 3300053094 Ga0500566_0015485 Ga0500566_0015485_1898_2752 281
2400 3300053119 Ga0500595_012681 Ga0500595_012681_399_1253 281
2401 3300053162 Ga0500638_000539 Ga0500638_000539_1895_2749 281
2402 3300055283 Ga0500661_000348 Ga0500661_000348_1833_2687 281

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03618

Kinase-PPPase

Kinase/pyrophosphorylase

53

302

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qsq-assembly2.cif.gz_B permutated n-terminal lobe of the ribose binding protein from thermotoga maritima 0.7552 8 91
1qnl-assembly1.cif.gz_A amide receptor/negative regulator of the amidase operon of pseudomonas aeruginosa (amic) complexed with butyramide 0.7042 9 91
1qo0-assembly1.cif.gz_B amide receptor of the amidase operon of pseudomonas aeruginosa (amic) complexed with the negative regulator amir. 0.6942 6 91
5x0o-assembly2.cif.gz_F regulatory domain of aphb treated with cumene hydroperoxide from vibrio vulnificus 0.686 5 42
5mmh-assembly4.cif.gz_D-5 the x-ray structure of the effector domain of the transcriptional regulator ampr of pseudomonas aeruginosa 0.6817 5 42
ID Description Score Start End Superfamily
af_Q69NA5_27_147_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.7423 7 91 3.40.50.2300
af_A0A1D6EQP7_1_152_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.7413 6 91 3.40.50.2300
af_P77269_27_144_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.736 5 91 3.40.50.2300
af_Q69L11_28_153_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.7327 4 91 3.40.50.2300
4wutA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.7216 9 91 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A519XS76-F1-model_v4 deleted 1.001 4 68
AF-A0A5K1HQ78-F1-model_v4 Phosphoenolpyruvate synthase regulatory protein 1 3 78 GO:0004674
GO:0005524
AF-A0A7Y4K261-F1-model_v4 Kinase/pyrophosphorylase 0.9931 1 83 GO:0004674
GO:0005524
AF-A0A520ELB6-F1-model_v4 deleted 0.987 6 85
AF-A0A528PA80-F1-model_v4 deleted 0.9859 5 104

Feature Viewer

pLDDT pTM Quality
87.64 0.64 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map