F496043
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1912 | 847 | 1679 | 273 |
Family's Representative Sequence
| Representative Sequence | 3300046524|Ga0495648_0033902|Ga0495648_0033902_833_1795 |
| Length | 320 |
| Sequence | MCCFADPGPIPASRNAWVPGLRRTTSLRDVLHRARDTDRNAMTKSLRFRAAVVSIAIFCAFIGTWHLATRGTGSIAAMTPEYAKLMGLTATVGKSAMPGPLDVGAKLWEHLKRPFYDNGPNDKGLGIQLAYSIGRVGLGYLLAVVIAIPLGFLIGMSPLMNKALDPFIQVLKPISPLAWMPLALYTIKDSGLSAIFVIFICSIWPMLLNTAFGVAAVRKEWINVARTLEVGTFRRAFTVILPAAAPTILTGMRISIGIAWLVIVAAEMLVGGTGIGYFVWNEWNNLSITNVIIAILLIGVVGMLLDQVLARFTRMVTFPE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 5 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 6 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 7 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 8 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 9 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 10 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 11 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 12 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 13 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 14 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 15 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 16 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 17 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 18 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 19 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 20 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 21 | 2522572158 | Azospirillum halopraeferens DSM 3675 | Isolate | Unclassified |
| 22 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 23 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 24 | 2545555834 | Methylobacterium sp. WSM2598 | Isolate | Nodule |
| 25 | 2548876994 | Herbaspirillum lusitanum P6-12 | Isolate | Nodule |
| 26 | 2595698237 | Methylobacterium sp. UNCCL125 | Isolate | Unclassified |
| 27 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 28 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 29 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 30 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 31 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 32 | 2600255389 | Pseudomonas sp. NFPP33 | Isolate | Rhizoplane |
| 33 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 34 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 35 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 36 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 37 | 2643221569 | Achromobacter sp. Root565 | Isolate | Unclassified |
| 38 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 39 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 40 | 2643221594 | Achromobacter sp. Root170 | Isolate | Unclassified |
| 41 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 42 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 43 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 44 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 45 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 46 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 47 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 48 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 49 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 50 | 2687453129 | Halotalea alkalilenta IHB B 13600 | Isolate | Unclassified |
| 51 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 52 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 53 | 2738541281 | Methylobacterium sp. GV094 | Isolate | Unclassified |
| 54 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 55 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 56 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 57 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 58 | 2738543032 | Methylobacterium sp. GV104 | Isolate | Unclassified |
| 59 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 60 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 61 | 2791355199 | |||
| 62 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 63 | 2808606386 | Herbaspirillum sp. SJZ099 | Isolate | Rhizosphere |
| 64 | 2808606395 | Achromobacter sp. SLBN-14 | Isolate | Unclassified |
| 65 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 66 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 67 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 68 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 69 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 70 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 71 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 72 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 73 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 74 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 75 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 76 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 77 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 78 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 79 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 80 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 81 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 82 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 83 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 84 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 85 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 86 | 2828305725 | Xanthobacter tagetidis DSM 11105 | Isolate | Unclassified |
| 87 | 2829745981 | Methylorubrum rhodinum DSM 2163 | Isolate | Rhizosphere |
| 88 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 89 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 90 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 91 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 92 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 93 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 94 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 95 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 96 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 97 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 98 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 99 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 100 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 101 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 102 | 2842694124 | Methylopila sp. R-72369 | Isolate | Unclassified |
| 103 | 2842698319 | Methylobacterium sp. R-72139 | Isolate | Unclassified |
| 104 | 2842718218 | Acidovorax sp. R-73343 | Isolate | Unclassified |
| 105 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 106 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 107 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 108 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 109 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 110 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 111 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 112 | 2857537821 | Achromobacter sp. R-71975 | Isolate | Unclassified |
| 113 | 2857542790 | Achromobacter sp. R-72367 | Isolate | Unclassified |
| 114 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 115 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 116 | 2857576091 | Pigmentiphaga sp. R-72090 | Isolate | Unclassified |
| 117 | 2861691609 | Methylorubrum thiocyanatum DSM 11490 | Isolate | Rhizosphere |
| 118 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 119 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 120 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 121 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 122 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 123 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 124 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 125 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 126 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 127 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 128 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 129 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 130 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 131 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 132 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 133 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 134 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 135 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 136 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 137 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 138 | 2894772417 | Roseomonas oryzicola KCTC 22478 | Isolate | Rhizosphere |
| 139 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 140 | 2899275550 | Paracoccus hibiscisoli CCTCC AB2016182 | Isolate | Rhizosphere |
| 141 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 142 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 143 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 144 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 145 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 146 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 147 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 148 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 149 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 150 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 151 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 152 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 153 | 2904699407 | |||
| 154 | 2906610324 | |||
| 155 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 156 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 157 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 158 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 159 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 160 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 161 | 2917699015 | Bosea sp. F3-2 | Isolate | Rhizosphere |
| 162 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 163 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 164 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 165 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 166 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 167 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 168 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 169 | 2922425934 | |||
| 170 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 171 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 172 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 173 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 174 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 175 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 176 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 177 | 2928125067 | Methylobacterium sp. 1973 | Isolate | Unclassified |
| 178 | 2929199973 | Roseomonas sp. R-73070 Hybrid assembly | Isolate | Unclassified |
| 179 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 180 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 181 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 182 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 183 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 184 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 185 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 186 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 187 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 188 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 189 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 190 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 191 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 192 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 193 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 194 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 195 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 196 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 197 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 198 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 199 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 200 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 201 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 202 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 203 | 2941479691 | |||
| 204 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 205 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 206 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 207 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 208 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 209 | 3003665799 | Methylobacterium aquaticum BG2 | Isolate | Unclassified |
| 210 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 211 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 212 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 213 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 214 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 215 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 216 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 217 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 218 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 219 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 220 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 221 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 222 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 223 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 224 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 225 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 226 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 227 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 228 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 229 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 230 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 231 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 232 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 233 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 234 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 235 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 236 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 237 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 238 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 239 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 240 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 241 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 242 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 243 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 244 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 245 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 246 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 247 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 248 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 249 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 250 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 251 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 252 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 253 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 254 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 255 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 256 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 257 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 258 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 259 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 260 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 261 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 262 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 263 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 264 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 265 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 266 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 267 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 268 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 269 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 270 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 271 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 272 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 273 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 274 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 275 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 276 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 277 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 278 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 279 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 280 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 281 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 282 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 283 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 284 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 285 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 286 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 287 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 288 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 289 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 290 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 291 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 292 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 293 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 294 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 295 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 296 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 297 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 298 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 299 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 300 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 301 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 302 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 303 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 304 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 305 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 306 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 307 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 308 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 309 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 310 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 311 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 312 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 313 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 314 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 315 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 316 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 317 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 318 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 319 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 320 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 321 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 322 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 323 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 324 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 325 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 326 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 327 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 328 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 329 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 330 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 331 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 332 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 333 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 334 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 335 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 336 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 337 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 338 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 339 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 340 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 341 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 342 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 343 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 344 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 345 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 346 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 347 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 348 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 349 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 350 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 351 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 352 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 353 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 354 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 355 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 356 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 357 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 358 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 359 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 360 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 361 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 362 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 363 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 364 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 365 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 366 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 367 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 368 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 369 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 370 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 371 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 372 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 373 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 374 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 375 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 376 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 377 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 378 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 379 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 380 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 381 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 382 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 383 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 384 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 385 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 386 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 387 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 388 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 389 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 390 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 391 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 392 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 393 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 394 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 395 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 396 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 397 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 398 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 399 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 400 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 401 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 402 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 403 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 404 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 405 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 406 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 407 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 408 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 409 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 410 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 411 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 412 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 413 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 414 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 415 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 416 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 417 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 418 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 419 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 420 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 421 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 422 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 423 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 424 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 425 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 426 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 427 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 428 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 429 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 430 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 431 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 432 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 433 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 434 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 435 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 436 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 437 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 438 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 439 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 440 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 441 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 442 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 443 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 444 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 445 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 446 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 447 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 448 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 449 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 450 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 451 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 452 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 453 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 454 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 455 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 456 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 457 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 458 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 459 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 460 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 461 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 462 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 463 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 464 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 465 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 466 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 467 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 468 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 469 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 470 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 471 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 472 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 473 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 474 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 475 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 476 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 477 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 478 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 479 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 480 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 481 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 482 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 483 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 484 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 485 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 486 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 487 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 488 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 489 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 490 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 491 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 492 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 493 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 494 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 495 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 496 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 497 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 498 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 499 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 500 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 501 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 502 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 503 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 504 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 505 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 506 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 507 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 508 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 509 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 510 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 511 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 512 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 513 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 514 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 515 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 516 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 517 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 518 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 519 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 520 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 521 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 522 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 523 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 524 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 525 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 526 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 527 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 528 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 529 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 530 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 531 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 532 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 533 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 534 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 535 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 536 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 537 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 538 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 539 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 540 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 541 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 542 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 543 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 544 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 545 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 546 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 547 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 548 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 549 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 550 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 551 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 552 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 553 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 554 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 555 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 556 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 557 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 558 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 559 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 560 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 561 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 562 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 563 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 564 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 565 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 566 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 567 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 568 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 569 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 570 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 571 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 572 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 573 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 574 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 575 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 576 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 577 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 578 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 579 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 580 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 581 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 582 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 583 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 584 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 585 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 586 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 587 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 588 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 589 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 590 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 591 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 592 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 593 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 594 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 595 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 596 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 597 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 598 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 599 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 600 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 601 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 602 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 603 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 604 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 605 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 606 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 607 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 608 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 609 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 610 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 611 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 612 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 613 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 614 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 615 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 616 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 617 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 618 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 619 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 620 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 621 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 622 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 623 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 624 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 625 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 626 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 627 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 628 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 629 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 630 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 631 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 632 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 633 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 634 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 635 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 636 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 637 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 638 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 639 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 640 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 641 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 642 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 643 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 644 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 645 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 646 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 647 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 648 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 649 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 650 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 651 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 652 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 653 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 654 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 655 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 656 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 657 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 658 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 659 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 660 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 661 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 662 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 663 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 664 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 665 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 666 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 667 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 668 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 669 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 670 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 671 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 672 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 673 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 674 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 675 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 676 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 677 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 678 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 679 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 680 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 681 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 682 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 683 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 684 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 685 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 686 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 687 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 688 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 689 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 690 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 691 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 692 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 693 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 694 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 695 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 696 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 697 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 698 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 699 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 700 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 701 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 702 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 703 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 704 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 705 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 706 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 707 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 708 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 709 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 710 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 711 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 712 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 713 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 714 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 715 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 716 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 717 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 718 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 719 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 720 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 721 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 722 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 723 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 724 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 725 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 726 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 727 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 728 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 729 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 730 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 731 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 732 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 733 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 734 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 735 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 736 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 737 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 738 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 739 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 740 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 741 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 742 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 743 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 744 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 745 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 746 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 747 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 748 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 749 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 750 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 751 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 752 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 753 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 754 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 755 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 756 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 757 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 758 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 759 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 760 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 761 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 762 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 763 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 764 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 765 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 766 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 767 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 768 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 769 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 770 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 771 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 772 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 773 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 774 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 775 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 776 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 777 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 778 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 779 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 780 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 781 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 782 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 783 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 784 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 785 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 786 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 787 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 788 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 789 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 790 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 791 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 792 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 793 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 794 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 795 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 796 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 797 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 798 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 799 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 800 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 801 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 802 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 803 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 804 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 805 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 806 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 807 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 808 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 809 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 810 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 811 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 812 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 813 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 814 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 815 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 816 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 817 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 818 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 819 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 820 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 821 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 822 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 823 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 824 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 825 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 826 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 827 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 828 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 829 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 830 | 641522639 | Methylobacterium sp. 4-46 | Isolate | Nodule |
| 831 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 832 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 833 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 834 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 835 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 836 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 837 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 838 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 839 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 840 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 841 | 8034962539 | Pseudomonas sediminis PI11 | Isolate | Rhizosphere |
| 842 | 8054002106 | Azospirillum lipoferum 59b | Isolate | Unclassified |
| 843 | 8055225921 | Achromobacter panacis KCTC 42751 | Isolate | Rhizosphere |
| 844 | 8055909800 | Plastoroseomonas hellenica LMG 31523 | Isolate | Unclassified |
| 845 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 846 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 847 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 87.95 |
| Metatranscriptomes | 0.05 |
| Isolates | 12 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.76 |
| Nodule | 5.44 |
| Rhizoplane | 3.5 |
| Rhizosphere | 63.44 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.86 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10015890 | 3300001979 | Bacteria | 2735 |
| 2 | JGI24737J22298_10054951 | 3300001990 | Bacteria | 1204 |
| 3 | JGI24743J22301_10005012 | 3300001991 | Bacteria | 2189 |
| 4 | JGI24750J21931_1012785 | 3300002070 | Bacteria | 1116 |
| 5 | JGI24748J21848_1011408 | 3300002074 | Bacteria | 1047 |
| 6 | JGI24738J21930_10035652 | 3300002075 | Bacteria | 1013 |
| 7 | JGI24744J21845_10033281 | 3300002077 | Bacteria | 981 |
| 8 | JGI24034J26672_10028956 | 3300002239 | Bacteria | 895 |
| 9 | JGI24751J29686_10016259 | 3300002459 | Bacteria | 1535 |
| 10 | JGI25155J39150_1000188 | 3300002704 | Bacteria | 26511 |
| 11 | JGI25155J39150_1000538 | 3300002704 | Bacteria | 8785 |
| 12 | JGI25156J39149_1000150 | 3300002705 | Bacteria | 51558 |
| 13 | JGI25154J39366_1000165 | 3300002738 | Bacteria | 51558 |
| 14 | JGI25154J39366_1000210 | 3300002738 | Bacteria | 41877 |
| 15 | JGI25157J39369_1000383 | 3300002741 | Bacteria | 30452 |
| 16 | JGI25150J39212_1001161 | 3300002774 | Bacteria | 7879 |
| 17 | JGI25151J46595_10005432 | 3300003187 | Bacteria | 6585 |
| 18 | JGI25406J46586_10000801 | 3300003203 | Bacteria | 14848 |
| 19 | JGI25406J46586_10003389 | 3300003203 | Bacteria | 7501 |
| 20 | JGI25406J46586_10003524 | 3300003203 | Bacteria | 7347 |
| 21 | JGI25406J46586_10059517 | 3300003203 | Bacteria | 1240 |
| 22 | JGI25153J46596_10002589 | 3300003215 | Bacteria | 10366 |
| 23 | JGI25153J46596_10003283 | 3300003215 | Bacteria | 9084 |
| 24 | JGI25153J46596_10005567 | 3300003215 | Bacteria | 6585 |
| 25 | JGI25153J46596_10006877 | 3300003215 | Bacteria | 5680 |
| 26 | JGI25153J46596_10021769 | 3300003215 | Bacteria | 2381 |
| 27 | rootL2_10019891 | 3300003322 | Bacteria | 13677 |
| 28 | rootH1_10025745 | 3300003323 | Bacteria | 7125 |
| 29 | JGI25160J50197_1000198 | 3300003354 | Bacteria | 50243 |
| 30 | JGI25160J50197_1003455 | 3300003354 | Bacteria | 7069 |
| 31 | JGI25160J50197_1006259 | 3300003354 | Bacteria | 4838 |
| 32 | JGI25160J50197_1006800 | 3300003354 | Bacteria | 4580 |
| 33 | JGI25160J50197_1007179 | 3300003354 | Bacteria | 4390 |
| 34 | JGI25161J50226_1000021 | 3300003374 | Bacteria | 163584 |
| 35 | JGI25161J50226_1001755 | 3300003374 | Bacteria | 6132 |
| 36 | JGI25404J52841_10003095 | 3300003659 | Bacteria | 3245 |
| 37 | JGI25404J52841_10011082 | 3300003659 | Bacteria | 1941 |
| 38 | Ga0055538_1000054 | 3300003751 | Bacteria | 123566 |
| 39 | Ga0055539_1000066 | 3300003752 | Bacteria | 136557 |
| 40 | Ga0055533_1000076 | 3300003756 | Bacteria | 136557 |
| 41 | Ga0055532_1000097 | 3300003758 | Bacteria | 98781 |
| 42 | Ga0055525_1000098 | 3300003759 | Bacteria | 136557 |
| 43 | Ga0055535_1000858 | 3300003761 | Bacteria | 21509 |
| 44 | Ga0055535_1003562 | 3300003761 | Bacteria | 4319 |
| 45 | Ga0055542_1000022 | 3300003762 | Bacteria | 302315 |
| 46 | Ga0055526_1002491 | 3300003771 | Bacteria | 12426 |
| 47 | Ga0055526_1006184 | 3300003771 | Bacteria | 6585 |
| 48 | Ga0055537_1002281 | 3300003773 | Bacteria | 6585 |
| 49 | Ga0055524_1000033 | 3300003775 | Bacteria | 180833 |
| 50 | Ga0055524_1004325 | 3300003775 | Bacteria | 6585 |
| 51 | Ga0055524_1023756 | 3300003775 | Bacteria | 1966 |
| 52 | Ga0055536_1032314 | 3300003781 | Bacteria | 1354 |
| 53 | Ga0055534_1002365 | 3300003784 | Bacteria | 6585 |
| 54 | Ga0055528_1004626 | 3300003790 | Bacteria | 6585 |
| 55 | Ga0055530_10008420 | 3300003791 | Bacteria | 4136 |
| 56 | Ga0055540_1000007 | 3300003792 | Bacteria | 318178 |
| 57 | Ga0055540_1000784 | 3300003792 | Bacteria | 21495 |
| 58 | Ga0055540_1002994 | 3300003792 | Bacteria | 8459 |
| 59 | Ga0055540_1020504 | 3300003792 | Bacteria | 1746 |
| 60 | Ga0055531_10007095 | 3300003794 | Bacteria | 6191 |
| 61 | Ga0055541_1000056 | 3300003841 | Bacteria | 123566 |
| 62 | Ga0055543_1000238 | 3300004625 | Bacteria | 42822 |
| 63 | Ga0055543_1002979 | 3300004625 | Bacteria | 5254 |
| 64 | Ga0055543_1003612 | 3300004625 | Bacteria | 4473 |
| 65 | Ga0065165_1000024 | 3300005262 | Bacteria | 247672 |
| 66 | Ga0065165_1001284 | 3300005262 | Bacteria | 28344 |
| 67 | Ga0065165_1002756 | 3300005262 | Bacteria | 13971 |
| 68 | Ga0065704_10104316 | 3300005289 | Bacteria | 2145 |
| 69 | Ga0065707_10014575 | 3300005295 | Bacteria | 1959 |
| 70 | Ga0070658_10029383 | 3300005327 | Bacteria | 4415 |
| 71 | Ga0070658_10049317 | 3300005327 | Bacteria | 3410 |
| 72 | Ga0070676_10106817 | 3300005328 | Bacteria | 1737 |
| 73 | Ga0070676_10125841 | 3300005328 | Bacteria | 1614 |
| 74 | Ga0070683_100248408 | 3300005329 | Bacteria | 1692 |
| 75 | Ga0070690_100265153 | 3300005330 | Bacteria | 1220 |
| 76 | Ga0070670_100000081 | 3300005331 | Bacteria | 92043 |
| 77 | Ga0070670_100016676 | 3300005331 | Bacteria | 6304 |
| 78 | Ga0070670_100026578 | 3300005331 | Bacteria | 4979 |
| 79 | Ga0070670_100056875 | 3300005331 | Bacteria | 3358 |
| 80 | Ga0070670_100096223 | 3300005331 | Bacteria | 2547 |
| 81 | Ga0068869_100207306 | 3300005334 | Bacteria | 1548 |
| 82 | Ga0068869_100334238 | 3300005334 | Bacteria | 1231 |
| 83 | Ga0070666_10168377 | 3300005335 | Bacteria | 1534 |
| 84 | Ga0070666_10248901 | 3300005335 | Bacteria | 1258 |
| 85 | Ga0068868_100066740 | 3300005338 | Bacteria | 2861 |
| 86 | Ga0068868_100072676 | 3300005338 | Bacteria | 2744 |
| 87 | Ga0070660_100133685 | 3300005339 | Bacteria | 1986 |
| 88 | Ga0070660_100301085 | 3300005339 | Bacteria | 1315 |
| 89 | Ga0070660_100325719 | 3300005339 | Bacteria | 1263 |
| 90 | Ga0070689_100136116 | 3300005340 | Bacteria | 1972 |
| 91 | Ga0070689_100138815 | 3300005340 | Bacteria | 1953 |
| 92 | Ga0070689_100165875 | 3300005340 | Bacteria | 1787 |
| 93 | Ga0070691_10045042 | 3300005341 | Bacteria | 2093 |
| 94 | Ga0070691_10208285 | 3300005341 | Bacteria | 1031 |
| 95 | Ga0070687_100101196 | 3300005343 | Bacteria | 1613 |
| 96 | Ga0070661_100129753 | 3300005344 | Bacteria | 1892 |
| 97 | Ga0070692_10119169 | 3300005345 | Bacteria | 1469 |
| 98 | Ga0070668_100121847 | 3300005347 | Bacteria | 2085 |
| 99 | Ga0070668_100132137 | 3300005347 | Bacteria | 2004 |
| 100 | Ga0070668_100411367 | 3300005347 | Bacteria | 1157 |
| 101 | Ga0070669_100029055 | 3300005353 | Bacteria | 3984 |
| 102 | Ga0070669_100233525 | 3300005353 | Bacteria | 1458 |
| 103 | Ga0070675_100005492 | 3300005354 | Bacteria | 9707 |
| 104 | Ga0070675_100102270 | 3300005354 | Bacteria | 2414 |
| 105 | Ga0070675_100122468 | 3300005354 | Bacteria | 2210 |
| 106 | Ga0070675_100256412 | 3300005354 | Bacteria | 1532 |
| 107 | Ga0070671_100011767 | 3300005355 | Bacteria | 7038 |
| 108 | Ga0070671_100075919 | 3300005355 | Bacteria | 2807 |
| 109 | Ga0070671_100098374 | 3300005355 | Bacteria | 2454 |
| 110 | Ga0070674_100218180 | 3300005356 | Bacteria | 1482 |
| 111 | Ga0070674_100232129 | 3300005356 | Bacteria | 1440 |
| 112 | Ga0070673_100009243 | 3300005364 | Bacteria | 6611 |
| 113 | Ga0070673_100177483 | 3300005364 | Bacteria | 1821 |
| 114 | Ga0070659_100235484 | 3300005366 | Bacteria | 1514 |
| 115 | Ga0070659_100473553 | 3300005366 | Bacteria | 1065 |
| 116 | Ga0070667_100001429 | 3300005367 | Bacteria | 21397 |
| 117 | Ga0070667_100057841 | 3300005367 | Bacteria | 3277 |
| 118 | Ga0070667_100446422 | 3300005367 | Bacteria | 1181 |
| 119 | Ga0070703_10092812 | 3300005406 | Bacteria | 1049 |
| 120 | Ga0070709_10001642 | 3300005434 | Bacteria | 12118 |
| 121 | Ga0070709_10003602 | 3300005434 | Bacteria | 8319 |
| 122 | Ga0070709_10039766 | 3300005434 | Bacteria | 2887 |
| 123 | Ga0070709_10068701 | 3300005434 | Bacteria | 2280 |
| 124 | Ga0070709_10171549 | 3300005434 | Bacteria | 1516 |
| 125 | Ga0070709_10345064 | 3300005434 | Bacteria | 1099 |
| 126 | Ga0070714_100013820 | 3300005435 | Bacteria | 6473 |
| 127 | Ga0070714_100023153 | 3300005435 | Bacteria | 5099 |
| 128 | Ga0070714_100263796 | 3300005435 | Bacteria | 1596 |
| 129 | Ga0070714_100459311 | 3300005435 | Bacteria | 1210 |
| 130 | Ga0070713_100003091 | 3300005436 | Bacteria | 10950 |
| 131 | Ga0070713_100132397 | 3300005436 | Bacteria | 2200 |
| 132 | Ga0070713_100183887 | 3300005436 | Bacteria | 1880 |
| 133 | Ga0070710_10001132 | 3300005437 | Bacteria | 12626 |
| 134 | Ga0070710_10003655 | 3300005437 | Bacteria | 7275 |
| 135 | Ga0070710_10255753 | 3300005437 | Bacteria | 1127 |
| 136 | Ga0070711_100003864 | 3300005439 | Bacteria | 8795 |
| 137 | Ga0070711_100007426 | 3300005439 | Bacteria | 6666 |
| 138 | Ga0070705_100021640 | 3300005440 | Bacteria | 3423 |
| 139 | Ga0070705_100040250 | 3300005440 | Bacteria | 2657 |
| 140 | Ga0070705_100069391 | 3300005440 | Bacteria | 2125 |
| 141 | Ga0070705_100211819 | 3300005440 | Bacteria | 1336 |
| 142 | Ga0070700_100038270 | 3300005441 | Bacteria | 2922 |
| 143 | Ga0070700_100195026 | 3300005441 | Bacteria | 1419 |
| 144 | Ga0070694_100099262 | 3300005444 | Bacteria | 2057 |
| 145 | Ga0070694_100277030 | 3300005444 | Bacteria | 1278 |
| 146 | Ga0070694_100372257 | 3300005444 | Bacteria | 1112 |
| 147 | Ga0070708_100005534 | 3300005445 | Bacteria | 10011 |
| 148 | Ga0070708_100006881 | 3300005445 | Bacteria | 9074 |
| 149 | Ga0070708_100011367 | 3300005445 | Bacteria | 7240 |
| 150 | Ga0070708_100014186 | 3300005445 | Bacteria | 6548 |
| 151 | Ga0070708_100020178 | 3300005445 | Bacteria | 5615 |
| 152 | Ga0070708_100043141 | 3300005445 | Bacteria | 3963 |
| 153 | Ga0070708_100093833 | 3300005445 | Bacteria | 2737 |
| 154 | Ga0070708_100241926 | 3300005445 | Bacteria | 1694 |
| 155 | Ga0070708_100285818 | 3300005445 | Bacteria | 1552 |
| 156 | Ga0070663_100197713 | 3300005455 | Bacteria | 1567 |
| 157 | Ga0070663_100199585 | 3300005455 | Bacteria | 1560 |
| 158 | Ga0070663_100212417 | 3300005455 | Bacteria | 1516 |
| 159 | Ga0070663_100303608 | 3300005455 | Bacteria | 1278 |
| 160 | Ga0070663_100438427 | 3300005455 | Bacteria | 1074 |
| 161 | Ga0070678_100033200 | 3300005456 | Bacteria | 3581 |
| 162 | Ga0070678_100068196 | 3300005456 | Bacteria | 2651 |
| 163 | Ga0070678_100098017 | 3300005456 | Bacteria | 2265 |
| 164 | Ga0070662_100042847 | 3300005457 | Bacteria | 3235 |
| 165 | Ga0070662_100092254 | 3300005457 | Bacteria | 2276 |
| 166 | Ga0070662_100154396 | 3300005457 | Bacteria | 1790 |
| 167 | Ga0068867_100342847 | 3300005459 | Bacteria | 1244 |
| 168 | Ga0070706_100001066 | 3300005467 | Bacteria | 29656 |
| 169 | Ga0070706_100007018 | 3300005467 | Bacteria | 10620 |
| 170 | Ga0070706_100033419 | 3300005467 | Bacteria | 4747 |
| 171 | Ga0070706_100038072 | 3300005467 | Bacteria | 4441 |
| 172 | Ga0070706_100043592 | 3300005467 | Bacteria | 4146 |
| 173 | Ga0070706_100122782 | 3300005467 | Bacteria | 2421 |
| 174 | Ga0070706_100225125 | 3300005467 | Bacteria | 1751 |
| 175 | Ga0070706_100569066 | 3300005467 | Bacteria | 1054 |
| 176 | Ga0070707_100003645 | 3300005468 | Bacteria | 14522 |
| 177 | Ga0070707_100005430 | 3300005468 | Bacteria | 11921 |
| 178 | Ga0070707_100011879 | 3300005468 | Bacteria | 8128 |
| 179 | Ga0070707_100019372 | 3300005468 | Bacteria | 6410 |
| 180 | Ga0070707_100059338 | 3300005468 | Bacteria | 3671 |
| 181 | Ga0070707_100059485 | 3300005468 | Bacteria | 3665 |
| 182 | Ga0070707_100250116 | 3300005468 | Bacteria | 1725 |
| 183 | Ga0070707_100261262 | 3300005468 | Bacteria | 1684 |
| 184 | Ga0070707_100335690 | 3300005468 | Bacteria | 1468 |
| 185 | Ga0070707_100578364 | 3300005468 | Bacteria | 1086 |
| 186 | Ga0070698_100002784 | 3300005471 | Bacteria | 19250 |
| 187 | Ga0070698_100007110 | 3300005471 | Bacteria | 12121 |
| 188 | Ga0070698_100010988 | 3300005471 | Bacteria | 9631 |
| 189 | Ga0070698_100044987 | 3300005471 | Bacteria | 4519 |
| 190 | Ga0070698_100049237 | 3300005471 | Bacteria | 4302 |
| 191 | Ga0070698_100063521 | 3300005471 | Bacteria | 3723 |
| 192 | Ga0070698_100121348 | 3300005471 | Bacteria | 2574 |
| 193 | Ga0070698_100296995 | 3300005471 | Bacteria | 1546 |
| 194 | Ga0070698_100701807 | 3300005471 | Bacteria | 954 |
| 195 | Ga0070699_100001365 | 3300005518 | Bacteria | 22450 |
| 196 | Ga0070699_100002979 | 3300005518 | Bacteria | 15035 |
| 197 | Ga0070699_100031502 | 3300005518 | Bacteria | 4578 |
| 198 | Ga0070699_100031521 | 3300005518 | Bacteria | 4577 |
| 199 | Ga0070699_100052038 | 3300005518 | Bacteria | 3545 |
| 200 | Ga0070699_100215687 | 3300005518 | Bacteria | 1709 |
| 201 | Ga0070699_100586436 | 3300005518 | Bacteria | 1016 |
| 202 | Ga0070684_100090112 | 3300005535 | Bacteria | 2726 |
| 203 | Ga0070684_100188390 | 3300005535 | Bacteria | 1877 |
| 204 | Ga0070697_100006480 | 3300005536 | Bacteria | 9064 |
| 205 | Ga0070697_100021560 | 3300005536 | Bacteria | 5105 |
| 206 | Ga0070697_100028321 | 3300005536 | Bacteria | 4485 |
| 207 | Ga0070697_100032132 | 3300005536 | Bacteria | 4222 |
| 208 | Ga0070697_100081756 | 3300005536 | Bacteria | 2662 |
| 209 | Ga0070697_100120397 | 3300005536 | Bacteria | 2195 |
| 210 | Ga0070697_100145288 | 3300005536 | Bacteria | 1996 |
| 211 | Ga0070697_100157509 | 3300005536 | Bacteria | 1918 |
| 212 | Ga0070697_100182558 | 3300005536 | Bacteria | 1779 |
| 213 | Ga0068853_100033377 | 3300005539 | Bacteria | 4366 |
| 214 | Ga0068853_100049035 | 3300005539 | Bacteria | 3628 |
| 215 | Ga0068853_100200802 | 3300005539 | Bacteria | 1814 |
| 216 | Ga0068853_100302143 | 3300005539 | Bacteria | 1479 |
| 217 | Ga0070672_100037636 | 3300005543 | Bacteria | 3692 |
| 218 | Ga0070672_100043233 | 3300005543 | Bacteria | 3473 |
| 219 | Ga0070672_100453596 | 3300005543 | Bacteria | 1105 |
| 220 | Ga0070672_100484313 | 3300005543 | Bacteria | 1068 |
| 221 | Ga0070686_100136507 | 3300005544 | Bacteria | 1702 |
| 222 | Ga0070695_100006466 | 3300005545 | Bacteria | 6930 |
| 223 | Ga0070695_100059478 | 3300005545 | Bacteria | 2474 |
| 224 | Ga0070695_100065670 | 3300005545 | Bacteria | 2363 |
| 225 | Ga0070696_100026289 | 3300005546 | Bacteria | 3960 |
| 226 | Ga0070696_100054561 | 3300005546 | Bacteria | 2785 |
| 227 | Ga0070696_100186436 | 3300005546 | Bacteria | 1542 |
| 228 | Ga0070693_100083628 | 3300005547 | Bacteria | 1908 |
| 229 | Ga0070665_100289452 | 3300005548 | Bacteria | 1640 |
| 230 | Ga0070665_100404253 | 3300005548 | Bacteria | 1374 |
| 231 | Ga0070665_100785064 | 3300005548 | Bacteria | 965 |
| 232 | Ga0070704_100027019 | 3300005549 | Bacteria | 3800 |
| 233 | Ga0070704_100255345 | 3300005549 | Bacteria | 1442 |
| 234 | Ga0070704_100380663 | 3300005549 | Bacteria | 1199 |
| 235 | Ga0070704_100440643 | 3300005549 | Bacteria | 1119 |
| 236 | Ga0070704_100526315 | 3300005549 | Bacteria | 1030 |
| 237 | Ga0070664_100043057 | 3300005564 | Bacteria | 3809 |
| 238 | Ga0070664_100426367 | 3300005564 | Bacteria | 1215 |
| 239 | Ga0068857_100071409 | 3300005577 | Bacteria | 3093 |
| 240 | Ga0068857_100725251 | 3300005577 | Bacteria | 946 |
| 241 | Ga0068854_100006416 | 3300005578 | Bacteria | 7482 |
| 242 | Ga0068854_100066660 | 3300005578 | Bacteria | 2620 |
| 243 | Ga0068856_100144187 | 3300005614 | Bacteria | 2389 |
| 244 | Ga0068856_100203937 | 3300005614 | Bacteria | 1992 |
| 245 | Ga0068852_100020468 | 3300005616 | Bacteria | 5263 |
| 246 | Ga0068852_100025410 | 3300005616 | Bacteria | 4799 |
| 247 | Ga0068859_100447057 | 3300005617 | Bacteria | 1389 |
| 248 | Ga0068864_100000016 | 3300005618 | Bacteria | 292454 |
| 249 | Ga0068864_100084285 | 3300005618 | Bacteria | 2792 |
| 250 | Ga0068864_100086254 | 3300005618 | Bacteria | 2762 |
| 251 | Ga0068864_100127422 | 3300005618 | Bacteria | 2283 |
| 252 | Ga0068866_10011607 | 3300005718 | Bacteria | 3817 |
| 253 | Ga0068866_10144321 | 3300005718 | Bacteria | 1370 |
| 254 | Ga0068861_100196620 | 3300005719 | Bacteria | 1690 |
| 255 | Ga0068861_100322672 | 3300005719 | Bacteria | 1345 |
| 256 | Ga0068861_100531127 | 3300005719 | Bacteria | 1068 |
| 257 | Ga0068851_10001866 | 3300005834 | Bacteria | 9251 |
| 258 | Ga0068870_10006935 | 3300005840 | Bacteria | 5024 |
| 259 | Ga0068870_10043461 | 3300005840 | Bacteria | 2344 |
| 260 | Ga0068870_10069906 | 3300005840 | Bacteria | 1911 |
| 261 | Ga0068870_10089405 | 3300005840 | Bacteria | 1719 |
| 262 | Ga0068863_100001887 | 3300005841 | Bacteria | 20811 |
| 263 | Ga0068863_100153961 | 3300005841 | Bacteria | 2200 |
| 264 | Ga0068858_100419515 | 3300005842 | Bacteria | 1287 |
| 265 | Ga0068858_100461051 | 3300005842 | Bacteria | 1225 |
| 266 | Ga0068860_100002390 | 3300005843 | Bacteria | 19702 |
| 267 | Ga0068860_100075903 | 3300005843 | Bacteria | 3196 |
| 268 | Ga0068860_100179335 | 3300005843 | Bacteria | 2047 |
| 269 | Ga0068862_100000068 | 3300005844 | Bacteria | 123535 |
| 270 | Ga0068862_100004260 | 3300005844 | Bacteria | 12112 |
| 271 | Ga0068862_100204372 | 3300005844 | Bacteria | 1782 |
| 272 | Ga0068862_100491316 | 3300005844 | Bacteria | 1163 |
| 273 | Ga0081455_10001350 | 3300005937 | Bacteria | 30362 |
| 274 | Ga0081455_10005811 | 3300005937 | Bacteria | 13435 |
| 275 | Ga0081455_10028316 | 3300005937 | Bacteria | 5120 |
| 276 | Ga0081455_10081940 | 3300005937 | Bacteria | 2641 |
| 277 | Ga0081455_10121092 | 3300005937 | Bacteria | 2062 |
| 278 | Ga0081455_10258385 | 3300005937 | Bacteria | 1270 |
| 279 | Ga0081540_1002554 | 3300005983 | Bacteria | 14768 |
| 280 | Ga0081540_1002649 | 3300005983 | Bacteria | 14558 |
| 281 | Ga0081540_1003830 | 3300005983 | Bacteria | 11775 |
| 282 | Ga0081540_1003910 | 3300005983 | Bacteria | 11604 |
| 283 | Ga0081540_1011713 | 3300005983 | Bacteria | 5837 |
| 284 | Ga0081540_1013996 | 3300005983 | Bacteria | 5175 |
| 285 | Ga0081540_1024563 | 3300005983 | Bacteria | 3495 |
| 286 | Ga0081540_1129797 | 3300005983 | Bacteria | 1031 |
| 287 | Ga0081539_10000008 | 3300005985 | Bacteria | 525071 |
| 288 | Ga0081539_10000009 | 3300005985 | Bacteria | 509286 |
| 289 | Ga0081539_10000747 | 3300005985 | Bacteria | 64612 |
| 290 | Ga0081539_10035862 | 3300005985 | Bacteria | 2974 |
| 291 | Ga0081539_10039464 | 3300005985 | Bacteria | 2785 |
| 292 | Ga0081539_10063382 | 3300005985 | Bacteria | 2017 |
| 293 | Ga0081539_10180159 | 3300005985 | Bacteria | 992 |
| 294 | Ga0070717_10006636 | 3300006028 | Bacteria | 8527 |
| 295 | Ga0070717_10018588 | 3300006028 | Bacteria | 5431 |
| 296 | Ga0070717_10058752 | 3300006028 | Bacteria | 3180 |
| 297 | Ga0070717_10375862 | 3300006028 | Bacteria | 1274 |
| 298 | Ga0075365_10006622 | 3300006038 | Bacteria | 6392 |
| 299 | Ga0075365_10025380 | 3300006038 | Bacteria | 3751 |
| 300 | Ga0075365_10152046 | 3300006038 | Bacteria | 1610 |
| 301 | Ga0075365_10170351 | 3300006038 | Bacteria | 1519 |
| 302 | Ga0075365_10237258 | 3300006038 | Bacteria | 1281 |
| 303 | Ga0075368_10002361 | 3300006042 | Bacteria | 6139 |
| 304 | Ga0075368_10007140 | 3300006042 | Bacteria | 3935 |
| 305 | Ga0075368_10028947 | 3300006042 | Bacteria | 2141 |
| 306 | Ga0075368_10029147 | 3300006042 | Bacteria | 2133 |
| 307 | Ga0075368_10085139 | 3300006042 | Bacteria | 1289 |
| 308 | Ga0075363_100012530 | 3300006048 | Bacteria | 4092 |
| 309 | Ga0075363_100055355 | 3300006048 | Bacteria | 2125 |
| 310 | Ga0075363_100083253 | 3300006048 | Bacteria | 1753 |
| 311 | Ga0075364_10043425 | 3300006051 | Bacteria | 2923 |
| 312 | Ga0075364_10051051 | 3300006051 | Bacteria | 2700 |
| 313 | Ga0075364_10117878 | 3300006051 | Bacteria | 1775 |
| 314 | Ga0075364_10177790 | 3300006051 | Bacteria | 1440 |
| 315 | Ga0075364_10186312 | 3300006051 | Bacteria | 1405 |
| 316 | Ga0075432_10005080 | 3300006058 | Bacteria | 4482 |
| 317 | Ga0070715_10000320 | 3300006163 | Bacteria | 11866 |
| 318 | Ga0070716_100001867 | 3300006173 | Bacteria | 9562 |
| 319 | Ga0070716_100039297 | 3300006173 | Bacteria | 2626 |
| 320 | Ga0070712_100001878 | 3300006175 | Bacteria | 12816 |
| 321 | Ga0070712_100006978 | 3300006175 | Bacteria | 7041 |
| 322 | Ga0070712_100028750 | 3300006175 | Bacteria | 3721 |
| 323 | Ga0070712_100183907 | 3300006175 | Bacteria | 1631 |
| 324 | Ga0070712_100220017 | 3300006175 | Bacteria | 1503 |
| 325 | Ga0070712_100412422 | 3300006175 | Bacteria | 1118 |
| 326 | Ga0075362_10004511 | 3300006177 | Bacteria | 5014 |
| 327 | Ga0075362_10016670 | 3300006177 | Bacteria | 3012 |
| 328 | Ga0075362_10184085 | 3300006177 | Bacteria | 1013 |
| 329 | Ga0075367_10012955 | 3300006178 | Bacteria | 4467 |
| 330 | Ga0075367_10013796 | 3300006178 | Bacteria | 4357 |
| 331 | Ga0075367_10025935 | 3300006178 | Bacteria | 3318 |
| 332 | Ga0075369_10013732 | 3300006186 | Bacteria | 3222 |
| 333 | Ga0075369_10032648 | 3300006186 | Bacteria | 2203 |
| 334 | Ga0075366_10008657 | 3300006195 | Bacteria | 5665 |
| 335 | Ga0075366_10163909 | 3300006195 | Bacteria | 1347 |
| 336 | Ga0075366_10247745 | 3300006195 | Bacteria | 1087 |
| 337 | Ga0075366_10314140 | 3300006195 | Bacteria | 959 |
| 338 | Ga0097621_100106660 | 3300006237 | Bacteria | 2363 |
| 339 | Ga0097621_100408495 | 3300006237 | Bacteria | 1217 |
| 340 | Ga0075370_10025758 | 3300006353 | Bacteria | 3254 |
| 341 | Ga0075370_10037869 | 3300006353 | Bacteria | 2713 |
| 342 | Ga0075370_10049886 | 3300006353 | Bacteria | 2373 |
| 343 | Ga0075370_10185373 | 3300006353 | Bacteria | 1225 |
| 344 | Ga0068871_100028813 | 3300006358 | Bacteria | 4358 |
| 345 | Ga0068871_100161239 | 3300006358 | Bacteria | 1918 |
| 346 | Ga0068871_100272124 | 3300006358 | Bacteria | 1480 |
| 347 | Ga0075428_100000103 | 3300006844 | Bacteria | 71205 |
| 348 | Ga0075428_100005548 | 3300006844 | Bacteria | 14035 |
| 349 | Ga0075428_100005908 | 3300006844 | Bacteria | 13603 |
| 350 | Ga0075428_100009742 | 3300006844 | Bacteria | 10673 |
| 351 | Ga0075428_100022110 | 3300006844 | Bacteria | 7041 |
| 352 | Ga0075428_100092828 | 3300006844 | Bacteria | 3291 |
| 353 | Ga0075428_100109159 | 3300006844 | Bacteria | 3015 |
| 354 | Ga0075428_100109308 | 3300006844 | Bacteria | 3013 |
| 355 | Ga0075428_100118910 | 3300006844 | Bacteria | 2877 |
| 356 | Ga0075428_100189864 | 3300006844 | Bacteria | 2222 |
| 357 | Ga0075428_100303162 | 3300006844 | Bacteria | 1717 |
| 358 | Ga0075428_100446847 | 3300006844 | Bacteria | 1385 |
| 359 | Ga0075430_100004771 | 3300006846 | Bacteria | 11408 |
| 360 | Ga0075430_100053942 | 3300006846 | Bacteria | 3383 |
| 361 | Ga0075430_100093588 | 3300006846 | Bacteria | 2512 |
| 362 | Ga0075430_100100706 | 3300006846 | Bacteria | 2413 |
| 363 | Ga0075430_100120620 | 3300006846 | Bacteria | 2186 |
| 364 | Ga0075430_100208635 | 3300006846 | Bacteria | 1621 |
| 365 | Ga0075430_100365116 | 3300006846 | Bacteria | 1192 |
| 366 | Ga0075431_100001293 | 3300006847 | Bacteria | 22854 |
| 367 | Ga0075431_100006070 | 3300006847 | Bacteria | 11977 |
| 368 | Ga0075431_100031643 | 3300006847 | Bacteria | 5449 |
| 369 | Ga0075431_100042861 | 3300006847 | Bacteria | 4668 |
| 370 | Ga0075431_100048829 | 3300006847 | Bacteria | 4364 |
| 371 | Ga0075431_100063577 | 3300006847 | Bacteria | 3809 |
| 372 | Ga0075431_100170055 | 3300006847 | Bacteria | 2240 |
| 373 | Ga0075431_100306893 | 3300006847 | Bacteria | 1602 |
| 374 | Ga0075431_100318325 | 3300006847 | Bacteria | 1569 |
| 375 | Ga0075433_10000090 | 3300006852 | Bacteria | 42150 |
| 376 | Ga0075433_10000781 | 3300006852 | Bacteria | 21965 |
| 377 | Ga0075433_10003084 | 3300006852 | Bacteria | 12811 |
| 378 | Ga0075433_10026223 | 3300006852 | Bacteria | 4932 |
| 379 | Ga0075433_10028948 | 3300006852 | Bacteria | 4714 |
| 380 | Ga0075433_10049015 | 3300006852 | Bacteria | 3674 |
| 381 | Ga0075433_10068973 | 3300006852 | Bacteria | 3104 |
| 382 | Ga0075433_10076167 | 3300006852 | Bacteria | 2954 |
| 383 | Ga0075433_10085987 | 3300006852 | Bacteria | 2777 |
| 384 | Ga0075433_10242297 | 3300006852 | Bacteria | 1600 |
| 385 | Ga0075433_10293189 | 3300006852 | Bacteria | 1441 |
| 386 | Ga0075434_100001936 | 3300006871 | Bacteria | 17947 |
| 387 | Ga0075434_100004709 | 3300006871 | Bacteria | 12330 |
| 388 | Ga0075434_100011879 | 3300006871 | Bacteria | 8233 |
| 389 | Ga0075434_100014750 | 3300006871 | Bacteria | 7475 |
| 390 | Ga0075434_100040652 | 3300006871 | Bacteria | 4605 |
| 391 | Ga0075434_100095898 | 3300006871 | Bacteria | 2971 |
| 392 | Ga0075434_100231935 | 3300006871 | Bacteria | 1865 |
| 393 | Ga0075434_100332433 | 3300006871 | Bacteria | 1540 |
| 394 | Ga0075434_100402486 | 3300006871 | Bacteria | 1390 |
| 395 | Ga0075429_100035774 | 3300006880 | Bacteria | 4319 |
| 396 | Ga0075429_100051162 | 3300006880 | Bacteria | 3595 |
| 397 | Ga0075429_100080528 | 3300006880 | Bacteria | 2839 |
| 398 | Ga0075429_100095420 | 3300006880 | Bacteria | 2593 |
| 399 | Ga0075429_100164325 | 3300006880 | Bacteria | 1945 |
| 400 | Ga0068865_100012565 | 3300006881 | Bacteria | 5335 |
| 401 | Ga0068865_100112158 | 3300006881 | Bacteria | 2013 |
| 402 | Ga0068865_100172049 | 3300006881 | Bacteria | 1661 |
| 403 | Ga0075436_100000168 | 3300006914 | Bacteria | 41115 |
| 404 | Ga0075436_100009932 | 3300006914 | Bacteria | 6509 |
| 405 | Ga0075436_100012546 | 3300006914 | Bacteria | 5808 |
| 406 | Ga0075436_100012919 | 3300006914 | Bacteria | 5726 |
| 407 | Ga0075436_100023235 | 3300006914 | Bacteria | 4259 |
| 408 | Ga0075436_100125932 | 3300006914 | Bacteria | 1795 |
| 409 | Ga0097620_100447029 | 3300006931 | Bacteria | 1389 |
| 410 | Ga0099824_1022507 | 3300006942 | Bacteria | 4141 |
| 411 | Ga0099823_1019469 | 3300006944 | Bacteria | 6478 |
| 412 | Ga0079104_1000009 | 3300006946 | Bacteria | 367015 |
| 413 | Ga0075435_100002088 | 3300007076 | Bacteria | 13118 |
| 414 | Ga0075435_100007665 | 3300007076 | Bacteria | 7709 |
| 415 | Ga0075435_100030311 | 3300007076 | Bacteria | 4251 |
| 416 | Ga0075435_100033463 | 3300007076 | Bacteria | 4064 |
| 417 | Ga0075435_100046354 | 3300007076 | Bacteria | 3487 |
| 418 | Ga0075435_100048805 | 3300007076 | Bacteria | 3402 |
| 419 | Ga0075435_100056294 | 3300007076 | Bacteria | 3178 |
| 420 | Ga0075435_100109034 | 3300007076 | Bacteria | 2301 |
| 421 | Ga0075435_100393262 | 3300007076 | Bacteria | 1192 |
| 422 | Ga0099794_10000734 | 3300007265 | Bacteria | 11022 |
| 423 | Ga0099794_10020028 | 3300007265 | Bacteria | 3024 |
| 424 | Ga0099794_10056573 | 3300007265 | Bacteria | 1898 |
| 425 | Ga0099794_10061464 | 3300007265 | Bacteria | 1825 |
| 426 | Ga0099794_10157309 | 3300007265 | Bacteria | 1155 |
| 427 | Ga0099795_10007542 | 3300007788 | Bacteria | 3044 |
| 428 | Ga0099795_10012611 | 3300007788 | Bacteria | 2569 |
| 429 | Ga0099795_10022863 | 3300007788 | Bacteria | 2068 |
| 430 | Ga0099795_10075004 | 3300007788 | Bacteria | 1283 |
| 431 | Ga0105251_10002065 | 3300009011 | Bacteria | 16214 |
| 432 | Ga0105244_10053100 | 3300009036 | Bacteria | 2061 |
| 433 | Ga0105250_10071833 | 3300009092 | Bacteria | 1398 |
| 434 | Ga0105240_10003119 | 3300009093 | Bacteria | 26094 |
| 435 | Ga0105240_10015980 | 3300009093 | Bacteria | 10175 |
| 436 | Ga0111539_10005030 | 3300009094 | Bacteria | 17186 |
| 437 | Ga0111539_10025207 | 3300009094 | Bacteria | 7290 |
| 438 | Ga0111539_10033030 | 3300009094 | Bacteria | 6283 |
| 439 | Ga0111539_10073832 | 3300009094 | Bacteria | 4020 |
| 440 | Ga0111539_10137087 | 3300009094 | Bacteria | 2866 |
| 441 | Ga0111539_10162201 | 3300009094 | Bacteria | 2614 |
| 442 | Ga0111539_10627459 | 3300009094 | Bacteria | 1251 |
| 443 | Ga0111539_10803545 | 3300009094 | Bacteria | 1095 |
| 444 | Ga0105245_10108434 | 3300009098 | Bacteria | 2579 |
| 445 | Ga0105245_10115897 | 3300009098 | Bacteria | 2498 |
| 446 | Ga0105245_10233393 | 3300009098 | Bacteria | 1780 |
| 447 | Ga0105247_10166020 | 3300009101 | Bacteria | 1465 |
| 448 | Ga0114129_10000881 | 3300009147 | Bacteria | 39092 |
| 449 | Ga0114129_10002331 | 3300009147 | Bacteria | 26353 |
| 450 | Ga0114129_10015357 | 3300009147 | Bacteria | 10896 |
| 451 | Ga0114129_10022173 | 3300009147 | Bacteria | 9015 |
| 452 | Ga0114129_10048974 | 3300009147 | Bacteria | 5939 |
| 453 | Ga0114129_10097656 | 3300009147 | Bacteria | 4066 |
| 454 | Ga0114129_10106691 | 3300009147 | Bacteria | 3869 |
| 455 | Ga0114129_10112688 | 3300009147 | Bacteria | 3751 |
| 456 | Ga0114129_10119579 | 3300009147 | Bacteria | 3628 |
| 457 | Ga0114129_10178412 | 3300009147 | Bacteria | 2892 |
| 458 | Ga0114129_10207383 | 3300009147 | Bacteria | 2651 |
| 459 | Ga0114129_10229472 | 3300009147 | Bacteria | 2501 |
| 460 | Ga0114129_10286979 | 3300009147 | Bacteria | 2197 |
| 461 | Ga0114129_10719075 | 3300009147 | Bacteria | 1282 |
| 462 | Ga0105243_10077966 | 3300009148 | Bacteria | 2696 |
| 463 | Ga0105243_10249751 | 3300009148 | Bacteria | 1583 |
| 464 | Ga0105241_10012907 | 3300009174 | Bacteria | 6130 |
| 465 | Ga0105242_10175319 | 3300009176 | Bacteria | 1887 |
| 466 | Ga0105242_10686701 | 3300009176 | Bacteria | 1000 |
| 467 | Ga0105248_10058098 | 3300009177 | Bacteria | 4343 |
| 468 | Ga0105248_10095407 | 3300009177 | Bacteria | 3349 |
| 469 | Ga0105248_10177251 | 3300009177 | Bacteria | 2402 |
| 470 | Ga0105248_10471815 | 3300009177 | Bacteria | 1414 |
| 471 | Ga0105248_10991186 | 3300009177 | Bacteria | 949 |
| 472 | Ga0105237_10073094 | 3300009545 | Bacteria | 3421 |
| 473 | Ga0105238_10003628 | 3300009551 | Bacteria | 15389 |
| 474 | Ga0105238_10052431 | 3300009551 | Bacteria | 4101 |
| 475 | Ga0105238_10271943 | 3300009551 | Bacteria | 1675 |
| 476 | Ga0105249_10093198 | 3300009553 | Bacteria | 2821 |
| 477 | Ga0105249_10288273 | 3300009553 | Bacteria | 1642 |
| 478 | Ga0105249_10369412 | 3300009553 | Bacteria | 1458 |
| 479 | Ga0105249_10663094 | 3300009553 | Bacteria | 1101 |
| 480 | Ga0099796_10006609 | 3300010159 | Bacteria | 2981 |
| 481 | Ga0105239_10044826 | 3300010375 | Bacteria | 4847 |
| 482 | Ga0105239_10507958 | 3300010375 | Bacteria | 1371 |
| 483 | Ga0105246_10271216 | 3300011119 | Bacteria | 1357 |
| 484 | Ga0157347_1002731 | 3300012502 | Bacteria | 1536 |
| 485 | Ga0157371_10004715 | 3300013102 | Bacteria | 11785 |
| 486 | Ga0157371_10056102 | 3300013102 | Bacteria | 2794 |
| 487 | Ga0157371_10191767 | 3300013102 | Bacteria | 1463 |
| 488 | Ga0157374_10003804 | 3300013296 | Bacteria | 12691 |
| 489 | Ga0157374_10025104 | 3300013296 | Bacteria | 5346 |
| 490 | Ga0157374_10140934 | 3300013296 | Bacteria | 2340 |
| 491 | Ga0157374_10185047 | 3300013296 | Bacteria | 2036 |
| 492 | Ga0157374_10220651 | 3300013296 | Bacteria | 1860 |
| 493 | Ga0157374_10355775 | 3300013296 | Bacteria | 1455 |
| 494 | Ga0157374_10774927 | 3300013296 | Bacteria | 974 |
| 495 | Ga0157378_10013539 | 3300013297 | Bacteria | 7135 |
| 496 | Ga0157378_10079320 | 3300013297 | Bacteria | 2964 |
| 497 | Ga0157378_10120618 | 3300013297 | Bacteria | 2417 |
| 498 | Ga0157378_10140868 | 3300013297 | Bacteria | 2239 |
| 499 | Ga0157372_10014793 | 3300013307 | Bacteria | 8353 |
| 500 | Ga0157375_10046832 | 3300013308 | Bacteria | 4219 |
| 501 | Ga0157375_10296547 | 3300013308 | Bacteria | 1780 |
| 502 | Ga0157375_10483195 | 3300013308 | Bacteria | 1403 |
| 503 | Ga0163163_10055535 | 3300014325 | Bacteria | 3914 |
| 504 | Ga0163163_10172747 | 3300014325 | Bacteria | 2208 |
| 505 | Ga0163163_10914649 | 3300014325 | Bacteria | 941 |
| 506 | Ga0157380_10129944 | 3300014326 | Bacteria | 2147 |
| 507 | Ga0157380_10149951 | 3300014326 | Bacteria | 2014 |
| 508 | Ga0157380_10554798 | 3300014326 | Bacteria | 1128 |
| 509 | Ga0182008_10005077 | 3300014497 | Bacteria | 7560 |
| 510 | Ga0182008_10075669 | 3300014497 | Bacteria | 1656 |
| 511 | Ga0182008_10130023 | 3300014497 | Bacteria | 1255 |
| 512 | Ga0157377_10187223 | 3300014745 | Bacteria | 1306 |
| 513 | Ga0157379_10243495 | 3300014968 | Bacteria | 1631 |
| 514 | Ga0157376_10002959 | 3300014969 | Bacteria | 11657 |
| 515 | Ga0157376_10015076 | 3300014969 | Bacteria | 5827 |
| 516 | Ga0157376_10146677 | 3300014969 | Bacteria | 2123 |
| 517 | Ga0157376_10286530 | 3300014969 | Bacteria | 1554 |
| 518 | Ga0182006_1001196 | 3300015261 | Bacteria | 16214 |
| 519 | Ga0182006_1015553 | 3300015261 | Bacteria | 3260 |
| 520 | Ga0182007_10000252 | 3300015262 | Bacteria | 36019 |
| 521 | Ga0163161_10019750 | 3300017792 | Bacteria | 4726 |
| 522 | Ga0163161_10045052 | 3300017792 | Bacteria | 3179 |
| 523 | Ga0163161_10055080 | 3300017792 | Bacteria | 2887 |
| 524 | Ga0163161_10124347 | 3300017792 | Bacteria | 1941 |
| 525 | Ga0214544_1000020 | 3300021320 | Bacteria | 178560 |
| 526 | Ga0214542_1000024 | 3300021321 | Bacteria | 191218 |
| 527 | Ga0214545_1000011 | 3300021324 | Bacteria | 190550 |
| 528 | Ga0214543_1000033 | 3300021327 | Bacteria | 190419 |
| 529 | Ga0213874_10009406 | 3300021377 | Bacteria | 2416 |
| 530 | Ga0213876_10001998 | 3300021384 | Bacteria | 12203 |
| 531 | Ga0213876_10193987 | 3300021384 | Bacteria | 1080 |
| 532 | Ga0213871_10012528 | 3300021441 | Bacteria | 1973 |
| 533 | Ga0209435_100040 | 3300025206 | Bacteria | 115475 |
| 534 | Ga0209784_100002 | 3300025224 | Bacteria | 1753105 |
| 535 | Ga0209566_100003 | 3300025225 | Bacteria | 1753105 |
| 536 | Ga0209674_100004 | 3300025226 | Bacteria | 1753105 |
| 537 | Ga0209672_100391 | 3300025228 | Bacteria | 26387 |
| 538 | Ga0209147_100141 | 3300025229 | Bacteria | 115466 |
| 539 | Ga0209563_100006 | 3300025230 | Bacteria | 1753105 |
| 540 | Ga0209563_101304 | 3300025230 | Bacteria | 6806 |
| 541 | Ga0209437_100229 | 3300025233 | Bacteria | 95900 |
| 542 | Ga0209258_100009 | 3300025242 | Bacteria | 996276 |
| 543 | Ga0209258_100657 | 3300025242 | Bacteria | 25150 |
| 544 | Ga0207425_1000343 | 3300025245 | Bacteria | 32292 |
| 545 | Ga0209646_1000204 | 3300025246 | Bacteria | 69552 |
| 546 | Ga0209646_1000253 | 3300025246 | Bacteria | 53522 |
| 547 | Ga0209026_1000306 | 3300025250 | Bacteria | 53524 |
| 548 | Ga0209677_100003 | 3300025253 | Bacteria | 1753105 |
| 549 | Ga0209677_102281 | 3300025253 | Bacteria | 7406 |
| 550 | Ga0209148_1000007 | 3300025254 | Bacteria | 1592273 |
| 551 | Ga0209759_1000298 | 3300025256 | Bacteria | 68472 |
| 552 | Ga0209759_1000398 | 3300025256 | Bacteria | 53628 |
| 553 | Ga0209129_1000024 | 3300025258 | Bacteria | 417268 |
| 554 | Ga0209129_1000085 | 3300025258 | Bacteria | 181765 |
| 555 | Ga0209233_1001066 | 3300025261 | Bacteria | 11357 |
| 556 | Ga0209233_1004907 | 3300025261 | Bacteria | 4499 |
| 557 | Ga0209233_1005718 | 3300025261 | Bacteria | 4099 |
| 558 | Ga0209565_1000546 | 3300025263 | Bacteria | 26226 |
| 559 | Ga0209455_1007559 | 3300025272 | Bacteria | 3053 |
| 560 | Ga0209455_1012365 | 3300025272 | Bacteria | 2045 |
| 561 | Ga0209673_1000571 | 3300025273 | Bacteria | 58695 |
| 562 | Ga0209673_1002149 | 3300025273 | Bacteria | 14613 |
| 563 | Ga0209673_1014952 | 3300025273 | Bacteria | 2976 |
| 564 | Ga0209673_1044222 | 3300025273 | Bacteria | 1235 |
| 565 | Ga0209130_1000103 | 3300025284 | Bacteria | 137115 |
| 566 | Ga0209130_1000505 | 3300025284 | Bacteria | 39706 |
| 567 | Ga0209675_1002642 | 3300025291 | Bacteria | 9054 |
| 568 | Ga0209675_1013210 | 3300025291 | Bacteria | 2601 |
| 569 | Ga0209676_1002143 | 3300025292 | Bacteria | 14987 |
| 570 | Ga0209676_1006736 | 3300025292 | Bacteria | 5588 |
| 571 | Ga0209025_1000267 | 3300025294 | Bacteria | 121798 |
| 572 | Ga0209564_1000005 | 3300025295 | Bacteria | 1147192 |
| 573 | Ga0209564_1000164 | 3300025295 | Bacteria | 160675 |
| 574 | Ga0209564_1000183 | 3300025295 | Bacteria | 150409 |
| 575 | Ga0209564_1014473 | 3300025295 | Bacteria | 3278 |
| 576 | Ga0209564_1025658 | 3300025295 | Bacteria | 1974 |
| 577 | Ga0209758_1000049 | 3300025297 | Bacteria | 345104 |
| 578 | Ga0209758_1000407 | 3300025297 | Bacteria | 73945 |
| 579 | Ga0209758_1000952 | 3300025297 | Bacteria | 39040 |
| 580 | Ga0209758_1001983 | 3300025297 | Bacteria | 22130 |
| 581 | Ga0209758_1034572 | 3300025297 | Bacteria | 2008 |
| 582 | Ga0209758_1037687 | 3300025297 | Bacteria | 1865 |
| 583 | Ga0209758_1073955 | 3300025297 | Bacteria | 1059 |
| 584 | Ga0209050_1000925 | 3300025298 | Bacteria | 38696 |
| 585 | Ga0209050_1001541 | 3300025298 | Bacteria | 24191 |
| 586 | Ga0209050_1002687 | 3300025298 | Bacteria | 14479 |
| 587 | Ga0209050_1014556 | 3300025298 | Bacteria | 3379 |
| 588 | Ga0209256_1000019 | 3300025299 | Bacteria | 558627 |
| 589 | Ga0209256_1000140 | 3300025299 | Bacteria | 152770 |
| 590 | Ga0209256_1000545 | 3300025299 | Bacteria | 54076 |
| 591 | Ga0209256_1006969 | 3300025299 | Bacteria | 5755 |
| 592 | Ga0207426_1000053 | 3300025302 | Bacteria | 384818 |
| 593 | Ga0207426_1000586 | 3300025302 | Bacteria | 48467 |
| 594 | Ga0207426_1001388 | 3300025302 | Bacteria | 20462 |
| 595 | Ga0207426_1006921 | 3300025302 | Bacteria | 4821 |
| 596 | Ga0209051_1000004 | 3300025303 | Bacteria | 1155596 |
| 597 | Ga0209051_1000059 | 3300025303 | Bacteria | 260307 |
| 598 | Ga0209051_1000159 | 3300025303 | Bacteria | 126836 |
| 599 | Ga0209051_1008640 | 3300025303 | Bacteria | 5362 |
| 600 | Ga0209051_1009022 | 3300025303 | Bacteria | 5193 |
| 601 | Ga0209051_1017422 | 3300025303 | Bacteria | 3211 |
| 602 | Ga0209257_1000022 | 3300025304 | Bacteria | 765258 |
| 603 | Ga0209257_1000038 | 3300025304 | Bacteria | 609032 |
| 604 | Ga0209257_1000044 | 3300025304 | Bacteria | 486709 |
| 605 | Ga0209257_1001136 | 3300025304 | Bacteria | 34058 |
| 606 | Ga0209257_1006273 | 3300025304 | Bacteria | 7771 |
| 607 | Ga0209257_1013152 | 3300025304 | Bacteria | 3718 |
| 608 | Ga0207656_10004648 | 3300025321 | Bacteria | 4811 |
| 609 | Ga0207656_10139610 | 3300025321 | Bacteria | 1141 |
| 610 | Ga0207653_10085811 | 3300025885 | Bacteria | 1096 |
| 611 | Ga0207682_10001102 | 3300025893 | Bacteria | 12493 |
| 612 | Ga0207692_10008475 | 3300025898 | Bacteria | 4253 |
| 613 | Ga0207692_10203433 | 3300025898 | Bacteria | 1165 |
| 614 | Ga0207710_10018129 | 3300025900 | Bacteria | 2992 |
| 615 | Ga0207710_10018417 | 3300025900 | Bacteria | 2969 |
| 616 | Ga0207710_10045537 | 3300025900 | Bacteria | 1957 |
| 617 | Ga0207688_10010399 | 3300025901 | Bacteria | 5064 |
| 618 | Ga0207680_10045750 | 3300025903 | Bacteria | 2583 |
| 619 | Ga0207647_10035209 | 3300025904 | Bacteria | 3192 |
| 620 | Ga0207685_10018550 | 3300025905 | Bacteria | 2274 |
| 621 | Ga0207685_10045335 | 3300025905 | Bacteria | 1667 |
| 622 | Ga0207699_10001319 | 3300025906 | Bacteria | 11796 |
| 623 | Ga0207699_10063949 | 3300025906 | Bacteria | 2225 |
| 624 | Ga0207699_10100942 | 3300025906 | Bacteria | 1831 |
| 625 | Ga0207645_10073442 | 3300025907 | Bacteria | 2190 |
| 626 | Ga0207645_10076453 | 3300025907 | Bacteria | 2144 |
| 627 | Ga0207645_10108673 | 3300025907 | Bacteria | 1794 |
| 628 | Ga0207643_10000418 | 3300025908 | Bacteria | 28078 |
| 629 | Ga0207643_10048218 | 3300025908 | Bacteria | 2413 |
| 630 | Ga0207705_10066695 | 3300025909 | Bacteria | 2603 |
| 631 | Ga0207684_10001444 | 3300025910 | Bacteria | 25714 |
| 632 | Ga0207684_10008691 | 3300025910 | Bacteria | 9015 |
| 633 | Ga0207684_10013538 | 3300025910 | Bacteria | 7053 |
| 634 | Ga0207684_10020436 | 3300025910 | Bacteria | 5657 |
| 635 | Ga0207684_10044620 | 3300025910 | Bacteria | 3760 |
| 636 | Ga0207684_10057109 | 3300025910 | Bacteria | 3311 |
| 637 | Ga0207684_10097598 | 3300025910 | Bacteria | 2509 |
| 638 | Ga0207684_10171532 | 3300025910 | Bacteria | 1870 |
| 639 | Ga0207684_10177590 | 3300025910 | Bacteria | 1836 |
| 640 | Ga0207684_10613801 | 3300025910 | Bacteria | 928 |
| 641 | Ga0207654_10017669 | 3300025911 | Bacteria | 3734 |
| 642 | Ga0207707_10234841 | 3300025912 | Bacteria | 1595 |
| 643 | Ga0207695_10001540 | 3300025913 | Bacteria | 37977 |
| 644 | Ga0207695_10017000 | 3300025913 | Bacteria | 8486 |
| 645 | Ga0207695_10023519 | 3300025913 | Bacteria | 6958 |
| 646 | Ga0207671_10032015 | 3300025914 | Bacteria | 3915 |
| 647 | Ga0207671_10112523 | 3300025914 | Bacteria | 2073 |
| 648 | Ga0207671_10158057 | 3300025914 | Bacteria | 1754 |
| 649 | Ga0207671_10326993 | 3300025914 | Bacteria | 1214 |
| 650 | Ga0207693_10001385 | 3300025915 | Bacteria | 21487 |
| 651 | Ga0207693_10011746 | 3300025915 | Bacteria | 7079 |
| 652 | Ga0207693_10024719 | 3300025915 | Bacteria | 4764 |
| 653 | Ga0207693_10056935 | 3300025915 | Bacteria | 3064 |
| 654 | Ga0207693_10087300 | 3300025915 | Bacteria | 2444 |
| 655 | Ga0207693_10207407 | 3300025915 | Bacteria | 1541 |
| 656 | Ga0207663_10000136 | 3300025916 | Bacteria | 34085 |
| 657 | Ga0207663_10006786 | 3300025916 | Bacteria | 5893 |
| 658 | Ga0207663_10096997 | 3300025916 | Bacteria | 1971 |
| 659 | Ga0207662_10072909 | 3300025918 | Bacteria | 2082 |
| 660 | Ga0207662_10097728 | 3300025918 | Bacteria | 1815 |
| 661 | Ga0207657_10012700 | 3300025919 | Bacteria | 8299 |
| 662 | Ga0207657_10095571 | 3300025919 | Bacteria | 2472 |
| 663 | Ga0207649_10049327 | 3300025920 | Bacteria | 2599 |
| 664 | Ga0207646_10001349 | 3300025922 | Bacteria | 30452 |
| 665 | Ga0207646_10001834 | 3300025922 | Bacteria | 25670 |
| 666 | Ga0207646_10007486 | 3300025922 | Bacteria | 11082 |
| 667 | Ga0207646_10013493 | 3300025922 | Bacteria | 7811 |
| 668 | Ga0207646_10068747 | 3300025922 | Bacteria | 3164 |
| 669 | Ga0207646_10140521 | 3300025922 | Bacteria | 2175 |
| 670 | Ga0207646_10179344 | 3300025922 | Bacteria | 1913 |
| 671 | Ga0207646_10462444 | 3300025922 | Bacteria | 1144 |
| 672 | Ga0207681_10040181 | 3300025923 | Bacteria | 3111 |
| 673 | Ga0207681_10058711 | 3300025923 | Bacteria | 2635 |
| 674 | Ga0207681_10270210 | 3300025923 | Bacteria | 1334 |
| 675 | Ga0207694_10014027 | 3300025924 | Bacteria | 6042 |
| 676 | Ga0207694_10035008 | 3300025924 | Bacteria | 3851 |
| 677 | Ga0207694_10280638 | 3300025924 | Bacteria | 1368 |
| 678 | Ga0207650_10000288 | 3300025925 | Bacteria | 51267 |
| 679 | Ga0207650_10001712 | 3300025925 | Bacteria | 15568 |
| 680 | Ga0207650_10010063 | 3300025925 | Bacteria | 6478 |
| 681 | Ga0207650_10049334 | 3300025925 | Bacteria | 3108 |
| 682 | Ga0207650_10166275 | 3300025925 | Bacteria | 1751 |
| 683 | Ga0207650_10425564 | 3300025925 | Bacteria | 1102 |
| 684 | Ga0207659_10342115 | 3300025926 | Bacteria | 1239 |
| 685 | Ga0207687_10171833 | 3300025927 | Bacteria | 1672 |
| 686 | Ga0207700_10006688 | 3300025928 | Bacteria | 6994 |
| 687 | Ga0207700_10032460 | 3300025928 | Bacteria | 3724 |
| 688 | Ga0207700_10069437 | 3300025928 | Bacteria | 2704 |
| 689 | Ga0207664_10012798 | 3300025929 | Bacteria | 6009 |
| 690 | Ga0207664_10013549 | 3300025929 | Bacteria | 5857 |
| 691 | Ga0207664_10181276 | 3300025929 | Bacteria | 1808 |
| 692 | Ga0207644_10027565 | 3300025931 | Bacteria | 3926 |
| 693 | Ga0207644_10041902 | 3300025931 | Bacteria | 3241 |
| 694 | Ga0207644_10055845 | 3300025931 | Bacteria | 2847 |
| 695 | Ga0207706_10014998 | 3300025933 | Bacteria | 7015 |
| 696 | Ga0207706_10050736 | 3300025933 | Bacteria | 3666 |
| 697 | Ga0207706_10070045 | 3300025933 | Bacteria | 3084 |
| 698 | Ga0207706_10128126 | 3300025933 | Bacteria | 2232 |
| 699 | Ga0207686_10213919 | 3300025934 | Bacteria | 1387 |
| 700 | Ga0207709_10099344 | 3300025935 | Bacteria | 1921 |
| 701 | Ga0207709_10174095 | 3300025935 | Bacteria | 1513 |
| 702 | Ga0207670_10116122 | 3300025936 | Bacteria | 1937 |
| 703 | Ga0207670_10268001 | 3300025936 | Bacteria | 1326 |
| 704 | Ga0207669_10168271 | 3300025937 | Bacteria | 1557 |
| 705 | Ga0207669_10290104 | 3300025937 | Bacteria | 1238 |
| 706 | Ga0207669_10354712 | 3300025937 | Bacteria | 1134 |
| 707 | Ga0207669_10402179 | 3300025937 | Bacteria | 1073 |
| 708 | Ga0207669_10403072 | 3300025937 | Bacteria | 1072 |
| 709 | Ga0207665_10000064 | 3300025939 | Bacteria | 68931 |
| 710 | Ga0207665_10004269 | 3300025939 | Bacteria | 9499 |
| 711 | Ga0207691_10061618 | 3300025940 | Bacteria | 3407 |
| 712 | Ga0207691_10118628 | 3300025940 | Bacteria | 2347 |
| 713 | Ga0207691_10145082 | 3300025940 | Bacteria | 2090 |
| 714 | Ga0207691_10457121 | 3300025940 | Bacteria | 1086 |
| 715 | Ga0207711_10111330 | 3300025941 | Bacteria | 2435 |
| 716 | Ga0207711_10282686 | 3300025941 | Bacteria | 1528 |
| 717 | Ga0207689_10039992 | 3300025942 | Bacteria | 3882 |
| 718 | Ga0207689_10073209 | 3300025942 | Bacteria | 2814 |
| 719 | Ga0207661_10169449 | 3300025944 | Bacteria | 1900 |
| 720 | Ga0207679_10008273 | 3300025945 | Bacteria | 6625 |
| 721 | Ga0207667_10088924 | 3300025949 | Bacteria | 3193 |
| 722 | Ga0207651_10001703 | 3300025960 | Bacteria | 10145 |
| 723 | Ga0207651_10172900 | 3300025960 | Bacteria | 1705 |
| 724 | Ga0207712_10251495 | 3300025961 | Bacteria | 1429 |
| 725 | Ga0207668_10194433 | 3300025972 | Bacteria | 1610 |
| 726 | Ga0207640_10048315 | 3300025981 | Bacteria | 2750 |
| 727 | Ga0207640_10061301 | 3300025981 | Bacteria | 2491 |
| 728 | Ga0207640_10165095 | 3300025981 | Bacteria | 1643 |
| 729 | Ga0207640_10218736 | 3300025981 | Bacteria | 1457 |
| 730 | Ga0207658_10000466 | 3300025986 | Bacteria | 37801 |
| 731 | Ga0207658_10357504 | 3300025986 | Bacteria | 1273 |
| 732 | Ga0207658_10784033 | 3300025986 | Bacteria | 865 |
| 733 | Ga0207677_10017339 | 3300026023 | Bacteria | 4291 |
| 734 | Ga0207677_10115036 | 3300026023 | Bacteria | 2011 |
| 735 | Ga0207677_10214991 | 3300026023 | Bacteria | 1538 |
| 736 | Ga0207703_10159359 | 3300026035 | Bacteria | 1975 |
| 737 | Ga0207703_10169795 | 3300026035 | Bacteria | 1917 |
| 738 | Ga0207703_10242139 | 3300026035 | Bacteria | 1622 |
| 739 | Ga0207639_10062071 | 3300026041 | Bacteria | 2888 |
| 740 | Ga0207639_10278169 | 3300026041 | Bacteria | 1471 |
| 741 | Ga0207639_10570532 | 3300026041 | Bacteria | 1041 |
| 742 | Ga0207678_10100542 | 3300026067 | Bacteria | 2470 |
| 743 | Ga0207678_10148846 | 3300026067 | Bacteria | 1999 |
| 744 | Ga0207708_10002881 | 3300026075 | Bacteria | 12675 |
| 745 | Ga0207708_10026254 | 3300026075 | Bacteria | 4406 |
| 746 | Ga0207702_10039969 | 3300026078 | Bacteria | 3932 |
| 747 | Ga0207702_10141568 | 3300026078 | Bacteria | 2177 |
| 748 | Ga0207641_10000103 | 3300026088 | Bacteria | 122350 |
| 749 | Ga0207641_10022737 | 3300026088 | Bacteria | 5162 |
| 750 | Ga0207641_10314925 | 3300026088 | Bacteria | 1482 |
| 751 | Ga0207648_10006999 | 3300026089 | Bacteria | 11151 |
| 752 | Ga0207648_10009796 | 3300026089 | Bacteria | 9155 |
| 753 | Ga0207648_10336172 | 3300026089 | Bacteria | 1359 |
| 754 | Ga0207676_10000044 | 3300026095 | Bacteria | 161679 |
| 755 | Ga0207676_10223852 | 3300026095 | Bacteria | 1677 |
| 756 | Ga0207675_100042588 | 3300026118 | Bacteria | 4239 |
| 757 | Ga0207675_100189232 | 3300026118 | Bacteria | 1973 |
| 758 | Ga0207683_10014258 | 3300026121 | Bacteria | 6772 |
| 759 | Ga0207683_10017123 | 3300026121 | Bacteria | 6169 |
| 760 | Ga0207683_10030901 | 3300026121 | Bacteria | 4645 |
| 761 | Ga0207683_10030958 | 3300026121 | Bacteria | 4641 |
| 762 | Ga0207683_10105063 | 3300026121 | Bacteria | 2524 |
| 763 | Ga0207683_10249155 | 3300026121 | Bacteria | 1621 |
| 764 | Ga0207698_10000603 | 3300026142 | Bacteria | 21081 |
| 765 | Ga0207698_10033824 | 3300026142 | Bacteria | 3719 |
| 766 | Ga0209281_1000023 | 3300027111 | Bacteria | 519955 |
| 767 | Ga0209389_1000011 | 3300027296 | Bacteria | 223265 |
| 768 | Ga0209389_1000424 | 3300027296 | Bacteria | 25082 |
| 769 | Ga0209371_1023377 | 3300027312 | Bacteria | 1456 |
| 770 | Ga0209589_1004180 | 3300027357 | Bacteria | 25082 |
| 771 | Ga0209489_100017 | 3300027361 | Bacteria | 223265 |
| 772 | Ga0209489_104563 | 3300027361 | Bacteria | 25351 |
| 773 | Ga0209700_100027 | 3300027363 | Bacteria | 223462 |
| 774 | Ga0209981_1012200 | 3300027378 | Bacteria | 1188 |
| 775 | Ga0209995_1017133 | 3300027471 | Bacteria | 1192 |
| 776 | Ga0209179_1012786 | 3300027512 | Bacteria | 1514 |
| 777 | Ga0209999_1000035 | 3300027543 | Bacteria | 14804 |
| 778 | Ga0209999_1006003 | 3300027543 | Bacteria | 2181 |
| 779 | Ga0209983_1007011 | 3300027665 | Bacteria | 2314 |
| 780 | Ga0209588_1001890 | 3300027671 | Bacteria | 5595 |
| 781 | Ga0209588_1018715 | 3300027671 | Bacteria | 2156 |
| 782 | Ga0209588_1023117 | 3300027671 | Bacteria | 1958 |
| 783 | Ga0209971_1012094 | 3300027682 | Bacteria | 2043 |
| 784 | Ga0209966_1000046 | 3300027695 | Bacteria | 52323 |
| 785 | Ga0209813_10013245 | 3300027866 | Bacteria | 2199 |
| 786 | Ga0209974_10003197 | 3300027876 | Bacteria | 5923 |
| 787 | Ga0207428_10028914 | 3300027907 | Bacteria | 4600 |
| 788 | Ga0207428_10030850 | 3300027907 | Bacteria | 4428 |
| 789 | Ga0207428_10071213 | 3300027907 | Bacteria | 2731 |
| 790 | Ga0207428_10290463 | 3300027907 | Bacteria | 1212 |
| 791 | Ga0268266_10100118 | 3300028379 | Bacteria | 2552 |
| 792 | Ga0268265_10000142 | 3300028380 | Bacteria | 91165 |
| 793 | Ga0268265_10067166 | 3300028380 | Bacteria | 2775 |
| 794 | Ga0268265_10178279 | 3300028380 | Bacteria | 1823 |
| 795 | Ga0268265_10186621 | 3300028380 | Bacteria | 1787 |
| 796 | Ga0268265_10239028 | 3300028380 | Bacteria | 1601 |
| 797 | Ga0268264_10000035 | 3300028381 | Bacteria | 398196 |
| 798 | Ga0268264_10766013 | 3300028381 | Bacteria | 962 |
| 799 | Ga0265326_10002505 | 3300028558 | Bacteria | 6188 |
| 800 | Ga0265319_1001186 | 3300028563 | Bacteria | 16109 |
| 801 | Ga0265334_10004555 | 3300028573 | Bacteria | 6143 |
| 802 | Ga0265318_10002315 | 3300028577 | Bacteria | 10231 |
| 803 | Ga0265323_10000768 | 3300028653 | Bacteria | 17199 |
| 804 | Ga0265322_10003636 | 3300028654 | Bacteria | 4638 |
| 805 | Ga0265336_10000106 | 3300028666 | Bacteria | 63839 |
| 806 | Ga0307517_10000049 | 3300028786 | Bacteria | 160368 |
| 807 | Ga0307515_10001611 | 3300028794 | Bacteria | 50308 |
| 808 | Ga0307515_10006414 | 3300028794 | Bacteria | 23532 |
| 809 | Ga0307515_10008473 | 3300028794 | Bacteria | 20029 |
| 810 | Ga0307515_10008712 | 3300028794 | Bacteria | 19722 |
| 811 | Ga0307515_10056637 | 3300028794 | Bacteria | 5692 |
| 812 | Ga0307515_10062205 | 3300028794 | Bacteria | 5278 |
| 813 | Ga0307515_10144962 | 3300028794 | Bacteria | 2522 |
| 814 | Ga0307515_10152692 | 3300028794 | Bacteria | 2404 |
| 815 | Ga0265338_10000065 | 3300028800 | Bacteria | 188966 |
| 816 | Ga0265324_10001808 | 3300029957 | Bacteria | 11615 |
| 817 | Ga0268256_1026489 | 3300030500 | Bacteria | 1456 |
| 818 | Ga0316177_1191241 | 3300030731 | Bacteria | 5583 |
| 819 | Ga0314311_1011733 | 3300030733 | Bacteria | 1676 |
| 820 | Ga0316179_1030285 | 3300030734 | Bacteria | 3866 |
| 821 | Ga0316178_1051116 | 3300030735 | Bacteria | 5558 |
| 822 | Ga0316180_1047811 | 3300030736 | Bacteria | 3091 |
| 823 | Ga0316183_1126188 | 3300030742 | Bacteria | 20738 |
| 824 | Ga0316182_1174059 | 3300030745 | Bacteria | 5579 |
| 825 | Ga0265330_10013442 | 3300031235 | Bacteria | 3814 |
| 826 | Ga0265325_10081996 | 3300031241 | Bacteria | 1602 |
| 827 | Ga0265339_10021009 | 3300031249 | Bacteria | 3807 |
| 828 | Ga0265327_10021443 | 3300031251 | Bacteria | 3898 |
| 829 | Ga0265327_10063988 | 3300031251 | Bacteria | 1866 |
| 830 | Ga0307513_10000028 | 3300031456 | Bacteria | 193264 |
| 831 | Ga0307513_10000568 | 3300031456 | Bacteria | 52926 |
| 832 | Ga0307513_10004235 | 3300031456 | Bacteria | 19184 |
| 833 | Ga0307513_10012841 | 3300031456 | Bacteria | 10312 |
| 834 | Ga0307513_10046454 | 3300031456 | Bacteria | 4733 |
| 835 | Ga0307513_10055014 | 3300031456 | Bacteria | 4261 |
| 836 | Ga0307513_10069332 | 3300031456 | Bacteria | 3690 |
| 837 | Ga0307513_10092185 | 3300031456 | Bacteria | 3085 |
| 838 | Ga0307513_10335005 | 3300031456 | Bacteria | 1266 |
| 839 | Ga0307509_10029697 | 3300031507 | Bacteria | 6062 |
| 840 | Ga0307509_10111327 | 3300031507 | Bacteria | 2740 |
| 841 | Ga0307509_10129637 | 3300031507 | Bacteria | 2481 |
| 842 | Ga0307408_100000005 | 3300031548 | Bacteria | 529098 |
| 843 | Ga0307408_100007613 | 3300031548 | Bacteria | 7162 |
| 844 | Ga0307408_100040667 | 3300031548 | Bacteria | 3292 |
| 845 | Ga0307408_100070704 | 3300031548 | Bacteria | 2577 |
| 846 | Ga0307408_100180100 | 3300031548 | Bacteria | 1694 |
| 847 | Ga0307408_100289875 | 3300031548 | Bacteria | 1366 |
| 848 | Ga0307408_100573360 | 3300031548 | Bacteria | 999 |
| 849 | Ga0307508_10000004 | 3300031616 | Bacteria | 287547 |
| 850 | Ga0307508_10000090 | 3300031616 | Bacteria | 106893 |
| 851 | Ga0307508_10000150 | 3300031616 | Bacteria | 83110 |
| 852 | Ga0307508_10178022 | 3300031616 | Bacteria | 1729 |
| 853 | Ga0307514_10000641 | 3300031649 | Bacteria | 63711 |
| 854 | Ga0307514_10011703 | 3300031649 | Bacteria | 7299 |
| 855 | Ga0307514_10028849 | 3300031649 | Bacteria | 4472 |
| 856 | Ga0307514_10108177 | 3300031649 | Bacteria | 1978 |
| 857 | Ga0316579_10007507 | 3300031691 | Bacteria | 4507 |
| 858 | Ga0265314_10075462 | 3300031711 | Bacteria | 2243 |
| 859 | Ga0265314_10158224 | 3300031711 | Bacteria | 1381 |
| 860 | Ga0316578_10031741 | 3300031728 | Bacteria | 3013 |
| 861 | Ga0307516_10005295 | 3300031730 | Bacteria | 15524 |
| 862 | Ga0307405_10052767 | 3300031731 | Bacteria | 2530 |
| 863 | Ga0307405_10090061 | 3300031731 | Bacteria | 2028 |
| 864 | Ga0307413_10065803 | 3300031824 | Bacteria | 2258 |
| 865 | Ga0307410_10319488 | 3300031852 | Bacteria | 1231 |
| 866 | Ga0307406_10000463 | 3300031901 | Bacteria | 23502 |
| 867 | Ga0307406_10001390 | 3300031901 | Bacteria | 13475 |
| 868 | Ga0307407_10111539 | 3300031903 | Bacteria | 1718 |
| 869 | Ga0307412_10014711 | 3300031911 | Bacteria | 4625 |
| 870 | Ga0307412_10071231 | 3300031911 | Bacteria | 2372 |
| 871 | Ga0307412_10128271 | 3300031911 | Bacteria | 1838 |
| 872 | Ga0307412_10238555 | 3300031911 | Bacteria | 1405 |
| 873 | Ga0307409_100136381 | 3300031995 | Bacteria | 2106 |
| 874 | Ga0307416_100166125 | 3300032002 | Bacteria | 2047 |
| 875 | Ga0307416_100166684 | 3300032002 | Bacteria | 2044 |
| 876 | Ga0307416_100220569 | 3300032002 | Bacteria | 1818 |
| 877 | Ga0307414_10095124 | 3300032004 | Bacteria | 2225 |
| 878 | Ga0307414_10101810 | 3300032004 | Bacteria | 2163 |
| 879 | Ga0307414_10161439 | 3300032004 | Bacteria | 1780 |
| 880 | Ga0307411_10006346 | 3300032005 | Bacteria | 5911 |
| 881 | Ga0307411_10009963 | 3300032005 | Bacteria | 5034 |
| 882 | Ga0307411_10116554 | 3300032005 | Bacteria | 1923 |
| 883 | Ga0307411_10348690 | 3300032005 | Bacteria | 1206 |
| 884 | Ga0307415_100090459 | 3300032126 | Bacteria | 2214 |
| 885 | Ga0307415_100191004 | 3300032126 | Bacteria | 1616 |
| 886 | Ga0307507_10098971 | 3300033179 | Bacteria | 2452 |
| 887 | Ga0307507_10146187 | 3300033179 | Bacteria | 1795 |
| 888 | Ga0307507_10211383 | 3300033179 | Bacteria | 1322 |
| 889 | Ga0307510_10001725 | 3300033180 | Bacteria | 24301 |
| 890 | Ga0307510_10019318 | 3300033180 | Bacteria | 7995 |
| 891 | Ga0307510_10033122 | 3300033180 | Bacteria | 5808 |
| 892 | Ga0307510_10044427 | 3300033180 | Bacteria | 4812 |
| 893 | Ga0307510_10075429 | 3300033180 | Bacteria | 3324 |
| 894 | Ga0307510_10094555 | 3300033180 | Bacteria | 2813 |
| 895 | Ga0307510_10236845 | 3300033180 | Bacteria | 1323 |
| 896 | Ga0307510_10316544 | 3300033180 | Bacteria | 1018 |
| 897 | Ga0315911_1000011 | 3300033442 | Bacteria | 264678 |
| 898 | Ga0316214_1011677 | 3300033545 | Bacteria | 1197 |
| 899 | Ga0373944_0011346 | 3300035089 | Bacteria | 2441 |
| 900 | Ga0373944_0032737 | 3300035089 | Bacteria | 1572 |
| 901 | Ga0373949_0016585 | 3300035090 | Bacteria | 1652 |
| 902 | Ga0373923_0003802 | 3300035111 | Bacteria | 4905 |
| 903 | Ga0373923_0010861 | 3300035111 | Bacteria | 3325 |
| 904 | Ga0373932_0002652 | 3300035112 | Bacteria | 4459 |
| 905 | Ga0373936_0035174 | 3300035113 | Bacteria | 1993 |
| 906 | Ga0373936_0058316 | 3300035113 | Bacteria | 1572 |
| 907 | Ga0373945_0022797 | 3300035116 | Bacteria | 2159 |
| 908 | Ga0373953_0022563 | 3300035117 | Bacteria | 2374 |
| 909 | Ga0373953_0058916 | 3300035117 | Bacteria | 1566 |
| 910 | Ga0373954_0010242 | 3300035118 | Bacteria | 4134 |
| 911 | Ga0373954_0024910 | 3300035118 | Bacteria | 2731 |
| 912 | Ga0373954_0101884 | 3300035118 | Bacteria | 1386 |
| 913 | Ga0373956_0012445 | 3300035119 | Bacteria | 3527 |
| 914 | Ga0373956_0168971 | 3300035119 | Bacteria | 1032 |
| 915 | Ga0373957_0000746 | 3300035120 | Bacteria | 8454 |
| 916 | Ga0373957_0002972 | 3300035120 | Bacteria | 4918 |
| 917 | Ga0373957_0020968 | 3300035120 | Bacteria | 2314 |
| 918 | Ga0373943_0048743 | 3300035170 | Bacteria | 2076 |
| 919 | Ga0373946_0015804 | 3300035171 | Bacteria | 2867 |
| 920 | Ga0373946_0222052 | 3300035171 | Bacteria | 913 |
| 921 | Ga0373955_0000360 | 3300035172 | Bacteria | 19140 |
| 922 | Ga0373955_0008786 | 3300035172 | Bacteria | 4706 |
| 923 | Ga0373955_0039759 | 3300035172 | Bacteria | 2512 |
| 924 | Ga0373955_0105315 | 3300035172 | Bacteria | 1624 |
| 925 | Ga0373942_0036963 | 3300035207 | Bacteria | 1318 |
| 926 | Ga0373961_0006253 | 3300035241 | Bacteria | 2862 |
| 927 | Ga0373962_0004069 | 3300035242 | Bacteria | 3527 |
| 928 | Ga0373962_0019931 | 3300035242 | Bacteria | 1757 |
| 929 | Ga0316574_0040978 | 3300035398 | Bacteria | 2853 |
| 930 | Ga0373924_0087304 | 3300035410 | Bacteria | 1332 |
| 931 | Ga0373931_0000242 | 3300035691 | Bacteria | 23253 |
| 932 | Ga0373931_0024711 | 3300035691 | Bacteria | 3046 |
| 933 | Ga0373931_0047379 | 3300035691 | Bacteria | 2275 |
| 934 | Ga0373931_0311109 | 3300035691 | Bacteria | 975 |
| 935 | Ga0373935_0002949 | 3300035692 | Bacteria | 9803 |
| 936 | Ga0373935_0006508 | 3300035692 | Bacteria | 6980 |
| 937 | Ga0373935_0009288 | 3300035692 | Bacteria | 5887 |
| 938 | Ga0373935_0012293 | 3300035692 | Bacteria | 5150 |
| 939 | Ga0373935_0289936 | 3300035692 | Bacteria | 1154 |
| 940 | Ga0373927_0000950 | 3300035695 | Bacteria | 22071 |
| 941 | Ga0373927_0034359 | 3300035695 | Bacteria | 3299 |
| 942 | Ga0373927_0035579 | 3300035695 | Bacteria | 3238 |
| 943 | Ga0373927_0171508 | 3300035695 | Bacteria | 1422 |
| 944 | Ga0373927_0274979 | 3300035695 | Bacteria | 1107 |
| 945 | Ga0373933_0003920 | 3300035724 | Bacteria | 8208 |
| 946 | Ga0373933_0114823 | 3300035724 | Bacteria | 1682 |
| 947 | Ga0373947_0000846 | 3300035725 | Bacteria | 18504 |
| 948 | Ga0373947_0010653 | 3300035725 | Bacteria | 5276 |
| 949 | Ga0373937_0000269 | 3300036401 | Bacteria | 50111 |
| 950 | Ga0373937_0008436 | 3300036401 | Bacteria | 8955 |
| 951 | Ga0373937_0031959 | 3300036401 | Bacteria | 4772 |
| 952 | Ga0373937_0239485 | 3300036401 | Bacteria | 1709 |
| 953 | Ga0372808_002242 | 3300036459 | Bacteria | 2195 |
| 954 | Ga0316582_0009082 | 3300036647 | Bacteria | 5378 |
| 955 | Ga0316582_0078104 | 3300036647 | Bacteria | 2156 |
| 956 | Ga0316582_0217325 | 3300036647 | Bacteria | 1306 |
| 957 | Ga0316584_0260446 | 3300036712 | Bacteria | 1265 |
| 958 | Ga0373925_0000075 | 3300037068 | Bacteria | 105395 |
| 959 | Ga0373925_0002196 | 3300037068 | Bacteria | 15850 |
| 960 | Ga0373925_0016899 | 3300037068 | Bacteria | 5282 |
| 961 | Ga0373925_0030229 | 3300037068 | Bacteria | 3976 |
| 962 | Ga0373925_0163994 | 3300037068 | Bacteria | 1752 |
| 963 | Ga0373925_0172510 | 3300037068 | Bacteria | 1708 |
| 964 | Ga0373925_0273550 | 3300037068 | Bacteria | 1359 |
| 965 | Ga0395900_0447224 | 3300037418 | Bacteria | 1249 |
| 966 | Ga0395898_0125625 | 3300037466 | Bacteria | 2458 |
| 967 | Ga0395898_0267108 | 3300037466 | Bacteria | 1632 |
| 968 | Ga0395905_0039879 | 3300037471 | Bacteria | 4405 |
| 969 | Ga0395905_0143784 | 3300037471 | Bacteria | 2244 |
| 970 | Ga0395905_0342674 | 3300037471 | Bacteria | 1386 |
| 971 | Ga0395905_0535264 | 3300037471 | Bacteria | 1072 |
| 972 | Ga0316581_0040528 | 3300037588 | Bacteria | 1418 |
| 973 | Ga0395901_0051193 | 3300038443 | Bacteria | 4293 |
| 974 | Ga0395901_0222493 | 3300038443 | Bacteria | 1973 |
| 975 | Ga0400490_13794 | 3300038726 | Bacteria | 3881 |
| 976 | Ga0400490_20324 | 3300038726 | Bacteria | 7197 |
| 977 | Ga0400490_45281 | 3300038726 | Bacteria | 70798 |
| 978 | Ga0400491_16995 | 3300038727 | Bacteria | 2643 |
| 979 | Ga0400488_23323 | 3300038741 | Bacteria | 6713 |
| 980 | Ga0400488_38093 | 3300038741 | Bacteria | 2631 |
| 981 | Ga0400486_06770 | 3300038742 | Bacteria | 10082 |
| 982 | Ga0400486_28053 | 3300038742 | Bacteria | 14118 |
| 983 | Ga0400483_027235 | 3300039062 | Bacteria | 3705 |
| 984 | Ga0400483_119201 | 3300039062 | Bacteria | 6428 |
| 985 | Ga0400483_208955 | 3300039062 | Bacteria | 5644 |
| 986 | Ga0400483_259163 | 3300039062 | Bacteria | 9856 |
| 987 | Ga0436365_0098421 | 3300039437 | Bacteria | 1188 |
| 988 | Ga0436365_0240210 | 3300039437 | Bacteria | 20191 |
| 989 | Ga0436365_0241740 | 3300039437 | Bacteria | 2361 |
| 990 | Ga0436365_0642532 | 3300039437 | Bacteria | 3284 |
| 991 | Ga0436365_0703504 | 3300039437 | Bacteria | 2062 |
| 992 | Ga0436360_0260696 | 3300039438 | Bacteria | 1469 |
| 993 | Ga0436360_0598803 | 3300039438 | Bacteria | 1232 |
| 994 | Ga0436360_0638294 | 3300039438 | Bacteria | 1090 |
| 995 | Ga0436361_0053786 | 3300039447 | Bacteria | 27680 |
| 996 | Ga0436361_0356069 | 3300039447 | Bacteria | 2837 |
| 997 | Ga0436363_0771056 | 3300039450 | Bacteria | 3332 |
| 998 | Ga0436363_1181230 | 3300039450 | Bacteria | 1553 |
| 999 | Ga0436363_1394953 | 3300039450 | Bacteria | 1495 |
| 1000 | Ga0436362_0365725 | 3300039453 | Bacteria | 1315 |
| 1001 | Ga0439453_0001117 | 3300041408 | Bacteria | 3346 |
| 1002 | Ga0439465_0042200 | 3300041413 | Bacteria | 1478 |
| 1003 | Ga0451853_3923888 | 3300041512 | Bacteria | 1247 |
| 1004 | Ga0439441_005120 | 3300042001 | Bacteria | 2020 |
| 1005 | Ga0439443_004522 | 3300042003 | Bacteria | 1817 |
| 1006 | Ga0439449_0002308 | 3300042007 | Bacteria | 7469 |
| 1007 | Ga0439449_0043482 | 3300042007 | Bacteria | 1668 |
| 1008 | Ga0439456_028952 | 3300042013 | Bacteria | 1182 |
| 1009 | Ga0450911_000717 | 3300042115 | Bacteria | 9642 |
| 1010 | Ga0450890_002196 | 3300042127 | Bacteria | 2715 |
| 1011 | Ga0439446_0024413 | 3300042156 | Bacteria | 1725 |
| 1012 | Ga0439434_0022733 | 3300042435 | Bacteria | 1885 |
| 1013 | Ga0439434_0029405 | 3300042435 | Bacteria | 1666 |
| 1014 | Ga0439435_0000398 | 3300042436 | Bacteria | 6721 |
| 1015 | Ga0439444_0000032 | 3300042437 | Bacteria | 10072 |
| 1016 | Ga0439460_0003204 | 3300042461 | Bacteria | 3952 |
| 1017 | Ga0450918_001083 | 3300042531 | Bacteria | 5609 |
| 1018 | Ga0450893_0001826 | 3300042532 | Bacteria | 3279 |
| 1019 | Ga0451577_0000206 | 3300042876 | Bacteria | 123278 |
| 1020 | Ga0451577_0244892 | 3300042876 | Bacteria | 1622 |
| 1021 | Ga0451577_0281251 | 3300042876 | Bacteria | 1507 |
| 1022 | Ga0466972_0000371 | 3300044658 | Bacteria | 24281 |
| 1023 | Ga0466972_0049275 | 3300044658 | Bacteria | 2034 |
| 1024 | Ga0453683_0000252 | 3300044673 | Bacteria | 70926 |
| 1025 | Ga0453683_0012589 | 3300044673 | Bacteria | 5542 |
| 1026 | Ga0466966_0004865 | 3300044684 | Bacteria | 8833 |
| 1027 | Ga0466961_0003875 | 3300044693 | Bacteria | 9345 |
| 1028 | Ga0453684_0000063 | 3300044712 | Bacteria | 486079 |
| 1029 | Ga0453684_0000218 | 3300044712 | Bacteria | 250267 |
| 1030 | Ga0453684_0005314 | 3300044712 | Bacteria | 25677 |
| 1031 | Ga0453684_0045710 | 3300044712 | Bacteria | 5835 |
| 1032 | Ga0453684_0049519 | 3300044712 | Bacteria | 5539 |
| 1033 | Ga0453684_0061368 | 3300044712 | Bacteria | 4826 |
| 1034 | Ga0453684_0609261 | 3300044712 | Bacteria | 1196 |
| 1035 | Ga0466957_0256682 | 3300044842 | Bacteria | 1164 |
| 1036 | Ga0466960_0142187 | 3300044901 | Bacteria | 1275 |
| 1037 | Ga0466959_0008411 | 3300045049 | Bacteria | 7295 |
| 1038 | Ga0466959_0079291 | 3300045049 | Bacteria | 2368 |
| 1039 | Ga0451576_0000621 | 3300045051 | Bacteria | 74139 |
| 1040 | Ga0451576_0002043 | 3300045051 | Bacteria | 31773 |
| 1041 | Ga0451576_0013397 | 3300045051 | Bacteria | 9175 |
| 1042 | Ga0451576_0091312 | 3300045051 | Bacteria | 3168 |
| 1043 | Ga0451576_0132049 | 3300045051 | Bacteria | 2603 |
| 1044 | Ga0451576_0288831 | 3300045051 | Bacteria | 1714 |
| 1045 | Ga0466958_0186496 | 3300045836 | Bacteria | 1317 |
| 1046 | Ga0466967_0144847 | 3300045976 | Bacteria | 2216 |
| 1047 | Ga0466967_0388207 | 3300045976 | Bacteria | 1357 |
| 1048 | Ga0495617_016710 | 3300046452 | Bacteria | 2481 |
| 1049 | Ga0495627_000004 | 3300046453 | Bacteria | 640612 |
| 1050 | Ga0495592_0000060 | 3300046454 | Bacteria | 100113 |
| 1051 | Ga0495592_0000553 | 3300046454 | Bacteria | 26681 |
| 1052 | Ga0495592_0009069 | 3300046454 | Bacteria | 7481 |
| 1053 | Ga0495592_0050267 | 3300046454 | Bacteria | 3097 |
| 1054 | Ga0495592_0094668 | 3300046454 | Bacteria | 2137 |
| 1055 | Ga0495603_0000200 | 3300046455 | Bacteria | 31435 |
| 1056 | Ga0495603_0004845 | 3300046455 | Bacteria | 8045 |
| 1057 | Ga0495603_0013905 | 3300046455 | Bacteria | 4869 |
| 1058 | Ga0495603_0094293 | 3300046455 | Bacteria | 1749 |
| 1059 | Ga0495590_0000149 | 3300046457 | Bacteria | 42250 |
| 1060 | Ga0495629_0002535 | 3300046459 | Bacteria | 14008 |
| 1061 | Ga0495629_0026394 | 3300046459 | Bacteria | 4126 |
| 1062 | Ga0495638_0001295 | 3300046460 | Bacteria | 23270 |
| 1063 | Ga0495638_0004444 | 3300046460 | Bacteria | 10621 |
| 1064 | Ga0495638_0029593 | 3300046460 | Bacteria | 3532 |
| 1065 | Ga0495638_0043120 | 3300046460 | Bacteria | 2847 |
| 1066 | Ga0495641_0006637 | 3300046461 | Bacteria | 7446 |
| 1067 | Ga0495641_0008896 | 3300046461 | Bacteria | 6042 |
| 1068 | Ga0495651_0000181 | 3300046462 | Bacteria | 46803 |
| 1069 | Ga0495651_0002101 | 3300046462 | Bacteria | 15375 |
| 1070 | Ga0495651_0027827 | 3300046462 | Bacteria | 4405 |
| 1071 | Ga0495651_0050887 | 3300046462 | Bacteria | 3195 |
| 1072 | Ga0495651_0095887 | 3300046462 | Bacteria | 2217 |
| 1073 | Ga0495653_0000129 | 3300046463 | Bacteria | 62515 |
| 1074 | Ga0495653_0001070 | 3300046463 | Bacteria | 21097 |
| 1075 | Ga0495653_0028701 | 3300046463 | Bacteria | 4448 |
| 1076 | Ga0495653_0229745 | 3300046463 | Bacteria | 1242 |
| 1077 | Ga0495650_0004948 | 3300046471 | Bacteria | 8889 |
| 1078 | Ga0495650_0014057 | 3300046471 | Bacteria | 4192 |
| 1079 | Ga0495650_0029154 | 3300046471 | Bacteria | 2520 |
| 1080 | Ga0495580_0001269 | 3300046472 | Bacteria | 22275 |
| 1081 | Ga0495580_0002104 | 3300046472 | Bacteria | 17472 |
| 1082 | Ga0495580_0043472 | 3300046472 | Bacteria | 3198 |
| 1083 | Ga0495580_0198352 | 3300046472 | Bacteria | 1383 |
| 1084 | Ga0495580_0281458 | 3300046472 | Bacteria | 1134 |
| 1085 | Ga0495580_0339238 | 3300046472 | Bacteria | 1019 |
| 1086 | Ga0495582_0000354 | 3300046473 | Bacteria | 25130 |
| 1087 | Ga0495582_0023610 | 3300046473 | Bacteria | 3363 |
| 1088 | Ga0495605_0002509 | 3300046474 | Bacteria | 11344 |
| 1089 | Ga0495605_0053460 | 3300046474 | Bacteria | 1959 |
| 1090 | Ga0495605_0074102 | 3300046474 | Bacteria | 1603 |
| 1091 | Ga0495639_0004987 | 3300046475 | Bacteria | 5696 |
| 1092 | Ga0495639_0005177 | 3300046475 | Bacteria | 5601 |
| 1093 | Ga0495662_0000590 | 3300046476 | Bacteria | 16763 |
| 1094 | Ga0495662_0001324 | 3300046476 | Bacteria | 12266 |
| 1095 | Ga0495664_0000003 | 3300046477 | Bacteria | 551602 |
| 1096 | Ga0495664_0003641 | 3300046477 | Bacteria | 8403 |
| 1097 | Ga0495664_0062180 | 3300046477 | Bacteria | 2223 |
| 1098 | Ga0495664_0064611 | 3300046477 | Bacteria | 2181 |
| 1099 | Ga0495664_0177127 | 3300046477 | Bacteria | 1293 |
| 1100 | Ga0495585_0067849 | 3300046492 | Bacteria | 1950 |
| 1101 | Ga0495585_0113489 | 3300046492 | Bacteria | 1439 |
| 1102 | Ga0495594_0001396 | 3300046499 | Bacteria | 12540 |
| 1103 | Ga0495594_0017864 | 3300046499 | Bacteria | 3752 |
| 1104 | Ga0495594_0094237 | 3300046499 | Bacteria | 1680 |
| 1105 | Ga0495594_0104651 | 3300046499 | Bacteria | 1593 |
| 1106 | Ga0495596_0053025 | 3300046500 | Bacteria | 1587 |
| 1107 | Ga0495607_0000018 | 3300046501 | Bacteria | 167673 |
| 1108 | Ga0495607_0000109 | 3300046501 | Bacteria | 86702 |
| 1109 | Ga0495607_0022482 | 3300046501 | Bacteria | 3960 |
| 1110 | Ga0495583_0000370 | 3300046506 | Bacteria | 69938 |
| 1111 | Ga0495606_0002687 | 3300046507 | Bacteria | 20107 |
| 1112 | Ga0495606_0008571 | 3300046507 | Bacteria | 8847 |
| 1113 | Ga0495606_0046693 | 3300046507 | Bacteria | 2861 |
| 1114 | Ga0495608_0000005 | 3300046511 | Bacteria | 350726 |
| 1115 | Ga0495608_0000832 | 3300046511 | Bacteria | 21541 |
| 1116 | Ga0495608_0005335 | 3300046511 | Bacteria | 9184 |
| 1117 | Ga0495608_0019297 | 3300046511 | Bacteria | 4694 |
| 1118 | Ga0495608_0113220 | 3300046511 | Bacteria | 1743 |
| 1119 | Ga0495610_0073587 | 3300046512 | Bacteria | 1587 |
| 1120 | Ga0495610_0151393 | 3300046512 | Bacteria | 989 |
| 1121 | Ga0495616_0007346 | 3300046513 | Bacteria | 6592 |
| 1122 | Ga0495618_0000044 | 3300046514 | Bacteria | 95526 |
| 1123 | Ga0495618_0003243 | 3300046514 | Bacteria | 10189 |
| 1124 | Ga0495618_0019644 | 3300046514 | Bacteria | 4158 |
| 1125 | Ga0495618_0046150 | 3300046514 | Bacteria | 2749 |
| 1126 | Ga0495618_0194174 | 3300046514 | Bacteria | 1286 |
| 1127 | Ga0495620_0000678 | 3300046515 | Bacteria | 21047 |
| 1128 | Ga0495620_0012060 | 3300046515 | Bacteria | 4484 |
| 1129 | Ga0495620_0032690 | 3300046515 | Bacteria | 2367 |
| 1130 | Ga0495620_0051357 | 3300046515 | Bacteria | 1755 |
| 1131 | Ga0495628_0000001 | 3300046516 | Bacteria | 917742 |
| 1132 | Ga0495628_0014573 | 3300046516 | Bacteria | 6584 |
| 1133 | Ga0495628_0077782 | 3300046516 | Bacteria | 2580 |
| 1134 | Ga0495628_0080064 | 3300046516 | Bacteria | 2540 |
| 1135 | Ga0495628_0187155 | 3300046516 | Bacteria | 1564 |
| 1136 | Ga0495628_0232882 | 3300046516 | Bacteria | 1380 |
| 1137 | Ga0495628_0324970 | 3300046516 | Bacteria | 1134 |
| 1138 | Ga0495630_0000574 | 3300046517 | Bacteria | 26824 |
| 1139 | Ga0495630_0030591 | 3300046517 | Bacteria | 4006 |
| 1140 | Ga0495631_0000764 | 3300046518 | Bacteria | 20676 |
| 1141 | Ga0495632_0000102 | 3300046519 | Bacteria | 87253 |
| 1142 | Ga0495632_0064658 | 3300046519 | Bacteria | 1768 |
| 1143 | Ga0495632_0071248 | 3300046519 | Bacteria | 1670 |
| 1144 | Ga0495637_0000699 | 3300046520 | Bacteria | 23092 |
| 1145 | Ga0495637_0004583 | 3300046520 | Bacteria | 7142 |
| 1146 | Ga0495643_0027646 | 3300046522 | Bacteria | 3185 |
| 1147 | Ga0495643_0056685 | 3300046522 | Bacteria | 2090 |
| 1148 | Ga0495644_0016360 | 3300046523 | Bacteria | 2838 |
| 1149 | Ga0495648_0000093 | 3300046524 | Bacteria | 111381 |
| 1150 | Ga0495648_0000723 | 3300046524 | Bacteria | 35198 |
| 1151 | Ga0495648_0005295 | 3300046524 | Bacteria | 10766 |
| 1152 | Ga0495648_0008413 | 3300046524 | Bacteria | 8123 |
| 1153 | Ga0495648_0010663 | 3300046524 | Bacteria | 6984 |
| 1154 | Ga0495648_0013147 | 3300046524 | Bacteria | 6137 |
| 1155 | Ga0495648_0033902 | 3300046524 | Bacteria | 3330 |
| 1156 | Ga0495648_0083089 | 3300046524 | Bacteria | 1815 |
| 1157 | Ga0495648_0102821 | 3300046524 | Bacteria | 1573 |
| 1158 | Ga0495642_0014290 | 3300046528 | Bacteria | 3076 |
| 1159 | Ga0495652_0000002 | 3300046529 | Bacteria | 946606 |
| 1160 | Ga0495652_0001533 | 3300046529 | Bacteria | 25351 |
| 1161 | Ga0495652_0006363 | 3300046529 | Bacteria | 10997 |
| 1162 | Ga0495652_0023871 | 3300046529 | Bacteria | 5416 |
| 1163 | Ga0495652_0037069 | 3300046529 | Bacteria | 4233 |
| 1164 | Ga0495652_0091222 | 3300046529 | Bacteria | 2491 |
| 1165 | Ga0495652_0388360 | 3300046529 | Bacteria | 991 |
| 1166 | Ga0495654_0000014 | 3300046530 | Bacteria | 312126 |
| 1167 | Ga0495654_0037178 | 3300046530 | Bacteria | 2444 |
| 1168 | Ga0495654_0053522 | 3300046530 | Bacteria | 1961 |
| 1169 | Ga0495665_0002572 | 3300046531 | Bacteria | 9795 |
| 1170 | Ga0495665_0170077 | 3300046531 | Bacteria | 1134 |
| 1171 | Ga0495640_0000001 | 3300046533 | Bacteria | 853827 |
| 1172 | Ga0495640_0002001 | 3300046533 | Bacteria | 16252 |
| 1173 | Ga0495640_0075246 | 3300046533 | Bacteria | 2255 |
| 1174 | Ga0495640_0153547 | 3300046533 | Bacteria | 1478 |
| 1175 | Ga0495587_0000001 | 3300046536 | Bacteria | 724132 |
| 1176 | Ga0495587_0005325 | 3300046536 | Bacteria | 8413 |
| 1177 | Ga0495587_0014270 | 3300046536 | Bacteria | 4985 |
| 1178 | Ga0495587_0024566 | 3300046536 | Bacteria | 3691 |
| 1179 | Ga0495587_0047368 | 3300046536 | Bacteria | 2549 |
| 1180 | Ga0495609_0000650 | 3300046538 | Bacteria | 27040 |
| 1181 | Ga0495609_0010985 | 3300046538 | Bacteria | 4325 |
| 1182 | Ga0495609_0036919 | 3300046538 | Bacteria | 2205 |
| 1183 | Ga0495645_0000002 | 3300046543 | Bacteria | 651644 |
| 1184 | Ga0495645_0004058 | 3300046543 | Bacteria | 9999 |
| 1185 | Ga0495645_0025205 | 3300046543 | Bacteria | 4315 |
| 1186 | Ga0495645_0089014 | 3300046543 | Bacteria | 2207 |
| 1187 | Ga0495645_0102213 | 3300046543 | Bacteria | 2037 |
| 1188 | Ga0495622_0053566 | 3300046557 | Bacteria | 1872 |
| 1189 | Ga0495622_0133979 | 3300046557 | Bacteria | 1127 |
| 1190 | Ga0495633_0056250 | 3300046558 | Bacteria | 1849 |
| 1191 | Ga0495667_0000039 | 3300046559 | Bacteria | 131308 |
| 1192 | Ga0495667_0003082 | 3300046559 | Bacteria | 11183 |
| 1193 | Ga0495667_0163575 | 3300046559 | Bacteria | 1431 |
| 1194 | Ga0495656_0023075 | 3300046615 | Bacteria | 2445 |
| 1195 | Ga0495656_0032291 | 3300046615 | Bacteria | 2129 |
| 1196 | Ga0495668_0027182 | 3300046616 | Bacteria | 3242 |
| 1197 | Ga0495668_0037116 | 3300046616 | Bacteria | 2728 |
| 1198 | Ga0495668_0174159 | 3300046616 | Bacteria | 1179 |
| 1199 | Ga0495634_0000010 | 3300046642 | Bacteria | 143792 |
| 1200 | Ga0495634_0003609 | 3300046642 | Bacteria | 12362 |
| 1201 | Ga0495634_0006837 | 3300046642 | Bacteria | 8630 |
| 1202 | Ga0495634_0074682 | 3300046642 | Bacteria | 2227 |
| 1203 | Ga0495611_0063919 | 3300046648 | Bacteria | 1675 |
| 1204 | Ga0495625_0000657 | 3300046660 | Bacteria | 49342 |
| 1205 | Ga0495625_0008614 | 3300046660 | Bacteria | 8681 |
| 1206 | Ga0495635_0000001 | 3300046663 | Bacteria | 704901 |
| 1207 | Ga0495635_0001348 | 3300046663 | Bacteria | 16335 |
| 1208 | Ga0495635_0001667 | 3300046663 | Bacteria | 14944 |
| 1209 | Ga0495635_0005872 | 3300046663 | Bacteria | 8558 |
| 1210 | Ga0495635_0026385 | 3300046663 | Bacteria | 4043 |
| 1211 | Ga0495659_0009843 | 3300046664 | Bacteria | 3058 |
| 1212 | Ga0495659_0021736 | 3300046664 | Bacteria | 2165 |
| 1213 | Ga0495661_0079084 | 3300046665 | Bacteria | 1901 |
| 1214 | Ga0495588_0010550 | 3300046674 | Bacteria | 4301 |
| 1215 | Ga0495657_0000042 | 3300046675 | Bacteria | 114669 |
| 1216 | Ga0495657_0002643 | 3300046675 | Bacteria | 14975 |
| 1217 | Ga0495657_0033520 | 3300046675 | Bacteria | 3574 |
| 1218 | Ga0495599_0000013 | 3300046678 | Bacteria | 179828 |
| 1219 | Ga0495599_0004148 | 3300046678 | Bacteria | 8559 |
| 1220 | Ga0495599_0006501 | 3300046678 | Bacteria | 7052 |
| 1221 | Ga0495599_0015314 | 3300046678 | Bacteria | 4758 |
| 1222 | Ga0495599_0028956 | 3300046678 | Bacteria | 3471 |
| 1223 | Ga0495599_0031977 | 3300046678 | Bacteria | 3303 |
| 1224 | Ga0495623_0000050 | 3300046679 | Bacteria | 72959 |
| 1225 | Ga0495623_0014984 | 3300046679 | Bacteria | 5011 |
| 1226 | Ga0495623_0015826 | 3300046679 | Bacteria | 4875 |
| 1227 | Ga0495623_0045431 | 3300046679 | Bacteria | 2790 |
| 1228 | Ga0495646_0000009 | 3300046680 | Bacteria | 200698 |
| 1229 | Ga0495646_0010792 | 3300046680 | Bacteria | 5803 |
| 1230 | Ga0495646_0031676 | 3300046680 | Bacteria | 3294 |
| 1231 | Ga0495646_0050016 | 3300046680 | Bacteria | 2535 |
| 1232 | Ga0495658_0006057 | 3300046683 | Bacteria | 5941 |
| 1233 | Ga0495658_0208822 | 3300046683 | Bacteria | 1219 |
| 1234 | Ga0495669_0059993 | 3300046684 | Bacteria | 1719 |
| 1235 | Ga0495613_0031324 | 3300046689 | Bacteria | 3950 |
| 1236 | Ga0495613_0041413 | 3300046689 | Bacteria | 3411 |
| 1237 | Ga0495613_0205691 | 3300046689 | Bacteria | 1386 |
| 1238 | Ga0495624_0002275 | 3300046690 | Bacteria | 14611 |
| 1239 | Ga0495624_0225932 | 3300046690 | Bacteria | 1134 |
| 1240 | Ga0495670_0012537 | 3300046691 | Bacteria | 4171 |
| 1241 | Ga0495671_0040020 | 3300046692 | Bacteria | 2365 |
| 1242 | Ga0495649_0000149 | 3300046694 | Bacteria | 60998 |
| 1243 | Ga0495649_0212609 | 3300046694 | Bacteria | 1002 |
| 1244 | Ga0495600_0000035 | 3300046809 | Bacteria | 80552 |
| 1245 | Ga0495600_0044768 | 3300046809 | Bacteria | 2886 |
| 1246 | Ga0495600_0114324 | 3300046809 | Bacteria | 1757 |
| 1247 | Ga0495600_0129701 | 3300046809 | Bacteria | 1639 |
| 1248 | Ga0495581_0000851 | 3300047315 | Bacteria | 16242 |
| 1249 | Ga0495581_0005368 | 3300047315 | Bacteria | 7416 |
| 1250 | Ga0495581_0007779 | 3300047315 | Bacteria | 6205 |
| 1251 | Ga0495604_0000069 | 3300047317 | Bacteria | 89935 |
| 1252 | Ga0495604_0005569 | 3300047317 | Bacteria | 9982 |
| 1253 | Ga0495604_0008438 | 3300047317 | Bacteria | 8136 |
| 1254 | Ga0495604_0008853 | 3300047317 | Bacteria | 7954 |
| 1255 | Ga0495604_0009053 | 3300047317 | Bacteria | 7876 |
| 1256 | Ga0495604_0266501 | 3300047317 | Bacteria | 1162 |
| 1257 | Ga0495636_0200176 | 3300047318 | Bacteria | 912 |
| 1258 | Ga0495674_0000002 | 3300047319 | Bacteria | 642785 |
| 1259 | Ga0495674_0000559 | 3300047319 | Bacteria | 34585 |
| 1260 | Ga0495674_0034030 | 3300047319 | Bacteria | 4610 |
| 1261 | Ga0495674_0059219 | 3300047319 | Bacteria | 3346 |
| 1262 | Ga0495674_0073584 | 3300047319 | Bacteria | 2945 |
| 1263 | Ga0495672_0007744 | 3300047320 | Bacteria | 8038 |
| 1264 | Ga0495672_0200710 | 3300047320 | Bacteria | 997 |
| 1265 | Ga0495676_0273696 | 3300047321 | Bacteria | 1145 |
| 1266 | Ga0495680_0000328 | 3300047322 | Bacteria | 53287 |
| 1267 | Ga0495680_0007181 | 3300047322 | Bacteria | 10259 |
| 1268 | Ga0495680_0029436 | 3300047322 | Bacteria | 4497 |
| 1269 | Ga0495680_0036826 | 3300047322 | Bacteria | 3923 |
| 1270 | Ga0495680_0114428 | 3300047322 | Bacteria | 1996 |
| 1271 | Ga0495683_0007187 | 3300047323 | Bacteria | 6040 |
| 1272 | Ga0495683_0133685 | 3300047323 | Bacteria | 1168 |
| 1273 | Ga0495687_004001 | 3300047443 | Bacteria | 10251 |
| 1274 | Ga0495675_0000164 | 3300047444 | Bacteria | 47361 |
| 1275 | Ga0495675_0010844 | 3300047444 | Bacteria | 5711 |
| 1276 | Ga0495675_0024047 | 3300047444 | Bacteria | 3881 |
| 1277 | Ga0495675_0064514 | 3300047444 | Bacteria | 2316 |
| 1278 | Ga0495679_000392 | 3300047446 | Bacteria | 33216 |
| 1279 | Ga0495679_058673 | 3300047446 | Bacteria | 1134 |
| 1280 | Ga0495673_0000008 | 3300047469 | Bacteria | 752462 |
| 1281 | Ga0495673_0000362 | 3300047469 | Bacteria | 55510 |
| 1282 | Ga0495673_0002002 | 3300047469 | Bacteria | 14994 |
| 1283 | Ga0495673_0035151 | 3300047469 | Bacteria | 2312 |
| 1284 | Ga0495681_0041281 | 3300047470 | Bacteria | 2240 |
| 1285 | Ga0495684_0000016 | 3300047471 | Bacteria | 169338 |
| 1286 | Ga0495684_0005198 | 3300047471 | Bacteria | 10142 |
| 1287 | Ga0495684_0005926 | 3300047471 | Bacteria | 9494 |
| 1288 | Ga0495684_0028039 | 3300047471 | Bacteria | 4325 |
| 1289 | Ga0495684_0032943 | 3300047471 | Bacteria | 3979 |
| 1290 | Ga0495593_0000606 | 3300047673 | Bacteria | 20452 |
| 1291 | Ga0495593_0000953 | 3300047673 | Bacteria | 16903 |
| 1292 | Ga0495593_0048060 | 3300047673 | Bacteria | 2268 |
| 1293 | Ga0495593_0077190 | 3300047673 | Bacteria | 1725 |
| 1294 | Ga0495602_0000240 | 3300048088 | Bacteria | 51242 |
| 1295 | Ga0495602_0002010 | 3300048088 | Bacteria | 20455 |
| 1296 | Ga0495602_0061124 | 3300048088 | Bacteria | 3278 |
| 1297 | Ga0495602_0077050 | 3300048088 | Bacteria | 2822 |
| 1298 | Ga0495602_0317541 | 3300048088 | Bacteria | 1134 |
| 1299 | Ga0495614_0011184 | 3300048089 | Bacteria | 3949 |
| 1300 | Ga0495614_0016077 | 3300048089 | Bacteria | 3258 |
| 1301 | Ga0495614_0026185 | 3300048089 | Bacteria | 2514 |
| 1302 | Ga0495615_0031366 | 3300048090 | Bacteria | 1275 |
| 1303 | Ga0495626_0024671 | 3300048091 | Bacteria | 2946 |
| 1304 | Ga0496100_0040451 | 3300048903 | Bacteria | 2966 |
| 1305 | Ga0496100_0047368 | 3300048903 | Bacteria | 2769 |
| 1306 | Ga0496101_0051847 | 3300048904 | Bacteria | 2957 |
| 1307 | Ga0496101_0170130 | 3300048904 | Bacteria | 1674 |
| 1308 | Ga0496101_0177225 | 3300048904 | Bacteria | 1640 |
| 1309 | Ga0496102_0002717 | 3300048905 | Bacteria | 15055 |
| 1310 | Ga0496102_0002990 | 3300048905 | Bacteria | 14313 |
| 1311 | Ga0496102_0134673 | 3300048905 | Bacteria | 2314 |
| 1312 | Ga0496102_0219683 | 3300048905 | Bacteria | 1791 |
| 1313 | Ga0496102_0223441 | 3300048905 | Bacteria | 1775 |
| 1314 | Ga0496102_0695057 | 3300048905 | Bacteria | 940 |
| 1315 | Ga0496103_0004038 | 3300048906 | Bacteria | 8917 |
| 1316 | Ga0496103_0020222 | 3300048906 | Bacteria | 3998 |
| 1317 | Ga0496103_0027506 | 3300048906 | Bacteria | 3446 |
| 1318 | Ga0496104_0002505 | 3300048907 | Bacteria | 15804 |
| 1319 | Ga0496104_0002941 | 3300048907 | Bacteria | 14675 |
| 1320 | Ga0496104_0005997 | 3300048907 | Bacteria | 10649 |
| 1321 | Ga0496105_0005733 | 3300048908 | Bacteria | 9457 |
| 1322 | Ga0496105_0121104 | 3300048908 | Bacteria | 2157 |
| 1323 | Ga0496106_0262661 | 3300048909 | Bacteria | 1381 |
| 1324 | Ga0496106_0323591 | 3300048909 | Bacteria | 1238 |
| 1325 | Ga0496106_0559315 | 3300048909 | Bacteria | 918 |
| 1326 | Ga0496107_0001922 | 3300048910 | Bacteria | 13186 |
| 1327 | Ga0496107_0063265 | 3300048910 | Bacteria | 2681 |
| 1328 | Ga0496107_0195648 | 3300048910 | Bacteria | 1503 |
| 1329 | Ga0496108_0000357 | 3300048911 | Bacteria | 38614 |
| 1330 | Ga0496108_0232373 | 3300048911 | Bacteria | 1603 |
| 1331 | Ga0496109_0002224 | 3300048912 | Bacteria | 16103 |
| 1332 | Ga0496109_0059771 | 3300048912 | Bacteria | 3482 |
| 1333 | Ga0496109_0144166 | 3300048912 | Bacteria | 2228 |
| 1334 | Ga0496110_0000889 | 3300048913 | Bacteria | 21090 |
| 1335 | Ga0496110_0032897 | 3300048913 | Bacteria | 4483 |
| 1336 | Ga0496110_0039631 | 3300048913 | Bacteria | 4103 |
| 1337 | Ga0496110_0045689 | 3300048913 | Bacteria | 3829 |
| 1338 | Ga0496110_0045760 | 3300048913 | Bacteria | 3826 |
| 1339 | Ga0496110_0052971 | 3300048913 | Bacteria | 3565 |
| 1340 | Ga0496110_0333239 | 3300048913 | Bacteria | 1382 |
| 1341 | Ga0496111_0116665 | 3300048914 | Bacteria | 1969 |
| 1342 | Ga0496112_0000117 | 3300048915 | Bacteria | 49274 |
| 1343 | Ga0496112_0006469 | 3300048915 | Bacteria | 10288 |
| 1344 | Ga0496112_0024359 | 3300048915 | Bacteria | 5793 |
| 1345 | Ga0496112_0034574 | 3300048915 | Bacteria | 4918 |
| 1346 | Ga0496112_0072710 | 3300048915 | Bacteria | 3399 |
| 1347 | Ga0496112_0094153 | 3300048915 | Bacteria | 2966 |
| 1348 | Ga0496112_0154568 | 3300048915 | Bacteria | 2261 |
| 1349 | Ga0496112_0191885 | 3300048915 | Bacteria | 2004 |
| 1350 | Ga0496112_0192936 | 3300048915 | Bacteria | 1998 |
| 1351 | Ga0496113_0010717 | 3300048916 | Bacteria | 6074 |
| 1352 | Ga0496113_0174795 | 3300048916 | Bacteria | 1701 |
| 1353 | Ga0496113_0259725 | 3300048916 | Bacteria | 1387 |
| 1354 | Ga0496113_0462982 | 3300048916 | Bacteria | 1019 |
| 1355 | Ga0496114_0037479 | 3300048917 | Bacteria | 4010 |
| 1356 | Ga0496114_0047484 | 3300048917 | Bacteria | 3572 |
| 1357 | Ga0496114_0070632 | 3300048917 | Bacteria | 2933 |
| 1358 | Ga0496114_0230250 | 3300048917 | Bacteria | 1628 |
| 1359 | Ga0496115_0002584 | 3300048918 | Bacteria | 12996 |
| 1360 | Ga0496115_0117048 | 3300048918 | Bacteria | 2192 |
| 1361 | Ga0496115_0132487 | 3300048918 | Bacteria | 2054 |
| 1362 | Ga0496115_0174778 | 3300048918 | Bacteria | 1776 |
| 1363 | Ga0496115_0212767 | 3300048918 | Bacteria | 1597 |
| 1364 | Ga0496116_0003967 | 3300048919 | Bacteria | 14367 |
| 1365 | Ga0496116_0006130 | 3300048919 | Bacteria | 10995 |
| 1366 | Ga0496116_0007895 | 3300048919 | Bacteria | 9335 |
| 1367 | Ga0496116_0049570 | 3300048919 | Bacteria | 2806 |
| 1368 | Ga0496116_0071638 | 3300048919 | Bacteria | 2194 |
| 1369 | Ga0496117_0013767 | 3300048920 | Bacteria | 7025 |
| 1370 | Ga0496117_0098322 | 3300048920 | Bacteria | 1861 |
| 1371 | Ga0496117_0187965 | 3300048920 | Bacteria | 1180 |
| 1372 | Ga0496118_0001099 | 3300048921 | Bacteria | 42066 |
| 1373 | Ga0496118_0013843 | 3300048921 | Bacteria | 7594 |
| 1374 | Ga0496118_0022793 | 3300048921 | Bacteria | 5460 |
| 1375 | Ga0496118_0094148 | 3300048921 | Bacteria | 2049 |
| 1376 | Ga0496118_0100525 | 3300048921 | Bacteria | 1956 |
| 1377 | Ga0496118_0138864 | 3300048921 | Bacteria | 1545 |
| 1378 | Ga0496118_0145225 | 3300048921 | Bacteria | 1495 |
| 1379 | Ga0496119_0016661 | 3300048922 | Bacteria | 5577 |
| 1380 | Ga0496120_0020029 | 3300048923 | Bacteria | 4262 |
| 1381 | Ga0496120_0054973 | 3300048923 | Bacteria | 2253 |
| 1382 | Ga0496121_0000094 | 3300048924 | Bacteria | 212726 |
| 1383 | Ga0496121_0001006 | 3300048924 | Bacteria | 50348 |
| 1384 | Ga0496121_0001373 | 3300048924 | Bacteria | 41404 |
| 1385 | Ga0496121_0003460 | 3300048924 | Bacteria | 22502 |
| 1386 | Ga0496121_0004413 | 3300048924 | Bacteria | 18951 |
| 1387 | Ga0496121_0034449 | 3300048924 | Bacteria | 4557 |
| 1388 | Ga0496121_0053860 | 3300048924 | Bacteria | 3367 |
| 1389 | Ga0496121_0072366 | 3300048924 | Bacteria | 2767 |
| 1390 | Ga0496121_0098517 | 3300048924 | Bacteria | 2262 |
| 1391 | Ga0496121_0134946 | 3300048924 | Bacteria | 1840 |
| 1392 | Ga0496121_0136095 | 3300048924 | Bacteria | 1830 |
| 1393 | Ga0496121_0167519 | 3300048924 | Bacteria | 1600 |
| 1394 | Ga0496121_0185303 | 3300048924 | Bacteria | 1497 |
| 1395 | Ga0496122_0000214 | 3300048925 | Bacteria | 129132 |
| 1396 | Ga0496122_0000693 | 3300048925 | Bacteria | 67068 |
| 1397 | Ga0496122_0001372 | 3300048925 | Bacteria | 39648 |
| 1398 | Ga0496122_0017391 | 3300048925 | Bacteria | 6726 |
| 1399 | Ga0496122_0045528 | 3300048925 | Bacteria | 3409 |
| 1400 | Ga0496122_0124378 | 3300048925 | Bacteria | 1654 |
| 1401 | Ga0496123_0000187 | 3300048926 | Bacteria | 125396 |
| 1402 | Ga0496123_0000433 | 3300048926 | Bacteria | 75427 |
| 1403 | Ga0496123_0004961 | 3300048926 | Bacteria | 13639 |
| 1404 | Ga0496123_0012078 | 3300048926 | Bacteria | 7406 |
| 1405 | Ga0496123_0025593 | 3300048926 | Bacteria | 4444 |
| 1406 | Ga0496123_0133114 | 3300048926 | Bacteria | 1373 |
| 1407 | Ga0496124_0000004 | 3300048927 | Bacteria | 976131 |
| 1408 | Ga0496124_0000224 | 3300048927 | Bacteria | 110603 |
| 1409 | Ga0496124_0009911 | 3300048927 | Bacteria | 9739 |
| 1410 | Ga0496124_0024007 | 3300048927 | Bacteria | 5551 |
| 1411 | Ga0496124_0031672 | 3300048927 | Bacteria | 4679 |
| 1412 | Ga0496124_0069590 | 3300048927 | Bacteria | 2921 |
| 1413 | Ga0496124_0078167 | 3300048927 | Bacteria | 2727 |
| 1414 | Ga0496124_0078550 | 3300048927 | Bacteria | 2719 |
| 1415 | Ga0496124_0085247 | 3300048927 | Bacteria | 2589 |
| 1416 | Ga0496124_0209953 | 3300048927 | Bacteria | 1474 |
| 1417 | Ga0496124_0218591 | 3300048927 | Bacteria | 1435 |
| 1418 | Ga0496124_0378292 | 3300048927 | Bacteria | 991 |
| 1419 | Ga0496125_0000063 | 3300048928 | Bacteria | 250260 |
| 1420 | Ga0496125_0000363 | 3300048928 | Bacteria | 85601 |
| 1421 | Ga0496125_0001879 | 3300048928 | Bacteria | 28856 |
| 1422 | Ga0496125_0002076 | 3300048928 | Bacteria | 27038 |
| 1423 | Ga0496125_0005173 | 3300048928 | Bacteria | 14671 |
| 1424 | Ga0496125_0028136 | 3300048928 | Bacteria | 5082 |
| 1425 | Ga0496125_0028421 | 3300048928 | Bacteria | 5051 |
| 1426 | Ga0496125_0039397 | 3300048928 | Bacteria | 4070 |
| 1427 | Ga0496125_0064305 | 3300048928 | Bacteria | 2916 |
| 1428 | Ga0496125_0079365 | 3300048928 | Bacteria | 2518 |
| 1429 | Ga0496126_0018230 | 3300048929 | Bacteria | 6965 |
| 1430 | Ga0496126_0130226 | 3300048929 | Bacteria | 2174 |
| 1431 | Ga0496126_0172406 | 3300048929 | Bacteria | 1842 |
| 1432 | Ga0496126_0295942 | 3300048929 | Bacteria | 1337 |
| 1433 | Ga0496126_0396589 | 3300048929 | Bacteria | 1120 |
| 1434 | Ga0496126_0415424 | 3300048929 | Bacteria | 1089 |
| 1435 | Ga0495678_000012 | 3300049459 | Bacteria | 333905 |
| 1436 | Ga0495678_021406 | 3300049459 | Bacteria | 2848 |
| 1437 | Ga0495682_0000087 | 3300049460 | Bacteria | 80534 |
| 1438 | Ga0495682_0000605 | 3300049460 | Bacteria | 24195 |
| 1439 | Ga0501034_0051746 | 3300049571 | Bacteria | 4141 |
| 1440 | Ga0501036_0214582 | 3300049572 | Bacteria | 1617 |
| 1441 | Ga0501040_0172442 | 3300049576 | Bacteria | 1532 |
| 1442 | Ga0501041_0077892 | 3300049577 | Bacteria | 2040 |
| 1443 | Ga0501042_0269581 | 3300049578 | Bacteria | 1229 |
| 1444 | Ga0501046_0064299 | 3300049580 | Bacteria | 2864 |
| 1445 | Ga0501048_0078999 | 3300049582 | Bacteria | 2322 |
| 1446 | Ga0501048_0163479 | 3300049582 | Bacteria | 1576 |
| 1447 | Ga0501071_0028125 | 3300049587 | Bacteria | 3960 |
| 1448 | Ga0501072_0096552 | 3300049588 | Bacteria | 2348 |
| 1449 | Ga0501073_0147546 | 3300049589 | Bacteria | 1630 |
| 1450 | Ga0501075_0006354 | 3300049591 | Bacteria | 8128 |
| 1451 | Ga0501076_0000981 | 3300049592 | Bacteria | 18652 |
| 1452 | Ga0501076_0086870 | 3300049592 | Bacteria | 2514 |
| 1453 | Ga0501227_023049 | 3300049665 | Bacteria | 1444 |
| 1454 | Ga0501235_004060 | 3300049669 | Bacteria | 3167 |
| 1455 | Ga0501258_004539 | 3300049687 | Bacteria | 1315 |
| 1456 | Ga0501221_004443 | 3300049704 | Bacteria | 2327 |
| 1457 | Ga0501229_000133 | 3300049706 | Bacteria | 7696 |
| 1458 | Ga0501229_007113 | 3300049706 | Bacteria | 1389 |
| 1459 | Ga0501079_0024279 | 3300049741 | Bacteria | 4652 |
| 1460 | Ga0501079_0067138 | 3300049741 | Bacteria | 2768 |
| 1461 | Ga0501080_0090377 | 3300049742 | Bacteria | 2845 |
| 1462 | Ga0501080_0095492 | 3300049742 | Bacteria | 2761 |
| 1463 | Ga0501081_0004564 | 3300049743 | Bacteria | 8894 |
| 1464 | Ga0501081_0061629 | 3300049743 | Bacteria | 2601 |
| 1465 | Ga0501081_0124671 | 3300049743 | Bacteria | 1837 |
| 1466 | Ga0501267_001299 | 3300049764 | Bacteria | 2119 |
| 1467 | Ga0501035_0352635 | 3300049822 | Bacteria | 1231 |
| 1468 | Ga0501045_0086938 | 3300049824 | Bacteria | 2308 |
| 1469 | Ga0501045_0104076 | 3300049824 | Bacteria | 2103 |
| 1470 | nmdc:mga03683_134761_c1 | 3300050489 | Bacteria | 1107 |
| 1471 | nmdc:mga03683_1535_c1 | 3300050489 | Bacteria | 6880 |
| 1472 | nmdc:mga03683_3361_c2 | 3300050489 | Bacteria | 1734 |
| 1473 | nmdc:mga03n38_159019_c1 | 3300050490 | Bacteria | 1143 |
| 1474 | nmdc:mga03n38_1633_c1 | 3300050490 | Bacteria | 6559 |
| 1475 | nmdc:mga00v17_101419_c1 | 3300050491 | Bacteria | 1817 |
| 1476 | nmdc:mga00v17_112900_c1 | 3300050491 | Bacteria | 1725 |
| 1477 | nmdc:mga00v17_184670_c1 | 3300050491 | Bacteria | 1346 |
| 1478 | nmdc:mga00v17_210178_c1 | 3300050491 | Bacteria | 1259 |
| 1479 | nmdc:mga00v17_240491_c1 | 3300050491 | Bacteria | 1174 |
| 1480 | nmdc:mga00v17_6544_c1 | 3300050491 | Bacteria | 6184 |
| 1481 | nmdc:mga00v17_97354_c1 | 3300050491 | Bacteria | 1340 |
| 1482 | nmdc:mga0yw44_137180_c1 | 3300050492 | Bacteria | 1588 |
| 1483 | nmdc:mga0yw44_190057_c1 | 3300050492 | Bacteria | 1354 |
| 1484 | nmdc:mga0yw44_19046_c1 | 3300050492 | Bacteria | 3776 |
| 1485 | nmdc:mga0yw44_20621_c1 | 3300050492 | Bacteria | 3662 |
| 1486 | nmdc:mga0yw44_29154_c1 | 3300050492 | Bacteria | 3184 |
| 1487 | nmdc:mga0k408_18076_c1 | 3300050493 | Bacteria | 3931 |
| 1488 | nmdc:mga0k408_42865_c1 | 3300050493 | Bacteria | 2606 |
| 1489 | nmdc:mga0k408_56087_c1 | 3300050493 | Bacteria | 2285 |
| 1490 | nmdc:mga06z11_117198_c1 | 3300050494 | Bacteria | 1482 |
| 1491 | nmdc:mga06z11_22668_c1 | 3300050494 | Bacteria | 2937 |
| 1492 | nmdc:mga04h51_2271_c1 | 3300050495 | Bacteria | 4532 |
| 1493 | nmdc:mga04h51_4146_c1 | 3300050495 | Bacteria | 3578 |
| 1494 | nmdc:mga07m45_128110_c1 | 3300050496 | Bacteria | 1468 |
| 1495 | nmdc:mga07m45_190150_c1 | 3300050496 | Bacteria | 1194 |
| 1496 | nmdc:mga07m45_27827_c1 | 3300050496 | Bacteria | 3118 |
| 1497 | nmdc:mga07m45_3642_c1 | 3300050496 | Bacteria | 7442 |
| 1498 | nmdc:mga07m45_48928_c1 | 3300050496 | Bacteria | 2378 |
| 1499 | nmdc:mga07m45_70372_c1 | 3300050496 | Bacteria | 1990 |
| 1500 | nmdc:mga07m45_9639_c1 | 3300050496 | Bacteria | 5019 |
| 1501 | nmdc:mga05p37_1204_c1 | 3300050507 | Bacteria | 29952 |
| 1502 | nmdc:mga05p37_204614_c1 | 3300050507 | Bacteria | 2388 |
| 1503 | nmdc:mga05p37_3429_c1 | 3300050507 | Bacteria | 18491 |
| 1504 | nmdc:mga05p37_413_c1 | 3300050507 | Bacteria | 46142 |
| 1505 | nmdc:mga05p37_47607_c1 | 3300050507 | Bacteria | 5272 |
| 1506 | nmdc:mga05p37_57887_c1 | 3300050507 | Bacteria | 4773 |
| 1507 | nmdc:mga05p37_60912_c1 | 3300050507 | Bacteria | 4647 |
| 1508 | nmdc:mga05p37_69744_c1 | 3300050507 | Bacteria | 4324 |
| 1509 | nmdc:mga05p37_74309_c1 | 3300050507 | Bacteria | 4183 |
| 1510 | nmdc:mga09592_11500_c1 | 3300050508 | Bacteria | 6607 |
| 1511 | nmdc:mga09592_136715_c1 | 3300050508 | Bacteria | 2111 |
| 1512 | nmdc:mga09592_145719_c1 | 3300050508 | Bacteria | 2042 |
| 1513 | nmdc:mga09592_17311_c1 | 3300050508 | Bacteria | 5904 |
| 1514 | nmdc:mga09592_178482_c1 | 3300050508 | Bacteria | 1837 |
| 1515 | nmdc:mga09592_304869_c1 | 3300050508 | Bacteria | 1381 |
| 1516 | nmdc:mga09592_33905_c1 | 3300050508 | Bacteria | 4266 |
| 1517 | nmdc:mga09592_41983_c1 | 3300050508 | Bacteria | 3848 |
| 1518 | nmdc:mga09592_7869_c1 | 3300050508 | Bacteria | 8665 |
| 1519 | nmdc:mga0qj67_141673_c1 | 3300050509 | Bacteria | 1950 |
| 1520 | nmdc:mga0qj67_260295_c1 | 3300050509 | Bacteria | 1407 |
| 1521 | nmdc:mga0qj67_404607_c1 | 3300050509 | Bacteria | 1101 |
| 1522 | nmdc:mga0qj67_41611_c1 | 3300050509 | Bacteria | 3614 |
| 1523 | nmdc:mga0qj67_48176_c1 | 3300050509 | Bacteria | 3367 |
| 1524 | nmdc:mga0qj67_88207_c1 | 3300050509 | Bacteria | 2491 |
| 1525 | nmdc:mga0qj67_933_c1 | 3300050509 | Bacteria | 20130 |
| 1526 | nmdc:mga0qj67_97211_c1 | 3300050509 | Bacteria | 2371 |
| 1527 | nmdc:mga06r32_104072_c1 | 3300050510 | Bacteria | 2788 |
| 1528 | nmdc:mga06r32_109575_c1 | 3300050510 | Bacteria | 2716 |
| 1529 | nmdc:mga06r32_16885_c1 | 3300050510 | Bacteria | 6659 |
| 1530 | nmdc:mga06r32_201_c1 | 3300050510 | Bacteria | 26944 |
| 1531 | nmdc:mga06r32_34997_c1 | 3300050510 | Bacteria | 4739 |
| 1532 | nmdc:mga06r32_541381_c1 | 3300050510 | Bacteria | 1139 |
| 1533 | nmdc:mga08y16_237415_c1 | 3300050511 | Bacteria | 1885 |
| 1534 | nmdc:mga08y16_36005_c1 | 3300050511 | Bacteria | 3810 |
| 1535 | nmdc:mga08y16_4141_c1 | 3300050511 | Bacteria | 15136 |
| 1536 | nmdc:mga08y16_514132_c1 | 3300050511 | Bacteria | 1215 |
| 1537 | nmdc:mga08y16_57115_c1 | 3300050511 | Bacteria | 4079 |
| 1538 | nmdc:mga08y16_620076_c1 | 3300050511 | Bacteria | 1089 |
| 1539 | nmdc:mga08y16_62145_c1 | 3300050511 | Bacteria | 3900 |
| 1540 | nmdc:mga08y16_622724_c1 | 3300050511 | Bacteria | 1086 |
| 1541 | nmdc:mga08y16_86448_c1 | 3300050511 | Bacteria | 3268 |
| 1542 | nmdc:mga08y16_93457_c2 | 3300050511 | Bacteria | 2281 |
| 1543 | nmdc:mga0n895_127_c1 | 3300050512 | Bacteria | 45097 |
| 1544 | nmdc:mga0n895_19327_c1 | 3300050512 | Bacteria | 6331 |
| 1545 | nmdc:mga0n895_231204_c1 | 3300050512 | Bacteria | 1877 |
| 1546 | nmdc:mga0n895_35568_c1 | 3300050512 | Bacteria | 4803 |
| 1547 | nmdc:mga0n895_38357_c1 | 3300050512 | Bacteria | 4642 |
| 1548 | nmdc:mga0n895_410774_c1 | 3300050512 | Bacteria | 1369 |
| 1549 | nmdc:mga0n895_4878_c1 | 3300050512 | Bacteria | 11111 |
| 1550 | nmdc:mga0n895_523143_c1 | 3300050512 | Bacteria | 1194 |
| 1551 | nmdc:mga0n895_57522_c1 | 3300050512 | Bacteria | 3833 |
| 1552 | nmdc:mga0n895_75123_c1 | 3300050512 | Bacteria | 3359 |
| 1553 | nmdc:mga0rr50_187163_c1 | 3300050513 | Bacteria | 1695 |
| 1554 | nmdc:mga0rr50_22233_c1 | 3300050513 | Bacteria | 4349 |
| 1555 | nmdc:mga0rr50_3231_c1 | 3300050513 | Bacteria | 9337 |
| 1556 | nmdc:mga0rr50_34409_c1 | 3300050513 | Bacteria | 3628 |
| 1557 | nmdc:mga0rr50_61461_c1 | 3300050513 | Bacteria | 2830 |
| 1558 | nmdc:mga0rr50_771_c1 | 3300050513 | Bacteria | 17249 |
| 1559 | nmdc:mga0rr50_8101_c1 | 3300050513 | Bacteria | 6522 |
| 1560 | nmdc:mga08x19_16260_c1 | 3300050514 | Bacteria | 4536 |
| 1561 | nmdc:mga08x19_17961_c1 | 3300050514 | Bacteria | 4332 |
| 1562 | nmdc:mga08x19_258516_c1 | 3300050514 | Bacteria | 1203 |
| 1563 | nmdc:mga08x19_30393_c1 | 3300050514 | Bacteria | 3393 |
| 1564 | nmdc:mga08x19_59288_c1 | 3300050514 | Bacteria | 2478 |
| 1565 | nmdc:mga08x19_66198_c1 | 3300050514 | Bacteria | 2348 |
| 1566 | nmdc:mga0a205_1877_c1 | 3300050515 | Bacteria | 18205 |
| 1567 | nmdc:mga0a205_2763_c1 | 3300050515 | Bacteria | 15503 |
| 1568 | nmdc:mga0a205_29651_c1 | 3300050515 | Bacteria | 5237 |
| 1569 | nmdc:mga0a205_30042_c1 | 3300050515 | Bacteria | 5201 |
| 1570 | nmdc:mga0a205_433_c1 | 3300050515 | Bacteria | 32195 |
| 1571 | nmdc:mga0a205_50973_c1 | 3300050515 | Bacteria | 3996 |
| 1572 | nmdc:mga0a205_548_c1 | 3300050515 | Bacteria | 29744 |
| 1573 | nmdc:mga0a205_56640_c1 | 3300050515 | Bacteria | 3784 |
| 1574 | nmdc:mga0a205_5859_c1 | 3300050515 | Bacteria | 11069 |
| 1575 | nmdc:mga0a205_65115_c1 | 3300050515 | Bacteria | 3521 |
| 1576 | nmdc:mga0a205_681269_c1 | 3300050515 | Bacteria | 878 |
| 1577 | nmdc:mga0a205_81202_c1 | 3300050515 | Bacteria | 3132 |
| 1578 | nmdc:mga0a205_99184_c1 | 3300050515 | Bacteria | 2811 |
| 1579 | nmdc:mga0sz30_105332_c1 | 3300050516 | Bacteria | 1234 |
| 1580 | nmdc:mga0sz30_15041_c1 | 3300050516 | Bacteria | 3055 |
| 1581 | nmdc:mga0sz30_155_c2 | 3300050516 | Bacteria | 13523 |
| 1582 | nmdc:mga0sz30_70976_c1 | 3300050516 | Bacteria | 1499 |
| 1583 | Ga0495601_0000001 | 3300053077 | Bacteria | 549454 |
| 1584 | Ga0495601_0023258 | 3300053077 | Bacteria | 3807 |
| 1585 | Ga0495601_0036750 | 3300053077 | Bacteria | 3060 |
| 1586 | Ga0495601_0087522 | 3300053077 | Bacteria | 2003 |
| 1587 | Ga0495601_0241353 | 3300053077 | Bacteria | 1180 |
| 1588 | Ga0495612_0000017 | 3300053078 | Bacteria | 152112 |
| 1589 | Ga0500610_0042322 | 3300053079 | Bacteria | 2356 |
| 1590 | Ga0500635_0008589 | 3300053080 | Bacteria | 2805 |
| 1591 | Ga0495595_0000010 | 3300053084 | Bacteria | 178819 |
| 1592 | Ga0495595_0000696 | 3300053084 | Bacteria | 12842 |
| 1593 | Ga0495595_0058530 | 3300053084 | Bacteria | 1799 |
| 1594 | Ga0495619_0000014 | 3300053085 | Bacteria | 261449 |
| 1595 | Ga0495619_0000966 | 3300053085 | Bacteria | 18840 |
| 1596 | Ga0495619_0004720 | 3300053085 | Bacteria | 8676 |
| 1597 | Ga0495619_0033264 | 3300053085 | Bacteria | 3348 |
| 1598 | Ga0495619_0047645 | 3300053085 | Bacteria | 2823 |
| 1599 | Ga0500578_0084710 | 3300053086 | Bacteria | 2014 |
| 1600 | Ga0500643_000019 | 3300053087 | Bacteria | 294301 |
| 1601 | Ga0500643_013129 | 3300053087 | Bacteria | 2938 |
| 1602 | Ga0500644_0002483 | 3300053088 | Bacteria | 4609 |
| 1603 | Ga0500647_0156860 | 3300053091 | Bacteria | 1059 |
| 1604 | Ga0500651_0001077 | 3300053093 | Bacteria | 13470 |
| 1605 | Ga0500651_0019640 | 3300053093 | Bacteria | 4201 |
| 1606 | Ga0500651_0099442 | 3300053093 | Bacteria | 1784 |
| 1607 | Ga0500566_0001407 | 3300053094 | Bacteria | 14073 |
| 1608 | Ga0500566_0017963 | 3300053094 | Bacteria | 4152 |
| 1609 | Ga0500566_0057431 | 3300053094 | Bacteria | 2210 |
| 1610 | Ga0500641_0007284 | 3300053096 | Bacteria | 3943 |
| 1611 | Ga0500641_0015643 | 3300053096 | Bacteria | 2820 |
| 1612 | Ga0500641_0044214 | 3300053096 | Bacteria | 1811 |
| 1613 | Ga0500554_002430 | 3300053102 | Bacteria | 3664 |
| 1614 | Ga0500554_003583 | 3300053102 | Bacteria | 3200 |
| 1615 | Ga0500555_004780 | 3300053103 | Bacteria | 3844 |
| 1616 | Ga0500556_0000069 | 3300053104 | Bacteria | 101263 |
| 1617 | Ga0500556_0081680 | 3300053104 | Bacteria | 1222 |
| 1618 | Ga0500557_000039 | 3300053105 | Bacteria | 66862 |
| 1619 | Ga0500569_007080 | 3300053109 | Bacteria | 2499 |
| 1620 | Ga0500569_009038 | 3300053109 | Bacteria | 2302 |
| 1621 | Ga0500571_044398 | 3300053110 | Bacteria | 2369 |
| 1622 | Ga0500572_001849 | 3300053111 | Bacteria | 5366 |
| 1623 | Ga0500595_008228 | 3300053119 | Bacteria | 4274 |
| 1624 | Ga0500595_009536 | 3300053119 | Bacteria | 3913 |
| 1625 | Ga0500595_028448 | 3300053119 | Bacteria | 1905 |
| 1626 | Ga0500595_048130 | 3300053119 | Bacteria | 1333 |
| 1627 | Ga0500595_059336 | 3300053119 | Bacteria | 1160 |
| 1628 | Ga0500597_051774 | 3300053120 | Bacteria | 1751 |
| 1629 | Ga0500614_052167 | 3300053123 | Bacteria | 1077 |
| 1630 | Ga0500618_000088 | 3300053125 | Bacteria | 74892 |
| 1631 | Ga0500618_000286 | 3300053125 | Bacteria | 38499 |
| 1632 | Ga0500618_001413 | 3300053125 | Bacteria | 10762 |
| 1633 | Ga0500642_0000032 | 3300053130 | Bacteria | 111097 |
| 1634 | Ga0500642_0000285 | 3300053130 | Bacteria | 18457 |
| 1635 | Ga0500642_0058734 | 3300053130 | Bacteria | 1720 |
| 1636 | Ga0500652_005774 | 3300053131 | Bacteria | 3929 |
| 1637 | Ga0500655_000880 | 3300053133 | Bacteria | 5835 |
| 1638 | Ga0500658_0000645 | 3300053134 | Bacteria | 14429 |
| 1639 | Ga0500658_0000750 | 3300053134 | Bacteria | 13400 |
| 1640 | Ga0500658_0029431 | 3300053134 | Bacteria | 2136 |
| 1641 | Ga0500658_0107985 | 3300053134 | Bacteria | 1222 |
| 1642 | Ga0500559_0000107 | 3300053136 | Bacteria | 65560 |
| 1643 | Ga0500559_0020758 | 3300053136 | Bacteria | 2779 |
| 1644 | Ga0500559_0020926 | 3300053136 | Bacteria | 2768 |
| 1645 | Ga0500559_0048585 | 3300053136 | Bacteria | 1866 |
| 1646 | Ga0500568_0004264 | 3300053139 | Bacteria | 7684 |
| 1647 | Ga0500568_0020039 | 3300053139 | Bacteria | 2900 |
| 1648 | Ga0500568_0070664 | 3300053139 | Bacteria | 1337 |
| 1649 | Ga0500568_0083281 | 3300053139 | Bacteria | 1212 |
| 1650 | Ga0500574_007277 | 3300053141 | Bacteria | 2285 |
| 1651 | Ga0500586_001308 | 3300053145 | Bacteria | 5231 |
| 1652 | Ga0500604_0024805 | 3300053151 | Bacteria | 1719 |
| 1653 | Ga0500604_0031788 | 3300053151 | Bacteria | 1552 |
| 1654 | Ga0500604_0052567 | 3300053151 | Bacteria | 1261 |
| 1655 | Ga0500616_0000028 | 3300053153 | Bacteria | 435722 |
| 1656 | Ga0500616_0000332 | 3300053153 | Bacteria | 67840 |
| 1657 | Ga0500616_0002011 | 3300053153 | Bacteria | 17989 |
| 1658 | Ga0500616_0003426 | 3300053153 | Bacteria | 12139 |
| 1659 | Ga0500622_0002230 | 3300053156 | Bacteria | 14254 |
| 1660 | Ga0500622_0002594 | 3300053156 | Bacteria | 12875 |
| 1661 | Ga0500622_0033061 | 3300053156 | Bacteria | 2711 |
| 1662 | Ga0500627_0051009 | 3300053158 | Bacteria | 1803 |
| 1663 | Ga0500630_000815 | 3300053159 | Bacteria | 14379 |
| 1664 | Ga0500634_0037909 | 3300053161 | Bacteria | 2621 |
| 1665 | Ga0500638_031056 | 3300053162 | Bacteria | 2575 |
| 1666 | Ga0500638_034026 | 3300053162 | Bacteria | 2465 |
| 1667 | Ga0500639_000221 | 3300053163 | Bacteria | 28281 |
| 1668 | Ga0500636_0000313 | 3300053177 | Bacteria | 26675 |
| 1669 | Ga0500636_0030709 | 3300053177 | Bacteria | 3180 |
| 1670 | Ga0500636_0145360 | 3300053177 | Bacteria | 1308 |
| 1671 | Ga0500637_0000655 | 3300053178 | Bacteria | 13752 |
| 1672 | Ga0500637_0057330 | 3300053178 | Bacteria | 2227 |
| 1673 | Ga0500645_000422 | 3300053730 | Bacteria | 29281 |
| 1674 | Ga0500645_013729 | 3300053730 | Bacteria | 2594 |
| 1675 | Ga0500601_000542 | 3300053737 | Bacteria | 5613 |
| 1676 | Ga0501084_0120064 | 3300054114 | Bacteria | 2210 |
| 1677 | Ga0501084_0280985 | 3300054114 | Bacteria | 1406 |
| 1678 | Ga0501082_0013883 | 3300060353 | Bacteria | 6926 |
| 1679 | Ga0501082_0338240 | 3300060353 | Bacteria | 1312 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046455 | Ga0495603_0094293 | Ga0495603_0094293_545_1327 | 229 |
| 2 | 3300046472 | Ga0495580_0001269 | Ga0495580_0001269_1551_2333 | 229 |
| 3 | 3300005937 | Ga0081455_10001350 | Ga0081455_100013505 | 230 |
| 4 | 3300005445 | Ga0070708_100285818 | Ga0070708_1002858182 | 232 |
| 5 | 3300005468 | Ga0070707_100261262 | Ga0070707_1002612622 | 232 |
| 6 | 3300005471 | Ga0070698_100296995 | Ga0070698_1002969951 | 232 |
| 7 | 3300005518 | Ga0070699_100215687 | Ga0070699_1002156872 | 232 |
| 8 | 3300005536 | Ga0070697_100145288 | Ga0070697_1001452882 | 232 |
| 9 | 3300005445 | Ga0070708_100011367 | Ga0070708_1000113674 | 236 |
| 10 | 3300005468 | Ga0070707_100019372 | Ga0070707_1000193726 | 236 |
| 11 | 3300005471 | Ga0070698_100063521 | Ga0070698_1000635212 | 236 |
| 12 | 3300005518 | Ga0070699_100031521 | Ga0070699_1000315214 | 236 |
| 13 | 3300005536 | Ga0070697_100028321 | Ga0070697_1000283213 | 236 |
| 14 | 3300007076 | Ga0075435_100109034 | Ga0075435_1001090342 | 236 |
| 15 | 3300025910 | Ga0207684_10020436 | Ga0207684_100204363 | 236 |
| 16 | 3300025922 | Ga0207646_10179344 | Ga0207646_101793442 | 236 |
| 17 | 3300050513 | nmdc:mga0rr50_187163_c1 | nmdc:mga0rr50_187163_c1_828_1607 | 236 |
| 18 | 3300006847 | Ga0075431_100318325 | Ga0075431_1003183252 | 238 |
| 19 | 3300050515 | nmdc:mga0a205_681269_c1 | nmdc:mga0a205_681269_c1_30_770 | 239 |
| 20 | 3300005536 | Ga0070697_100021560 | Ga0070697_1000215604 | 241 |
| 21 | 3300005546 | Ga0070696_100186436 | Ga0070696_1001864362 | 241 |
| 22 | 3300006173 | Ga0070716_100039297 | Ga0070716_1000392972 | 241 |
| 23 | 3300025906 | Ga0207699_10063949 | Ga0207699_100639492 | 241 |
| 24 | 3300050507 | nmdc:mga05p37_57887_c1 | nmdc:mga05p37_57887_c1_931_1692 | 241 |
| 25 | 3300050512 | nmdc:mga0n895_38357_c1 | nmdc:mga0n895_38357_c1_3825_4586 | 241 |
| 26 | 3300050513 | nmdc:mga0rr50_8101_c1 | nmdc:mga0rr50_8101_c1_3972_4733 | 241 |
| 27 | 3300050514 | nmdc:mga08x19_30393_c1 | nmdc:mga08x19_30393_c1_1813_2574 | 241 |
| 28 | 3300050515 | nmdc:mga0a205_2763_c1 | nmdc:mga0a205_2763_c1_1941_2702 | 241 |
| 29 | 3300007265 | Ga0099794_10056573 | Ga0099794_100565732 | 242 |
| 30 | 3300003203 | JGI25406J46586_10059517 | JGI25406J46586_100595171 | 243 |
| 31 | 3300005536 | Ga0070697_100081756 | Ga0070697_1000817562 | 243 |
| 32 | 3300005985 | Ga0081539_10000009 | Ga0081539_10000009486 | 243 |
| 33 | 3300005444 | Ga0070694_100372257 | Ga0070694_1003722572 | 244 |
| 34 | 3300007265 | Ga0099794_10020028 | Ga0099794_100200282 | 246 |
| 35 | 3300006852 | Ga0075433_10085987 | Ga0075433_100859872 | 248 |
| 36 | 3300007076 | Ga0075435_100033463 | Ga0075435_1000334633 | 248 |
| 37 | 3300050512 | nmdc:mga0n895_231204_c1 | nmdc:mga0n895_231204_c1_32_811 | 248 |
| 38 | 3300050515 | nmdc:mga0a205_548_c1 | nmdc:mga0a205_548_c1_3523_4302 | 248 |
| 39 | 3300005440 | Ga0070705_100040250 | Ga0070705_1000402502 | 249 |
| 40 | 3300005467 | Ga0070706_100043592 | Ga0070706_1000435923 | 249 |
| 41 | 3300006852 | Ga0075433_10000781 | Ga0075433_100007817 | 249 |
| 42 | 3300006871 | Ga0075434_100001936 | Ga0075434_10000193610 | 249 |
| 43 | 3300006881 | Ga0068865_100112158 | Ga0068865_1001121582 | 249 |
| 44 | 3300006914 | Ga0075436_100012919 | Ga0075436_1000129193 | 249 |
| 45 | 3300007076 | Ga0075435_100002088 | Ga0075435_10000208812 | 249 |
| 46 | 3300009553 | Ga0105249_10663094 | Ga0105249_106630942 | 249 |
| 47 | 3300013297 | Ga0157378_10140868 | Ga0157378_101408682 | 249 |
| 48 | 3300025910 | Ga0207684_10057109 | Ga0207684_100571093 | 249 |
| 49 | 3300046664 | Ga0495659_0021736 | Ga0495659_0021736_545_1327 | 249 |
| 50 | 3300047318 | Ga0495636_0200176 | Ga0495636_0200176_88_870 | 249 |
| 51 | 3300049572 | Ga0501036_0214582 | Ga0501036_0214582_236_1039 | 249 |
| 52 | 3300005549 | Ga0070704_100526315 | Ga0070704_1005263151 | 250 |
| 53 | 3300042876 | Ga0451577_0281251 | Ga0451577_0281251_142_939 | 250 |
| 54 | 3300044673 | Ga0453683_0012589 | Ga0453683_0012589_1996_2793 | 250 |
| 55 | 3300044712 | Ga0453684_0061368 | Ga0453684_0061368_1919_2716 | 250 |
| 56 | 3300046524 | Ga0495648_0083089 | Ga0495648_0083089_350_1249 | 250 |
| 57 | 3300046529 | Ga0495652_0037069 | Ga0495652_0037069_2630_3529 | 250 |
| 58 | 3300046559 | Ga0495667_0163575 | Ga0495667_0163575_196_1119 | 251 |
| 59 | 3300047444 | Ga0495675_0064514 | Ga0495675_0064514_1183_2106 | 251 |
| 60 | 3300047471 | Ga0495684_0005926 | Ga0495684_0005926_6681_7604 | 251 |
| 61 | 3300050515 | nmdc:mga0a205_5859_c1 | nmdc:mga0a205_5859_c1_8071_8829 | 251 |
| 62 | 3300048909 | Ga0496106_0323591 | Ga0496106_0323591_442_1203 | 252 |
| 63 | 3300005445 | Ga0070708_100043141 | Ga0070708_1000431415 | 253 |
| 64 | 3300005467 | Ga0070706_100033419 | Ga0070706_1000334192 | 253 |
| 65 | 3300005535 | Ga0070684_100188390 | Ga0070684_1001883901 | 253 |
| 66 | 3300006353 | Ga0075370_10037869 | Ga0075370_100378692 | 253 |
| 67 | 3300007076 | Ga0075435_100393262 | Ga0075435_1003932622 | 253 |
| 68 | 3300025937 | Ga0207669_10402179 | Ga0207669_104021792 | 253 |
| 69 | 3300026089 | Ga0207648_10336172 | Ga0207648_103361722 | 253 |
| 70 | 3300031456 | Ga0307513_10055014 | Ga0307513_100550144 | 253 |
| 71 | 3300050493 | nmdc:mga0k408_18076_c1 | nmdc:mga0k408_18076_c1_2561_3394 | 253 |
| 72 | 3300005445 | Ga0070708_100020178 | Ga0070708_1000201785 | 254 |
| 73 | 3300005471 | Ga0070698_100701807 | Ga0070698_1007018071 | 254 |
| 74 | 3300006871 | Ga0075434_100332433 | Ga0075434_1003324332 | 254 |
| 75 | 3300006914 | Ga0075436_100023235 | Ga0075436_1000232354 | 254 |
| 76 | 3300007076 | Ga0075435_100056294 | Ga0075435_1000562942 | 254 |
| 77 | 3300009147 | Ga0114129_10178412 | Ga0114129_101784122 | 254 |
| 78 | 3300021384 | Ga0213876_10001998 | Ga0213876_100019989 | 254 |
| 79 | 3300025914 | Ga0207671_10158057 | Ga0207671_101580572 | 254 |
| 80 | 3300039437 | Ga0436365_0240210 | Ga0436365_0240210_14969_15802 | 254 |
| 81 | 3300039437 | Ga0436365_0241740 | Ga0436365_0241740_1207_2040 | 254 |
| 82 | 3300039450 | Ga0436363_1181230 | Ga0436363_1181230_217_1056 | 254 |
| 83 | 3300045049 | Ga0466959_0079291 | Ga0466959_0079291_502_1335 | 254 |
| 84 | 3300050507 | nmdc:mga05p37_204614_c1 | nmdc:mga05p37_204614_c1_621_1460 | 254 |
| 85 | 3300050512 | nmdc:mga0n895_410774_c1 | nmdc:mga0n895_410774_c1_320_1123 | 254 |
| 86 | 3300050513 | nmdc:mga0rr50_34409_c1 | nmdc:mga0rr50_34409_c1_904_1743 | 254 |
| 87 | 3300050514 | nmdc:mga08x19_17961_c1 | nmdc:mga08x19_17961_c1_1623_2462 | 254 |
| 88 | 3300050515 | nmdc:mga0a205_56640_c1 | nmdc:mga0a205_56640_c1_1995_2834 | 254 |
| 89 | 3300053153 | Ga0500616_0002011 | Ga0500616_0002011_6881_7720 | 254 |
| 90 | 3300005434 | Ga0070709_10345064 | Ga0070709_103450641 | 255 |
| 91 | 3300005445 | Ga0070708_100241926 | Ga0070708_1002419262 | 255 |
| 92 | 3300005467 | Ga0070706_100038072 | Ga0070706_1000380724 | 255 |
| 93 | 3300006042 | Ga0075368_10007140 | Ga0075368_100071402 | 255 |
| 94 | 3300006048 | Ga0075363_100055355 | Ga0075363_1000553552 | 255 |
| 95 | 3300006051 | Ga0075364_10043425 | Ga0075364_100434254 | 255 |
| 96 | 3300006175 | Ga0070712_100220017 | Ga0070712_1002200172 | 255 |
| 97 | 3300006178 | Ga0075367_10013796 | Ga0075367_100137962 | 255 |
| 98 | 3300006844 | Ga0075428_100446847 | Ga0075428_1004468472 | 255 |
| 99 | 3300006846 | Ga0075430_100004771 | Ga0075430_1000047712 | 255 |
| 100 | 3300009092 | Ga0105250_10071833 | Ga0105250_100718332 | 255 |
| 101 | 3300025910 | Ga0207684_10013538 | Ga0207684_100135384 | 255 |
| 102 | 3300025922 | Ga0207646_10462444 | Ga0207646_104624442 | 255 |
| 103 | 3300027671 | Ga0209588_1018715 | Ga0209588_10187152 | 255 |
| 104 | 3300031456 | Ga0307513_10046454 | Ga0307513_100464542 | 255 |
| 105 | 3300031548 | Ga0307408_100573360 | Ga0307408_1005733602 | 255 |
| 106 | 3300046454 | Ga0495592_0050267 | Ga0495592_0050267_1668_2534 | 255 |
| 107 | 3300046473 | Ga0495582_0023610 | Ga0495582_0023610_1534_2400 | 255 |
| 108 | 3300046500 | Ga0495596_0053025 | Ga0495596_0053025_21_887 | 255 |
| 109 | 3300046511 | Ga0495608_0113220 | Ga0495608_0113220_365_1231 | 255 |
| 110 | 3300046516 | Ga0495628_0324970 | Ga0495628_0324970_192_1058 | 255 |
| 111 | 3300046520 | Ga0495637_0000699 | Ga0495637_0000699_7898_8767 | 255 |
| 112 | 3300046528 | Ga0495642_0014290 | Ga0495642_0014290_566_1432 | 255 |
| 113 | 3300046530 | Ga0495654_0000014 | Ga0495654_0000014_53285_54154 | 255 |
| 114 | 3300046531 | Ga0495665_0170077 | Ga0495665_0170077_77_943 | 255 |
| 115 | 3300046558 | Ga0495633_0056250 | Ga0495633_0056250_55_894 | 255 |
| 116 | 3300046642 | Ga0495634_0074682 | Ga0495634_0074682_1285_2151 | 255 |
| 117 | 3300046648 | Ga0495611_0063919 | Ga0495611_0063919_784_1650 | 255 |
| 118 | 3300046674 | Ga0495588_0010550 | Ga0495588_0010550_974_1840 | 255 |
| 119 | 3300046678 | Ga0495599_0004148 | Ga0495599_0004148_3490_4356 | 255 |
| 120 | 3300046690 | Ga0495624_0225932 | Ga0495624_0225932_77_943 | 255 |
| 121 | 3300048905 | Ga0496102_0134673 | Ga0496102_0134673_349_1287 | 255 |
| 122 | 3300048907 | Ga0496104_0002505 | Ga0496104_0002505_4883_5821 | 255 |
| 123 | 3300048908 | Ga0496105_0121104 | Ga0496105_0121104_37_975 | 255 |
| 124 | 3300048910 | Ga0496107_0063265 | Ga0496107_0063265_60_998 | 255 |
| 125 | 3300048911 | Ga0496108_0000357 | Ga0496108_0000357_10127_11065 | 255 |
| 126 | 3300048912 | Ga0496109_0002224 | Ga0496109_0002224_11864_12802 | 255 |
| 127 | 3300048913 | Ga0496110_0052971 | Ga0496110_0052971_2168_3106 | 255 |
| 128 | 3300048915 | Ga0496112_0006469 | Ga0496112_0006469_5934_6872 | 255 |
| 129 | 3300048916 | Ga0496113_0259725 | Ga0496113_0259725_266_1204 | 255 |
| 130 | 3300048925 | Ga0496122_0045528 | Ga0496122_0045528_515_1354 | 255 |
| 131 | 3300048926 | Ga0496123_0025593 | Ga0496123_0025593_1376_2215 | 255 |
| 132 | 3300048927 | Ga0496124_0209953 | Ga0496124_0209953_235_1074 | 255 |
| 133 | 3300050491 | nmdc:mga00v17_112900_c1 | nmdc:mga00v17_112900_c1_41_880 | 255 |
| 134 | 3300050509 | nmdc:mga0qj67_933_c1 | nmdc:mga0qj67_933_c1_10320_11159 | 255 |
| 135 | 3300053085 | Ga0495619_0004720 | Ga0495619_0004720_3853_4692 | 255 |
| 136 | 3300001990 | JGI24737J22298_10054951 | JGI24737J22298_100549512 | 256 |
| 137 | 3300001991 | JGI24743J22301_10005012 | JGI24743J22301_100050121 | 256 |
| 138 | 3300002070 | JGI24750J21931_1012785 | JGI24750J21931_10127851 | 256 |
| 139 | 3300002074 | JGI24748J21848_1011408 | JGI24748J21848_10114081 | 256 |
| 140 | 3300002075 | JGI24738J21930_10035652 | JGI24738J21930_100356521 | 256 |
| 141 | 3300002077 | JGI24744J21845_10033281 | JGI24744J21845_100332811 | 256 |
| 142 | 3300002239 | JGI24034J26672_10028956 | JGI24034J26672_100289561 | 256 |
| 143 | 3300002459 | JGI24751J29686_10016259 | JGI24751J29686_100162591 | 256 |
| 144 | 3300005328 | Ga0070676_10125841 | Ga0070676_101258412 | 256 |
| 145 | 3300005331 | Ga0070670_100026578 | Ga0070670_1000265781 | 256 |
| 146 | 3300005334 | Ga0068869_100334238 | Ga0068869_1003342381 | 256 |
| 147 | 3300005339 | Ga0070660_100133685 | Ga0070660_1001336852 | 256 |
| 148 | 3300005340 | Ga0070689_100138815 | Ga0070689_1001388152 | 256 |
| 149 | 3300005341 | Ga0070691_10208285 | Ga0070691_102082851 | 256 |
| 150 | 3300005343 | Ga0070687_100101196 | Ga0070687_1001011962 | 256 |
| 151 | 3300005344 | Ga0070661_100129753 | Ga0070661_1001297532 | 256 |
| 152 | 3300005345 | Ga0070692_10119169 | Ga0070692_101191692 | 256 |
| 153 | 3300005347 | Ga0070668_100121847 | Ga0070668_1001218472 | 256 |
| 154 | 3300005354 | Ga0070675_100122468 | Ga0070675_1001224682 | 256 |
| 155 | 3300005355 | Ga0070671_100075919 | Ga0070671_1000759192 | 256 |
| 156 | 3300005356 | Ga0070674_100232129 | Ga0070674_1002321292 | 256 |
| 157 | 3300005364 | Ga0070673_100177483 | Ga0070673_1001774832 | 256 |
| 158 | 3300005367 | Ga0070667_100057841 | Ga0070667_1000578412 | 256 |
| 159 | 3300005434 | Ga0070709_10171549 | Ga0070709_101715492 | 256 |
| 160 | 3300005435 | Ga0070714_100023153 | Ga0070714_1000231532 | 256 |
| 161 | 3300005436 | Ga0070713_100003091 | Ga0070713_10000309110 | 256 |
| 162 | 3300005436 | Ga0070713_100132397 | Ga0070713_1001323972 | 256 |
| 163 | 3300005437 | Ga0070710_10255753 | Ga0070710_102557531 | 256 |
| 164 | 3300005440 | Ga0070705_100069391 | Ga0070705_1000693912 | 256 |
| 165 | 3300005441 | Ga0070700_100038270 | Ga0070700_1000382702 | 256 |
| 166 | 3300005445 | Ga0070708_100006881 | Ga0070708_1000068816 | 256 |
| 167 | 3300005455 | Ga0070663_100199585 | Ga0070663_1001995852 | 256 |
| 168 | 3300005457 | Ga0070662_100154396 | Ga0070662_1001543962 | 256 |
| 169 | 3300005459 | Ga0068867_100342847 | Ga0068867_1003428471 | 256 |
| 170 | 3300005468 | Ga0070707_100335690 | Ga0070707_1003356902 | 256 |
| 171 | 3300005471 | Ga0070698_100010988 | Ga0070698_1000109886 | 256 |
| 172 | 3300005518 | Ga0070699_100001365 | Ga0070699_10000136517 | 256 |
| 173 | 3300005535 | Ga0070684_100090112 | Ga0070684_1000901122 | 256 |
| 174 | 3300005536 | Ga0070697_100120397 | Ga0070697_1001203972 | 256 |
| 175 | 3300005536 | Ga0070697_100157509 | Ga0070697_1001575091 | 256 |
| 176 | 3300005543 | Ga0070672_100484313 | Ga0070672_1004843131 | 256 |
| 177 | 3300005544 | Ga0070686_100136507 | Ga0070686_1001365072 | 256 |
| 178 | 3300005564 | Ga0070664_100426367 | Ga0070664_1004263671 | 256 |
| 179 | 3300005617 | Ga0068859_100447057 | Ga0068859_1004470571 | 256 |
| 180 | 3300005618 | Ga0068864_100084285 | Ga0068864_1000842852 | 256 |
| 181 | 3300005718 | Ga0068866_10144321 | Ga0068866_101443212 | 256 |
| 182 | 3300005719 | Ga0068861_100322672 | Ga0068861_1003226722 | 256 |
| 183 | 3300005840 | Ga0068870_10006935 | Ga0068870_100069352 | 256 |
| 184 | 3300005842 | Ga0068858_100419515 | Ga0068858_1004195152 | 256 |
| 185 | 3300005842 | Ga0068858_100461051 | Ga0068858_1004610511 | 256 |
| 186 | 3300005843 | Ga0068860_100002390 | Ga0068860_1000023903 | 256 |
| 187 | 3300005843 | Ga0068860_100075903 | Ga0068860_1000759032 | 256 |
| 188 | 3300005844 | Ga0068862_100491316 | Ga0068862_1004913162 | 256 |
| 189 | 3300005983 | Ga0081540_1002554 | Ga0081540_100255414 | 256 |
| 190 | 3300005983 | Ga0081540_1129797 | Ga0081540_11297972 | 256 |
| 191 | 3300006028 | Ga0070717_10006636 | Ga0070717_100066362 | 256 |
| 192 | 3300006028 | Ga0070717_10058752 | Ga0070717_100587522 | 256 |
| 193 | 3300006028 | Ga0070717_10375862 | Ga0070717_103758621 | 256 |
| 194 | 3300006175 | Ga0070712_100006978 | Ga0070712_1000069786 | 256 |
| 195 | 3300006358 | Ga0068871_100161239 | Ga0068871_1001612392 | 256 |
| 196 | 3300006881 | Ga0068865_100172049 | Ga0068865_1001720492 | 256 |
| 197 | 3300006931 | Ga0097620_100447029 | Ga0097620_1004470292 | 256 |
| 198 | 3300007788 | Ga0099795_10075004 | Ga0099795_100750042 | 256 |
| 199 | 3300009094 | Ga0111539_10627459 | Ga0111539_106274592 | 256 |
| 200 | 3300009101 | Ga0105247_10166020 | Ga0105247_101660202 | 256 |
| 201 | 3300009553 | Ga0105249_10288273 | Ga0105249_102882732 | 256 |
| 202 | 3300010159 | Ga0099796_10006609 | Ga0099796_100066092 | 256 |
| 203 | 3300010375 | Ga0105239_10044826 | Ga0105239_100448263 | 256 |
| 204 | 3300010375 | Ga0105239_10507958 | Ga0105239_105079582 | 256 |
| 205 | 3300011119 | Ga0105246_10271216 | Ga0105246_102712161 | 256 |
| 206 | 3300013102 | Ga0157371_10191767 | Ga0157371_101917672 | 256 |
| 207 | 3300013296 | Ga0157374_10355775 | Ga0157374_103557752 | 256 |
| 208 | 3300013297 | Ga0157378_10079320 | Ga0157378_100793202 | 256 |
| 209 | 3300014325 | Ga0163163_10172747 | Ga0163163_101727472 | 256 |
| 210 | 3300014326 | Ga0157380_10149951 | Ga0157380_101499512 | 256 |
| 211 | 3300014968 | Ga0157379_10243495 | Ga0157379_102434952 | 256 |
| 212 | 3300014969 | Ga0157376_10286530 | Ga0157376_102865302 | 256 |
| 213 | 3300017792 | Ga0163161_10019750 | Ga0163161_100197504 | 256 |
| 214 | 3300021377 | Ga0213874_10009406 | Ga0213874_100094062 | 256 |
| 215 | 3300021384 | Ga0213876_10193987 | Ga0213876_101939871 | 256 |
| 216 | 3300021441 | Ga0213871_10012528 | Ga0213871_100125283 | 256 |
| 217 | 3300025253 | Ga0209677_102281 | Ga0209677_1022813 | 256 |
| 218 | 3300025261 | Ga0209233_1004907 | Ga0209233_10049072 | 256 |
| 219 | 3300025261 | Ga0209233_1005718 | Ga0209233_10057184 | 256 |
| 220 | 3300025272 | Ga0209455_1007559 | Ga0209455_10075594 | 256 |
| 221 | 3300025900 | Ga0207710_10018129 | Ga0207710_100181293 | 256 |
| 222 | 3300025900 | Ga0207710_10018417 | Ga0207710_100184173 | 256 |
| 223 | 3300025901 | Ga0207688_10010399 | Ga0207688_100103993 | 256 |
| 224 | 3300025903 | Ga0207680_10045750 | Ga0207680_100457502 | 256 |
| 225 | 3300025904 | Ga0207647_10035209 | Ga0207647_100352093 | 256 |
| 226 | 3300025905 | Ga0207685_10045335 | Ga0207685_100453352 | 256 |
| 227 | 3300025908 | Ga0207643_10000418 | Ga0207643_1000041821 | 256 |
| 228 | 3300025910 | Ga0207684_10171532 | Ga0207684_101715321 | 256 |
| 229 | 3300025914 | Ga0207671_10326993 | Ga0207671_103269931 | 256 |
| 230 | 3300025915 | Ga0207693_10024719 | Ga0207693_100247196 | 256 |
| 231 | 3300025915 | Ga0207693_10056935 | Ga0207693_100569352 | 256 |
| 232 | 3300025918 | Ga0207662_10097728 | Ga0207662_100977282 | 256 |
| 233 | 3300025919 | Ga0207657_10012700 | Ga0207657_100127004 | 256 |
| 234 | 3300025923 | Ga0207681_10040181 | Ga0207681_100401812 | 256 |
| 235 | 3300025925 | Ga0207650_10425564 | Ga0207650_104255641 | 256 |
| 236 | 3300025926 | Ga0207659_10342115 | Ga0207659_103421151 | 256 |
| 237 | 3300025928 | Ga0207700_10006688 | Ga0207700_100066887 | 256 |
| 238 | 3300025928 | Ga0207700_10032460 | Ga0207700_100324603 | 256 |
| 239 | 3300025931 | Ga0207644_10041902 | Ga0207644_100419022 | 256 |
| 240 | 3300025933 | Ga0207706_10014998 | Ga0207706_100149985 | 256 |
| 241 | 3300025934 | Ga0207686_10213919 | Ga0207686_102139192 | 256 |
| 242 | 3300025940 | Ga0207691_10145082 | Ga0207691_101450821 | 256 |
| 243 | 3300025941 | Ga0207711_10111330 | Ga0207711_101113302 | 256 |
| 244 | 3300025961 | Ga0207712_10251495 | Ga0207712_102514952 | 256 |
| 245 | 3300025972 | Ga0207668_10194433 | Ga0207668_101944332 | 256 |
| 246 | 3300026023 | Ga0207677_10115036 | Ga0207677_101150362 | 256 |
| 247 | 3300026035 | Ga0207703_10159359 | Ga0207703_101593592 | 256 |
| 248 | 3300026035 | Ga0207703_10169795 | Ga0207703_101697951 | 256 |
| 249 | 3300026075 | Ga0207708_10002881 | Ga0207708_1000288110 | 256 |
| 250 | 3300026088 | Ga0207641_10314925 | Ga0207641_103149252 | 256 |
| 251 | 3300026089 | Ga0207648_10009796 | Ga0207648_100097965 | 256 |
| 252 | 3300026118 | Ga0207675_100042588 | Ga0207675_1000425883 | 256 |
| 253 | 3300026121 | Ga0207683_10014258 | Ga0207683_100142584 | 256 |
| 254 | 3300027907 | Ga0207428_10290463 | Ga0207428_102904631 | 256 |
| 255 | 3300028380 | Ga0268265_10067166 | Ga0268265_100671662 | 256 |
| 256 | 3300028381 | Ga0268264_10000035 | Ga0268264_1000003527 | 256 |
| 257 | 3300028558 | Ga0265326_10002505 | Ga0265326_100025059 | 256 |
| 258 | 3300028563 | Ga0265319_1001186 | Ga0265319_10011865 | 256 |
| 259 | 3300028573 | Ga0265334_10004555 | Ga0265334_100045554 | 256 |
| 260 | 3300028577 | Ga0265318_10002315 | Ga0265318_100023159 | 256 |
| 261 | 3300028653 | Ga0265323_10000768 | Ga0265323_1000076810 | 256 |
| 262 | 3300028654 | Ga0265322_10003636 | Ga0265322_100036364 | 256 |
| 263 | 3300028666 | Ga0265336_10000106 | Ga0265336_1000010620 | 256 |
| 264 | 3300028800 | Ga0265338_10000065 | Ga0265338_10000065111 | 256 |
| 265 | 3300029957 | Ga0265324_10001808 | Ga0265324_1000180810 | 256 |
| 266 | 3300031235 | Ga0265330_10013442 | Ga0265330_100134423 | 256 |
| 267 | 3300031249 | Ga0265339_10021009 | Ga0265339_100210093 | 256 |
| 268 | 3300031507 | Ga0307509_10029697 | Ga0307509_100296973 | 256 |
| 269 | 3300031507 | Ga0307509_10129637 | Ga0307509_101296372 | 256 |
| 270 | 3300031616 | Ga0307508_10000090 | Ga0307508_1000009082 | 256 |
| 271 | 3300031616 | Ga0307508_10178022 | Ga0307508_101780221 | 256 |
| 272 | 3300031711 | Ga0265314_10158224 | Ga0265314_101582242 | 256 |
| 273 | 3300033180 | Ga0307510_10019318 | Ga0307510_100193184 | 256 |
| 274 | 3300033545 | Ga0316214_1011677 | Ga0316214_10116772 | 256 |
| 275 | 3300035111 | Ga0373923_0003802 | Ga0373923_0003802_4000_4839 | 256 |
| 276 | 3300035117 | Ga0373953_0058916 | Ga0373953_0058916_103_942 | 256 |
| 277 | 3300035118 | Ga0373954_0010242 | Ga0373954_0010242_2627_3466 | 256 |
| 278 | 3300035118 | Ga0373954_0101884 | Ga0373954_0101884_186_1025 | 256 |
| 279 | 3300035119 | Ga0373956_0012445 | Ga0373956_0012445_1530_2369 | 256 |
| 280 | 3300035120 | Ga0373957_0000746 | Ga0373957_0000746_1080_1919 | 256 |
| 281 | 3300035171 | Ga0373946_0222052 | Ga0373946_0222052_31_870 | 256 |
| 282 | 3300035172 | Ga0373955_0000360 | Ga0373955_0000360_1496_2335 | 256 |
| 283 | 3300035172 | Ga0373955_0039759 | Ga0373955_0039759_1516_2355 | 256 |
| 284 | 3300035692 | Ga0373935_0002949 | Ga0373935_0002949_4465_5304 | 256 |
| 285 | 3300035695 | Ga0373927_0000950 | Ga0373927_0000950_11325_12164 | 256 |
| 286 | 3300035724 | Ga0373933_0003920 | Ga0373933_0003920_6780_7619 | 256 |
| 287 | 3300036401 | Ga0373937_0008436 | Ga0373937_0008436_463_1302 | 256 |
| 288 | 3300036401 | Ga0373937_0031959 | Ga0373937_0031959_397_1236 | 256 |
| 289 | 3300036459 | Ga0372808_002242 | Ga0372808_002242_1243_2082 | 256 |
| 290 | 3300037068 | Ga0373925_0002196 | Ga0373925_0002196_13583_14422 | 256 |
| 291 | 3300037068 | Ga0373925_0030229 | Ga0373925_0030229_1643_2482 | 256 |
| 292 | 3300039438 | Ga0436360_0598803 | Ga0436360_0598803_316_1155 | 256 |
| 293 | 3300039438 | Ga0436360_0638294 | Ga0436360_0638294_136_975 | 256 |
| 294 | 3300039447 | Ga0436361_0356069 | Ga0436361_0356069_1726_2565 | 256 |
| 295 | 3300039450 | Ga0436363_0771056 | Ga0436363_0771056_845_1684 | 256 |
| 296 | 3300039453 | Ga0436362_0365725 | Ga0436362_0365725_463_1302 | 256 |
| 297 | 3300046453 | Ga0495627_000004 | Ga0495627_000004_253289_254140 | 256 |
| 298 | 3300046454 | Ga0495592_0009069 | Ga0495592_0009069_4971_5810 | 256 |
| 299 | 3300046455 | Ga0495603_0000200 | Ga0495603_0000200_16479_17318 | 256 |
| 300 | 3300046455 | Ga0495603_0004845 | Ga0495603_0004845_5091_5930 | 256 |
| 301 | 3300046455 | Ga0495603_0013905 | Ga0495603_0013905_1623_2462 | 256 |
| 302 | 3300046457 | Ga0495590_0000149 | Ga0495590_0000149_36414_37337 | 256 |
| 303 | 3300046459 | Ga0495629_0002535 | Ga0495629_0002535_1988_2827 | 256 |
| 304 | 3300046461 | Ga0495641_0008896 | Ga0495641_0008896_3443_4282 | 256 |
| 305 | 3300046462 | Ga0495651_0050887 | Ga0495651_0050887_766_1605 | 256 |
| 306 | 3300046463 | Ga0495653_0001070 | Ga0495653_0001070_10816_11655 | 256 |
| 307 | 3300046463 | Ga0495653_0229745 | Ga0495653_0229745_107_946 | 256 |
| 308 | 3300046471 | Ga0495650_0014057 | Ga0495650_0014057_3240_4163 | 256 |
| 309 | 3300046472 | Ga0495580_0002104 | Ga0495580_0002104_16539_17378 | 256 |
| 310 | 3300046473 | Ga0495582_0000354 | Ga0495582_0000354_2478_3317 | 256 |
| 311 | 3300046474 | Ga0495605_0002509 | Ga0495605_0002509_6927_7850 | 256 |
| 312 | 3300046475 | Ga0495639_0004987 | Ga0495639_0004987_1381_2220 | 256 |
| 313 | 3300046476 | Ga0495662_0001324 | Ga0495662_0001324_1543_2382 | 256 |
| 314 | 3300046477 | Ga0495664_0177127 | Ga0495664_0177127_323_1162 | 256 |
| 315 | 3300046492 | Ga0495585_0067849 | Ga0495585_0067849_19_858 | 256 |
| 316 | 3300046499 | Ga0495594_0001396 | Ga0495594_0001396_11407_12246 | 256 |
| 317 | 3300046499 | Ga0495594_0104651 | Ga0495594_0104651_704_1543 | 256 |
| 318 | 3300046501 | Ga0495607_0022482 | Ga0495607_0022482_3080_3919 | 256 |
| 319 | 3300046506 | Ga0495583_0000370 | Ga0495583_0000370_48986_49909 | 256 |
| 320 | 3300046507 | Ga0495606_0008571 | Ga0495606_0008571_5103_6026 | 256 |
| 321 | 3300046511 | Ga0495608_0000832 | Ga0495608_0000832_5290_6129 | 256 |
| 322 | 3300046514 | Ga0495618_0019644 | Ga0495618_0019644_2269_3108 | 256 |
| 323 | 3300046514 | Ga0495618_0194174 | Ga0495618_0194174_363_1202 | 256 |
| 324 | 3300046515 | Ga0495620_0012060 | Ga0495620_0012060_2130_3053 | 256 |
| 325 | 3300046516 | Ga0495628_0080064 | Ga0495628_0080064_897_1736 | 256 |
| 326 | 3300046516 | Ga0495628_0187155 | Ga0495628_0187155_232_1071 | 256 |
| 327 | 3300046517 | Ga0495630_0030591 | Ga0495630_0030591_186_1025 | 256 |
| 328 | 3300046524 | Ga0495648_0000723 | Ga0495648_0000723_776_1699 | 256 |
| 329 | 3300046524 | Ga0495648_0008413 | Ga0495648_0008413_5490_6329 | 256 |
| 330 | 3300046529 | Ga0495652_0023871 | Ga0495652_0023871_2563_3402 | 256 |
| 331 | 3300046529 | Ga0495652_0388360 | Ga0495652_0388360_58_897 | 256 |
| 332 | 3300046531 | Ga0495665_0002572 | Ga0495665_0002572_5289_6128 | 256 |
| 333 | 3300046533 | Ga0495640_0002001 | Ga0495640_0002001_15156_15995 | 256 |
| 334 | 3300046533 | Ga0495640_0153547 | Ga0495640_0153547_577_1416 | 256 |
| 335 | 3300046536 | Ga0495587_0014270 | Ga0495587_0014270_1627_2466 | 256 |
| 336 | 3300046543 | Ga0495645_0025205 | Ga0495645_0025205_1046_1885 | 256 |
| 337 | 3300046559 | Ga0495667_0003082 | Ga0495667_0003082_8306_9145 | 256 |
| 338 | 3300046616 | Ga0495668_0174159 | Ga0495668_0174159_191_1030 | 256 |
| 339 | 3300046642 | Ga0495634_0003609 | Ga0495634_0003609_9764_10603 | 256 |
| 340 | 3300046642 | Ga0495634_0006837 | Ga0495634_0006837_1503_2342 | 256 |
| 341 | 3300046663 | Ga0495635_0001348 | Ga0495635_0001348_3738_4577 | 256 |
| 342 | 3300046663 | Ga0495635_0001667 | Ga0495635_0001667_11939_12778 | 256 |
| 343 | 3300046665 | Ga0495661_0079084 | Ga0495661_0079084_279_1118 | 256 |
| 344 | 3300046675 | Ga0495657_0033520 | Ga0495657_0033520_697_1536 | 256 |
| 345 | 3300046678 | Ga0495599_0006501 | Ga0495599_0006501_5751_6590 | 256 |
| 346 | 3300046680 | Ga0495646_0010792 | Ga0495646_0010792_2476_3315 | 256 |
| 347 | 3300046683 | Ga0495658_0006057 | Ga0495658_0006057_3649_4488 | 256 |
| 348 | 3300046689 | Ga0495613_0031324 | Ga0495613_0031324_1675_2514 | 256 |
| 349 | 3300046689 | Ga0495613_0041413 | Ga0495613_0041413_1044_1883 | 256 |
| 350 | 3300046690 | Ga0495624_0002275 | Ga0495624_0002275_12098_12937 | 256 |
| 351 | 3300046694 | Ga0495649_0000149 | Ga0495649_0000149_58581_59504 | 256 |
| 352 | 3300046809 | Ga0495600_0044768 | Ga0495600_0044768_2015_2854 | 256 |
| 353 | 3300047315 | Ga0495581_0000851 | Ga0495581_0000851_10938_11777 | 256 |
| 354 | 3300047317 | Ga0495604_0009053 | Ga0495604_0009053_6789_7628 | 256 |
| 355 | 3300047319 | Ga0495674_0000559 | Ga0495674_0000559_11746_12585 | 256 |
| 356 | 3300047320 | Ga0495672_0007744 | Ga0495672_0007744_4596_5519 | 256 |
| 357 | 3300047322 | Ga0495680_0036826 | Ga0495680_0036826_495_1334 | 256 |
| 358 | 3300047323 | Ga0495683_0007187 | Ga0495683_0007187_1754_2677 | 256 |
| 359 | 3300047444 | Ga0495675_0024047 | Ga0495675_0024047_2580_3419 | 256 |
| 360 | 3300047446 | Ga0495679_000392 | Ga0495679_000392_14_937 | 256 |
| 361 | 3300047469 | Ga0495673_0000362 | Ga0495673_0000362_22965_23888 | 256 |
| 362 | 3300047471 | Ga0495684_0005198 | Ga0495684_0005198_2039_2878 | 256 |
| 363 | 3300047471 | Ga0495684_0032943 | Ga0495684_0032943_1584_2423 | 256 |
| 364 | 3300047673 | Ga0495593_0000606 | Ga0495593_0000606_16516_17355 | 256 |
| 365 | 3300047673 | Ga0495593_0000953 | Ga0495593_0000953_5995_6834 | 256 |
| 366 | 3300048088 | Ga0495602_0077050 | Ga0495602_0077050_1287_2126 | 256 |
| 367 | 3300048089 | Ga0495614_0011184 | Ga0495614_0011184_2852_3691 | 256 |
| 368 | 3300048091 | Ga0495626_0024671 | Ga0495626_0024671_223_1146 | 256 |
| 369 | 3300048903 | Ga0496100_0047368 | Ga0496100_0047368_437_1276 | 256 |
| 370 | 3300048904 | Ga0496101_0170130 | Ga0496101_0170130_549_1388 | 256 |
| 371 | 3300048905 | Ga0496102_0223441 | Ga0496102_0223441_469_1308 | 256 |
| 372 | 3300048906 | Ga0496103_0020222 | Ga0496103_0020222_1511_2350 | 256 |
| 373 | 3300048909 | Ga0496106_0262661 | Ga0496106_0262661_45_884 | 256 |
| 374 | 3300048911 | Ga0496108_0232373 | Ga0496108_0232373_596_1435 | 256 |
| 375 | 3300048912 | Ga0496109_0059771 | Ga0496109_0059771_1459_2298 | 256 |
| 376 | 3300048913 | Ga0496110_0039631 | Ga0496110_0039631_1858_2739 | 256 |
| 377 | 3300048913 | Ga0496110_0333239 | Ga0496110_0333239_218_1057 | 256 |
| 378 | 3300048915 | Ga0496112_0034574 | Ga0496112_0034574_1613_2452 | 256 |
| 379 | 3300048915 | Ga0496112_0191885 | Ga0496112_0191885_222_1061 | 256 |
| 380 | 3300048916 | Ga0496113_0174795 | Ga0496113_0174795_400_1239 | 256 |
| 381 | 3300048917 | Ga0496114_0070632 | Ga0496114_0070632_452_1291 | 256 |
| 382 | 3300048918 | Ga0496115_0132487 | Ga0496115_0132487_156_995 | 256 |
| 383 | 3300048918 | Ga0496115_0174778 | Ga0496115_0174778_269_1108 | 256 |
| 384 | 3300048918 | Ga0496115_0212767 | Ga0496115_0212767_434_1273 | 256 |
| 385 | 3300048920 | Ga0496117_0098322 | Ga0496117_0098322_870_1709 | 256 |
| 386 | 3300048921 | Ga0496118_0013843 | Ga0496118_0013843_3581_4420 | 256 |
| 387 | 3300048921 | Ga0496118_0022793 | Ga0496118_0022793_4428_5267 | 256 |
| 388 | 3300048924 | Ga0496121_0034449 | Ga0496121_0034449_3295_4134 | 256 |
| 389 | 3300048924 | Ga0496121_0072366 | Ga0496121_0072366_59_898 | 256 |
| 390 | 3300048927 | Ga0496124_0078167 | Ga0496124_0078167_1007_1846 | 256 |
| 391 | 3300048927 | Ga0496124_0085247 | Ga0496124_0085247_1313_2164 | 256 |
| 392 | 3300048929 | Ga0496126_0018230 | Ga0496126_0018230_3325_4164 | 256 |
| 393 | 3300049459 | Ga0495678_021406 | Ga0495678_021406_1133_2056 | 256 |
| 394 | 3300049460 | Ga0495682_0000605 | Ga0495682_0000605_3244_4167 | 256 |
| 395 | 3300050491 | nmdc:mga00v17_210178_c1 | nmdc:mga00v17_210178_c1_404_1243 | 256 |
| 396 | 3300050511 | nmdc:mga08y16_620076_c1 | nmdc:mga08y16_620076_c1_85_924 | 256 |
| 397 | 3300053077 | Ga0495601_0036750 | Ga0495601_0036750_1640_2479 | 256 |
| 398 | 3300053077 | Ga0495601_0087522 | Ga0495601_0087522_143_982 | 256 |
| 399 | 3300053080 | Ga0500635_0008589 | Ga0500635_0008589_1452_2291 | 256 |
| 400 | 3300053084 | Ga0495595_0000696 | Ga0495595_0000696_2459_3298 | 256 |
| 401 | 3300053085 | Ga0495619_0000966 | Ga0495619_0000966_10817_11656 | 256 |
| 402 | 3300053091 | Ga0500647_0156860 | Ga0500647_0156860_19_858 | 256 |
| 403 | 3300053094 | Ga0500566_0057431 | Ga0500566_0057431_1126_1965 | 256 |
| 404 | 3300053102 | Ga0500554_002430 | Ga0500554_002430_991_1830 | 256 |
| 405 | 3300053111 | Ga0500572_001849 | Ga0500572_001849_150_989 | 256 |
| 406 | 3300053123 | Ga0500614_052167 | Ga0500614_052167_45_932 | 256 |
| 407 | 3300053136 | Ga0500559_0020926 | Ga0500559_0020926_1846_2685 | 256 |
| 408 | 3300053159 | Ga0500630_000815 | Ga0500630_000815_123_1010 | 256 |
| 409 | 3300053163 | Ga0500639_000221 | Ga0500639_000221_27287_28174 | 256 |
| 410 | 3300053177 | Ga0500636_0030709 | Ga0500636_0030709_2292_3131 | 256 |
| 411 | 3300053178 | Ga0500637_0057330 | Ga0500637_0057330_707_1546 | 256 |
| 412 | 3300005445 | Ga0070708_100014186 | Ga0070708_1000141865 | 257 |
| 413 | 3300005468 | Ga0070707_100005430 | Ga0070707_1000054308 | 257 |
| 414 | 3300005468 | Ga0070707_100250116 | Ga0070707_1002501161 | 257 |
| 415 | 3300005471 | Ga0070698_100007110 | Ga0070698_1000071107 | 257 |
| 416 | 3300005518 | Ga0070699_100002979 | Ga0070699_1000029796 | 257 |
| 417 | 3300005518 | Ga0070699_100031502 | Ga0070699_1000315022 | 257 |
| 418 | 3300005536 | Ga0070697_100006480 | Ga0070697_1000064803 | 257 |
| 419 | 3300005546 | Ga0070696_100026289 | Ga0070696_1000262892 | 257 |
| 420 | 3300005548 | Ga0070665_100289452 | Ga0070665_1002894521 | 257 |
| 421 | 3300005937 | Ga0081455_10028316 | Ga0081455_100283162 | 257 |
| 422 | 3300005983 | Ga0081540_1002649 | Ga0081540_10026499 | 257 |
| 423 | 3300005983 | Ga0081540_1013996 | Ga0081540_10139962 | 257 |
| 424 | 3300005985 | Ga0081539_10063382 | Ga0081539_100633823 | 257 |
| 425 | 3300005985 | Ga0081539_10180159 | Ga0081539_101801591 | 257 |
| 426 | 3300006042 | Ga0075368_10085139 | Ga0075368_100851392 | 257 |
| 427 | 3300006048 | Ga0075363_100083253 | Ga0075363_1000832532 | 257 |
| 428 | 3300006844 | Ga0075428_100005548 | Ga0075428_10000554812 | 257 |
| 429 | 3300006844 | Ga0075428_100022110 | Ga0075428_1000221105 | 257 |
| 430 | 3300006846 | Ga0075430_100208635 | Ga0075430_1002086351 | 257 |
| 431 | 3300006847 | Ga0075431_100006070 | Ga0075431_1000060707 | 257 |
| 432 | 3300006847 | Ga0075431_100042861 | Ga0075431_1000428613 | 257 |
| 433 | 3300006852 | Ga0075433_10000090 | Ga0075433_1000009012 | 257 |
| 434 | 3300006852 | Ga0075433_10028948 | Ga0075433_100289487 | 257 |
| 435 | 3300006852 | Ga0075433_10076167 | Ga0075433_100761674 | 257 |
| 436 | 3300006852 | Ga0075433_10242297 | Ga0075433_102422972 | 257 |
| 437 | 3300006871 | Ga0075434_100011879 | Ga0075434_1000118798 | 257 |
| 438 | 3300006871 | Ga0075434_100014750 | Ga0075434_1000147508 | 257 |
| 439 | 3300006871 | Ga0075434_100402486 | Ga0075434_1004024862 | 257 |
| 440 | 3300006914 | Ga0075436_100000168 | Ga0075436_10000016828 | 257 |
| 441 | 3300006914 | Ga0075436_100012546 | Ga0075436_1000125464 | 257 |
| 442 | 3300006914 | Ga0075436_100125932 | Ga0075436_1001259322 | 257 |
| 443 | 3300007076 | Ga0075435_100007665 | Ga0075435_1000076654 | 257 |
| 444 | 3300007076 | Ga0075435_100046354 | Ga0075435_1000463544 | 257 |
| 445 | 3300007076 | Ga0075435_100048805 | Ga0075435_1000488055 | 257 |
| 446 | 3300009094 | Ga0111539_10073832 | Ga0111539_100738325 | 257 |
| 447 | 3300009147 | Ga0114129_10000881 | Ga0114129_1000088122 | 257 |
| 448 | 3300009147 | Ga0114129_10002331 | Ga0114129_100023312 | 257 |
| 449 | 3300009147 | Ga0114129_10015357 | Ga0114129_100153574 | 257 |
| 450 | 3300009147 | Ga0114129_10022173 | Ga0114129_100221736 | 257 |
| 451 | 3300009147 | Ga0114129_10097656 | Ga0114129_100976562 | 257 |
| 452 | 3300009147 | Ga0114129_10119579 | Ga0114129_101195794 | 257 |
| 453 | 3300009147 | Ga0114129_10286979 | Ga0114129_102869792 | 257 |
| 454 | 3300009147 | Ga0114129_10719075 | Ga0114129_107190752 | 257 |
| 455 | 3300014745 | Ga0157377_10187223 | Ga0157377_101872232 | 257 |
| 456 | 3300025297 | Ga0209758_1073955 | Ga0209758_10739552 | 257 |
| 457 | 3300025910 | Ga0207684_10001444 | Ga0207684_1000144415 | 257 |
| 458 | 3300025910 | Ga0207684_10044620 | Ga0207684_100446203 | 257 |
| 459 | 3300025922 | Ga0207646_10001834 | Ga0207646_100018347 | 257 |
| 460 | 3300025922 | Ga0207646_10013493 | Ga0207646_100134934 | 257 |
| 461 | 3300026088 | Ga0207641_10022737 | Ga0207641_100227375 | 257 |
| 462 | 3300027907 | Ga0207428_10071213 | Ga0207428_100712132 | 257 |
| 463 | 3300028380 | Ga0268265_10186621 | Ga0268265_101866212 | 257 |
| 464 | 3300037418 | Ga0395900_0447224 | Ga0395900_0447224_208_987 | 257 |
| 465 | 3300037466 | Ga0395898_0267108 | Ga0395898_0267108_564_1343 | 257 |
| 466 | 3300037471 | Ga0395905_0143784 | Ga0395905_0143784_195_1034 | 257 |
| 467 | 3300037471 | Ga0395905_0342674 | Ga0395905_0342674_535_1314 | 257 |
| 468 | 3300038443 | Ga0395901_0051193 | Ga0395901_0051193_1618_2457 | 257 |
| 469 | 3300038443 | Ga0395901_0222493 | Ga0395901_0222493_999_1778 | 257 |
| 470 | 3300038742 | Ga0400486_06770 | Ga0400486_06770_1380_2159 | 257 |
| 471 | 3300044673 | Ga0453683_0000252 | Ga0453683_0000252_19879_20688 | 257 |
| 472 | 3300046461 | Ga0495641_0006637 | Ga0495641_0006637_5827_6750 | 257 |
| 473 | 3300046462 | Ga0495651_0095887 | Ga0495651_0095887_987_1910 | 257 |
| 474 | 3300046472 | Ga0495580_0281458 | Ga0495580_0281458_20_943 | 257 |
| 475 | 3300046499 | Ga0495594_0017864 | Ga0495594_0017864_1089_2012 | 257 |
| 476 | 3300046507 | Ga0495606_0002687 | Ga0495606_0002687_17813_18652 | 257 |
| 477 | 3300046514 | Ga0495618_0003243 | Ga0495618_0003243_1036_1959 | 257 |
| 478 | 3300046529 | Ga0495652_0001533 | Ga0495652_0001533_24237_25160 | 257 |
| 479 | 3300046536 | Ga0495587_0005325 | Ga0495587_0005325_6496_7419 | 257 |
| 480 | 3300046543 | Ga0495645_0004058 | Ga0495645_0004058_2139_3062 | 257 |
| 481 | 3300046557 | Ga0495622_0133979 | Ga0495622_0133979_165_1088 | 257 |
| 482 | 3300046663 | Ga0495635_0005872 | Ga0495635_0005872_827_1750 | 257 |
| 483 | 3300046679 | Ga0495623_0015826 | Ga0495623_0015826_1920_2843 | 257 |
| 484 | 3300046809 | Ga0495600_0114324 | Ga0495600_0114324_431_1354 | 257 |
| 485 | 3300047317 | Ga0495604_0008853 | Ga0495604_0008853_6125_7048 | 257 |
| 486 | 3300047322 | Ga0495680_0114428 | Ga0495680_0114428_882_1805 | 257 |
| 487 | 3300047446 | Ga0495679_058673 | Ga0495679_058673_192_1115 | 257 |
| 488 | 3300047470 | Ga0495681_0041281 | Ga0495681_0041281_895_1818 | 257 |
| 489 | 3300048088 | Ga0495602_0317541 | Ga0495602_0317541_20_943 | 257 |
| 490 | 3300048089 | Ga0495614_0016077 | Ga0495614_0016077_192_1115 | 257 |
| 491 | 3300048920 | Ga0496117_0187965 | Ga0496117_0187965_246_1085 | 257 |
| 492 | 3300048924 | Ga0496121_0003460 | Ga0496121_0003460_1759_2598 | 257 |
| 493 | 3300050507 | nmdc:mga05p37_1204_c1 | nmdc:mga05p37_1204_c1_25532_26311 | 257 |
| 494 | 3300050507 | nmdc:mga05p37_413_c1 | nmdc:mga05p37_413_c1_12182_12961 | 257 |
| 495 | 3300050507 | nmdc:mga05p37_47607_c1 | nmdc:mga05p37_47607_c1_2491_3270 | 257 |
| 496 | 3300050507 | nmdc:mga05p37_74309_c1 | nmdc:mga05p37_74309_c1_1458_2237 | 257 |
| 497 | 3300050508 | nmdc:mga09592_33905_c1 | nmdc:mga09592_33905_c1_1860_2639 | 257 |
| 498 | 3300050509 | nmdc:mga0qj67_41611_c1 | nmdc:mga0qj67_41611_c1_1944_2723 | 257 |
| 499 | 3300050511 | nmdc:mga08y16_237415_c1 | nmdc:mga08y16_237415_c1_220_999 | 257 |
| 500 | 3300050512 | nmdc:mga0n895_127_c1 | nmdc:mga0n895_127_c1_30331_31110 | 257 |
| 501 | 3300050512 | nmdc:mga0n895_19327_c1 | nmdc:mga0n895_19327_c1_4811_5590 | 257 |
| 502 | 3300050512 | nmdc:mga0n895_35568_c1 | nmdc:mga0n895_35568_c1_1327_2106 | 257 |
| 503 | 3300050512 | nmdc:mga0n895_523143_c1 | nmdc:mga0n895_523143_c1_64_843 | 257 |
| 504 | 3300050513 | nmdc:mga0rr50_3231_c1 | nmdc:mga0rr50_3231_c1_2355_3134 | 257 |
| 505 | 3300050513 | nmdc:mga0rr50_771_c1 | nmdc:mga0rr50_771_c1_15556_16335 | 257 |
| 506 | 3300050514 | nmdc:mga08x19_258516_c1 | nmdc:mga08x19_258516_c1_175_954 | 257 |
| 507 | 3300050514 | nmdc:mga08x19_59288_c1 | nmdc:mga08x19_59288_c1_915_1694 | 257 |
| 508 | 3300050514 | nmdc:mga08x19_66198_c1 | nmdc:mga08x19_66198_c1_1169_1948 | 257 |
| 509 | 3300050515 | nmdc:mga0a205_433_c1 | nmdc:mga0a205_433_c1_30317_31096 | 257 |
| 510 | 3300050515 | nmdc:mga0a205_50973_c1 | nmdc:mga0a205_50973_c1_1913_2692 | 257 |
| 511 | 3300050515 | nmdc:mga0a205_81202_c1 | nmdc:mga0a205_81202_c1_771_1550 | 257 |
| 512 | 3300050515 | nmdc:mga0a205_99184_c1 | nmdc:mga0a205_99184_c1_187_966 | 257 |
| 513 | 3300053093 | Ga0500651_0019640 | Ga0500651_0019640_885_1724 | 257 |
| 514 | 3300053119 | Ga0500595_009536 | Ga0500595_009536_443_1282 | 257 |
| 515 | 3300053130 | Ga0500642_0058734 | Ga0500642_0058734_212_1054 | 257 |
| 516 | 3300053153 | Ga0500616_0000028 | Ga0500616_0000028_195412_196251 | 257 |
| 517 | 3300003775 | Ga0055524_1023756 | Ga0055524_10237562 | 258 |
| 518 | 3300005434 | Ga0070709_10068701 | Ga0070709_100687012 | 258 |
| 519 | 3300005436 | Ga0070713_100183887 | Ga0070713_1001838872 | 258 |
| 520 | 3300005467 | Ga0070706_100122782 | Ga0070706_1001227823 | 258 |
| 521 | 3300005468 | Ga0070707_100059338 | Ga0070707_1000593382 | 258 |
| 522 | 3300005471 | Ga0070698_100002784 | Ga0070698_10000278414 | 258 |
| 523 | 3300005985 | Ga0081539_10035862 | Ga0081539_100358624 | 258 |
| 524 | 3300007265 | Ga0099794_10061464 | Ga0099794_100614642 | 258 |
| 525 | 3300013308 | Ga0157375_10296547 | Ga0157375_102965471 | 258 |
| 526 | 3300025299 | Ga0209256_1000545 | Ga0209256_100054529 | 258 |
| 527 | 3300025302 | Ga0207426_1006921 | Ga0207426_10069214 | 258 |
| 528 | 3300025910 | Ga0207684_10097598 | Ga0207684_100975982 | 258 |
| 529 | 3300025916 | Ga0207663_10096997 | Ga0207663_100969972 | 258 |
| 530 | 3300025922 | Ga0207646_10068747 | Ga0207646_100687472 | 258 |
| 531 | 3300025937 | Ga0207669_10403072 | Ga0207669_104030722 | 258 |
| 532 | 3300025986 | Ga0207658_10784033 | Ga0207658_107840331 | 258 |
| 533 | 3300026023 | Ga0207677_10214991 | Ga0207677_102149912 | 258 |
| 534 | 3300031241 | Ga0265325_10081996 | Ga0265325_100819962 | 258 |
| 535 | 3300035691 | Ga0373931_0047379 | Ga0373931_0047379_1150_1995 | 258 |
| 536 | 3300037068 | Ga0373925_0163994 | Ga0373925_0163994_638_1483 | 258 |
| 537 | 3300047469 | Ga0495673_0000008 | Ga0495673_0000008_503806_504654 | 258 |
| 538 | 3300050492 | nmdc:mga0yw44_29154_c1 | nmdc:mga0yw44_29154_c1_1237_2091 | 258 |
| 539 | 3300053153 | Ga0500616_0003426 | Ga0500616_0003426_8819_9664 | 258 |
| 540 | 3300053730 | Ga0500645_013729 | Ga0500645_013729_531_1376 | 258 |
| 541 | 3300006844 | Ga0075428_100109308 | Ga0075428_1001093082 | 259 |
| 542 | 3300006847 | Ga0075431_100048829 | Ga0075431_1000488294 | 259 |
| 543 | 3300006852 | Ga0075433_10049015 | Ga0075433_100490154 | 259 |
| 544 | 3300006871 | Ga0075434_100095898 | Ga0075434_1000958981 | 259 |
| 545 | 3300006880 | Ga0075429_100035774 | Ga0075429_1000357744 | 259 |
| 546 | 3300007076 | Ga0075435_100030311 | Ga0075435_1000303114 | 259 |
| 547 | 3300009147 | Ga0114129_10106691 | Ga0114129_101066914 | 259 |
| 548 | 3300050507 | nmdc:mga05p37_60912_c1 | nmdc:mga05p37_60912_c1_1749_2534 | 259 |
| 549 | 3300050508 | nmdc:mga09592_17311_c1 | nmdc:mga09592_17311_c1_3184_3969 | 259 |
| 550 | 3300050510 | nmdc:mga06r32_34997_c1 | nmdc:mga06r32_34997_c1_1878_2663 | 259 |
| 551 | 3300050512 | nmdc:mga0n895_75123_c1 | nmdc:mga0n895_75123_c1_47_832 | 259 |
| 552 | 3300050513 | nmdc:mga0rr50_22233_c1 | nmdc:mga0rr50_22233_c1_1710_2495 | 259 |
| 553 | 3300050515 | nmdc:mga0a205_65115_c1 | nmdc:mga0a205_65115_c1_527_1312 | 259 |
| 554 | 3300005440 | Ga0070705_100211819 | Ga0070705_1002118192 | 260 |
| 555 | 3300005467 | Ga0070706_100225125 | Ga0070706_1002251252 | 260 |
| 556 | 3300005518 | Ga0070699_100586436 | Ga0070699_1005864361 | 260 |
| 557 | 3300006852 | Ga0075433_10003084 | Ga0075433_1000308413 | 260 |
| 558 | 3300006871 | Ga0075434_100040652 | Ga0075434_1000406523 | 260 |
| 559 | 3300006914 | Ga0075436_100009932 | Ga0075436_1000099328 | 260 |
| 560 | 3300025910 | Ga0207684_10177590 | Ga0207684_101775902 | 260 |
| 561 | 3300033180 | Ga0307510_10236845 | Ga0307510_102368452 | 260 |
| 562 | 3300046522 | Ga0495643_0056685 | Ga0495643_0056685_94_945 | 260 |
| 563 | 3300046523 | Ga0495644_0016360 | Ga0495644_0016360_1593_2444 | 260 |
| 564 | 3300046538 | Ga0495609_0000650 | Ga0495609_0000650_8935_9786 | 260 |
| 565 | 3300046678 | Ga0495599_0031977 | Ga0495599_0031977_1003_1791 | 260 |
| 566 | 3300048927 | Ga0496124_0024007 | Ga0496124_0024007_3161_4012 | 260 |
| 567 | 3300049459 | Ga0495678_000012 | Ga0495678_000012_331536_332387 | 260 |
| 568 | 3300049571 | Ga0501034_0051746 | Ga0501034_0051746_1185_1973 | 260 |
| 569 | 3300050512 | nmdc:mga0n895_57522_c1 | nmdc:mga0n895_57522_c1_1453_2253 | 260 |
| 570 | 3300050513 | nmdc:mga0rr50_61461_c1 | nmdc:mga0rr50_61461_c1_253_1053 | 260 |
| 571 | 3300050514 | nmdc:mga08x19_16260_c1 | nmdc:mga08x19_16260_c1_218_1018 | 260 |
| 572 | 3300050515 | nmdc:mga0a205_29651_c1 | nmdc:mga0a205_29651_c1_2057_2857 | 260 |
| 573 | 3300053139 | Ga0500568_0020039 | Ga0500568_0020039_1205_2056 | 260 |
| 574 | 3300005335 | Ga0070666_10248901 | Ga0070666_102489011 | 261 |
| 575 | 3300005354 | Ga0070675_100102270 | Ga0070675_1001022703 | 261 |
| 576 | 3300005445 | Ga0070708_100093833 | Ga0070708_1000938332 | 261 |
| 577 | 3300005455 | Ga0070663_100438427 | Ga0070663_1004384272 | 261 |
| 578 | 3300005457 | Ga0070662_100042847 | Ga0070662_1000428472 | 261 |
| 579 | 3300005467 | Ga0070706_100001066 | Ga0070706_1000010662 | 261 |
| 580 | 3300005467 | Ga0070706_100007018 | Ga0070706_1000070186 | 261 |
| 581 | 3300005468 | Ga0070707_100011879 | Ga0070707_1000118796 | 261 |
| 582 | 3300005468 | Ga0070707_100578364 | Ga0070707_1005783641 | 261 |
| 583 | 3300005471 | Ga0070698_100049237 | Ga0070698_1000492375 | 261 |
| 584 | 3300005518 | Ga0070699_100052038 | Ga0070699_1000520383 | 261 |
| 585 | 3300005536 | Ga0070697_100032132 | Ga0070697_1000321322 | 261 |
| 586 | 3300013296 | Ga0157374_10185047 | Ga0157374_101850472 | 261 |
| 587 | 3300025893 | Ga0207682_10001102 | Ga0207682_1000110210 | 261 |
| 588 | 3300025910 | Ga0207684_10008691 | Ga0207684_100086912 | 261 |
| 589 | 3300025922 | Ga0207646_10001349 | Ga0207646_1000134926 | 261 |
| 590 | 3300025922 | Ga0207646_10140521 | Ga0207646_101405212 | 261 |
| 591 | 3300025941 | Ga0207711_10282686 | Ga0207711_102826862 | 261 |
| 592 | 3300026121 | Ga0207683_10017123 | Ga0207683_100171234 | 261 |
| 593 | 3300044712 | Ga0453684_0049519 | Ga0453684_0049519_991_1857 | 261 |
| 594 | 3300005331 | Ga0070670_100096223 | Ga0070670_1000962232 | 262 |
| 595 | 3300005347 | Ga0070668_100411367 | Ga0070668_1004113671 | 262 |
| 596 | 3300005467 | Ga0070706_100569066 | Ga0070706_1005690662 | 262 |
| 597 | 3300005471 | Ga0070698_100044987 | Ga0070698_1000449872 | 262 |
| 598 | 3300005549 | Ga0070704_100380663 | Ga0070704_1003806631 | 262 |
| 599 | 3300006852 | Ga0075433_10026223 | Ga0075433_100262232 | 262 |
| 600 | 3300006852 | Ga0075433_10293189 | Ga0075433_102931892 | 262 |
| 601 | 3300006871 | Ga0075434_100231935 | Ga0075434_1002319352 | 262 |
| 602 | 3300009177 | Ga0105248_10058098 | Ga0105248_100580984 | 262 |
| 603 | 3300025910 | Ga0207684_10613801 | Ga0207684_106138011 | 262 |
| 604 | 3300025925 | Ga0207650_10166275 | Ga0207650_101662752 | 262 |
| 605 | 3300044658 | Ga0466972_0049275 | Ga0466972_0049275_17_823 | 262 |
| 606 | 3300044901 | Ga0466960_0142187 | Ga0466960_0142187_19_825 | 262 |
| 607 | 3300046471 | Ga0495650_0029154 | Ga0495650_0029154_1203_2069 | 262 |
| 608 | 3300006353 | Ga0075370_10025758 | Ga0075370_100257582 | 263 |
| 609 | 3300007788 | Ga0099795_10012611 | Ga0099795_100126112 | 263 |
| 610 | 3300027512 | Ga0209179_1012786 | Ga0209179_10127862 | 263 |
| 611 | 3300031649 | Ga0307514_10011703 | Ga0307514_100117035 | 263 |
| 612 | 3300033180 | Ga0307510_10033122 | Ga0307510_100331224 | 263 |
| 613 | 3300033180 | Ga0307510_10075429 | Ga0307510_100754294 | 263 |
| 614 | 3300035113 | Ga0373936_0058316 | Ga0373936_0058316_692_1531 | 263 |
| 615 | 3300035410 | Ga0373924_0087304 | Ga0373924_0087304_367_1209 | 263 |
| 616 | 3300035692 | Ga0373935_0012293 | Ga0373935_0012293_75_917 | 263 |
| 617 | 3300037068 | Ga0373925_0172510 | Ga0373925_0172510_39_881 | 263 |
| 618 | 3300046454 | Ga0495592_0000553 | Ga0495592_0000553_16872_17738 | 263 |
| 619 | 3300046472 | Ga0495580_0043472 | Ga0495580_0043472_1982_2785 | 263 |
| 620 | 3300048928 | Ga0496125_0001879 | Ga0496125_0001879_21091_21945 | 263 |
| 621 | 3300049582 | Ga0501048_0163479 | Ga0501048_0163479_76_879 | 263 |
| 622 | 3300049587 | Ga0501071_0028125 | Ga0501071_0028125_1577_2380 | 263 |
| 623 | 3300049588 | Ga0501072_0096552 | Ga0501072_0096552_838_1641 | 263 |
| 624 | 3300049591 | Ga0501075_0006354 | Ga0501075_0006354_1631_2434 | 263 |
| 625 | 3300049592 | Ga0501076_0000981 | Ga0501076_0000981_16552_17355 | 263 |
| 626 | 3300049741 | Ga0501079_0024279 | Ga0501079_0024279_2183_2986 | 263 |
| 627 | 3300049742 | Ga0501080_0095492 | Ga0501080_0095492_1027_1830 | 263 |
| 628 | 3300049743 | Ga0501081_0004564 | Ga0501081_0004564_6423_7226 | 263 |
| 629 | 3300049824 | Ga0501045_0104076 | Ga0501045_0104076_1145_1948 | 263 |
| 630 | 3300050493 | nmdc:mga0k408_42865_c1 | nmdc:mga0k408_42865_c1_1423_2262 | 263 |
| 631 | 3300050496 | nmdc:mga07m45_70372_c1 | nmdc:mga07m45_70372_c1_931_1770 | 263 |
| 632 | 3300050509 | nmdc:mga0qj67_404607_c1 | nmdc:mga0qj67_404607_c1_224_1027 | 263 |
| 633 | 3300053136 | Ga0500559_0000107 | Ga0500559_0000107_19162_20028 | 263 |
| 634 | 3300054114 | Ga0501084_0120064 | Ga0501084_0120064_1322_2125 | 263 |
| 635 | 3300060353 | Ga0501082_0013883 | Ga0501082_0013883_2214_3017 | 263 |
| 636 | 3300006175 | Ga0070712_100412422 | Ga0070712_1004124221 | 264 |
| 637 | 3300033180 | Ga0307510_10001725 | Ga0307510_1000172513 | 264 |
| 638 | 3300035118 | Ga0373954_0024910 | Ga0373954_0024910_1491_2429 | 264 |
| 639 | 3300035119 | Ga0373956_0168971 | Ga0373956_0168971_160_999 | 264 |
| 640 | 3300035120 | Ga0373957_0020968 | Ga0373957_0020968_324_1262 | 264 |
| 641 | 3300035171 | Ga0373946_0015804 | Ga0373946_0015804_825_1763 | 264 |
| 642 | 3300035692 | Ga0373935_0006508 | Ga0373935_0006508_1869_2807 | 264 |
| 643 | 3300035695 | Ga0373927_0035579 | Ga0373927_0035579_1606_2544 | 264 |
| 644 | 3300035725 | Ga0373947_0000846 | Ga0373947_0000846_15891_16829 | 264 |
| 645 | 3300036401 | Ga0373937_0000269 | Ga0373937_0000269_40213_41151 | 264 |
| 646 | 3300037068 | Ga0373925_0000075 | Ga0373925_0000075_46663_47601 | 264 |
| 647 | 3300046454 | Ga0495592_0000060 | Ga0495592_0000060_42577_43515 | 264 |
| 648 | 3300046459 | Ga0495629_0026394 | Ga0495629_0026394_1458_2396 | 264 |
| 649 | 3300046462 | Ga0495651_0000181 | Ga0495651_0000181_3348_4286 | 264 |
| 650 | 3300046463 | Ga0495653_0000129 | Ga0495653_0000129_7652_8590 | 264 |
| 651 | 3300046476 | Ga0495662_0000590 | Ga0495662_0000590_12425_13363 | 264 |
| 652 | 3300046477 | Ga0495664_0000003 | Ga0495664_0000003_40218_41156 | 264 |
| 653 | 3300046511 | Ga0495608_0000005 | Ga0495608_0000005_12968_13906 | 264 |
| 654 | 3300046514 | Ga0495618_0000044 | Ga0495618_0000044_52051_52989 | 264 |
| 655 | 3300046516 | Ga0495628_0000001 | Ga0495628_0000001_529619_530557 | 264 |
| 656 | 3300046517 | Ga0495630_0000574 | Ga0495630_0000574_21177_22115 | 264 |
| 657 | 3300046529 | Ga0495652_0000002 | Ga0495652_0000002_744153_745091 | 264 |
| 658 | 3300046533 | Ga0495640_0000001 | Ga0495640_0000001_838157_839095 | 264 |
| 659 | 3300046536 | Ga0495587_0000001 | Ga0495587_0000001_56888_57826 | 264 |
| 660 | 3300046543 | Ga0495645_0000002 | Ga0495645_0000002_529632_530570 | 264 |
| 661 | 3300046559 | Ga0495667_0000039 | Ga0495667_0000039_87777_88715 | 264 |
| 662 | 3300046642 | Ga0495634_0000010 | Ga0495634_0000010_111925_112863 | 264 |
| 663 | 3300046663 | Ga0495635_0000001 | Ga0495635_0000001_42712_43650 | 264 |
| 664 | 3300046675 | Ga0495657_0000042 | Ga0495657_0000042_71298_72236 | 264 |
| 665 | 3300046678 | Ga0495599_0000013 | Ga0495599_0000013_121056_121994 | 264 |
| 666 | 3300046679 | Ga0495623_0000050 | Ga0495623_0000050_27307_28245 | 264 |
| 667 | 3300046680 | Ga0495646_0000009 | Ga0495646_0000009_57721_58659 | 264 |
| 668 | 3300046809 | Ga0495600_0000035 | Ga0495600_0000035_61271_62209 | 264 |
| 669 | 3300047315 | Ga0495581_0007779 | Ga0495581_0007779_84_1022 | 264 |
| 670 | 3300047317 | Ga0495604_0000069 | Ga0495604_0000069_31637_32575 | 264 |
| 671 | 3300047319 | Ga0495674_0000002 | Ga0495674_0000002_529620_530558 | 264 |
| 672 | 3300047322 | Ga0495680_0000328 | Ga0495680_0000328_9740_10678 | 264 |
| 673 | 3300047444 | Ga0495675_0000164 | Ga0495675_0000164_39223_40161 | 264 |
| 674 | 3300047471 | Ga0495684_0000016 | Ga0495684_0000016_121336_122274 | 264 |
| 675 | 3300048088 | Ga0495602_0000240 | Ga0495602_0000240_7549_8487 | 264 |
| 676 | 3300048927 | Ga0496124_0009911 | Ga0496124_0009911_1843_2730 | 264 |
| 677 | 3300053077 | Ga0495601_0000001 | Ga0495601_0000001_501769_502707 | 264 |
| 678 | 3300053078 | Ga0495612_0000017 | Ga0495612_0000017_93554_94492 | 264 |
| 679 | 3300053084 | Ga0495595_0000010 | Ga0495595_0000010_121032_121970 | 264 |
| 680 | 3300053085 | Ga0495619_0000014 | Ga0495619_0000014_1696_2634 | 264 |
| 681 | 3300005471 | Ga0070698_100121348 | Ga0070698_1001213482 | 265 |
| 682 | 3300007788 | Ga0099795_10007542 | Ga0099795_100075422 | 265 |
| 683 | 3300031456 | Ga0307513_10000028 | Ga0307513_1000002835 | 265 |
| 684 | 3300037068 | Ga0373925_0273550 | Ga0373925_0273550_356_1198 | 265 |
| 685 | 3300042461 | Ga0439460_0003204 | Ga0439460_0003204_17_814 | 265 |
| 686 | 3300046471 | Ga0495650_0004948 | Ga0495650_0004948_152_1021 | 265 |
| 687 | 3300046472 | Ga0495580_0339238 | Ga0495580_0339238_50_892 | 265 |
| 688 | 3300053125 | Ga0500618_000088 | Ga0500618_000088_19091_19987 | 265 |
| 689 | 3300039437 | Ga0436365_0703504 | Ga0436365_0703504_1176_2012 | 266 |
| 690 | 3300048921 | Ga0496118_0094148 | Ga0496118_0094148_187_1008 | 266 |
| 691 | 3300048924 | Ga0496121_0053860 | Ga0496121_0053860_1775_2656 | 266 |
| 692 | 3300048927 | Ga0496124_0031672 | Ga0496124_0031672_141_1022 | 266 |
| 693 | 3300027378 | Ga0209981_1012200 | Ga0209981_10122002 | 267 |
| 694 | 3300028794 | Ga0307515_10144962 | Ga0307515_101449623 | 267 |
| 695 | 3300031251 | Ga0265327_10021443 | Ga0265327_100214433 | 267 |
| 696 | 3300048905 | Ga0496102_0695057 | Ga0496102_0695057_15_821 | 267 |
| 697 | 3300048919 | Ga0496116_0071638 | Ga0496116_0071638_1135_1944 | 267 |
| 698 | 3300048924 | Ga0496121_0001373 | Ga0496121_0001373_17752_18561 | 267 |
| 699 | 3300048927 | Ga0496124_0000224 | Ga0496124_0000224_72170_72979 | 267 |
| 700 | 3300053125 | Ga0500618_001413 | Ga0500618_001413_4751_5617 | 267 |
| 701 | 3300005468 | Ga0070707_100003645 | Ga0070707_10000364510 | 268 |
| 702 | 3300025922 | Ga0207646_10007486 | Ga0207646_100074863 | 268 |
| 703 | 3300033179 | Ga0307507_10098971 | Ga0307507_100989711 | 268 |
| 704 | 3300046524 | Ga0495648_0013147 | Ga0495648_0013147_4697_5548 | 268 |
| 705 | 3300003203 | JGI25406J46586_10000801 | JGI25406J46586_100008012 | 269 |
| 706 | 3300005434 | Ga0070709_10003602 | Ga0070709_100036021 | 269 |
| 707 | 3300005435 | Ga0070714_100263796 | Ga0070714_1002637961 | 269 |
| 708 | 3300005437 | Ga0070710_10001132 | Ga0070710_1000113211 | 269 |
| 709 | 3300005439 | Ga0070711_100003864 | Ga0070711_1000038642 | 269 |
| 710 | 3300005985 | Ga0081539_10000008 | Ga0081539_10000008442 | 269 |
| 711 | 3300025898 | Ga0207692_10203433 | Ga0207692_102034331 | 269 |
| 712 | 3300025906 | Ga0207699_10001319 | Ga0207699_1000131911 | 269 |
| 713 | 3300025915 | Ga0207693_10087300 | Ga0207693_100873002 | 269 |
| 714 | 3300025916 | Ga0207663_10006786 | Ga0207663_100067866 | 269 |
| 715 | 3300025929 | Ga0207664_10012798 | Ga0207664_100127982 | 269 |
| 716 | 3300025939 | Ga0207665_10004269 | Ga0207665_1000426912 | 269 |
| 717 | 3300005262 | Ga0065165_1000024 | Ga0065165_100002424 | 270 |
| 718 | 3300048916 | Ga0496113_0462982 | Ga0496113_0462982_100_939 | 270 |
| 719 | 3300049576 | Ga0501040_0172442 | Ga0501040_0172442_333_1172 | 270 |
| 720 | 3300049577 | Ga0501041_0077892 | Ga0501041_0077892_13_852 | 270 |
| 721 | 3300049578 | Ga0501042_0269581 | Ga0501042_0269581_13_852 | 270 |
| 722 | 3300049580 | Ga0501046_0064299 | Ga0501046_0064299_1109_1948 | 270 |
| 723 | 3300049582 | Ga0501048_0078999 | Ga0501048_0078999_1409_2248 | 270 |
| 724 | 3300049592 | Ga0501076_0086870 | Ga0501076_0086870_208_1047 | 270 |
| 725 | 3300049741 | Ga0501079_0067138 | Ga0501079_0067138_368_1207 | 270 |
| 726 | 3300049743 | Ga0501081_0061629 | Ga0501081_0061629_421_1260 | 270 |
| 727 | 3300049824 | Ga0501045_0086938 | Ga0501045_0086938_1361_2200 | 270 |
| 728 | 3300031456 | Ga0307513_10092185 | Ga0307513_100921853 | 271 |
| 729 | 3300031616 | Ga0307508_10000004 | Ga0307508_1000000429 | 271 |
| 730 | 3300049589 | Ga0501073_0147546 | Ga0501073_0147546_641_1462 | 271 |
| 731 | 3300049742 | Ga0501080_0090377 | Ga0501080_0090377_17_838 | 271 |
| 732 | 3300003215 | JGI25153J46596_10002589 | JGI25153J46596_100025895 | 272 |
| 733 | 3300003215 | JGI25153J46596_10021769 | JGI25153J46596_100217692 | 272 |
| 734 | 3300003354 | JGI25160J50197_1006259 | JGI25160J50197_10062593 | 272 |
| 735 | 3300003354 | JGI25160J50197_1006800 | JGI25160J50197_10068003 | 272 |
| 736 | 3300003659 | JGI25404J52841_10011082 | JGI25404J52841_100110822 | 272 |
| 737 | 3300005262 | Ga0065165_1001284 | Ga0065165_100128413 | 272 |
| 738 | 3300005327 | Ga0070658_10049317 | Ga0070658_100493175 | 272 |
| 739 | 3300005328 | Ga0070676_10106817 | Ga0070676_101068172 | 272 |
| 740 | 3300005331 | Ga0070670_100016676 | Ga0070670_1000166763 | 272 |
| 741 | 3300005335 | Ga0070666_10168377 | Ga0070666_101683772 | 272 |
| 742 | 3300005338 | Ga0068868_100072676 | Ga0068868_1000726763 | 272 |
| 743 | 3300005339 | Ga0070660_100301085 | Ga0070660_1003010852 | 272 |
| 744 | 3300005354 | Ga0070675_100005492 | Ga0070675_1000054927 | 272 |
| 745 | 3300005355 | Ga0070671_100011767 | Ga0070671_1000117673 | 272 |
| 746 | 3300005364 | Ga0070673_100009243 | Ga0070673_1000092432 | 272 |
| 747 | 3300005366 | Ga0070659_100235484 | Ga0070659_1002354841 | 272 |
| 748 | 3300005455 | Ga0070663_100197713 | Ga0070663_1001977132 | 272 |
| 749 | 3300005455 | Ga0070663_100303608 | Ga0070663_1003036081 | 272 |
| 750 | 3300005456 | Ga0070678_100033200 | Ga0070678_1000332001 | 272 |
| 751 | 3300005456 | Ga0070678_100068196 | Ga0070678_1000681962 | 272 |
| 752 | 3300005457 | Ga0070662_100092254 | Ga0070662_1000922542 | 272 |
| 753 | 3300005468 | Ga0070707_100059485 | Ga0070707_1000594852 | 272 |
| 754 | 3300005539 | Ga0068853_100033377 | Ga0068853_1000333776 | 272 |
| 755 | 3300005539 | Ga0068853_100200802 | Ga0068853_1002008022 | 272 |
| 756 | 3300005543 | Ga0070672_100037636 | Ga0070672_1000376363 | 272 |
| 757 | 3300005545 | Ga0070695_100065670 | Ga0070695_1000656702 | 272 |
| 758 | 3300005547 | Ga0070693_100083628 | Ga0070693_1000836282 | 272 |
| 759 | 3300005548 | Ga0070665_100785064 | Ga0070665_1007850641 | 272 |
| 760 | 3300005549 | Ga0070704_100440643 | Ga0070704_1004406432 | 272 |
| 761 | 3300005564 | Ga0070664_100043057 | Ga0070664_1000430573 | 272 |
| 762 | 3300005578 | Ga0068854_100066660 | Ga0068854_1000666602 | 272 |
| 763 | 3300005614 | Ga0068856_100144187 | Ga0068856_1001441871 | 272 |
| 764 | 3300005616 | Ga0068852_100020468 | Ga0068852_1000204684 | 272 |
| 765 | 3300005618 | Ga0068864_100086254 | Ga0068864_1000862543 | 272 |
| 766 | 3300005718 | Ga0068866_10011607 | Ga0068866_100116072 | 272 |
| 767 | 3300005840 | Ga0068870_10043461 | Ga0068870_100434612 | 272 |
| 768 | 3300005843 | Ga0068860_100179335 | Ga0068860_1001793352 | 272 |
| 769 | 3300005844 | Ga0068862_100204372 | Ga0068862_1002043722 | 272 |
| 770 | 3300005983 | Ga0081540_1003830 | Ga0081540_100383013 | 272 |
| 771 | 3300005983 | Ga0081540_1003910 | Ga0081540_100391012 | 272 |
| 772 | 3300005983 | Ga0081540_1024563 | Ga0081540_10245633 | 272 |
| 773 | 3300006042 | Ga0075368_10002361 | Ga0075368_100023617 | 272 |
| 774 | 3300006042 | Ga0075368_10029147 | Ga0075368_100291472 | 272 |
| 775 | 3300006048 | Ga0075363_100012530 | Ga0075363_1000125302 | 272 |
| 776 | 3300006051 | Ga0075364_10177790 | Ga0075364_101777902 | 272 |
| 777 | 3300006175 | Ga0070712_100183907 | Ga0070712_1001839072 | 272 |
| 778 | 3300006178 | Ga0075367_10012955 | Ga0075367_100129552 | 272 |
| 779 | 3300006178 | Ga0075367_10025935 | Ga0075367_100259352 | 272 |
| 780 | 3300006237 | Ga0097621_100106660 | Ga0097621_1001066602 | 272 |
| 781 | 3300006353 | Ga0075370_10185373 | Ga0075370_101853731 | 272 |
| 782 | 3300006358 | Ga0068871_100028813 | Ga0068871_1000288134 | 272 |
| 783 | 3300006358 | Ga0068871_100272124 | Ga0068871_1002721241 | 272 |
| 784 | 3300006844 | Ga0075428_100303162 | Ga0075428_1003031622 | 272 |
| 785 | 3300006942 | Ga0099824_1022507 | Ga0099824_10225072 | 272 |
| 786 | 3300006944 | Ga0099823_1019469 | Ga0099823_10194692 | 272 |
| 787 | 3300009174 | Ga0105241_10012907 | Ga0105241_100129073 | 272 |
| 788 | 3300009176 | Ga0105242_10175319 | Ga0105242_101753192 | 272 |
| 789 | 3300009176 | Ga0105242_10686701 | Ga0105242_106867012 | 272 |
| 790 | 3300009177 | Ga0105248_10095407 | Ga0105248_100954072 | 272 |
| 791 | 3300009177 | Ga0105248_10177251 | Ga0105248_101772512 | 272 |
| 792 | 3300009177 | Ga0105248_10471815 | Ga0105248_104718151 | 272 |
| 793 | 3300009551 | Ga0105238_10271943 | Ga0105238_102719432 | 272 |
| 794 | 3300009553 | Ga0105249_10093198 | Ga0105249_100931982 | 272 |
| 795 | 3300013296 | Ga0157374_10003804 | Ga0157374_100038048 | 272 |
| 796 | 3300013296 | Ga0157374_10140934 | Ga0157374_101409342 | 272 |
| 797 | 3300013296 | Ga0157374_10220651 | Ga0157374_102206512 | 272 |
| 798 | 3300013296 | Ga0157374_10774927 | Ga0157374_107749271 | 272 |
| 799 | 3300013297 | Ga0157378_10013539 | Ga0157378_100135394 | 272 |
| 800 | 3300013308 | Ga0157375_10483195 | Ga0157375_104831951 | 272 |
| 801 | 3300014325 | Ga0163163_10055535 | Ga0163163_100555352 | 272 |
| 802 | 3300014969 | Ga0157376_10015076 | Ga0157376_100150766 | 272 |
| 803 | 3300014969 | Ga0157376_10146677 | Ga0157376_101466772 | 272 |
| 804 | 3300021320 | Ga0214544_1000020 | Ga0214544_100002085 | 272 |
| 805 | 3300021321 | Ga0214542_1000024 | Ga0214542_100002496 | 272 |
| 806 | 3300021324 | Ga0214545_1000011 | Ga0214545_100001196 | 272 |
| 807 | 3300021327 | Ga0214543_1000033 | Ga0214543_1000033108 | 272 |
| 808 | 3300025230 | Ga0209563_101304 | Ga0209563_1013045 | 272 |
| 809 | 3300025261 | Ga0209233_1001066 | Ga0209233_10010662 | 272 |
| 810 | 3300025273 | Ga0209673_1044222 | Ga0209673_10442221 | 272 |
| 811 | 3300025295 | Ga0209564_1014473 | Ga0209564_10144733 | 272 |
| 812 | 3300025297 | Ga0209758_1000952 | Ga0209758_100095236 | 272 |
| 813 | 3300025297 | Ga0209758_1037687 | Ga0209758_10376872 | 272 |
| 814 | 3300025304 | Ga0209257_1013152 | Ga0209257_10131522 | 272 |
| 815 | 3300025900 | Ga0207710_10045537 | Ga0207710_100455372 | 272 |
| 816 | 3300025907 | Ga0207645_10073442 | Ga0207645_100734422 | 272 |
| 817 | 3300025907 | Ga0207645_10076453 | Ga0207645_100764532 | 272 |
| 818 | 3300025909 | Ga0207705_10066695 | Ga0207705_100666952 | 272 |
| 819 | 3300025911 | Ga0207654_10017669 | Ga0207654_100176693 | 272 |
| 820 | 3300025912 | Ga0207707_10234841 | Ga0207707_102348411 | 272 |
| 821 | 3300025914 | Ga0207671_10112523 | Ga0207671_101125233 | 272 |
| 822 | 3300025915 | Ga0207693_10207407 | Ga0207693_102074072 | 272 |
| 823 | 3300025924 | Ga0207694_10280638 | Ga0207694_102806382 | 272 |
| 824 | 3300025925 | Ga0207650_10001712 | Ga0207650_1000171211 | 272 |
| 825 | 3300025931 | Ga0207644_10027565 | Ga0207644_100275655 | 272 |
| 826 | 3300025931 | Ga0207644_10055845 | Ga0207644_100558452 | 272 |
| 827 | 3300025933 | Ga0207706_10128126 | Ga0207706_101281262 | 272 |
| 828 | 3300025942 | Ga0207689_10039992 | Ga0207689_100399922 | 272 |
| 829 | 3300025942 | Ga0207689_10073209 | Ga0207689_100732092 | 272 |
| 830 | 3300025945 | Ga0207679_10008273 | Ga0207679_100082737 | 272 |
| 831 | 3300025960 | Ga0207651_10001703 | Ga0207651_100017037 | 272 |
| 832 | 3300025981 | Ga0207640_10061301 | Ga0207640_100613011 | 272 |
| 833 | 3300025981 | Ga0207640_10218736 | Ga0207640_102187362 | 272 |
| 834 | 3300026023 | Ga0207677_10017339 | Ga0207677_100173395 | 272 |
| 835 | 3300026041 | Ga0207639_10278169 | Ga0207639_102781691 | 272 |
| 836 | 3300026041 | Ga0207639_10570532 | Ga0207639_105705321 | 272 |
| 837 | 3300026067 | Ga0207678_10100542 | Ga0207678_101005423 | 272 |
| 838 | 3300026078 | Ga0207702_10039969 | Ga0207702_100399695 | 272 |
| 839 | 3300026095 | Ga0207676_10223852 | Ga0207676_102238522 | 272 |
| 840 | 3300026121 | Ga0207683_10030958 | Ga0207683_100309584 | 272 |
| 841 | 3300026142 | Ga0207698_10000603 | Ga0207698_1000060311 | 272 |
| 842 | 3300027296 | Ga0209389_1000011 | Ga0209389_1000011119 | 272 |
| 843 | 3300027296 | Ga0209389_1000424 | Ga0209389_100042410 | 272 |
| 844 | 3300027357 | Ga0209589_1004180 | Ga0209589_100418010 | 272 |
| 845 | 3300027361 | Ga0209489_100017 | Ga0209489_100017115 | 272 |
| 846 | 3300027361 | Ga0209489_104563 | Ga0209489_10456311 | 272 |
| 847 | 3300027363 | Ga0209700_100027 | Ga0209700_100027119 | 272 |
| 848 | 3300027866 | Ga0209813_10013245 | Ga0209813_100132453 | 272 |
| 849 | 3300028379 | Ga0268266_10100118 | Ga0268266_101001183 | 272 |
| 850 | 3300028381 | Ga0268264_10766013 | Ga0268264_107660132 | 272 |
| 851 | 3300028786 | Ga0307517_10000049 | Ga0307517_1000004936 | 272 |
| 852 | 3300028794 | Ga0307515_10152692 | Ga0307515_101526921 | 272 |
| 853 | 3300031711 | Ga0265314_10075462 | Ga0265314_100754622 | 272 |
| 854 | 3300031730 | Ga0307516_10005295 | Ga0307516_100052952 | 272 |
| 855 | 3300033180 | Ga0307510_10044427 | Ga0307510_100444273 | 272 |
| 856 | 3300035089 | Ga0373944_0032737 | Ga0373944_0032737_286_1125 | 272 |
| 857 | 3300035117 | Ga0373953_0022563 | Ga0373953_0022563_786_1625 | 272 |
| 858 | 3300035120 | Ga0373957_0002972 | Ga0373957_0002972_1528_2367 | 272 |
| 859 | 3300035172 | Ga0373955_0008786 | Ga0373955_0008786_3331_4170 | 272 |
| 860 | 3300035692 | Ga0373935_0289936 | Ga0373935_0289936_276_1115 | 272 |
| 861 | 3300035695 | Ga0373927_0171508 | Ga0373927_0171508_23_862 | 272 |
| 862 | 3300035724 | Ga0373933_0114823 | Ga0373933_0114823_522_1361 | 272 |
| 863 | 3300044684 | Ga0466966_0004865 | Ga0466966_0004865_7840_8679 | 272 |
| 864 | 3300044693 | Ga0466961_0003875 | Ga0466961_0003875_4203_5042 | 272 |
| 865 | 3300045049 | Ga0466959_0008411 | Ga0466959_0008411_1494_2333 | 272 |
| 866 | 3300046452 | Ga0495617_016710 | Ga0495617_016710_104_943 | 272 |
| 867 | 3300046454 | Ga0495592_0094668 | Ga0495592_0094668_839_1678 | 272 |
| 868 | 3300046460 | Ga0495638_0004444 | Ga0495638_0004444_9564_10403 | 272 |
| 869 | 3300046462 | Ga0495651_0002101 | Ga0495651_0002101_11767_12606 | 272 |
| 870 | 3300046462 | Ga0495651_0027827 | Ga0495651_0027827_3039_3878 | 272 |
| 871 | 3300046463 | Ga0495653_0028701 | Ga0495653_0028701_801_1640 | 272 |
| 872 | 3300046474 | Ga0495605_0074102 | Ga0495605_0074102_277_1116 | 272 |
| 873 | 3300046477 | Ga0495664_0062180 | Ga0495664_0062180_995_1834 | 272 |
| 874 | 3300046477 | Ga0495664_0064611 | Ga0495664_0064611_1097_1936 | 272 |
| 875 | 3300046507 | Ga0495606_0046693 | Ga0495606_0046693_789_1631 | 272 |
| 876 | 3300046511 | Ga0495608_0005335 | Ga0495608_0005335_1186_2025 | 272 |
| 877 | 3300046511 | Ga0495608_0019297 | Ga0495608_0019297_1517_2356 | 272 |
| 878 | 3300046512 | Ga0495610_0151393 | Ga0495610_0151393_70_909 | 272 |
| 879 | 3300046514 | Ga0495618_0046150 | Ga0495618_0046150_1332_2171 | 272 |
| 880 | 3300046516 | Ga0495628_0014573 | Ga0495628_0014573_2696_3535 | 272 |
| 881 | 3300046516 | Ga0495628_0077782 | Ga0495628_0077782_770_1609 | 272 |
| 882 | 3300046519 | Ga0495632_0064658 | Ga0495632_0064658_827_1666 | 272 |
| 883 | 3300046519 | Ga0495632_0071248 | Ga0495632_0071248_698_1537 | 272 |
| 884 | 3300046522 | Ga0495643_0027646 | Ga0495643_0027646_973_1815 | 272 |
| 885 | 3300046529 | Ga0495652_0006363 | Ga0495652_0006363_6600_7439 | 272 |
| 886 | 3300046529 | Ga0495652_0091222 | Ga0495652_0091222_656_1495 | 272 |
| 887 | 3300046533 | Ga0495640_0075246 | Ga0495640_0075246_425_1264 | 272 |
| 888 | 3300046536 | Ga0495587_0024566 | Ga0495587_0024566_1488_2327 | 272 |
| 889 | 3300046536 | Ga0495587_0047368 | Ga0495587_0047368_1053_1892 | 272 |
| 890 | 3300046538 | Ga0495609_0036919 | Ga0495609_0036919_351_1190 | 272 |
| 891 | 3300046543 | Ga0495645_0089014 | Ga0495645_0089014_668_1507 | 272 |
| 892 | 3300046615 | Ga0495656_0023075 | Ga0495656_0023075_1027_1848 | 272 |
| 893 | 3300046615 | Ga0495656_0032291 | Ga0495656_0032291_199_1038 | 272 |
| 894 | 3300046616 | Ga0495668_0037116 | Ga0495668_0037116_1716_2558 | 272 |
| 895 | 3300046663 | Ga0495635_0026385 | Ga0495635_0026385_1538_2377 | 272 |
| 896 | 3300046675 | Ga0495657_0002643 | Ga0495657_0002643_10793_11632 | 272 |
| 897 | 3300046678 | Ga0495599_0015314 | Ga0495599_0015314_2695_3534 | 272 |
| 898 | 3300046678 | Ga0495599_0028956 | Ga0495599_0028956_2483_3322 | 272 |
| 899 | 3300046679 | Ga0495623_0014984 | Ga0495623_0014984_77_916 | 272 |
| 900 | 3300046679 | Ga0495623_0045431 | Ga0495623_0045431_429_1268 | 272 |
| 901 | 3300046680 | Ga0495646_0031676 | Ga0495646_0031676_509_1348 | 272 |
| 902 | 3300046809 | Ga0495600_0129701 | Ga0495600_0129701_401_1240 | 272 |
| 903 | 3300047317 | Ga0495604_0005569 | Ga0495604_0005569_5238_6077 | 272 |
| 904 | 3300047317 | Ga0495604_0008438 | Ga0495604_0008438_1913_2752 | 272 |
| 905 | 3300047319 | Ga0495674_0059219 | Ga0495674_0059219_1929_2768 | 272 |
| 906 | 3300047319 | Ga0495674_0073584 | Ga0495674_0073584_370_1209 | 272 |
| 907 | 3300047321 | Ga0495676_0273696 | Ga0495676_0273696_50_889 | 272 |
| 908 | 3300047322 | Ga0495680_0007181 | Ga0495680_0007181_5218_6057 | 272 |
| 909 | 3300047322 | Ga0495680_0029436 | Ga0495680_0029436_989_1828 | 272 |
| 910 | 3300047323 | Ga0495683_0133685 | Ga0495683_0133685_197_1036 | 272 |
| 911 | 3300047443 | Ga0495687_004001 | Ga0495687_004001_7283_8125 | 272 |
| 912 | 3300047444 | Ga0495675_0010844 | Ga0495675_0010844_4002_4841 | 272 |
| 913 | 3300047471 | Ga0495684_0028039 | Ga0495684_0028039_553_1392 | 272 |
| 914 | 3300047673 | Ga0495593_0048060 | Ga0495593_0048060_419_1258 | 272 |
| 915 | 3300048088 | Ga0495602_0002010 | Ga0495602_0002010_12876_13715 | 272 |
| 916 | 3300048088 | Ga0495602_0061124 | Ga0495602_0061124_746_1585 | 272 |
| 917 | 3300048090 | Ga0495615_0031366 | Ga0495615_0031366_390_1229 | 272 |
| 918 | 3300048905 | Ga0496102_0219683 | Ga0496102_0219683_158_994 | 272 |
| 919 | 3300048906 | Ga0496103_0027506 | Ga0496103_0027506_1462_2304 | 272 |
| 920 | 3300048912 | Ga0496109_0144166 | Ga0496109_0144166_1189_2019 | 272 |
| 921 | 3300048913 | Ga0496110_0032897 | Ga0496110_0032897_1902_2732 | 272 |
| 922 | 3300048915 | Ga0496112_0154568 | Ga0496112_0154568_574_1416 | 272 |
| 923 | 3300048918 | Ga0496115_0117048 | Ga0496115_0117048_872_1711 | 272 |
| 924 | 3300048919 | Ga0496116_0007895 | Ga0496116_0007895_1948_2787 | 272 |
| 925 | 3300048921 | Ga0496118_0145225 | Ga0496118_0145225_316_1155 | 272 |
| 926 | 3300048924 | Ga0496121_0004413 | Ga0496121_0004413_16478_17317 | 272 |
| 927 | 3300048924 | Ga0496121_0134946 | Ga0496121_0134946_58_897 | 272 |
| 928 | 3300048927 | Ga0496124_0218591 | Ga0496124_0218591_286_1125 | 272 |
| 929 | 3300048928 | Ga0496125_0079365 | Ga0496125_0079365_1130_1969 | 272 |
| 930 | 3300048929 | Ga0496126_0130226 | Ga0496126_0130226_844_1683 | 272 |
| 931 | 3300050490 | nmdc:mga03n38_1633_c1 | nmdc:mga03n38_1633_c1_3344_4183 | 272 |
| 932 | 3300050492 | nmdc:mga0yw44_137180_c1 | nmdc:mga0yw44_137180_c1_655_1494 | 272 |
| 933 | 3300050494 | nmdc:mga06z11_117198_c1 | nmdc:mga06z11_117198_c1_114_953 | 272 |
| 934 | 3300050495 | nmdc:mga04h51_2271_c1 | nmdc:mga04h51_2271_c1_3525_4367 | 272 |
| 935 | 3300050496 | nmdc:mga07m45_190150_c1 | nmdc:mga07m45_190150_c1_191_1030 | 272 |
| 936 | 3300050496 | nmdc:mga07m45_9639_c1 | nmdc:mga07m45_9639_c1_1141_1983 | 272 |
| 937 | 3300050516 | nmdc:mga0sz30_105332_c1 | nmdc:mga0sz30_105332_c1_141_980 | 272 |
| 938 | 3300050516 | nmdc:mga0sz30_15041_c1 | nmdc:mga0sz30_15041_c1_595_1437 | 272 |
| 939 | 3300050516 | nmdc:mga0sz30_70976_c1 | nmdc:mga0sz30_70976_c1_376_1215 | 272 |
| 940 | 3300053077 | Ga0495601_0023258 | Ga0495601_0023258_2101_2940 | 272 |
| 941 | 3300053084 | Ga0495595_0058530 | Ga0495595_0058530_520_1359 | 272 |
| 942 | 3300053085 | Ga0495619_0033264 | Ga0495619_0033264_2187_3026 | 272 |
| 943 | 3300053085 | Ga0495619_0047645 | Ga0495619_0047645_876_1715 | 272 |
| 944 | 3300053093 | Ga0500651_0099442 | Ga0500651_0099442_225_1064 | 272 |
| 945 | 3300053104 | Ga0500556_0000069 | Ga0500556_0000069_24480_25319 | 272 |
| 946 | 3300053109 | Ga0500569_007080 | Ga0500569_007080_62_901 | 272 |
| 947 | 3300053119 | Ga0500595_028448 | Ga0500595_028448_25_864 | 272 |
| 948 | 3300053119 | Ga0500595_059336 | Ga0500595_059336_69_908 | 272 |
| 949 | 3300053130 | Ga0500642_0000032 | Ga0500642_0000032_35259_36098 | 272 |
| 950 | 3300053131 | Ga0500652_005774 | Ga0500652_005774_2915_3754 | 272 |
| 951 | 3300053134 | Ga0500658_0107985 | Ga0500658_0107985_295_1134 | 272 |
| 952 | 3300053139 | Ga0500568_0070664 | Ga0500568_0070664_26_865 | 272 |
| 953 | 3300053153 | Ga0500616_0000332 | Ga0500616_0000332_42782_43621 | 272 |
| 954 | 3300053156 | Ga0500622_0002594 | Ga0500622_0002594_54_893 | 272 |
| 955 | iso_pu_bacteria | 2600255389 | 2602008613 | 272 |
| 956 | iso_pu_bacteria | 2899275550 | 2899277767 | 272 |
| 957 | iso_pu_bacteria | 2904690495 | 2904693432 | 272 |
| 958 | iso_pu_bacteria | 8034962539 | 8034963474 | 272 |
| 959 | iso_pu_bacteria | 8056689827 | 8056691832 | 272 |
| 960 | 3300006844 | Ga0075428_100005908 | Ga0075428_1000059089 | 273 |
| 961 | 3300006846 | Ga0075430_100053942 | Ga0075430_1000539422 | 273 |
| 962 | 3300006847 | Ga0075431_100031643 | Ga0075431_1000316436 | 273 |
| 963 | 3300009147 | Ga0114129_10229472 | Ga0114129_102294723 | 273 |
| 964 | 3300027471 | Ga0209995_1017133 | Ga0209995_10171332 | 273 |
| 965 | 3300031548 | Ga0307408_100000005 | Ga0307408_10000000565 | 273 |
| 966 | 3300031728 | Ga0316578_10031741 | Ga0316578_100317412 | 273 |
| 967 | 3300031901 | Ga0307406_10000463 | Ga0307406_1000046311 | 273 |
| 968 | 3300035398 | Ga0316574_0040978 | Ga0316574_0040978_1309_2139 | 273 |
| 969 | 3300036647 | Ga0316582_0009082 | Ga0316582_0009082_3618_4448 | 273 |
| 970 | 3300036647 | Ga0316582_0078104 | Ga0316582_0078104_747_1577 | 273 |
| 971 | 3300036647 | Ga0316582_0217325 | Ga0316582_0217325_164_994 | 273 |
| 972 | 3300036712 | Ga0316584_0260446 | Ga0316584_0260446_349_1179 | 273 |
| 973 | 3300037588 | Ga0316581_0040528 | Ga0316581_0040528_451_1281 | 273 |
| 974 | 3300038726 | Ga0400490_13794 | Ga0400490_13794_1827_2657 | 273 |
| 975 | 3300038726 | Ga0400490_20324 | Ga0400490_20324_4004_4834 | 273 |
| 976 | 3300038726 | Ga0400490_45281 | Ga0400490_45281_28072_28902 | 273 |
| 977 | 3300038727 | Ga0400491_16995 | Ga0400491_16995_1314_2144 | 273 |
| 978 | 3300038741 | Ga0400488_23323 | Ga0400488_23323_5599_6429 | 273 |
| 979 | 3300038741 | Ga0400488_38093 | Ga0400488_38093_1096_1926 | 273 |
| 980 | 3300038742 | Ga0400486_28053 | Ga0400486_28053_11182_12012 | 273 |
| 981 | 3300039062 | Ga0400483_027235 | Ga0400483_027235_1162_1992 | 273 |
| 982 | 3300039062 | Ga0400483_119201 | Ga0400483_119201_960_1787 | 273 |
| 983 | 3300039062 | Ga0400483_208955 | Ga0400483_208955_1567_2397 | 273 |
| 984 | 3300039062 | Ga0400483_259163 | Ga0400483_259163_4925_5752 | 273 |
| 985 | 3300041408 | Ga0439453_0001117 | Ga0439453_0001117_948_1769 | 273 |
| 986 | 3300042001 | Ga0439441_005120 | Ga0439441_005120_337_1158 | 273 |
| 987 | 3300042003 | Ga0439443_004522 | Ga0439443_004522_889_1710 | 273 |
| 988 | 3300042013 | Ga0439456_028952 | Ga0439456_028952_49_870 | 273 |
| 989 | 3300042156 | Ga0439446_0024413 | Ga0439446_0024413_752_1573 | 273 |
| 990 | 3300042435 | Ga0439434_0029405 | Ga0439434_0029405_541_1362 | 273 |
| 991 | 3300042436 | Ga0439435_0000398 | Ga0439435_0000398_1178_1999 | 273 |
| 992 | 3300042437 | Ga0439444_0000032 | Ga0439444_0000032_6674_7495 | 273 |
| 993 | 3300050508 | nmdc:mga09592_7869_c1 | nmdc:mga09592_7869_c1_5732_6553 | 273 |
| 994 | 3300050509 | nmdc:mga0qj67_88207_c1 | nmdc:mga0qj67_88207_c1_261_1082 | 273 |
| 995 | 3300050510 | nmdc:mga06r32_104072_c1 | nmdc:mga06r32_104072_c1_1410_2231 | 273 |
| 996 | iso_pu_bacteria | 2885383462 | 2885390200 | 273 |
| 997 | iso_pu_bacteria | 8056681323 | 8056685047 | 273 |
| 998 | 3300005445 | Ga0070708_100005534 | Ga0070708_1000055349 | 274 |
| 999 | 3300005536 | Ga0070697_100182558 | Ga0070697_1001825582 | 274 |
| 1000 | 3300005614 | Ga0068856_100203937 | Ga0068856_1002039372 | 274 |
| 1001 | 3300007265 | Ga0099794_10000734 | Ga0099794_100007349 | 274 |
| 1002 | 3300007265 | Ga0099794_10157309 | Ga0099794_101573092 | 274 |
| 1003 | 3300009147 | Ga0114129_10112688 | Ga0114129_101126884 | 274 |
| 1004 | 3300025298 | Ga0209050_1014556 | Ga0209050_10145562 | 274 |
| 1005 | 3300025949 | Ga0207667_10088924 | Ga0207667_100889244 | 274 |
| 1006 | 3300026078 | Ga0207702_10141568 | Ga0207702_101415682 | 274 |
| 1007 | 3300027671 | Ga0209588_1001890 | Ga0209588_10018904 | 274 |
| 1008 | 3300027671 | Ga0209588_1023117 | Ga0209588_10231173 | 274 |
| 1009 | 3300048928 | Ga0496125_0028421 | Ga0496125_0028421_470_1327 | 274 |
| 1010 | 3300050491 | nmdc:mga00v17_97354_c1 | nmdc:mga00v17_97354_c1_71_922 | 274 |
| 1011 | iso_pu_bacteria | 2507262055 | 2507510102 | 274 |
| 1012 | iso_pu_bacteria | 2508501128 | 2509153534 | 274 |
| 1013 | iso_pu_bacteria | 2511231028 | 2511400835 | 274 |
| 1014 | iso_pu_bacteria | 2513237095 | 2513648930 | 274 |
| 1015 | iso_pu_bacteria | 2513237098 | 2513676463 | 274 |
| 1016 | iso_pu_bacteria | 2513237101 | 2513697013 | 274 |
| 1017 | iso_pu_bacteria | 2513237102 | 2513702056 | 274 |
| 1018 | iso_pu_bacteria | 2513237137 | 2513858195 | 274 |
| 1019 | iso_pu_bacteria | 2513237139 | 2513878039 | 274 |
| 1020 | iso_pu_bacteria | 2513237141 | 2513892004 | 274 |
| 1021 | iso_pu_bacteria | 2517093001 | 2517105160 | 274 |
| 1022 | iso_pu_bacteria | 2517572143 | 2517893916 | 274 |
| 1023 | iso_pu_bacteria | 2522572158 | 2523102996 | 274 |
| 1024 | iso_pu_bacteria | 2524023210 | 2524467067 | 274 |
| 1025 | iso_pu_bacteria | 2524023228 | 2524540685 | 274 |
| 1026 | iso_pu_bacteria | 2545555834 | 2545674443 | 274 |
| 1027 | iso_pu_bacteria | 2595698237 | 2596372892 | 274 |
| 1028 | iso_pu_bacteria | 2602042107 | 2603860979 | 274 |
| 1029 | iso_pu_bacteria | 2617270735 | 2617352561 | 274 |
| 1030 | iso_pu_bacteria | 2617270741 | 2617379029 | 274 |
| 1031 | iso_pu_bacteria | 2667528175 | 2671122907 | 274 |
| 1032 | iso_pu_bacteria | 2687453129 | 2687579123 | 274 |
| 1033 | iso_pu_bacteria | 2721755755 | 2723846457 | 274 |
| 1034 | iso_pu_bacteria | 2738541281 | 2738744125 | 274 |
| 1035 | iso_pu_bacteria | 2738543032 | 2739353355 | 274 |
| 1036 | iso_pu_bacteria | 2791355196 | 2793059916 | 274 |
| 1037 | iso_pu_bacteria | 2791355199 | 2793076882 | 274 |
| 1038 | iso_pu_bacteria | 2802429603 | 2805919999 | 274 |
| 1039 | iso_pu_bacteria | 2816332527 | 2818241666 | 274 |
| 1040 | iso_pu_bacteria | 2824617872 | 2824622787 | 274 |
| 1041 | iso_pu_bacteria | 2824626560 | 2824632380 | 274 |
| 1042 | iso_pu_bacteria | 2824635225 | 2824640399 | 274 |
| 1043 | iso_pu_bacteria | 2824644064 | 2824647388 | 274 |
| 1044 | iso_pu_bacteria | 2824671348 | 2824674263 | 274 |
| 1045 | iso_pu_bacteria | 2824679649 | 2824682548 | 274 |
| 1046 | iso_pu_bacteria | 2824687955 | 2824690885 | 274 |
| 1047 | iso_pu_bacteria | 2824696289 | 2824698541 | 274 |
| 1048 | iso_pu_bacteria | 2824714736 | 2824718917 | 274 |
| 1049 | iso_pu_bacteria | 2824723954 | 2824729421 | 274 |
| 1050 | iso_pu_bacteria | 2824732956 | 2824737811 | 274 |
| 1051 | iso_pu_bacteria | 2824746037 | 2824749969 | 274 |
| 1052 | iso_pu_bacteria | 2824773399 | 2824778198 | 274 |
| 1053 | iso_pu_bacteria | 2829745981 | 2829747716 | 274 |
| 1054 | iso_pu_bacteria | 2841941048 | 2841941597 | 274 |
| 1055 | iso_pu_bacteria | 2841949485 | 2841952387 | 274 |
| 1056 | iso_pu_bacteria | 2841966195 | 2841967742 | 274 |
| 1057 | iso_pu_bacteria | 2841974524 | 2841982094 | 274 |
| 1058 | iso_pu_bacteria | 2842038055 | 2842038179 | 274 |
| 1059 | iso_pu_bacteria | 2842045827 | 2842048875 | 274 |
| 1060 | iso_pu_bacteria | 2842698319 | 2842699592 | 274 |
| 1061 | iso_pu_bacteria | 2847930680 | 2847934449 | 274 |
| 1062 | iso_pu_bacteria | 2847939898 | 2847945044 | 274 |
| 1063 | iso_pu_bacteria | 2849076700 | 2849080760 | 274 |
| 1064 | iso_pu_bacteria | 2857509624 | 2857509875 | 274 |
| 1065 | iso_pu_bacteria | 2857524615 | 2857528892 | 274 |
| 1066 | iso_pu_bacteria | 2861691609 | 2861694134 | 274 |
| 1067 | iso_pu_bacteria | 2874604998 | 2874610577 | 274 |
| 1068 | iso_pu_bacteria | 2874612657 | 2874618148 | 274 |
| 1069 | iso_pu_bacteria | 2874620515 | 2874623141 | 274 |
| 1070 | iso_pu_bacteria | 2874628541 | 2874636119 | 274 |
| 1071 | iso_pu_bacteria | 2876808645 | 2876810064 | 274 |
| 1072 | iso_pu_bacteria | 2879083081 | 2879089642 | 274 |
| 1073 | iso_pu_bacteria | 2879110137 | 2879118635 | 274 |
| 1074 | iso_pu_bacteria | 2881364244 | 2881367673 | 274 |
| 1075 | iso_pu_bacteria | 2881665667 | 2881670897 | 274 |
| 1076 | iso_pu_bacteria | 2888378607 | 2888382383 | 274 |
| 1077 | iso_pu_bacteria | 2889033259 | 2889039028 | 274 |
| 1078 | iso_pu_bacteria | 2893066018 | 2893069089 | 274 |
| 1079 | iso_pu_bacteria | 2903748898 | 2903751923 | 274 |
| 1080 | iso_pu_bacteria | 2903768456 | 2903771706 | 274 |
| 1081 | iso_pu_bacteria | 2904666416 | 2904669961 | 274 |
| 1082 | iso_pu_bacteria | 2904699407 | 2904700665 | 274 |
| 1083 | iso_pu_bacteria | 2906610324 | 2906610806 | 274 |
| 1084 | iso_pu_bacteria | 2906626472 | 2906634817 | 274 |
| 1085 | iso_pu_bacteria | 2906635258 | 2906635966 | 274 |
| 1086 | iso_pu_bacteria | 2906643746 | 2906646680 | 274 |
| 1087 | iso_pu_bacteria | 2906660503 | 2906663936 | 274 |
| 1088 | iso_pu_bacteria | 2908756301 | 2908761757 | 274 |
| 1089 | iso_pu_bacteria | 2908775508 | 2908778630 | 274 |
| 1090 | iso_pu_bacteria | 2919073203 | 2919079316 | 274 |
| 1091 | iso_pu_bacteria | 2922361189 | 2922362270 | 274 |
| 1092 | iso_pu_bacteria | 2922386360 | 2922387977 | 274 |
| 1093 | iso_pu_bacteria | 2922393267 | 2922394903 | 274 |
| 1094 | iso_pu_bacteria | 2922425934 | 2922428521 | 274 |
| 1095 | iso_pu_bacteria | 2928125067 | 2928125749 | 274 |
| 1096 | iso_pu_bacteria | 2935630451 | 2935634501 | 274 |
| 1097 | iso_pu_bacteria | 2935908558 | 2935911713 | 274 |
| 1098 | iso_pu_bacteria | 2935916978 | 2935919368 | 274 |
| 1099 | iso_pu_bacteria | 2935926038 | 2935928742 | 274 |
| 1100 | iso_pu_bacteria | 2935934488 | 2935938387 | 274 |
| 1101 | iso_pu_bacteria | 2935942939 | 2935945721 | 274 |
| 1102 | iso_pu_bacteria | 2935951376 | 2935954672 | 274 |
| 1103 | iso_pu_bacteria | 2935967501 | 2935970559 | 274 |
| 1104 | iso_pu_bacteria | 2941507105 | 2941508987 | 274 |
| 1105 | iso_pu_bacteria | 2941515067 | 2941516816 | 274 |
| 1106 | iso_pu_bacteria | 2941523033 | 2941525089 | 274 |
| 1107 | iso_pu_bacteria | 3003665799 | 3003669388 | 274 |
| 1108 | iso_pu_bacteria | 3005474847 | 3005478649 | 274 |
| 1109 | iso_pu_bacteria | 3005483717 | 3005487861 | 274 |
| 1110 | iso_pu_bacteria | 3005587118 | 3005589360 | 274 |
| 1111 | iso_pu_bacteria | 3005594810 | 3005597396 | 274 |
| 1112 | iso_pu_bacteria | 3005710791 | 3005713421 | 274 |
| 1113 | iso_pu_bacteria | 641522639 | 641644954 | 274 |
| 1114 | iso_pu_bacteria | 8006933436 | 8006942715 | 274 |
| 1115 | iso_pu_bacteria | 8006964411 | 8006964844 | 274 |
| 1116 | iso_pu_bacteria | 8006973647 | 8006982438 | 274 |
| 1117 | iso_pu_bacteria | 8006984368 | 8006991760 | 274 |
| 1118 | iso_pu_bacteria | 8006994254 | 8006995579 | 274 |
| 1119 | iso_pu_bacteria | 8016583857 | 8016590758 | 274 |
| 1120 | iso_pu_bacteria | 8019555841 | 8019558476 | 274 |
| 1121 | iso_pu_bacteria | 8019565922 | 8019566821 | 274 |
| 1122 | iso_pu_bacteria | 8019687851 | 8019688359 | 274 |
| 1123 | iso_pu_bacteria | 8054002106 | 8054005746 | 274 |
| 1124 | iso_pu_bacteria | 8056673599 | 8056676374 | 274 |
| 1125 | 3300005577 | Ga0068857_100071409 | Ga0068857_1000714093 | 275 |
| 1126 | 3300006847 | Ga0075431_100001293 | Ga0075431_10000129311 | 275 |
| 1127 | 3300006880 | Ga0075429_100051162 | Ga0075429_1000511622 | 275 |
| 1128 | 3300039438 | Ga0436360_0260696 | Ga0436360_0260696_441_1274 | 275 |
| 1129 | 3300042115 | Ga0450911_000717 | Ga0450911_000717_8341_9198 | 275 |
| 1130 | 3300048925 | Ga0496122_0017391 | Ga0496122_0017391_483_1346 | 275 |
| 1131 | 3300048926 | Ga0496123_0004961 | Ga0496123_0004961_11365_12228 | 275 |
| 1132 | 3300049743 | Ga0501081_0124671 | Ga0501081_0124671_434_1267 | 275 |
| 1133 | 3300049822 | Ga0501035_0352635 | Ga0501035_0352635_378_1211 | 275 |
| 1134 | 3300050508 | nmdc:mga09592_41983_c1 | nmdc:mga09592_41983_c1_2348_3181 | 275 |
| 1135 | 3300050510 | nmdc:mga06r32_201_c1 | nmdc:mga06r32_201_c1_16662_17495 | 275 |
| 1136 | 3300054114 | Ga0501084_0280985 | Ga0501084_0280985_514_1347 | 275 |
| 1137 | 3300060353 | Ga0501082_0338240 | Ga0501082_0338240_79_912 | 275 |
| 1138 | iso_pu_bacteria | 2508501009 | 2508544104 | 275 |
| 1139 | iso_pu_bacteria | 2508501042 | 2508697956 | 275 |
| 1140 | iso_pu_bacteria | 2513237092 | 2513628336 | 275 |
| 1141 | iso_pu_bacteria | 2513237161 | 2514012664 | 275 |
| 1142 | iso_pu_bacteria | 2599185292 | 2599907642 | 275 |
| 1143 | iso_pu_bacteria | 2643221569 | 2643860941 | 275 |
| 1144 | iso_pu_bacteria | 2643221594 | 2643981186 | 275 |
| 1145 | iso_pu_bacteria | 2643221621 | 2644124240 | 275 |
| 1146 | iso_pu_bacteria | 2808606395 | 2809035035 | 275 |
| 1147 | iso_pu_bacteria | 2828305725 | 2828308235 | 275 |
| 1148 | iso_pu_bacteria | 2838122688 | 2838127450 | 275 |
| 1149 | iso_pu_bacteria | 2841957949 | 2841959408 | 275 |
| 1150 | iso_pu_bacteria | 2841983080 | 2841986411 | 275 |
| 1151 | iso_pu_bacteria | 2857537821 | 2857540374 | 275 |
| 1152 | iso_pu_bacteria | 2857542790 | 2857547414 | 275 |
| 1153 | iso_pu_bacteria | 2885366525 | 2885368858 | 275 |
| 1154 | iso_pu_bacteria | 2888388044 | 2888388309 | 275 |
| 1155 | iso_pu_bacteria | 2917699015 | 2917705400 | 275 |
| 1156 | iso_pu_bacteria | 2932794094 | 2932797248 | 275 |
| 1157 | iso_pu_bacteria | 2932801729 | 2932804867 | 275 |
| 1158 | iso_pu_bacteria | 2935608549 | 2935610992 | 275 |
| 1159 | iso_pu_bacteria | 2935648319 | 2935648424 | 275 |
| 1160 | iso_pu_bacteria | 2935656913 | 2935657588 | 275 |
| 1161 | iso_pu_bacteria | 2935819856 | 2935820477 | 275 |
| 1162 | iso_pu_bacteria | 2935847175 | 2935849514 | 275 |
| 1163 | iso_pu_bacteria | 2935883170 | 2935884897 | 275 |
| 1164 | iso_pu_bacteria | 2935959822 | 2935963272 | 275 |
| 1165 | iso_pu_bacteria | 2935984226 | 2935987783 | 275 |
| 1166 | iso_pu_bacteria | 2936011229 | 2936011334 | 275 |
| 1167 | iso_pu_bacteria | 2936019824 | 2936019929 | 275 |
| 1168 | iso_pu_bacteria | 2936028420 | 2936028525 | 275 |
| 1169 | iso_pu_bacteria | 2936046547 | 2936046652 | 275 |
| 1170 | iso_pu_bacteria | 2936055302 | 2936062345 | 275 |
| 1171 | iso_pu_bacteria | 2941479691 | 2941484554 | 275 |
| 1172 | iso_pu_bacteria | 8016630954 | 8016632661 | 275 |
| 1173 | iso_pu_bacteria | 8055225921 | 8055228326 | 275 |
| 1174 | 3300014326 | Ga0157380_10554798 | Ga0157380_105547982 | 276 |
| 1175 | 3300048919 | Ga0496116_0006130 | Ga0496116_0006130_2024_2857 | 276 |
| 1176 | 3300048924 | Ga0496121_0098517 | Ga0496121_0098517_496_1329 | 276 |
| 1177 | 3300048925 | Ga0496122_0000214 | Ga0496122_0000214_109266_110099 | 276 |
| 1178 | 3300048926 | Ga0496123_0000187 | Ga0496123_0000187_120913_121746 | 276 |
| 1179 | 3300048927 | Ga0496124_0078550 | Ga0496124_0078550_225_1058 | 276 |
| 1180 | 3300048927 | Ga0496124_0378292 | Ga0496124_0378292_46_879 | 276 |
| 1181 | 3300048928 | Ga0496125_0028136 | Ga0496125_0028136_1739_2572 | 276 |
| 1182 | 3300053156 | Ga0500622_0002230 | Ga0500622_0002230_13069_14004 | 276 |
| 1183 | iso_pu_bacteria | 2842694124 | 2842697015 | 276 |
| 1184 | iso_pu_bacteria | 2894772417 | 2894775122 | 276 |
| 1185 | 3300003203 | JGI25406J46586_10003389 | JGI25406J46586_100033895 | 277 |
| 1186 | 3300003203 | JGI25406J46586_10003524 | JGI25406J46586_100035247 | 277 |
| 1187 | 3300003215 | JGI25153J46596_10003283 | JGI25153J46596_100032833 | 277 |
| 1188 | 3300003215 | JGI25153J46596_10006877 | JGI25153J46596_100068775 | 277 |
| 1189 | 3300003354 | JGI25160J50197_1003455 | JGI25160J50197_10034552 | 277 |
| 1190 | 3300003659 | JGI25404J52841_10003095 | JGI25404J52841_100030953 | 277 |
| 1191 | 3300004625 | Ga0055543_1002979 | Ga0055543_10029794 | 277 |
| 1192 | 3300005329 | Ga0070683_100248408 | Ga0070683_1002484082 | 277 |
| 1193 | 3300005330 | Ga0070690_100265153 | Ga0070690_1002651532 | 277 |
| 1194 | 3300005334 | Ga0068869_100207306 | Ga0068869_1002073062 | 277 |
| 1195 | 3300005339 | Ga0070660_100325719 | Ga0070660_1003257191 | 277 |
| 1196 | 3300005340 | Ga0070689_100165875 | Ga0070689_1001658752 | 277 |
| 1197 | 3300005341 | Ga0070691_10045042 | Ga0070691_100450422 | 277 |
| 1198 | 3300005347 | Ga0070668_100132137 | Ga0070668_1001321372 | 277 |
| 1199 | 3300005353 | Ga0070669_100233525 | Ga0070669_1002335252 | 277 |
| 1200 | 3300005354 | Ga0070675_100256412 | Ga0070675_1002564121 | 277 |
| 1201 | 3300005356 | Ga0070674_100218180 | Ga0070674_1002181802 | 277 |
| 1202 | 3300005366 | Ga0070659_100473553 | Ga0070659_1004735531 | 277 |
| 1203 | 3300005367 | Ga0070667_100446422 | Ga0070667_1004464221 | 277 |
| 1204 | 3300005406 | Ga0070703_10092812 | Ga0070703_100928121 | 277 |
| 1205 | 3300005434 | Ga0070709_10001642 | Ga0070709_100016425 | 277 |
| 1206 | 3300005434 | Ga0070709_10039766 | Ga0070709_100397662 | 277 |
| 1207 | 3300005435 | Ga0070714_100013820 | Ga0070714_1000138205 | 277 |
| 1208 | 3300005435 | Ga0070714_100459311 | Ga0070714_1004593112 | 277 |
| 1209 | 3300005437 | Ga0070710_10003655 | Ga0070710_100036553 | 277 |
| 1210 | 3300005439 | Ga0070711_100007426 | Ga0070711_1000074268 | 277 |
| 1211 | 3300005440 | Ga0070705_100021640 | Ga0070705_1000216402 | 277 |
| 1212 | 3300005441 | Ga0070700_100195026 | Ga0070700_1001950261 | 277 |
| 1213 | 3300005444 | Ga0070694_100099262 | Ga0070694_1000992622 | 277 |
| 1214 | 3300005455 | Ga0070663_100212417 | Ga0070663_1002124172 | 277 |
| 1215 | 3300005456 | Ga0070678_100098017 | Ga0070678_1000980172 | 277 |
| 1216 | 3300005543 | Ga0070672_100453596 | Ga0070672_1004535962 | 277 |
| 1217 | 3300005545 | Ga0070695_100006466 | Ga0070695_1000064668 | 277 |
| 1218 | 3300005545 | Ga0070695_100059478 | Ga0070695_1000594782 | 277 |
| 1219 | 3300005546 | Ga0070696_100054561 | Ga0070696_1000545613 | 277 |
| 1220 | 3300005548 | Ga0070665_100404253 | Ga0070665_1004042532 | 277 |
| 1221 | 3300005549 | Ga0070704_100027019 | Ga0070704_1000270195 | 277 |
| 1222 | 3300005549 | Ga0070704_100255345 | Ga0070704_1002553452 | 277 |
| 1223 | 3300005618 | Ga0068864_100127422 | Ga0068864_1001274222 | 277 |
| 1224 | 3300005719 | Ga0068861_100531127 | Ga0068861_1005311271 | 277 |
| 1225 | 3300005840 | Ga0068870_10089405 | Ga0068870_100894051 | 277 |
| 1226 | 3300005937 | Ga0081455_10005811 | Ga0081455_1000581113 | 277 |
| 1227 | 3300005937 | Ga0081455_10081940 | Ga0081455_100819402 | 277 |
| 1228 | 3300005937 | Ga0081455_10121092 | Ga0081455_101210922 | 277 |
| 1229 | 3300005983 | Ga0081540_1011713 | Ga0081540_10117131 | 277 |
| 1230 | 3300005985 | Ga0081539_10000747 | Ga0081539_1000074775 | 277 |
| 1231 | 3300005985 | Ga0081539_10039464 | Ga0081539_100394642 | 277 |
| 1232 | 3300006028 | Ga0070717_10018588 | Ga0070717_100185883 | 277 |
| 1233 | 3300006038 | Ga0075365_10152046 | Ga0075365_101520462 | 277 |
| 1234 | 3300006038 | Ga0075365_10170351 | Ga0075365_101703512 | 277 |
| 1235 | 3300006038 | Ga0075365_10237258 | Ga0075365_102372582 | 277 |
| 1236 | 3300006042 | Ga0075368_10028947 | Ga0075368_100289471 | 277 |
| 1237 | 3300006051 | Ga0075364_10117878 | Ga0075364_101178782 | 277 |
| 1238 | 3300006163 | Ga0070715_10000320 | Ga0070715_100003209 | 277 |
| 1239 | 3300006173 | Ga0070716_100001867 | Ga0070716_1000018678 | 277 |
| 1240 | 3300006175 | Ga0070712_100001878 | Ga0070712_10000187814 | 277 |
| 1241 | 3300006175 | Ga0070712_100028750 | Ga0070712_1000287503 | 277 |
| 1242 | 3300006177 | Ga0075362_10184085 | Ga0075362_101840852 | 277 |
| 1243 | 3300006237 | Ga0097621_100408495 | Ga0097621_1004084952 | 277 |
| 1244 | 3300006844 | Ga0075428_100009742 | Ga0075428_1000097422 | 277 |
| 1245 | 3300006844 | Ga0075428_100092828 | Ga0075428_1000928284 | 277 |
| 1246 | 3300006844 | Ga0075428_100109159 | Ga0075428_1001091593 | 277 |
| 1247 | 3300006844 | Ga0075428_100118910 | Ga0075428_1001189104 | 277 |
| 1248 | 3300006844 | Ga0075428_100189864 | Ga0075428_1001898642 | 277 |
| 1249 | 3300006846 | Ga0075430_100093588 | Ga0075430_1000935882 | 277 |
| 1250 | 3300006846 | Ga0075430_100100706 | Ga0075430_1001007061 | 277 |
| 1251 | 3300006847 | Ga0075431_100170055 | Ga0075431_1001700552 | 277 |
| 1252 | 3300006847 | Ga0075431_100306893 | Ga0075431_1003068932 | 277 |
| 1253 | 3300006852 | Ga0075433_10068973 | Ga0075433_100689732 | 277 |
| 1254 | 3300006871 | Ga0075434_100004709 | Ga0075434_1000047093 | 277 |
| 1255 | 3300006880 | Ga0075429_100080528 | Ga0075429_1000805284 | 277 |
| 1256 | 3300006880 | Ga0075429_100164325 | Ga0075429_1001643251 | 277 |
| 1257 | 3300006881 | Ga0068865_100012565 | Ga0068865_1000125651 | 277 |
| 1258 | 3300007788 | Ga0099795_10022863 | Ga0099795_100228632 | 277 |
| 1259 | 3300009094 | Ga0111539_10025207 | Ga0111539_100252075 | 277 |
| 1260 | 3300009094 | Ga0111539_10033030 | Ga0111539_100330304 | 277 |
| 1261 | 3300009094 | Ga0111539_10137087 | Ga0111539_101370872 | 277 |
| 1262 | 3300009094 | Ga0111539_10803545 | Ga0111539_108035452 | 277 |
| 1263 | 3300009098 | Ga0105245_10108434 | Ga0105245_101084342 | 277 |
| 1264 | 3300009098 | Ga0105245_10233393 | Ga0105245_102333932 | 277 |
| 1265 | 3300009147 | Ga0114129_10207383 | Ga0114129_102073832 | 277 |
| 1266 | 3300009177 | Ga0105248_10991186 | Ga0105248_109911861 | 277 |
| 1267 | 3300009553 | Ga0105249_10369412 | Ga0105249_103694122 | 277 |
| 1268 | 3300013296 | Ga0157374_10025104 | Ga0157374_100251042 | 277 |
| 1269 | 3300013308 | Ga0157375_10046832 | Ga0157375_100468325 | 277 |
| 1270 | 3300014325 | Ga0163163_10914649 | Ga0163163_109146491 | 277 |
| 1271 | 3300014326 | Ga0157380_10129944 | Ga0157380_101299442 | 277 |
| 1272 | 3300014969 | Ga0157376_10002959 | Ga0157376_100029599 | 277 |
| 1273 | 3300017792 | Ga0163161_10055080 | Ga0163161_100550802 | 277 |
| 1274 | 3300017792 | Ga0163161_10124347 | Ga0163161_101243472 | 277 |
| 1275 | 3300025295 | Ga0209564_1000164 | Ga0209564_100016462 | 277 |
| 1276 | 3300025295 | Ga0209564_1025658 | Ga0209564_10256582 | 277 |
| 1277 | 3300025297 | Ga0209758_1000407 | Ga0209758_100040760 | 277 |
| 1278 | 3300025297 | Ga0209758_1001983 | Ga0209758_10019833 | 277 |
| 1279 | 3300025297 | Ga0209758_1034572 | Ga0209758_10345722 | 277 |
| 1280 | 3300025299 | Ga0209256_1006969 | Ga0209256_10069695 | 277 |
| 1281 | 3300025302 | Ga0207426_1001388 | Ga0207426_10013887 | 277 |
| 1282 | 3300025304 | Ga0209257_1001136 | Ga0209257_100113628 | 277 |
| 1283 | 3300025885 | Ga0207653_10085811 | Ga0207653_100858112 | 277 |
| 1284 | 3300025898 | Ga0207692_10008475 | Ga0207692_100084753 | 277 |
| 1285 | 3300025905 | Ga0207685_10018550 | Ga0207685_100185501 | 277 |
| 1286 | 3300025906 | Ga0207699_10100942 | Ga0207699_101009421 | 277 |
| 1287 | 3300025907 | Ga0207645_10108673 | Ga0207645_101086732 | 277 |
| 1288 | 3300025908 | Ga0207643_10048218 | Ga0207643_100482183 | 277 |
| 1289 | 3300025915 | Ga0207693_10001385 | Ga0207693_100013857 | 277 |
| 1290 | 3300025915 | Ga0207693_10011746 | Ga0207693_100117466 | 277 |
| 1291 | 3300025916 | Ga0207663_10000136 | Ga0207663_100001362 | 277 |
| 1292 | 3300025918 | Ga0207662_10072909 | Ga0207662_100729092 | 277 |
| 1293 | 3300025919 | Ga0207657_10095571 | Ga0207657_100955713 | 277 |
| 1294 | 3300025927 | Ga0207687_10171833 | Ga0207687_101718332 | 277 |
| 1295 | 3300025928 | Ga0207700_10069437 | Ga0207700_100694374 | 277 |
| 1296 | 3300025929 | Ga0207664_10013549 | Ga0207664_100135496 | 277 |
| 1297 | 3300025929 | Ga0207664_10181276 | Ga0207664_101812762 | 277 |
| 1298 | 3300025933 | Ga0207706_10070045 | Ga0207706_100700454 | 277 |
| 1299 | 3300025935 | Ga0207709_10099344 | Ga0207709_100993441 | 277 |
| 1300 | 3300025935 | Ga0207709_10174095 | Ga0207709_101740952 | 277 |
| 1301 | 3300025936 | Ga0207670_10116122 | Ga0207670_101161222 | 277 |
| 1302 | 3300025936 | Ga0207670_10268001 | Ga0207670_102680012 | 277 |
| 1303 | 3300025937 | Ga0207669_10290104 | Ga0207669_102901042 | 277 |
| 1304 | 3300025937 | Ga0207669_10354712 | Ga0207669_103547122 | 277 |
| 1305 | 3300025939 | Ga0207665_10000064 | Ga0207665_1000006468 | 277 |
| 1306 | 3300025940 | Ga0207691_10061618 | Ga0207691_100616181 | 277 |
| 1307 | 3300025940 | Ga0207691_10457121 | Ga0207691_104571211 | 277 |
| 1308 | 3300025944 | Ga0207661_10169449 | Ga0207661_101694492 | 277 |
| 1309 | 3300025981 | Ga0207640_10165095 | Ga0207640_101650951 | 277 |
| 1310 | 3300025986 | Ga0207658_10357504 | Ga0207658_103575041 | 277 |
| 1311 | 3300026035 | Ga0207703_10242139 | Ga0207703_102421392 | 277 |
| 1312 | 3300026067 | Ga0207678_10148846 | Ga0207678_101488462 | 277 |
| 1313 | 3300026075 | Ga0207708_10026254 | Ga0207708_100262542 | 277 |
| 1314 | 3300026089 | Ga0207648_10006999 | Ga0207648_100069997 | 277 |
| 1315 | 3300026121 | Ga0207683_10030901 | Ga0207683_100309016 | 277 |
| 1316 | 3300026121 | Ga0207683_10105063 | Ga0207683_101050632 | 277 |
| 1317 | 3300026121 | Ga0207683_10249155 | Ga0207683_102491552 | 277 |
| 1318 | 3300027907 | Ga0207428_10028914 | Ga0207428_100289144 | 277 |
| 1319 | 3300027907 | Ga0207428_10030850 | Ga0207428_100308503 | 277 |
| 1320 | 3300028380 | Ga0268265_10178279 | Ga0268265_101782791 | 277 |
| 1321 | 3300028380 | Ga0268265_10239028 | Ga0268265_102390282 | 277 |
| 1322 | 3300028794 | Ga0307515_10008473 | Ga0307515_1000847316 | 277 |
| 1323 | 3300031548 | Ga0307408_100289875 | Ga0307408_1002898752 | 277 |
| 1324 | 3300031911 | Ga0307412_10014711 | Ga0307412_100147117 | 277 |
| 1325 | 3300031995 | Ga0307409_100136381 | Ga0307409_1001363812 | 277 |
| 1326 | 3300032002 | Ga0307416_100166125 | Ga0307416_1001661253 | 277 |
| 1327 | 3300032002 | Ga0307416_100166684 | Ga0307416_1001666842 | 277 |
| 1328 | 3300032126 | Ga0307415_100090459 | Ga0307415_1000904592 | 277 |
| 1329 | 3300033442 | Ga0315911_1000011 | Ga0315911_1000011105 | 277 |
| 1330 | 3300035089 | Ga0373944_0011346 | Ga0373944_0011346_1274_2113 | 277 |
| 1331 | 3300035111 | Ga0373923_0010861 | Ga0373923_0010861_1164_2003 | 277 |
| 1332 | 3300035113 | Ga0373936_0035174 | Ga0373936_0035174_1019_1858 | 277 |
| 1333 | 3300035116 | Ga0373945_0022797 | Ga0373945_0022797_13_852 | 277 |
| 1334 | 3300035170 | Ga0373943_0048743 | Ga0373943_0048743_353_1192 | 277 |
| 1335 | 3300035172 | Ga0373955_0105315 | Ga0373955_0105315_764_1603 | 277 |
| 1336 | 3300035207 | Ga0373942_0036963 | Ga0373942_0036963_131_970 | 277 |
| 1337 | 3300035242 | Ga0373962_0019931 | Ga0373962_0019931_824_1666 | 277 |
| 1338 | 3300035691 | Ga0373931_0024711 | Ga0373931_0024711_1991_2833 | 277 |
| 1339 | 3300035691 | Ga0373931_0311109 | Ga0373931_0311109_39_878 | 277 |
| 1340 | 3300035692 | Ga0373935_0009288 | Ga0373935_0009288_4323_5162 | 277 |
| 1341 | 3300035695 | Ga0373927_0034359 | Ga0373927_0034359_596_1435 | 277 |
| 1342 | 3300035695 | Ga0373927_0274979 | Ga0373927_0274979_257_1096 | 277 |
| 1343 | 3300035725 | Ga0373947_0010653 | Ga0373947_0010653_384_1223 | 277 |
| 1344 | 3300036401 | Ga0373937_0239485 | Ga0373937_0239485_222_1061 | 277 |
| 1345 | 3300037068 | Ga0373925_0016899 | Ga0373925_0016899_1511_2350 | 277 |
| 1346 | 3300037466 | Ga0395898_0125625 | Ga0395898_0125625_206_1108 | 277 |
| 1347 | 3300037471 | Ga0395905_0039879 | Ga0395905_0039879_1462_2364 | 277 |
| 1348 | 3300037471 | Ga0395905_0535264 | Ga0395905_0535264_78_917 | 277 |
| 1349 | 3300039437 | Ga0436365_0642532 | Ga0436365_0642532_351_1190 | 277 |
| 1350 | 3300039450 | Ga0436363_1394953 | Ga0436363_1394953_127_963 | 277 |
| 1351 | 3300041413 | Ga0439465_0042200 | Ga0439465_0042200_19_861 | 277 |
| 1352 | 3300044658 | Ga0466972_0000371 | Ga0466972_0000371_9841_10680 | 277 |
| 1353 | 3300044842 | Ga0466957_0256682 | Ga0466957_0256682_83_922 | 277 |
| 1354 | 3300045836 | Ga0466958_0186496 | Ga0466958_0186496_104_943 | 277 |
| 1355 | 3300045976 | Ga0466967_0144847 | Ga0466967_0144847_1204_2043 | 277 |
| 1356 | 3300045976 | Ga0466967_0388207 | Ga0466967_0388207_165_1004 | 277 |
| 1357 | 3300046460 | Ga0495638_0001295 | Ga0495638_0001295_11499_12338 | 277 |
| 1358 | 3300046460 | Ga0495638_0029593 | Ga0495638_0029593_1692_2531 | 277 |
| 1359 | 3300046472 | Ga0495580_0198352 | Ga0495580_0198352_385_1224 | 277 |
| 1360 | 3300046474 | Ga0495605_0053460 | Ga0495605_0053460_954_1793 | 277 |
| 1361 | 3300046475 | Ga0495639_0005177 | Ga0495639_0005177_2313_3152 | 277 |
| 1362 | 3300046477 | Ga0495664_0003641 | Ga0495664_0003641_6194_7033 | 277 |
| 1363 | 3300046492 | Ga0495585_0113489 | Ga0495585_0113489_185_1024 | 277 |
| 1364 | 3300046499 | Ga0495594_0094237 | Ga0495594_0094237_480_1319 | 277 |
| 1365 | 3300046515 | Ga0495620_0051357 | Ga0495620_0051357_697_1536 | 277 |
| 1366 | 3300046516 | Ga0495628_0232882 | Ga0495628_0232882_67_906 | 277 |
| 1367 | 3300046524 | Ga0495648_0033902 | Ga0495648_0033902_833_1795 | 277 |
| 1368 | 3300046524 | Ga0495648_0102821 | Ga0495648_0102821_288_1130 | 277 |
| 1369 | 3300046530 | Ga0495654_0053522 | Ga0495654_0053522_332_1171 | 277 |
| 1370 | 3300046664 | Ga0495659_0009843 | Ga0495659_0009843_938_1774 | 277 |
| 1371 | 3300046680 | Ga0495646_0050016 | Ga0495646_0050016_711_1550 | 277 |
| 1372 | 3300046683 | Ga0495658_0208822 | Ga0495658_0208822_50_889 | 277 |
| 1373 | 3300046684 | Ga0495669_0059993 | Ga0495669_0059993_647_1486 | 277 |
| 1374 | 3300046689 | Ga0495613_0205691 | Ga0495613_0205691_286_1125 | 277 |
| 1375 | 3300046694 | Ga0495649_0212609 | Ga0495649_0212609_149_991 | 277 |
| 1376 | 3300047315 | Ga0495581_0005368 | Ga0495581_0005368_2199_3038 | 277 |
| 1377 | 3300047317 | Ga0495604_0266501 | Ga0495604_0266501_144_983 | 277 |
| 1378 | 3300047319 | Ga0495674_0034030 | Ga0495674_0034030_1317_2156 | 277 |
| 1379 | 3300047320 | Ga0495672_0200710 | Ga0495672_0200710_127_966 | 277 |
| 1380 | 3300047673 | Ga0495593_0077190 | Ga0495593_0077190_874_1713 | 277 |
| 1381 | 3300048903 | Ga0496100_0040451 | Ga0496100_0040451_1392_2231 | 277 |
| 1382 | 3300048904 | Ga0496101_0051847 | Ga0496101_0051847_282_1121 | 277 |
| 1383 | 3300048905 | Ga0496102_0002717 | Ga0496102_0002717_33_872 | 277 |
| 1384 | 3300048907 | Ga0496104_0002941 | Ga0496104_0002941_12972_13811 | 277 |
| 1385 | 3300048907 | Ga0496104_0005997 | Ga0496104_0005997_7733_8572 | 277 |
| 1386 | 3300048908 | Ga0496105_0005733 | Ga0496105_0005733_454_1293 | 277 |
| 1387 | 3300048909 | Ga0496106_0559315 | Ga0496106_0559315_22_861 | 277 |
| 1388 | 3300048910 | Ga0496107_0001922 | Ga0496107_0001922_4250_5089 | 277 |
| 1389 | 3300048910 | Ga0496107_0195648 | Ga0496107_0195648_353_1192 | 277 |
| 1390 | 3300048913 | Ga0496110_0000889 | Ga0496110_0000889_4992_5831 | 277 |
| 1391 | 3300048913 | Ga0496110_0045689 | Ga0496110_0045689_2617_3456 | 277 |
| 1392 | 3300048913 | Ga0496110_0045760 | Ga0496110_0045760_1488_2327 | 277 |
| 1393 | 3300048914 | Ga0496111_0116665 | Ga0496111_0116665_366_1205 | 277 |
| 1394 | 3300048915 | Ga0496112_0000117 | Ga0496112_0000117_37010_37849 | 277 |
| 1395 | 3300048915 | Ga0496112_0024359 | Ga0496112_0024359_4785_5624 | 277 |
| 1396 | 3300048915 | Ga0496112_0072710 | Ga0496112_0072710_1536_2375 | 277 |
| 1397 | 3300048915 | Ga0496112_0094153 | Ga0496112_0094153_506_1345 | 277 |
| 1398 | 3300048915 | Ga0496112_0192936 | Ga0496112_0192936_79_918 | 277 |
| 1399 | 3300048916 | Ga0496113_0010717 | Ga0496113_0010717_4930_5769 | 277 |
| 1400 | 3300048917 | Ga0496114_0037479 | Ga0496114_0037479_814_1653 | 277 |
| 1401 | 3300048917 | Ga0496114_0230250 | Ga0496114_0230250_605_1444 | 277 |
| 1402 | 3300048918 | Ga0496115_0002584 | Ga0496115_0002584_2178_3017 | 277 |
| 1403 | 3300048923 | Ga0496120_0054973 | Ga0496120_0054973_53_892 | 277 |
| 1404 | 3300048924 | Ga0496121_0001006 | Ga0496121_0001006_37172_38011 | 277 |
| 1405 | 3300048925 | Ga0496122_0124378 | Ga0496122_0124378_80_919 | 277 |
| 1406 | 3300048928 | Ga0496125_0000063 | Ga0496125_0000063_31314_32153 | 277 |
| 1407 | 3300048928 | Ga0496125_0005173 | Ga0496125_0005173_11185_12024 | 277 |
| 1408 | 3300048928 | Ga0496125_0039397 | Ga0496125_0039397_316_1155 | 277 |
| 1409 | 3300048928 | Ga0496125_0064305 | Ga0496125_0064305_169_1008 | 277 |
| 1410 | 3300048929 | Ga0496126_0172406 | Ga0496126_0172406_393_1232 | 277 |
| 1411 | 3300048929 | Ga0496126_0295942 | Ga0496126_0295942_168_1007 | 277 |
| 1412 | 3300050489 | nmdc:mga03683_134761_c1 | nmdc:mga03683_134761_c1_19_858 | 277 |
| 1413 | 3300050491 | nmdc:mga00v17_240491_c1 | nmdc:mga00v17_240491_c1_92_931 | 277 |
| 1414 | 3300050492 | nmdc:mga0yw44_190057_c1 | nmdc:mga0yw44_190057_c1_403_1242 | 277 |
| 1415 | 3300050492 | nmdc:mga0yw44_19046_c1 | nmdc:mga0yw44_19046_c1_467_1309 | 277 |
| 1416 | 3300050494 | nmdc:mga06z11_22668_c1 | nmdc:mga06z11_22668_c1_24_863 | 277 |
| 1417 | 3300050495 | nmdc:mga04h51_4146_c1 | nmdc:mga04h51_4146_c1_2542_3381 | 277 |
| 1418 | 3300050496 | nmdc:mga07m45_128110_c1 | nmdc:mga07m45_128110_c1_190_1029 | 277 |
| 1419 | 3300050507 | nmdc:mga05p37_69744_c1 | nmdc:mga05p37_69744_c1_1659_2501 | 277 |
| 1420 | 3300050508 | nmdc:mga09592_145719_c1 | nmdc:mga09592_145719_c1_712_1554 | 277 |
| 1421 | 3300050508 | nmdc:mga09592_178482_c1 | nmdc:mga09592_178482_c1_560_1396 | 277 |
| 1422 | 3300050509 | nmdc:mga0qj67_141673_c1 | nmdc:mga0qj67_141673_c1_906_1748 | 277 |
| 1423 | 3300050509 | nmdc:mga0qj67_48176_c1 | nmdc:mga0qj67_48176_c1_978_1814 | 277 |
| 1424 | 3300050510 | nmdc:mga06r32_109575_c1 | nmdc:mga06r32_109575_c1_469_1311 | 277 |
| 1425 | 3300050510 | nmdc:mga06r32_541381_c1 | nmdc:mga06r32_541381_c1_140_979 | 277 |
| 1426 | 3300050511 | nmdc:mga08y16_36005_c1 | nmdc:mga08y16_36005_c1_1674_2513 | 277 |
| 1427 | 3300050511 | nmdc:mga08y16_514132_c1 | nmdc:mga08y16_514132_c1_255_1094 | 277 |
| 1428 | 3300050511 | nmdc:mga08y16_57115_c1 | nmdc:mga08y16_57115_c1_1085_1927 | 277 |
| 1429 | 3300050511 | nmdc:mga08y16_62145_c1 | nmdc:mga08y16_62145_c1_700_1542 | 277 |
| 1430 | 3300050511 | nmdc:mga08y16_622724_c1 | nmdc:mga08y16_622724_c1_112_951 | 277 |
| 1431 | 3300050512 | nmdc:mga0n895_4878_c1 | nmdc:mga0n895_4878_c1_1532_2371 | 277 |
| 1432 | 3300050515 | nmdc:mga0a205_1877_c1 | nmdc:mga0a205_1877_c1_10966_11805 | 277 |
| 1433 | 3300050515 | nmdc:mga0a205_30042_c1 | nmdc:mga0a205_30042_c1_530_1372 | 277 |
| 1434 | 3300053077 | Ga0495601_0241353 | Ga0495601_0241353_158_997 | 277 |
| 1435 | 3300053086 | Ga0500578_0084710 | Ga0500578_0084710_1047_1886 | 277 |
| 1436 | 3300053087 | Ga0500643_000019 | Ga0500643_000019_164680_165522 | 277 |
| 1437 | 3300053094 | Ga0500566_0001407 | Ga0500566_0001407_13191_14030 | 277 |
| 1438 | 3300053094 | Ga0500566_0017963 | Ga0500566_0017963_663_1502 | 277 |
| 1439 | 3300053096 | Ga0500641_0007284 | Ga0500641_0007284_809_1648 | 277 |
| 1440 | 3300053096 | Ga0500641_0015643 | Ga0500641_0015643_1303_2142 | 277 |
| 1441 | 3300053096 | Ga0500641_0044214 | Ga0500641_0044214_74_913 | 277 |
| 1442 | 3300053102 | Ga0500554_003583 | Ga0500554_003583_1075_1914 | 277 |
| 1443 | 3300053103 | Ga0500555_004780 | Ga0500555_004780_1224_2066 | 277 |
| 1444 | 3300053104 | Ga0500556_0081680 | Ga0500556_0081680_350_1189 | 277 |
| 1445 | 3300053105 | Ga0500557_000039 | Ga0500557_000039_38774_39613 | 277 |
| 1446 | 3300053109 | Ga0500569_009038 | Ga0500569_009038_751_1590 | 277 |
| 1447 | 3300053119 | Ga0500595_008228 | Ga0500595_008228_854_1693 | 277 |
| 1448 | 3300053119 | Ga0500595_048130 | Ga0500595_048130_53_892 | 277 |
| 1449 | 3300053130 | Ga0500642_0000285 | Ga0500642_0000285_4291_5130 | 277 |
| 1450 | 3300053134 | Ga0500658_0029431 | Ga0500658_0029431_604_1443 | 277 |
| 1451 | 3300053136 | Ga0500559_0020758 | Ga0500559_0020758_1219_2058 | 277 |
| 1452 | 3300053139 | Ga0500568_0004264 | Ga0500568_0004264_3878_4720 | 277 |
| 1453 | 3300053139 | Ga0500568_0083281 | Ga0500568_0083281_190_1029 | 277 |
| 1454 | 3300053145 | Ga0500586_001308 | Ga0500586_001308_2572_3411 | 277 |
| 1455 | 3300053151 | Ga0500604_0024805 | Ga0500604_0024805_868_1707 | 277 |
| 1456 | 3300053151 | Ga0500604_0031788 | Ga0500604_0031788_296_1135 | 277 |
| 1457 | 3300053151 | Ga0500604_0052567 | Ga0500604_0052567_314_1156 | 277 |
| 1458 | 3300053156 | Ga0500622_0033061 | Ga0500622_0033061_888_1730 | 277 |
| 1459 | 3300053158 | Ga0500627_0051009 | Ga0500627_0051009_913_1752 | 277 |
| 1460 | 3300053162 | Ga0500638_031056 | Ga0500638_031056_1090_1929 | 277 |
| 1461 | 3300053177 | Ga0500636_0000313 | Ga0500636_0000313_4702_5544 | 277 |
| 1462 | 3300053177 | Ga0500636_0145360 | Ga0500636_0145360_417_1256 | 277 |
| 1463 | 3300053178 | Ga0500637_0000655 | Ga0500637_0000655_10004_10843 | 277 |
| 1464 | 3300053737 | Ga0500601_000542 | Ga0500601_000542_53_895 | 277 |
| 1465 | iso_pu_bacteria | 2513237087 | 2513592132 | 277 |
| 1466 | iso_pu_bacteria | 2929199973 | 2929202433 | 277 |
| 1467 | iso_pu_bacteria | 8055909800 | 8055915835 | 277 |
| 1468 | 3300013102 | Ga0157371_10056102 | Ga0157371_100561023 | 278 |
| 1469 | 3300025292 | Ga0209676_1002143 | Ga0209676_10021435 | 278 |
| 1470 | 3300025298 | Ga0209050_1000925 | Ga0209050_10009257 | 278 |
| 1471 | 3300025303 | Ga0209051_1009022 | Ga0209051_10090227 | 278 |
| 1472 | 3300027312 | Ga0209371_1023377 | Ga0209371_10233771 | 278 |
| 1473 | 3300028794 | Ga0307515_10062205 | Ga0307515_100622056 | 278 |
| 1474 | 3300030500 | Ga0268256_1026489 | Ga0268256_10264892 | 278 |
| 1475 | 3300031456 | Ga0307513_10004235 | Ga0307513_100042359 | 278 |
| 1476 | 3300044712 | Ga0453684_0005314 | Ga0453684_0005314_17301_18143 | 278 |
| 1477 | 3300044712 | Ga0453684_0045710 | Ga0453684_0045710_1864_2706 | 278 |
| 1478 | 3300044712 | Ga0453684_0609261 | Ga0453684_0609261_141_1019 | 278 |
| 1479 | 3300045051 | Ga0451576_0132049 | Ga0451576_0132049_964_1806 | 278 |
| 1480 | 3300048919 | Ga0496116_0049570 | Ga0496116_0049570_535_1377 | 278 |
| 1481 | 3300048921 | Ga0496118_0100525 | Ga0496118_0100525_257_1099 | 278 |
| 1482 | 3300048922 | Ga0496119_0016661 | Ga0496119_0016661_524_1366 | 278 |
| 1483 | 3300048923 | Ga0496120_0020029 | Ga0496120_0020029_107_949 | 278 |
| 1484 | 3300048924 | Ga0496121_0000094 | Ga0496121_0000094_199469_200311 | 278 |
| 1485 | 3300048924 | Ga0496121_0167519 | Ga0496121_0167519_202_1044 | 278 |
| 1486 | 3300048927 | Ga0496124_0000004 | Ga0496124_0000004_904480_905322 | 278 |
| 1487 | 3300048927 | Ga0496124_0069590 | Ga0496124_0069590_130_972 | 278 |
| 1488 | 3300048928 | Ga0496125_0000363 | Ga0496125_0000363_4695_5537 | 278 |
| 1489 | 3300050491 | nmdc:mga00v17_101419_c1 | nmdc:mga00v17_101419_c1_833_1675 | 278 |
| 1490 | 3300050491 | nmdc:mga00v17_6544_c1 | nmdc:mga00v17_6544_c1_1797_2639 | 278 |
| 1491 | iso_pu_bacteria | 2521172590 | 2521559257 | 278 |
| 1492 | iso_pu_bacteria | 2808606386 | 2808981295 | 278 |
| 1493 | iso_pu_bacteria | 2808606415 | 2809128881 | 278 |
| 1494 | iso_pu_bacteria | 2808606419 | 2809148502 | 278 |
| 1495 | iso_pu_bacteria | 2818991449 | 2819615762 | 278 |
| 1496 | iso_pu_bacteria | 2821131069 | 2821134903 | 278 |
| 1497 | iso_pu_bacteria | 2852618963 | 2852621036 | 278 |
| 1498 | iso_pu_bacteria | 2857553236 | 2857558181 | 278 |
| 1499 | iso_pu_bacteria | 2904439833 | 2904443634 | 278 |
| 1500 | iso_pu_bacteria | 2904530477 | 2904532551 | 278 |
| 1501 | iso_pu_bacteria | 2904584206 | 2904585020 | 278 |
| 1502 | iso_pu_bacteria | 2904589729 | 2904593369 | 278 |
| 1503 | iso_pu_bacteria | 2904601388 | 2904605563 | 278 |
| 1504 | iso_pu_bacteria | 2919079590 | 2919081336 | 278 |
| 1505 | 3300003792 | Ga0055540_1002994 | Ga0055540_10029945 | 279 |
| 1506 | 3300005295 | Ga0065707_10014575 | Ga0065707_100145752 | 279 |
| 1507 | 3300005340 | Ga0070689_100136116 | Ga0070689_1001361162 | 279 |
| 1508 | 3300005444 | Ga0070694_100277030 | Ga0070694_1002770301 | 279 |
| 1509 | 3300005937 | Ga0081455_10258385 | Ga0081455_102583852 | 279 |
| 1510 | 3300006186 | Ga0075369_10013732 | Ga0075369_100137323 | 279 |
| 1511 | 3300006844 | Ga0075428_100000103 | Ga0075428_10000010314 | 279 |
| 1512 | 3300006846 | Ga0075430_100120620 | Ga0075430_1001206202 | 279 |
| 1513 | 3300006846 | Ga0075430_100365116 | Ga0075430_1003651162 | 279 |
| 1514 | 3300006847 | Ga0075431_100063577 | Ga0075431_1000635772 | 279 |
| 1515 | 3300006880 | Ga0075429_100095420 | Ga0075429_1000954202 | 279 |
| 1516 | 3300009094 | Ga0111539_10005030 | Ga0111539_1000503012 | 279 |
| 1517 | 3300009094 | Ga0111539_10162201 | Ga0111539_101622012 | 279 |
| 1518 | 3300009147 | Ga0114129_10048974 | Ga0114129_100489742 | 279 |
| 1519 | 3300025273 | Ga0209673_1014952 | Ga0209673_10149522 | 279 |
| 1520 | 3300025303 | Ga0209051_1000059 | Ga0209051_1000059172 | 279 |
| 1521 | 3300025304 | Ga0209257_1000022 | Ga0209257_1000022228 | 279 |
| 1522 | 3300027543 | Ga0209999_1000035 | Ga0209999_10000358 | 279 |
| 1523 | 3300027665 | Ga0209983_1007011 | Ga0209983_10070112 | 279 |
| 1524 | 3300027682 | Ga0209971_1012094 | Ga0209971_10120942 | 279 |
| 1525 | 3300027876 | Ga0209974_10003197 | Ga0209974_100031976 | 279 |
| 1526 | 3300031251 | Ga0265327_10063988 | Ga0265327_100639882 | 279 |
| 1527 | 3300031456 | Ga0307513_10069332 | Ga0307513_100693322 | 279 |
| 1528 | 3300031691 | Ga0316579_10007507 | Ga0316579_100075074 | 279 |
| 1529 | 3300031852 | Ga0307410_10319488 | Ga0307410_103194882 | 279 |
| 1530 | 3300031903 | Ga0307407_10111539 | Ga0307407_101115392 | 279 |
| 1531 | 3300031911 | Ga0307412_10238555 | Ga0307412_102385552 | 279 |
| 1532 | 3300032002 | Ga0307416_100220569 | Ga0307416_1002205692 | 279 |
| 1533 | 3300032005 | Ga0307411_10116554 | Ga0307411_101165542 | 279 |
| 1534 | 3300032126 | Ga0307415_100191004 | Ga0307415_1001910042 | 279 |
| 1535 | 3300035090 | Ga0373949_0016585 | Ga0373949_0016585_360_1202 | 279 |
| 1536 | 3300035112 | Ga0373932_0002652 | Ga0373932_0002652_2145_2987 | 279 |
| 1537 | 3300035241 | Ga0373961_0006253 | Ga0373961_0006253_926_1768 | 279 |
| 1538 | 3300035242 | Ga0373962_0004069 | Ga0373962_0004069_954_1796 | 279 |
| 1539 | 3300035691 | Ga0373931_0000242 | Ga0373931_0000242_4102_4944 | 279 |
| 1540 | 3300039437 | Ga0436365_0098421 | Ga0436365_0098421_60_902 | 279 |
| 1541 | 3300045051 | Ga0451576_0013397 | Ga0451576_0013397_8124_8966 | 279 |
| 1542 | 3300047469 | Ga0495673_0035151 | Ga0495673_0035151_700_1554 | 279 |
| 1543 | 3300050489 | nmdc:mga03683_3361_c2 | nmdc:mga03683_3361_c2_608_1462 | 279 |
| 1544 | 3300050496 | nmdc:mga07m45_27827_c1 | nmdc:mga07m45_27827_c1_1599_2453 | 279 |
| 1545 | 3300050507 | nmdc:mga05p37_3429_c1 | nmdc:mga05p37_3429_c1_16447_17289 | 279 |
| 1546 | 3300050508 | nmdc:mga09592_11500_c1 | nmdc:mga09592_11500_c1_2121_2963 | 279 |
| 1547 | 3300050508 | nmdc:mga09592_136715_c1 | nmdc:mga09592_136715_c1_571_1413 | 279 |
| 1548 | 3300050508 | nmdc:mga09592_304869_c1 | nmdc:mga09592_304869_c1_276_1118 | 279 |
| 1549 | 3300050509 | nmdc:mga0qj67_260295_c1 | nmdc:mga0qj67_260295_c1_266_1111 | 279 |
| 1550 | 3300050509 | nmdc:mga0qj67_97211_c1 | nmdc:mga0qj67_97211_c1_641_1483 | 279 |
| 1551 | 3300050510 | nmdc:mga06r32_16885_c1 | nmdc:mga06r32_16885_c1_4133_4975 | 279 |
| 1552 | 3300050511 | nmdc:mga08y16_4141_c1 | nmdc:mga08y16_4141_c1_14108_14950 | 279 |
| 1553 | 3300050511 | nmdc:mga08y16_86448_c1 | nmdc:mga08y16_86448_c1_2176_3018 | 279 |
| 1554 | 3300050511 | nmdc:mga08y16_93457_c2 | nmdc:mga08y16_93457_c2_214_1056 | 279 |
| 1555 | 3300050516 | nmdc:mga0sz30_155_c2 | nmdc:mga0sz30_155_c2_10920_11774 | 279 |
| 1556 | iso_pu_bacteria | 2548876994 | 2550693792 | 279 |
| 1557 | iso_pu_bacteria | 2765235838 | 2765568570 | 279 |
| 1558 | iso_pu_bacteria | 2839094727 | 2839096550 | 279 |
| 1559 | iso_pu_bacteria | 2919046199 | 2919048138 | 279 |
| 1560 | 3300006051 | Ga0075364_10186312 | Ga0075364_101863122 | 280 |
| 1561 | 3300006186 | Ga0075369_10032648 | Ga0075369_100326482 | 280 |
| 1562 | 3300006195 | Ga0075366_10163909 | Ga0075366_101639092 | 280 |
| 1563 | 3300006195 | Ga0075366_10247745 | Ga0075366_102477452 | 280 |
| 1564 | 3300006195 | Ga0075366_10314140 | Ga0075366_103141402 | 280 |
| 1565 | 3300006353 | Ga0075370_10049886 | Ga0075370_100498862 | 280 |
| 1566 | 3300031507 | Ga0307509_10111327 | Ga0307509_101113272 | 280 |
| 1567 | 3300033179 | Ga0307507_10146187 | Ga0307507_101461872 | 280 |
| 1568 | 3300045051 | Ga0451576_0288831 | Ga0451576_0288831_279_1157 | 280 |
| 1569 | 3300050496 | nmdc:mga07m45_48928_c1 | nmdc:mga07m45_48928_c1_622_1467 | 280 |
| 1570 | iso_pu_bacteria | 2919046199 | 2919049616 | 280 |
| 1571 | 3300003751 | Ga0055538_1000054 | Ga0055538_100005464 | 281 |
| 1572 | 3300003752 | Ga0055539_1000066 | Ga0055539_100006664 | 281 |
| 1573 | 3300003756 | Ga0055533_1000076 | Ga0055533_100007664 | 281 |
| 1574 | 3300003759 | Ga0055525_1000098 | Ga0055525_100009864 | 281 |
| 1575 | 3300003841 | Ga0055541_1000056 | Ga0055541_100005664 | 281 |
| 1576 | 3300005331 | Ga0070670_100000081 | Ga0070670_10000008112 | 281 |
| 1577 | 3300005367 | Ga0070667_100001429 | Ga0070667_10000142914 | 281 |
| 1578 | 3300005578 | Ga0068854_100006416 | Ga0068854_1000064164 | 281 |
| 1579 | 3300005618 | Ga0068864_100000016 | Ga0068864_10000001613 | 281 |
| 1580 | 3300005841 | Ga0068863_100001887 | Ga0068863_10000188711 | 281 |
| 1581 | 3300005844 | Ga0068862_100000068 | Ga0068862_10000006813 | 281 |
| 1582 | 3300009011 | Ga0105251_10002065 | Ga0105251_100020653 | 281 |
| 1583 | 3300009036 | Ga0105244_10053100 | Ga0105244_100531002 | 281 |
| 1584 | 3300009545 | Ga0105237_10073094 | Ga0105237_100730942 | 281 |
| 1585 | 3300009551 | Ga0105238_10003628 | Ga0105238_1000362811 | 281 |
| 1586 | 3300015261 | Ga0182006_1001196 | Ga0182006_10011969 | 281 |
| 1587 | 3300025224 | Ga0209784_100002 | Ga0209784_1000021551 | 281 |
| 1588 | 3300025225 | Ga0209566_100003 | Ga0209566_1000031551 | 281 |
| 1589 | 3300025226 | Ga0209674_100004 | Ga0209674_1000041551 | 281 |
| 1590 | 3300025230 | Ga0209563_100006 | Ga0209563_1000061551 | 281 |
| 1591 | 3300025253 | Ga0209677_100003 | Ga0209677_1000031551 | 281 |
| 1592 | 3300025913 | Ga0207695_10001540 | Ga0207695_1000154049 | 281 |
| 1593 | 3300025914 | Ga0207671_10032015 | Ga0207671_100320154 | 281 |
| 1594 | 3300025924 | Ga0207694_10014027 | Ga0207694_100140272 | 281 |
| 1595 | 3300025925 | Ga0207650_10000288 | Ga0207650_1000028848 | 281 |
| 1596 | 3300025986 | Ga0207658_10000466 | Ga0207658_1000046629 | 281 |
| 1597 | 3300026088 | Ga0207641_10000103 | Ga0207641_1000010312 | 281 |
| 1598 | 3300026095 | Ga0207676_10000044 | Ga0207676_1000004412 | 281 |
| 1599 | 3300028380 | Ga0268265_10000142 | Ga0268265_1000014212 | 281 |
| 1600 | 3300031548 | Ga0307408_100180100 | Ga0307408_1001801002 | 281 |
| 1601 | 3300031616 | Ga0307508_10000150 | Ga0307508_1000015053 | 281 |
| 1602 | 3300031731 | Ga0307405_10052767 | Ga0307405_100527672 | 281 |
| 1603 | 3300033179 | Ga0307507_10211383 | Ga0307507_102113832 | 281 |
| 1604 | 3300033180 | Ga0307510_10316544 | Ga0307510_103165441 | 281 |
| 1605 | 3300039447 | Ga0436361_0053786 | Ga0436361_0053786_16791_17639 | 281 |
| 1606 | 3300044712 | Ga0453684_0000063 | Ga0453684_0000063_243986_244837 | 281 |
| 1607 | 3300046501 | Ga0495607_0000018 | Ga0495607_0000018_18788_19639 | 281 |
| 1608 | 3300046515 | Ga0495620_0000678 | Ga0495620_0000678_1507_2358 | 281 |
| 1609 | 3300046515 | Ga0495620_0032690 | Ga0495620_0032690_13_864 | 281 |
| 1610 | 3300046519 | Ga0495632_0000102 | Ga0495632_0000102_31388_32239 | 281 |
| 1611 | 3300046524 | Ga0495648_0000093 | Ga0495648_0000093_40254_41105 | 281 |
| 1612 | 3300046538 | Ga0495609_0010985 | Ga0495609_0010985_3113_3964 | 281 |
| 1613 | 3300046557 | Ga0495622_0053566 | Ga0495622_0053566_905_1756 | 281 |
| 1614 | 3300046616 | Ga0495668_0027182 | Ga0495668_0027182_495_1346 | 281 |
| 1615 | 3300047469 | Ga0495673_0002002 | Ga0495673_0002002_3914_4765 | 281 |
| 1616 | 3300048906 | Ga0496103_0004038 | Ga0496103_0004038_3087_3938 | 281 |
| 1617 | 3300048920 | Ga0496117_0013767 | Ga0496117_0013767_2929_3780 | 281 |
| 1618 | 3300048921 | Ga0496118_0001099 | Ga0496118_0001099_10914_11765 | 281 |
| 1619 | 3300049460 | Ga0495682_0000087 | Ga0495682_0000087_18290_19141 | 281 |
| 1620 | 3300053125 | Ga0500618_000286 | Ga0500618_000286_27558_28406 | 281 |
| 1621 | iso_pu_bacteria | 2643221544 | 2643746030 | 281 |
| 1622 | iso_pu_bacteria | 2643221585 | 2643936995 | 281 |
| 1623 | iso_pu_bacteria | 2643221639 | 2644218041 | 281 |
| 1624 | iso_pu_bacteria | 2643221656 | 2644318160 | 281 |
| 1625 | iso_pu_bacteria | 2738543013 | 2739250193 | 281 |
| 1626 | iso_pu_bacteria | 2818991445 | 2819595073 | 281 |
| 1627 | 3300046660 | Ga0495625_0000657 | Ga0495625_0000657_36332_37207 | 282 |
| 1628 | 3300048928 | Ga0496125_0002076 | Ga0496125_0002076_279_1154 | 282 |
| 1629 | 3300048929 | Ga0496126_0415424 | Ga0496126_0415424_32_907 | 282 |
| 1630 | iso_pu_bacteria | 2511231002 | 2511244993 | 282 |
| 1631 | iso_pu_bacteria | 2511231003 | 2511252131 | 282 |
| 1632 | iso_pu_bacteria | 2643221646 | 2644258218 | 282 |
| 1633 | iso_pu_bacteria | 2831864461 | 2831866719 | 282 |
| 1634 | iso_pu_bacteria | 2857564685 | 2857569715 | 282 |
| 1635 | iso_pu_bacteria | 2884811622 | 2884814939 | 282 |
| 1636 | iso_pu_bacteria | 2884836552 | 2884836775 | 282 |
| 1637 | iso_pu_bacteria | 2884852848 | 2884853066 | 282 |
| 1638 | iso_pu_bacteria | 2896154374 | 2896155816 | 282 |
| 1639 | 3300027543 | Ga0209999_1006003 | Ga0209999_10060032 | 283 |
| 1640 | 3300027695 | Ga0209966_1000046 | Ga0209966_100004620 | 283 |
| 1641 | iso_pu_bacteria | 2738541337 | 2739057176 | 283 |
| 1642 | iso_pu_bacteria | 2857576091 | 2857576595 | 283 |
| 1643 | iso_pu_bacteria | 2919704043 | 2919708155 | 283 |
| 1644 | 3300002704 | JGI25155J39150_1000188 | JGI25155J39150_100018823 | 284 |
| 1645 | 3300002705 | JGI25156J39149_1000150 | JGI25156J39149_100015025 | 284 |
| 1646 | 3300002738 | JGI25154J39366_1000165 | JGI25154J39366_100016525 | 284 |
| 1647 | 3300002741 | JGI25157J39369_1000383 | JGI25157J39369_10003838 | 284 |
| 1648 | 3300003758 | Ga0055532_1000097 | Ga0055532_100009762 | 284 |
| 1649 | 3300003761 | Ga0055535_1003562 | Ga0055535_10035622 | 284 |
| 1650 | 3300003791 | Ga0055530_10008420 | Ga0055530_100084204 | 284 |
| 1651 | 3300003792 | Ga0055540_1000007 | Ga0055540_10000075 | 284 |
| 1652 | 3300005331 | Ga0070670_100056875 | Ga0070670_1000568754 | 284 |
| 1653 | 3300005719 | Ga0068861_100196620 | Ga0068861_1001966202 | 284 |
| 1654 | 3300005844 | Ga0068862_100004260 | Ga0068862_10000426012 | 284 |
| 1655 | 3300006038 | Ga0075365_10025380 | Ga0075365_100253803 | 284 |
| 1656 | 3300006946 | Ga0079104_1000009 | Ga0079104_1000009275 | 284 |
| 1657 | 3300009093 | Ga0105240_10003119 | Ga0105240_1000311912 | 284 |
| 1658 | 3300009551 | Ga0105238_10052431 | Ga0105238_100524312 | 284 |
| 1659 | 3300025206 | Ga0209435_100040 | Ga0209435_10004022 | 284 |
| 1660 | 3300025229 | Ga0209147_100141 | Ga0209147_10014177 | 284 |
| 1661 | 3300025242 | Ga0209258_100657 | Ga0209258_10065717 | 284 |
| 1662 | 3300025246 | Ga0209646_1000253 | Ga0209646_100025322 | 284 |
| 1663 | 3300025250 | Ga0209026_1000306 | Ga0209026_100030627 | 284 |
| 1664 | 3300025256 | Ga0209759_1000398 | Ga0209759_100039827 | 284 |
| 1665 | 3300025272 | Ga0209455_1012365 | Ga0209455_10123652 | 284 |
| 1666 | 3300025298 | Ga0209050_1001541 | Ga0209050_10015415 | 284 |
| 1667 | 3300025303 | Ga0209051_1000004 | Ga0209051_100000458 | 284 |
| 1668 | 3300025304 | Ga0209257_1000038 | Ga0209257_1000038192 | 284 |
| 1669 | 3300025304 | Ga0209257_1000044 | Ga0209257_1000044368 | 284 |
| 1670 | 3300025913 | Ga0207695_10023519 | Ga0207695_100235192 | 284 |
| 1671 | 3300025924 | Ga0207694_10035008 | Ga0207694_100350082 | 284 |
| 1672 | 3300025925 | Ga0207650_10049334 | Ga0207650_100493343 | 284 |
| 1673 | 3300026118 | Ga0207675_100189232 | Ga0207675_1001892322 | 284 |
| 1674 | 3300026142 | Ga0207698_10033824 | Ga0207698_100338244 | 284 |
| 1675 | 3300027111 | Ga0209281_1000023 | Ga0209281_1000023112 | 284 |
| 1676 | 3300031548 | Ga0307408_100007613 | Ga0307408_1000076132 | 284 |
| 1677 | 3300031911 | Ga0307412_10128271 | Ga0307412_101282712 | 284 |
| 1678 | 3300042876 | Ga0451577_0244892 | Ga0451577_0244892_471_1340 | 284 |
| 1679 | 3300045051 | Ga0451576_0091312 | Ga0451576_0091312_160_1029 | 284 |
| 1680 | 3300046524 | Ga0495648_0010663 | Ga0495648_0010663_5494_6357 | 284 |
| 1681 | 3300048905 | Ga0496102_0002990 | Ga0496102_0002990_1679_2548 | 284 |
| 1682 | 3300048919 | Ga0496116_0003967 | Ga0496116_0003967_12374_13255 | 284 |
| 1683 | 3300048924 | Ga0496121_0136095 | Ga0496121_0136095_539_1420 | 284 |
| 1684 | 3300048925 | Ga0496122_0000693 | Ga0496122_0000693_38095_38976 | 284 |
| 1685 | 3300048926 | Ga0496123_0000433 | Ga0496123_0000433_46339_47220 | 284 |
| 1686 | iso_pu_bacteria | 2643221570 | 2643866285 | 284 |
| 1687 | iso_pu_bacteria | 2643221596 | 2643994275 | 284 |
| 1688 | iso_pu_bacteria | 2643221609 | 2644057469 | 284 |
| 1689 | iso_pu_bacteria | 2643221611 | 2644072442 | 284 |
| 1690 | iso_pu_bacteria | 2643221652 | 2644293105 | 284 |
| 1691 | iso_pu_bacteria | 2738543012 | 2739241740 | 284 |
| 1692 | iso_pu_bacteria | 2816332133 | 2816470955 | 284 |
| 1693 | iso_pu_bacteria | 2842718218 | 2842718236 | 284 |
| 1694 | iso_pu_bacteria | 2842733646 | 2842736913 | 284 |
| 1695 | iso_pu_bacteria | 2990710928 | 2990714339 | 284 |
| 1696 | 3300002704 | JGI25155J39150_1000538 | JGI25155J39150_10005387 | 285 |
| 1697 | 3300002738 | JGI25154J39366_1000210 | JGI25154J39366_100021024 | 285 |
| 1698 | 3300003354 | JGI25160J50197_1000198 | JGI25160J50197_100019835 | 285 |
| 1699 | 3300003374 | JGI25161J50226_1000021 | JGI25161J50226_1000021138 | 285 |
| 1700 | 3300003775 | Ga0055524_1000033 | Ga0055524_100003359 | 285 |
| 1701 | 3300004625 | Ga0055543_1000238 | Ga0055543_100023818 | 285 |
| 1702 | 3300005262 | Ga0065165_1002756 | Ga0065165_100275610 | 285 |
| 1703 | 3300005577 | Ga0068857_100725251 | Ga0068857_1007252511 | 285 |
| 1704 | 3300009093 | Ga0105240_10015980 | Ga0105240_100159808 | 285 |
| 1705 | 3300014497 | Ga0182008_10130023 | Ga0182008_101300232 | 285 |
| 1706 | 3300015261 | Ga0182006_1015553 | Ga0182006_10155534 | 285 |
| 1707 | 3300025233 | Ga0209437_100229 | Ga0209437_1002298 | 285 |
| 1708 | 3300025246 | Ga0209646_1000204 | Ga0209646_100020438 | 285 |
| 1709 | 3300025256 | Ga0209759_1000298 | Ga0209759_100029838 | 285 |
| 1710 | 3300025284 | Ga0209130_1000103 | Ga0209130_100010326 | 285 |
| 1711 | 3300025291 | Ga0209675_1013210 | Ga0209675_10132102 | 285 |
| 1712 | 3300025298 | Ga0209050_1002687 | Ga0209050_10026872 | 285 |
| 1713 | 3300025299 | Ga0209256_1000019 | Ga0209256_1000019336 | 285 |
| 1714 | 3300025302 | Ga0207426_1000586 | Ga0207426_100058626 | 285 |
| 1715 | 3300025913 | Ga0207695_10017000 | Ga0207695_100170002 | 285 |
| 1716 | 3300031456 | Ga0307513_10000568 | Ga0307513_1000056829 | 285 |
| 1717 | 3300032004 | Ga0307414_10161439 | Ga0307414_101614392 | 285 |
| 1718 | 3300032005 | Ga0307411_10009963 | Ga0307411_100099633 | 285 |
| 1719 | 3300042127 | Ga0450890_002196 | Ga0450890_002196_1106_1975 | 285 |
| 1720 | 3300042532 | Ga0450893_0001826 | Ga0450893_0001826_1600_2469 | 285 |
| 1721 | 3300046524 | Ga0495648_0005295 | Ga0495648_0005295_2944_3807 | 285 |
| 1722 | 3300048917 | Ga0496114_0047484 | Ga0496114_0047484_2066_2935 | 285 |
| 1723 | 3300049665 | Ga0501227_023049 | Ga0501227_023049_263_1132 | 285 |
| 1724 | 3300049669 | Ga0501235_004060 | Ga0501235_004060_749_1618 | 285 |
| 1725 | 3300049687 | Ga0501258_004539 | Ga0501258_004539_139_1008 | 285 |
| 1726 | 3300049704 | Ga0501221_004443 | Ga0501221_004443_853_1722 | 285 |
| 1727 | 3300049706 | Ga0501229_000133 | Ga0501229_000133_5861_6730 | 285 |
| 1728 | 3300049706 | Ga0501229_007113 | Ga0501229_007113_85_954 | 285 |
| 1729 | 3300049764 | Ga0501267_001299 | Ga0501267_001299_556_1425 | 285 |
| 1730 | 3300050493 | nmdc:mga0k408_56087_c1 | nmdc:mga0k408_56087_c1_349_1206 | 285 |
| 1731 | 3300053088 | Ga0500644_0002483 | Ga0500644_0002483_3497_4360 | 285 |
| 1732 | 3300053730 | Ga0500645_000422 | Ga0500645_000422_7658_8521 | 285 |
| 1733 | iso_pu_bacteria | 2599185214 | 2599625545 | 285 |
| 1734 | iso_pu_bacteria | 2599185226 | 2599673558 | 285 |
| 1735 | iso_pu_bacteria | 2599185227 | 2599683228 | 285 |
| 1736 | iso_pu_bacteria | 2599185229 | 2599695284 | 285 |
| 1737 | iso_pu_bacteria | 2738541277 | 2738719160 | 285 |
| 1738 | iso_pu_bacteria | 2738543019 | 2739281922 | 285 |
| 1739 | iso_pu_bacteria | 2818991446 | 2819599647 | 285 |
| 1740 | iso_pu_bacteria | 2831265667 | 2831271081 | 285 |
| 1741 | iso_pu_bacteria | 2838054893 | 2838055671 | 285 |
| 1742 | iso_pu_bacteria | 2842677519 | 2842680806 | 285 |
| 1743 | iso_pu_bacteria | 2885198086 | 2885200792 | 285 |
| 1744 | iso_pu_bacteria | 2885211737 | 2885214425 | 285 |
| 1745 | iso_pu_bacteria | 2899924645 | 2899927720 | 285 |
| 1746 | iso_pu_bacteria | 2904449895 | 2904450593 | 285 |
| 1747 | iso_pu_bacteria | 2904456579 | 2904456585 | 285 |
| 1748 | iso_pu_bacteria | 2928037797 | 2928042002 | 285 |
| 1749 | iso_pu_bacteria | 2928044640 | 2928049566 | 285 |
| 1750 | iso_pu_bacteria | 2928051484 | 2928051759 | 285 |
| 1751 | iso_pu_bacteria | 2928064002 | 2928065548 | 285 |
| 1752 | iso_pu_bacteria | 2928070936 | 2928073007 | 285 |
| 1753 | iso_pu_bacteria | 2928084124 | 2928086806 | 285 |
| 1754 | iso_pu_bacteria | 2929520902 | 2929521310 | 285 |
| 1755 | iso_pu_bacteria | 2945945610 | 2945949328 | 285 |
| 1756 | 3300003322 | rootL2_10019891 | rootL2_1001989112 | 286 |
| 1757 | 3300003771 | Ga0055526_1002491 | Ga0055526_10024914 | 286 |
| 1758 | 3300006038 | Ga0075365_10006622 | Ga0075365_100066225 | 286 |
| 1759 | 3300006051 | Ga0075364_10051051 | Ga0075364_100510514 | 286 |
| 1760 | 3300006058 | Ga0075432_10005080 | Ga0075432_100050805 | 286 |
| 1761 | 3300006177 | Ga0075362_10016670 | Ga0075362_100166702 | 286 |
| 1762 | 3300006195 | Ga0075366_10008657 | Ga0075366_100086574 | 286 |
| 1763 | 3300014497 | Ga0182008_10075669 | Ga0182008_100756692 | 286 |
| 1764 | 3300015262 | Ga0182007_10000252 | Ga0182007_100002525 | 286 |
| 1765 | 3300025273 | Ga0209673_1002149 | Ga0209673_10021497 | 286 |
| 1766 | 3300025295 | Ga0209564_1000005 | Ga0209564_1000005396 | 286 |
| 1767 | 3300028794 | Ga0307515_10001611 | Ga0307515_1000161127 | 286 |
| 1768 | 3300028794 | Ga0307515_10006414 | Ga0307515_1000641413 | 286 |
| 1769 | 3300028794 | Ga0307515_10008712 | Ga0307515_1000871214 | 286 |
| 1770 | 3300028794 | Ga0307515_10056637 | Ga0307515_100566373 | 286 |
| 1771 | 3300031456 | Ga0307513_10012841 | Ga0307513_100128414 | 286 |
| 1772 | 3300031456 | Ga0307513_10335005 | Ga0307513_103350052 | 286 |
| 1773 | 3300031548 | Ga0307408_100070704 | Ga0307408_1000707042 | 286 |
| 1774 | 3300031649 | Ga0307514_10000641 | Ga0307514_1000064119 | 286 |
| 1775 | 3300031649 | Ga0307514_10108177 | Ga0307514_101081772 | 286 |
| 1776 | 3300031731 | Ga0307405_10090061 | Ga0307405_100900612 | 286 |
| 1777 | 3300031824 | Ga0307413_10065803 | Ga0307413_100658032 | 286 |
| 1778 | 3300031911 | Ga0307412_10071231 | Ga0307412_100712311 | 286 |
| 1779 | 3300032004 | Ga0307414_10101810 | Ga0307414_101018103 | 286 |
| 1780 | 3300032005 | Ga0307411_10006346 | Ga0307411_100063465 | 286 |
| 1781 | 3300033180 | Ga0307510_10094555 | Ga0307510_100945552 | 286 |
| 1782 | 3300041512 | Ga0451853_3923888 | Ga0451853_3923888_198_1058 | 286 |
| 1783 | 3300042007 | Ga0439449_0002308 | Ga0439449_0002308_358_1221 | 286 |
| 1784 | 3300042435 | Ga0439434_0022733 | Ga0439434_0022733_689_1549 | 286 |
| 1785 | 3300042531 | Ga0450918_001083 | Ga0450918_001083_2311_3171 | 286 |
| 1786 | 3300045051 | Ga0451576_0000621 | Ga0451576_0000621_23102_23983 | 286 |
| 1787 | 3300050489 | nmdc:mga03683_1535_c1 | nmdc:mga03683_1535_c1_293_1153 | 286 |
| 1788 | 3300050490 | nmdc:mga03n38_159019_c1 | nmdc:mga03n38_159019_c1_92_952 | 286 |
| 1789 | 3300050491 | nmdc:mga00v17_184670_c1 | nmdc:mga00v17_184670_c1_458_1318 | 286 |
| 1790 | 3300050492 | nmdc:mga0yw44_20621_c1 | nmdc:mga0yw44_20621_c1_503_1363 | 286 |
| 1791 | 3300005327 | Ga0070658_10029383 | Ga0070658_100293831 | 287 |
| 1792 | 3300005338 | Ga0068868_100066740 | Ga0068868_1000667402 | 287 |
| 1793 | 3300005355 | Ga0070671_100098374 | Ga0070671_1000983742 | 287 |
| 1794 | 3300005539 | Ga0068853_100302143 | Ga0068853_1003021432 | 287 |
| 1795 | 3300005543 | Ga0070672_100043233 | Ga0070672_1000432334 | 287 |
| 1796 | 3300005616 | Ga0068852_100025410 | Ga0068852_1000254102 | 287 |
| 1797 | 3300005840 | Ga0068870_10069906 | Ga0068870_100699062 | 287 |
| 1798 | 3300005841 | Ga0068863_100153961 | Ga0068863_1001539612 | 287 |
| 1799 | 3300009098 | Ga0105245_10115897 | Ga0105245_101158972 | 287 |
| 1800 | 3300013297 | Ga0157378_10120618 | Ga0157378_101206182 | 287 |
| 1801 | 3300025321 | Ga0207656_10139610 | Ga0207656_101396102 | 287 |
| 1802 | 3300025920 | Ga0207649_10049327 | Ga0207649_100493272 | 287 |
| 1803 | 3300025923 | Ga0207681_10270210 | Ga0207681_102702102 | 287 |
| 1804 | 3300025925 | Ga0207650_10010063 | Ga0207650_100100631 | 287 |
| 1805 | 3300025933 | Ga0207706_10050736 | Ga0207706_100507362 | 287 |
| 1806 | 3300025937 | Ga0207669_10168271 | Ga0207669_101682712 | 287 |
| 1807 | 3300025940 | Ga0207691_10118628 | Ga0207691_101186282 | 287 |
| 1808 | 3300025960 | Ga0207651_10172900 | Ga0207651_101729002 | 287 |
| 1809 | 3300025981 | Ga0207640_10048315 | Ga0207640_100483153 | 287 |
| 1810 | 3300042876 | Ga0451577_0000206 | Ga0451577_0000206_90681_91544 | 287 |
| 1811 | 3300044712 | Ga0453684_0000218 | Ga0453684_0000218_190433_191296 | 287 |
| 1812 | 3300045051 | Ga0451576_0002043 | Ga0451576_0002043_30378_31241 | 287 |
| 1813 | 3300046501 | Ga0495607_0000109 | Ga0495607_0000109_26553_27422 | 287 |
| 1814 | 3300046543 | Ga0495645_0102213 | Ga0495645_0102213_893_1765 | 287 |
| 1815 | iso_pu_bacteria | 2928115317 | 2928115934 | 287 |
| 1816 | 3300003792 | Ga0055540_1000784 | Ga0055540_10007843 | 288 |
| 1817 | 3300005289 | Ga0065704_10104316 | Ga0065704_101043161 | 288 |
| 1818 | 3300005353 | Ga0070669_100029055 | Ga0070669_1000290553 | 288 |
| 1819 | 3300006177 | Ga0075362_10004511 | Ga0075362_100045114 | 288 |
| 1820 | 3300012502 | Ga0157347_1002731 | Ga0157347_10027312 | 288 |
| 1821 | 3300025303 | Ga0209051_1000159 | Ga0209051_100015960 | 288 |
| 1822 | 3300025923 | Ga0207681_10058711 | Ga0207681_100587113 | 288 |
| 1823 | 3300030731 | Ga0316177_1191241 | Ga0316177_11912414 | 288 |
| 1824 | 3300030733 | Ga0314311_1011733 | Ga0314311_10117332 | 288 |
| 1825 | 3300030734 | Ga0316179_1030285 | Ga0316179_10302851 | 288 |
| 1826 | 3300030735 | Ga0316178_1051116 | Ga0316178_10511162 | 288 |
| 1827 | 3300030736 | Ga0316180_1047811 | Ga0316180_10478114 | 288 |
| 1828 | 3300030742 | Ga0316183_1126188 | Ga0316183_112618820 | 288 |
| 1829 | 3300030745 | Ga0316182_1174059 | Ga0316182_11740596 | 288 |
| 1830 | 3300031548 | Ga0307408_100040667 | Ga0307408_1000406674 | 288 |
| 1831 | 3300031649 | Ga0307514_10028849 | Ga0307514_100288494 | 288 |
| 1832 | 3300031901 | Ga0307406_10001390 | Ga0307406_100013903 | 288 |
| 1833 | 3300032004 | Ga0307414_10095124 | Ga0307414_100951243 | 288 |
| 1834 | 3300032005 | Ga0307411_10348690 | Ga0307411_103486902 | 288 |
| 1835 | 3300042007 | Ga0439449_0043482 | Ga0439449_0043482_502_1371 | 288 |
| 1836 | 3300046520 | Ga0495637_0004583 | Ga0495637_0004583_5572_6441 | 288 |
| 1837 | 3300046691 | Ga0495670_0012537 | Ga0495670_0012537_2955_3824 | 288 |
| 1838 | 3300048925 | Ga0496122_0001372 | Ga0496122_0001372_32731_33600 | 288 |
| 1839 | 3300048926 | Ga0496123_0012078 | Ga0496123_0012078_5949_6818 | 288 |
| 1840 | 3300001979 | JGI24740J21852_10015890 | JGI24740J21852_100158903 | 289 |
| 1841 | 3300002774 | JGI25150J39212_1001161 | JGI25150J39212_10011617 | 289 |
| 1842 | 3300003187 | JGI25151J46595_10005432 | JGI25151J46595_100054325 | 289 |
| 1843 | 3300003215 | JGI25153J46596_10005567 | JGI25153J46596_100055675 | 289 |
| 1844 | 3300003323 | rootH1_10025745 | rootH1_100257456 | 289 |
| 1845 | 3300003354 | JGI25160J50197_1007179 | JGI25160J50197_10071792 | 289 |
| 1846 | 3300003374 | JGI25161J50226_1001755 | JGI25161J50226_10017554 | 289 |
| 1847 | 3300003761 | Ga0055535_1000858 | Ga0055535_100085824 | 289 |
| 1848 | 3300003762 | Ga0055542_1000022 | Ga0055542_1000022111 | 289 |
| 1849 | 3300003771 | Ga0055526_1006184 | Ga0055526_10061845 | 289 |
| 1850 | 3300003773 | Ga0055537_1002281 | Ga0055537_10022815 | 289 |
| 1851 | 3300003775 | Ga0055524_1004325 | Ga0055524_10043255 | 289 |
| 1852 | 3300003781 | Ga0055536_1032314 | Ga0055536_10323141 | 289 |
| 1853 | 3300003784 | Ga0055534_1002365 | Ga0055534_10023655 | 289 |
| 1854 | 3300003790 | Ga0055528_1004626 | Ga0055528_10046265 | 289 |
| 1855 | 3300003792 | Ga0055540_1020504 | Ga0055540_10205042 | 289 |
| 1856 | 3300003794 | Ga0055531_10007095 | Ga0055531_100070954 | 289 |
| 1857 | 3300004625 | Ga0055543_1003612 | Ga0055543_10036124 | 289 |
| 1858 | 3300005539 | Ga0068853_100049035 | Ga0068853_1000490354 | 289 |
| 1859 | 3300005834 | Ga0068851_10001866 | Ga0068851_100018665 | 289 |
| 1860 | 3300009148 | Ga0105243_10077966 | Ga0105243_100779663 | 289 |
| 1861 | 3300009148 | Ga0105243_10249751 | Ga0105243_102497512 | 289 |
| 1862 | 3300013102 | Ga0157371_10004715 | Ga0157371_100047156 | 289 |
| 1863 | 3300013307 | Ga0157372_10014793 | Ga0157372_100147932 | 289 |
| 1864 | 3300014497 | Ga0182008_10005077 | Ga0182008_100050771 | 289 |
| 1865 | 3300017792 | Ga0163161_10045052 | Ga0163161_100450522 | 289 |
| 1866 | 3300025228 | Ga0209672_100391 | Ga0209672_10039120 | 289 |
| 1867 | 3300025242 | Ga0209258_100009 | Ga0209258_100009774 | 289 |
| 1868 | 3300025245 | Ga0207425_1000343 | Ga0207425_10003439 | 289 |
| 1869 | 3300025254 | Ga0209148_1000007 | Ga0209148_1000007774 | 289 |
| 1870 | 3300025258 | Ga0209129_1000024 | Ga0209129_1000024301 | 289 |
| 1871 | 3300025258 | Ga0209129_1000085 | Ga0209129_100008581 | 289 |
| 1872 | 3300025263 | Ga0209565_1000546 | Ga0209565_100054626 | 289 |
| 1873 | 3300025273 | Ga0209673_1000571 | Ga0209673_100057156 | 289 |
| 1874 | 3300025284 | Ga0209130_1000505 | Ga0209130_100050538 | 289 |
| 1875 | 3300025291 | Ga0209675_1002642 | Ga0209675_10026427 | 289 |
| 1876 | 3300025292 | Ga0209676_1006736 | Ga0209676_10067362 | 289 |
| 1877 | 3300025294 | Ga0209025_1000267 | Ga0209025_100026764 | 289 |
| 1878 | 3300025295 | Ga0209564_1000183 | Ga0209564_100018337 | 289 |
| 1879 | 3300025297 | Ga0209758_1000049 | Ga0209758_1000049220 | 289 |
| 1880 | 3300025299 | Ga0209256_1000140 | Ga0209256_100014037 | 289 |
| 1881 | 3300025302 | Ga0207426_1000053 | Ga0207426_1000053256 | 289 |
| 1882 | 3300025303 | Ga0209051_1008640 | Ga0209051_10086404 | 289 |
| 1883 | 3300025303 | Ga0209051_1017422 | Ga0209051_10174222 | 289 |
| 1884 | 3300025304 | Ga0209257_1006273 | Ga0209257_10062737 | 289 |
| 1885 | 3300025321 | Ga0207656_10004648 | Ga0207656_100046485 | 289 |
| 1886 | 3300026041 | Ga0207639_10062071 | Ga0207639_100620712 | 289 |
| 1887 | 3300046460 | Ga0495638_0043120 | Ga0495638_0043120_628_1497 | 289 |
| 1888 | 3300046512 | Ga0495610_0073587 | Ga0495610_0073587_132_1001 | 289 |
| 1889 | 3300046513 | Ga0495616_0007346 | Ga0495616_0007346_5135_6004 | 289 |
| 1890 | 3300046518 | Ga0495631_0000764 | Ga0495631_0000764_14279_15148 | 289 |
| 1891 | 3300046530 | Ga0495654_0037178 | Ga0495654_0037178_1387_2256 | 289 |
| 1892 | 3300046660 | Ga0495625_0008614 | Ga0495625_0008614_2345_3214 | 289 |
| 1893 | 3300046692 | Ga0495671_0040020 | Ga0495671_0040020_1049_1921 | 289 |
| 1894 | 3300048089 | Ga0495614_0026185 | Ga0495614_0026185_1269_2138 | 289 |
| 1895 | 3300048904 | Ga0496101_0177225 | Ga0496101_0177225_233_1111 | 289 |
| 1896 | 3300048921 | Ga0496118_0138864 | Ga0496118_0138864_120_989 | 289 |
| 1897 | 3300048924 | Ga0496121_0185303 | Ga0496121_0185303_343_1212 | 289 |
| 1898 | 3300048926 | Ga0496123_0133114 | Ga0496123_0133114_269_1138 | 289 |
| 1899 | 3300048929 | Ga0496126_0396589 | Ga0496126_0396589_207_1076 | 289 |
| 1900 | 3300050496 | nmdc:mga07m45_3642_c1 | nmdc:mga07m45_3642_c1_445_1326 | 289 |
| 1901 | 3300053079 | Ga0500610_0042322 | Ga0500610_0042322_1135_2007 | 289 |
| 1902 | 3300053087 | Ga0500643_013129 | Ga0500643_013129_257_1126 | 289 |
| 1903 | 3300053093 | Ga0500651_0001077 | Ga0500651_0001077_398_1267 | 289 |
| 1904 | 3300053110 | Ga0500571_044398 | Ga0500571_044398_1208_2077 | 289 |
| 1905 | 3300053120 | Ga0500597_051774 | Ga0500597_051774_481_1350 | 289 |
| 1906 | 3300053133 | Ga0500655_000880 | Ga0500655_000880_1867_2736 | 289 |
| 1907 | 3300053134 | Ga0500658_0000645 | Ga0500658_0000645_8274_9143 | 289 |
| 1908 | 3300053134 | Ga0500658_0000750 | Ga0500658_0000750_379_1248 | 289 |
| 1909 | 3300053136 | Ga0500559_0048585 | Ga0500559_0048585_779_1651 | 289 |
| 1910 | 3300053141 | Ga0500574_007277 | Ga0500574_007277_767_1636 | 289 |
| 1911 | 3300053161 | Ga0500634_0037909 | Ga0500634_0037909_568_1440 | 289 |
| 1912 | 3300053162 | Ga0500638_034026 | Ga0500638_034026_434_1303 | 289 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00528
BPD_transp_1
Binding-protein-dependent transport system inner membrane component
147
317
0.9
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7ahc-assembly1.cif.gz_B | opua apo inward-facing | 0.8929 | 97 | 282 |
| 3tui-assembly2.cif.gz_E | inward facing conformations of the metni methionine abc transporter: cy5 native crystal form | 0.808 | 97 | 287 |
| 3tuz-assembly2.cif.gz_F | inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form | 0.8069 | 94 | 287 |
| 7ahd-assembly1.cif.gz_B | opua (e190q) occluded | 0.7943 | 64 | 282 |
| 3dhw-assembly1.cif.gz_B | crystal structure of methionine importer metni | 0.792 | 97 | 277 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G1I4_54_251_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9483 | 94 | 285 | 1.10.3720.10 |
| af_Q57856_64_258_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9458 | 97 | 283 | 1.10.3720.10 |
| af_Q47539_71_268_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.944 | 91 | 286 | 1.10.3720.10 |
| af_P75851_53_247_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9336 | 94 | 282 | 1.10.3720.10 |
| af_Q47539_71_268_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9303 | 91 | 286 | 1.10.3720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2N2UDI5-F1-model_v4 | deleted | 0.9672 | 69 | 289 |
|
| AF-A0A2N2UDI5-F1-model_v4 | deleted | 0.9587 | 69 | 289 |
|
| AF-A0A6J4KGY1-F1-model_v4 | Nitrate ABC transporter, permease protein | 0.9586 | 81 | 287 |
GO:0005886
GO:0006811 GO:0015112 |
| AF-A0A3N5MR33-F1-model_v4 | Nitrate ABC transporter, permease protein | 0.9546 | 93 | 286 |
GO:0005886
GO:0006811 GO:0015112 |
| AF-A0A355B7I0-F1-model_v4 | Nitrate ABC transporter, permease protein | 0.9529 | 79 | 289 |
GO:0005886
GO:0006811 GO:0015112 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar