F496043

General Info

Members Datasets Scaffolds Average Seq Length
1912 847 1679 273

Family's Representative Sequence

Representative Sequence 3300046524|Ga0495648_0033902|Ga0495648_0033902_833_1795
Length 320
Sequence MCCFADPGPIPASRNAWVPGLRRTTSLRDVLHRARDTDRNAMTKSLRFRAAVVSIAIFCAFIGTWHLATRGTGSIAAMTPEYAKLMGLTATVGKSAMPGPLDVGAKLWEHLKRPFYDNGPNDKGLGIQLAYSIGRVGLGYLLAVVIAIPLGFLIGMSPLMNKALDPFIQVLKPISPLAWMPLALYTIKDSGLSAIFVIFICSIWPMLLNTAFGVAAVRKEWINVARTLEVGTFRRAFTVILPAAAPTILTGMRISIGIAWLVIVAAEMLVGGTGIGYFVWNEWNNLSITNVIIAILLIGVVGMLLDQVLARFTRMVTFPE

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
5 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
6 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
7 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
8 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
9 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
10 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
11 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
12 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
13 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
14 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
15 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
16 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
17 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
18 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
19 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
20 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
21 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
22 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
23 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
24 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
25 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
26 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
27 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
28 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
29 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
30 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
31 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
32 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
33 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
34 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
35 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
36 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
37 2643221569 Achromobacter sp. Root565 Isolate Unclassified
38 2643221570 Acidovorax sp. Root568 Isolate Unclassified
39 2643221585 Pelomonas sp. Root662 Isolate Unclassified
40 2643221594 Achromobacter sp. Root170 Isolate Unclassified
41 2643221596 Acidovorax sp. Root70 Isolate Unclassified
42 2643221609 Acidovorax sp. Root217 Isolate Unclassified
43 2643221611 Acidovorax sp. Root219 Isolate Unclassified
44 2643221621 Achromobacter sp. Root83 Isolate Unclassified
45 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
46 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
47 2643221652 Acidovorax sp. Root402 Isolate Unclassified
48 2643221656 Pelomonas sp. Root405 Isolate Unclassified
49 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
50 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
51 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
52 2738541277 Variovorax sp. GV051 Isolate Unclassified
53 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
54 2738541337 Pelomonas sp. BT06 Isolate Unclassified
55 2738543012 Acidovorax sp. CF301 Isolate Unclassified
56 2738543013 Variovorax sp. BT01 Isolate Unclassified
57 2738543019 Variovorax sp. GV040 Isolate Unclassified
58 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
59 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
60 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
61 2791355199
62 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
63 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
64 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
65 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
66 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
67 2816332133 Acidovorax radicis 2721A Isolate Unclassified
68 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
69 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
70 2818991446 Variovorax sp. 1180 Isolate Unclassified
71 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
72 2821131069 Duganella sp. 1224 Isolate Unclassified
73 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
74 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
75 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
76 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
77 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
78 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
79 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
80 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
81 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
82 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
83 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
84 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
85 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
86 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
87 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
88 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
89 2831864461 Roseateles noduli HZ7 Isolate Nodule
90 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
91 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
92 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
93 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
94 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
95 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
96 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
97 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
98 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
99 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
100 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
101 2842677519 Variovorax sp. R-72495 Isolate Unclassified
102 2842694124 Methylopila sp. R-72369 Isolate Unclassified
103 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
104 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
105 2842733646 Variovorax sp. R-72446 Isolate Unclassified
106 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
107 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
108 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
109 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
110 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
111 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
112 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
113 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
114 2857553236 Duganella sp. R-74557 Isolate Unclassified
115 2857564685 Duganella sp. R-74599 Isolate Unclassified
116 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
117 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
118 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
119 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
120 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
121 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
122 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
123 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
124 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
125 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
126 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
127 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
128 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
129 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
130 2885198086 Variovorax sp. 679 Isolate Unclassified
131 2885211737 Variovorax sp. 553 Isolate Unclassified
132 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
133 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
134 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
135 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
136 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
137 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
138 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
139 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
140 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
141 2899924645 Variovorax sp. 369 Isolate Unclassified
142 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
143 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
144 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
145 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
146 2904456579 Variovorax sp. 2002 Isolate Unclassified
147 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
148 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
149 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
150 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
151 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
152 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
153 2904699407
154 2906610324
155 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
156 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
157 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
158 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
159 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
160 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
161 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
162 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
163 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
164 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
165 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
166 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
167 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
168 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
169 2922425934
170 2928037797 Variovorax sp. 1126 Isolate Unclassified
171 2928044640 Variovorax sp. 1128 Isolate Unclassified
172 2928051484 Variovorax sp. 1133 Isolate Unclassified
173 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
174 2928070936 Variovorax gossypii 1167 Isolate Unclassified
175 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
176 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
177 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
178 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
179 2929520902 Variovorax beijingensis 502 Isolate Unclassified
180 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
181 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
182 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
183 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
184 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
185 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
186 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
187 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
188 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
189 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
190 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
191 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
192 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
193 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
194 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
195 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
196 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
197 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
198 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
199 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
200 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
201 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
202 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
203 2941479691
204 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
205 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
206 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
207 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
208 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
209 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
210 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
211 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
212 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
213 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
214 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
215 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
216 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
217 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
218 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
219 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
220 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
221 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
222 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
223 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
224 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
225 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
226 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
227 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
228 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
229 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
230 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
231 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
232 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
233 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
234 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
235 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
236 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
237 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
238 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
239 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
240 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
241 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
242 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
243 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
244 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
245 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
246 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
247 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
248 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
249 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
250 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
251 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
252 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
253 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
254 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
255 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
256 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
257 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
258 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
259 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
260 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
261 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
262 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
263 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
264 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
265 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
266 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
267 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
268 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
269 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
270 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
271 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
272 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
273 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
274 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
275 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
276 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
277 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
278 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
279 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
280 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
281 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
282 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
283 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
284 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
285 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
286 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
287 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
288 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
289 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
290 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
291 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
292 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
293 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
294 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
295 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
296 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
297 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
298 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
299 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
300 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
301 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
302 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
303 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
304 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
305 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
306 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
307 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
308 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
309 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
310 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
311 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
312 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
313 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
314 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
315 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
316 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
317 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
318 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
319 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
320 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
321 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
322 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
323 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
324 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
325 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
326 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
327 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
328 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
329 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
330 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
331 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
332 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
333 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
334 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
335 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
336 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
337 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
338 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
339 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
340 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
341 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
342 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
343 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
344 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
345 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
346 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
347 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
348 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
349 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
350 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
351 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
352 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
353 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
354 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
355 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
356 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
357 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
358 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
359 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
360 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
361 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
362 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
363 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
364 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
365 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
366 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
367 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
368 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
369 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
370 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
371 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
372 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
373 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
374 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
375 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
376 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
377 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
378 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
379 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
380 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
381 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
382 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
383 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
384 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
385 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
386 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
387 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
388 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
389 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
390 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
391 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
392 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
393 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
394 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
395 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
396 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
397 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
398 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
399 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
400 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
401 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
402 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
403 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
404 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
405 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
406 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
407 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
408 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
409 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
410 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
411 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
412 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
413 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
414 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
415 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
416 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
417 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
418 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
419 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
420 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
421 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
422 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
423 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
424 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
425 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
426 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
427 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
428 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
429 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
430 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
431 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
432 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
433 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
434 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
435 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
436 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
437 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
438 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
439 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
440 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
441 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
442 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
443 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
444 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
445 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
446 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
447 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
448 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
449 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
450 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
451 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
452 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
453 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
454 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
455 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
456 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
457 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
458 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
459 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
460 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
461 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
462 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
463 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
464 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
465 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
466 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
467 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
468 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
469 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
470 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
471 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
472 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
473 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
474 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
475 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
476 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
477 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
478 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
479 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
480 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
481 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
482 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
483 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
484 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
485 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
486 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
487 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
488 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
489 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
490 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
491 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
492 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
493 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
494 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
495 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
496 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
497 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
498 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
499 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
500 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
501 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
502 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
503 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
504 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
505 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
506 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
507 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
508 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
509 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
510 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
511 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
512 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
513 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
514 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
515 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
516 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
517 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
518 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
519 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
520 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
521 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
522 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
523 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
524 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
525 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
526 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
527 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
528 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
529 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
530 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
531 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
532 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
533 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
534 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
535 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
536 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
537 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
538 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
539 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
540 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
541 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
542 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
543 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
544 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
545 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
546 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
547 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
548 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
549 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
550 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
551 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
552 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
553 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
554 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
555 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
556 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
557 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
558 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
559 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
560 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
561 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
562 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
563 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
564 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
565 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
566 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
567 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
568 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
569 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
570 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
571 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
572 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
573 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
574 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
575 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
576 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
577 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
578 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
579 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
580 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
581 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
582 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
583 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
584 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
585 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
586 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
587 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
588 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
589 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
590 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
591 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
592 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
593 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
594 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
595 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
596 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
597 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
598 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
599 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
600 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
601 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
602 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
603 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
604 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
605 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
606 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
607 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
608 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
609 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
610 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
611 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
612 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
613 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
614 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
615 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
616 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
617 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
618 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
619 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
620 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
621 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
622 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
623 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
624 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
625 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
626 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
627 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
628 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
629 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
630 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
631 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
632 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
633 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
634 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
635 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
636 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
637 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
638 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
639 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
640 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
641 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
642 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
643 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
644 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
645 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
646 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
647 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
648 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
649 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
650 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
651 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
652 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
653 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
654 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
655 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
656 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
657 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
658 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
659 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
660 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
661 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
662 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
663 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
664 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
665 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
666 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
667 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
668 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
669 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
670 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
671 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
672 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
673 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
674 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
675 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
676 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
677 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
678 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
679 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
680 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
681 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
682 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
683 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
684 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
685 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
686 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
687 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
688 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
689 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
690 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
691 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
692 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
693 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
694 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
695 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
696 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
697 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
698 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
699 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
700 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
701 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
702 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
703 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
704 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
705 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
706 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
707 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
708 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
709 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
710 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
711 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
712 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
713 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
714 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
715 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
716 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
717 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
718 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
719 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
720 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
721 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
722 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
723 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
724 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
725 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
726 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
727 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
728 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
729 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
730 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
731 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
732 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
733 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
734 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
735 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
736 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
737 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
738 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
739 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
740 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
741 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
742 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
743 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
744 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
745 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
746 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
747 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
748 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
749 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
750 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
751 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
752 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
753 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
754 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
755 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
756 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
757 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
758 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
759 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
760 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
761 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
762 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
763 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
764 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
765 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
766 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
767 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
768 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
769 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
770 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
771 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
772 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
773 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
774 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
775 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
776 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
777 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
778 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
779 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
780 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
781 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
782 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
783 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
784 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
785 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
786 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
787 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
788 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
789 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
790 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
791 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
792 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
793 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
794 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
795 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
796 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
797 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
798 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
799 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
800 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
801 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
802 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
803 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
804 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
805 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
806 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
807 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
808 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
809 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
810 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
811 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
812 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
813 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
814 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
815 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
816 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
817 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
818 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
819 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
820 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
821 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
822 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
823 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
824 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
825 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
826 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
827 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
828 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
829 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
830 641522639 Methylobacterium sp. 4-46 Isolate Nodule
831 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
832 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
833 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
834 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
835 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
836 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
837 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
838 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
839 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
840 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
841 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
842 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
843 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere
844 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
845 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
846 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
847 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.95
Metatranscriptomes 0.05
Isolates 12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.76
Nodule 5.44
Rhizoplane 3.5
Rhizosphere 63.44
Stem 0
Stem Tuber 0
Unclassified 13.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10015890 3300001979 Bacteria 2735
2 JGI24737J22298_10054951 3300001990 Bacteria 1204
3 JGI24743J22301_10005012 3300001991 Bacteria 2189
4 JGI24750J21931_1012785 3300002070 Bacteria 1116
5 JGI24748J21848_1011408 3300002074 Bacteria 1047
6 JGI24738J21930_10035652 3300002075 Bacteria 1013
7 JGI24744J21845_10033281 3300002077 Bacteria 981
8 JGI24034J26672_10028956 3300002239 Bacteria 895
9 JGI24751J29686_10016259 3300002459 Bacteria 1535
10 JGI25155J39150_1000188 3300002704 Bacteria 26511
11 JGI25155J39150_1000538 3300002704 Bacteria 8785
12 JGI25156J39149_1000150 3300002705 Bacteria 51558
13 JGI25154J39366_1000165 3300002738 Bacteria 51558
14 JGI25154J39366_1000210 3300002738 Bacteria 41877
15 JGI25157J39369_1000383 3300002741 Bacteria 30452
16 JGI25150J39212_1001161 3300002774 Bacteria 7879
17 JGI25151J46595_10005432 3300003187 Bacteria 6585
18 JGI25406J46586_10000801 3300003203 Bacteria 14848
19 JGI25406J46586_10003389 3300003203 Bacteria 7501
20 JGI25406J46586_10003524 3300003203 Bacteria 7347
21 JGI25406J46586_10059517 3300003203 Bacteria 1240
22 JGI25153J46596_10002589 3300003215 Bacteria 10366
23 JGI25153J46596_10003283 3300003215 Bacteria 9084
24 JGI25153J46596_10005567 3300003215 Bacteria 6585
25 JGI25153J46596_10006877 3300003215 Bacteria 5680
26 JGI25153J46596_10021769 3300003215 Bacteria 2381
27 rootL2_10019891 3300003322 Bacteria 13677
28 rootH1_10025745 3300003323 Bacteria 7125
29 JGI25160J50197_1000198 3300003354 Bacteria 50243
30 JGI25160J50197_1003455 3300003354 Bacteria 7069
31 JGI25160J50197_1006259 3300003354 Bacteria 4838
32 JGI25160J50197_1006800 3300003354 Bacteria 4580
33 JGI25160J50197_1007179 3300003354 Bacteria 4390
34 JGI25161J50226_1000021 3300003374 Bacteria 163584
35 JGI25161J50226_1001755 3300003374 Bacteria 6132
36 JGI25404J52841_10003095 3300003659 Bacteria 3245
37 JGI25404J52841_10011082 3300003659 Bacteria 1941
38 Ga0055538_1000054 3300003751 Bacteria 123566
39 Ga0055539_1000066 3300003752 Bacteria 136557
40 Ga0055533_1000076 3300003756 Bacteria 136557
41 Ga0055532_1000097 3300003758 Bacteria 98781
42 Ga0055525_1000098 3300003759 Bacteria 136557
43 Ga0055535_1000858 3300003761 Bacteria 21509
44 Ga0055535_1003562 3300003761 Bacteria 4319
45 Ga0055542_1000022 3300003762 Bacteria 302315
46 Ga0055526_1002491 3300003771 Bacteria 12426
47 Ga0055526_1006184 3300003771 Bacteria 6585
48 Ga0055537_1002281 3300003773 Bacteria 6585
49 Ga0055524_1000033 3300003775 Bacteria 180833
50 Ga0055524_1004325 3300003775 Bacteria 6585
51 Ga0055524_1023756 3300003775 Bacteria 1966
52 Ga0055536_1032314 3300003781 Bacteria 1354
53 Ga0055534_1002365 3300003784 Bacteria 6585
54 Ga0055528_1004626 3300003790 Bacteria 6585
55 Ga0055530_10008420 3300003791 Bacteria 4136
56 Ga0055540_1000007 3300003792 Bacteria 318178
57 Ga0055540_1000784 3300003792 Bacteria 21495
58 Ga0055540_1002994 3300003792 Bacteria 8459
59 Ga0055540_1020504 3300003792 Bacteria 1746
60 Ga0055531_10007095 3300003794 Bacteria 6191
61 Ga0055541_1000056 3300003841 Bacteria 123566
62 Ga0055543_1000238 3300004625 Bacteria 42822
63 Ga0055543_1002979 3300004625 Bacteria 5254
64 Ga0055543_1003612 3300004625 Bacteria 4473
65 Ga0065165_1000024 3300005262 Bacteria 247672
66 Ga0065165_1001284 3300005262 Bacteria 28344
67 Ga0065165_1002756 3300005262 Bacteria 13971
68 Ga0065704_10104316 3300005289 Bacteria 2145
69 Ga0065707_10014575 3300005295 Bacteria 1959
70 Ga0070658_10029383 3300005327 Bacteria 4415
71 Ga0070658_10049317 3300005327 Bacteria 3410
72 Ga0070676_10106817 3300005328 Bacteria 1737
73 Ga0070676_10125841 3300005328 Bacteria 1614
74 Ga0070683_100248408 3300005329 Bacteria 1692
75 Ga0070690_100265153 3300005330 Bacteria 1220
76 Ga0070670_100000081 3300005331 Bacteria 92043
77 Ga0070670_100016676 3300005331 Bacteria 6304
78 Ga0070670_100026578 3300005331 Bacteria 4979
79 Ga0070670_100056875 3300005331 Bacteria 3358
80 Ga0070670_100096223 3300005331 Bacteria 2547
81 Ga0068869_100207306 3300005334 Bacteria 1548
82 Ga0068869_100334238 3300005334 Bacteria 1231
83 Ga0070666_10168377 3300005335 Bacteria 1534
84 Ga0070666_10248901 3300005335 Bacteria 1258
85 Ga0068868_100066740 3300005338 Bacteria 2861
86 Ga0068868_100072676 3300005338 Bacteria 2744
87 Ga0070660_100133685 3300005339 Bacteria 1986
88 Ga0070660_100301085 3300005339 Bacteria 1315
89 Ga0070660_100325719 3300005339 Bacteria 1263
90 Ga0070689_100136116 3300005340 Bacteria 1972
91 Ga0070689_100138815 3300005340 Bacteria 1953
92 Ga0070689_100165875 3300005340 Bacteria 1787
93 Ga0070691_10045042 3300005341 Bacteria 2093
94 Ga0070691_10208285 3300005341 Bacteria 1031
95 Ga0070687_100101196 3300005343 Bacteria 1613
96 Ga0070661_100129753 3300005344 Bacteria 1892
97 Ga0070692_10119169 3300005345 Bacteria 1469
98 Ga0070668_100121847 3300005347 Bacteria 2085
99 Ga0070668_100132137 3300005347 Bacteria 2004
100 Ga0070668_100411367 3300005347 Bacteria 1157
101 Ga0070669_100029055 3300005353 Bacteria 3984
102 Ga0070669_100233525 3300005353 Bacteria 1458
103 Ga0070675_100005492 3300005354 Bacteria 9707
104 Ga0070675_100102270 3300005354 Bacteria 2414
105 Ga0070675_100122468 3300005354 Bacteria 2210
106 Ga0070675_100256412 3300005354 Bacteria 1532
107 Ga0070671_100011767 3300005355 Bacteria 7038
108 Ga0070671_100075919 3300005355 Bacteria 2807
109 Ga0070671_100098374 3300005355 Bacteria 2454
110 Ga0070674_100218180 3300005356 Bacteria 1482
111 Ga0070674_100232129 3300005356 Bacteria 1440
112 Ga0070673_100009243 3300005364 Bacteria 6611
113 Ga0070673_100177483 3300005364 Bacteria 1821
114 Ga0070659_100235484 3300005366 Bacteria 1514
115 Ga0070659_100473553 3300005366 Bacteria 1065
116 Ga0070667_100001429 3300005367 Bacteria 21397
117 Ga0070667_100057841 3300005367 Bacteria 3277
118 Ga0070667_100446422 3300005367 Bacteria 1181
119 Ga0070703_10092812 3300005406 Bacteria 1049
120 Ga0070709_10001642 3300005434 Bacteria 12118
121 Ga0070709_10003602 3300005434 Bacteria 8319
122 Ga0070709_10039766 3300005434 Bacteria 2887
123 Ga0070709_10068701 3300005434 Bacteria 2280
124 Ga0070709_10171549 3300005434 Bacteria 1516
125 Ga0070709_10345064 3300005434 Bacteria 1099
126 Ga0070714_100013820 3300005435 Bacteria 6473
127 Ga0070714_100023153 3300005435 Bacteria 5099
128 Ga0070714_100263796 3300005435 Bacteria 1596
129 Ga0070714_100459311 3300005435 Bacteria 1210
130 Ga0070713_100003091 3300005436 Bacteria 10950
131 Ga0070713_100132397 3300005436 Bacteria 2200
132 Ga0070713_100183887 3300005436 Bacteria 1880
133 Ga0070710_10001132 3300005437 Bacteria 12626
134 Ga0070710_10003655 3300005437 Bacteria 7275
135 Ga0070710_10255753 3300005437 Bacteria 1127
136 Ga0070711_100003864 3300005439 Bacteria 8795
137 Ga0070711_100007426 3300005439 Bacteria 6666
138 Ga0070705_100021640 3300005440 Bacteria 3423
139 Ga0070705_100040250 3300005440 Bacteria 2657
140 Ga0070705_100069391 3300005440 Bacteria 2125
141 Ga0070705_100211819 3300005440 Bacteria 1336
142 Ga0070700_100038270 3300005441 Bacteria 2922
143 Ga0070700_100195026 3300005441 Bacteria 1419
144 Ga0070694_100099262 3300005444 Bacteria 2057
145 Ga0070694_100277030 3300005444 Bacteria 1278
146 Ga0070694_100372257 3300005444 Bacteria 1112
147 Ga0070708_100005534 3300005445 Bacteria 10011
148 Ga0070708_100006881 3300005445 Bacteria 9074
149 Ga0070708_100011367 3300005445 Bacteria 7240
150 Ga0070708_100014186 3300005445 Bacteria 6548
151 Ga0070708_100020178 3300005445 Bacteria 5615
152 Ga0070708_100043141 3300005445 Bacteria 3963
153 Ga0070708_100093833 3300005445 Bacteria 2737
154 Ga0070708_100241926 3300005445 Bacteria 1694
155 Ga0070708_100285818 3300005445 Bacteria 1552
156 Ga0070663_100197713 3300005455 Bacteria 1567
157 Ga0070663_100199585 3300005455 Bacteria 1560
158 Ga0070663_100212417 3300005455 Bacteria 1516
159 Ga0070663_100303608 3300005455 Bacteria 1278
160 Ga0070663_100438427 3300005455 Bacteria 1074
161 Ga0070678_100033200 3300005456 Bacteria 3581
162 Ga0070678_100068196 3300005456 Bacteria 2651
163 Ga0070678_100098017 3300005456 Bacteria 2265
164 Ga0070662_100042847 3300005457 Bacteria 3235
165 Ga0070662_100092254 3300005457 Bacteria 2276
166 Ga0070662_100154396 3300005457 Bacteria 1790
167 Ga0068867_100342847 3300005459 Bacteria 1244
168 Ga0070706_100001066 3300005467 Bacteria 29656
169 Ga0070706_100007018 3300005467 Bacteria 10620
170 Ga0070706_100033419 3300005467 Bacteria 4747
171 Ga0070706_100038072 3300005467 Bacteria 4441
172 Ga0070706_100043592 3300005467 Bacteria 4146
173 Ga0070706_100122782 3300005467 Bacteria 2421
174 Ga0070706_100225125 3300005467 Bacteria 1751
175 Ga0070706_100569066 3300005467 Bacteria 1054
176 Ga0070707_100003645 3300005468 Bacteria 14522
177 Ga0070707_100005430 3300005468 Bacteria 11921
178 Ga0070707_100011879 3300005468 Bacteria 8128
179 Ga0070707_100019372 3300005468 Bacteria 6410
180 Ga0070707_100059338 3300005468 Bacteria 3671
181 Ga0070707_100059485 3300005468 Bacteria 3665
182 Ga0070707_100250116 3300005468 Bacteria 1725
183 Ga0070707_100261262 3300005468 Bacteria 1684
184 Ga0070707_100335690 3300005468 Bacteria 1468
185 Ga0070707_100578364 3300005468 Bacteria 1086
186 Ga0070698_100002784 3300005471 Bacteria 19250
187 Ga0070698_100007110 3300005471 Bacteria 12121
188 Ga0070698_100010988 3300005471 Bacteria 9631
189 Ga0070698_100044987 3300005471 Bacteria 4519
190 Ga0070698_100049237 3300005471 Bacteria 4302
191 Ga0070698_100063521 3300005471 Bacteria 3723
192 Ga0070698_100121348 3300005471 Bacteria 2574
193 Ga0070698_100296995 3300005471 Bacteria 1546
194 Ga0070698_100701807 3300005471 Bacteria 954
195 Ga0070699_100001365 3300005518 Bacteria 22450
196 Ga0070699_100002979 3300005518 Bacteria 15035
197 Ga0070699_100031502 3300005518 Bacteria 4578
198 Ga0070699_100031521 3300005518 Bacteria 4577
199 Ga0070699_100052038 3300005518 Bacteria 3545
200 Ga0070699_100215687 3300005518 Bacteria 1709
201 Ga0070699_100586436 3300005518 Bacteria 1016
202 Ga0070684_100090112 3300005535 Bacteria 2726
203 Ga0070684_100188390 3300005535 Bacteria 1877
204 Ga0070697_100006480 3300005536 Bacteria 9064
205 Ga0070697_100021560 3300005536 Bacteria 5105
206 Ga0070697_100028321 3300005536 Bacteria 4485
207 Ga0070697_100032132 3300005536 Bacteria 4222
208 Ga0070697_100081756 3300005536 Bacteria 2662
209 Ga0070697_100120397 3300005536 Bacteria 2195
210 Ga0070697_100145288 3300005536 Bacteria 1996
211 Ga0070697_100157509 3300005536 Bacteria 1918
212 Ga0070697_100182558 3300005536 Bacteria 1779
213 Ga0068853_100033377 3300005539 Bacteria 4366
214 Ga0068853_100049035 3300005539 Bacteria 3628
215 Ga0068853_100200802 3300005539 Bacteria 1814
216 Ga0068853_100302143 3300005539 Bacteria 1479
217 Ga0070672_100037636 3300005543 Bacteria 3692
218 Ga0070672_100043233 3300005543 Bacteria 3473
219 Ga0070672_100453596 3300005543 Bacteria 1105
220 Ga0070672_100484313 3300005543 Bacteria 1068
221 Ga0070686_100136507 3300005544 Bacteria 1702
222 Ga0070695_100006466 3300005545 Bacteria 6930
223 Ga0070695_100059478 3300005545 Bacteria 2474
224 Ga0070695_100065670 3300005545 Bacteria 2363
225 Ga0070696_100026289 3300005546 Bacteria 3960
226 Ga0070696_100054561 3300005546 Bacteria 2785
227 Ga0070696_100186436 3300005546 Bacteria 1542
228 Ga0070693_100083628 3300005547 Bacteria 1908
229 Ga0070665_100289452 3300005548 Bacteria 1640
230 Ga0070665_100404253 3300005548 Bacteria 1374
231 Ga0070665_100785064 3300005548 Bacteria 965
232 Ga0070704_100027019 3300005549 Bacteria 3800
233 Ga0070704_100255345 3300005549 Bacteria 1442
234 Ga0070704_100380663 3300005549 Bacteria 1199
235 Ga0070704_100440643 3300005549 Bacteria 1119
236 Ga0070704_100526315 3300005549 Bacteria 1030
237 Ga0070664_100043057 3300005564 Bacteria 3809
238 Ga0070664_100426367 3300005564 Bacteria 1215
239 Ga0068857_100071409 3300005577 Bacteria 3093
240 Ga0068857_100725251 3300005577 Bacteria 946
241 Ga0068854_100006416 3300005578 Bacteria 7482
242 Ga0068854_100066660 3300005578 Bacteria 2620
243 Ga0068856_100144187 3300005614 Bacteria 2389
244 Ga0068856_100203937 3300005614 Bacteria 1992
245 Ga0068852_100020468 3300005616 Bacteria 5263
246 Ga0068852_100025410 3300005616 Bacteria 4799
247 Ga0068859_100447057 3300005617 Bacteria 1389
248 Ga0068864_100000016 3300005618 Bacteria 292454
249 Ga0068864_100084285 3300005618 Bacteria 2792
250 Ga0068864_100086254 3300005618 Bacteria 2762
251 Ga0068864_100127422 3300005618 Bacteria 2283
252 Ga0068866_10011607 3300005718 Bacteria 3817
253 Ga0068866_10144321 3300005718 Bacteria 1370
254 Ga0068861_100196620 3300005719 Bacteria 1690
255 Ga0068861_100322672 3300005719 Bacteria 1345
256 Ga0068861_100531127 3300005719 Bacteria 1068
257 Ga0068851_10001866 3300005834 Bacteria 9251
258 Ga0068870_10006935 3300005840 Bacteria 5024
259 Ga0068870_10043461 3300005840 Bacteria 2344
260 Ga0068870_10069906 3300005840 Bacteria 1911
261 Ga0068870_10089405 3300005840 Bacteria 1719
262 Ga0068863_100001887 3300005841 Bacteria 20811
263 Ga0068863_100153961 3300005841 Bacteria 2200
264 Ga0068858_100419515 3300005842 Bacteria 1287
265 Ga0068858_100461051 3300005842 Bacteria 1225
266 Ga0068860_100002390 3300005843 Bacteria 19702
267 Ga0068860_100075903 3300005843 Bacteria 3196
268 Ga0068860_100179335 3300005843 Bacteria 2047
269 Ga0068862_100000068 3300005844 Bacteria 123535
270 Ga0068862_100004260 3300005844 Bacteria 12112
271 Ga0068862_100204372 3300005844 Bacteria 1782
272 Ga0068862_100491316 3300005844 Bacteria 1163
273 Ga0081455_10001350 3300005937 Bacteria 30362
274 Ga0081455_10005811 3300005937 Bacteria 13435
275 Ga0081455_10028316 3300005937 Bacteria 5120
276 Ga0081455_10081940 3300005937 Bacteria 2641
277 Ga0081455_10121092 3300005937 Bacteria 2062
278 Ga0081455_10258385 3300005937 Bacteria 1270
279 Ga0081540_1002554 3300005983 Bacteria 14768
280 Ga0081540_1002649 3300005983 Bacteria 14558
281 Ga0081540_1003830 3300005983 Bacteria 11775
282 Ga0081540_1003910 3300005983 Bacteria 11604
283 Ga0081540_1011713 3300005983 Bacteria 5837
284 Ga0081540_1013996 3300005983 Bacteria 5175
285 Ga0081540_1024563 3300005983 Bacteria 3495
286 Ga0081540_1129797 3300005983 Bacteria 1031
287 Ga0081539_10000008 3300005985 Bacteria 525071
288 Ga0081539_10000009 3300005985 Bacteria 509286
289 Ga0081539_10000747 3300005985 Bacteria 64612
290 Ga0081539_10035862 3300005985 Bacteria 2974
291 Ga0081539_10039464 3300005985 Bacteria 2785
292 Ga0081539_10063382 3300005985 Bacteria 2017
293 Ga0081539_10180159 3300005985 Bacteria 992
294 Ga0070717_10006636 3300006028 Bacteria 8527
295 Ga0070717_10018588 3300006028 Bacteria 5431
296 Ga0070717_10058752 3300006028 Bacteria 3180
297 Ga0070717_10375862 3300006028 Bacteria 1274
298 Ga0075365_10006622 3300006038 Bacteria 6392
299 Ga0075365_10025380 3300006038 Bacteria 3751
300 Ga0075365_10152046 3300006038 Bacteria 1610
301 Ga0075365_10170351 3300006038 Bacteria 1519
302 Ga0075365_10237258 3300006038 Bacteria 1281
303 Ga0075368_10002361 3300006042 Bacteria 6139
304 Ga0075368_10007140 3300006042 Bacteria 3935
305 Ga0075368_10028947 3300006042 Bacteria 2141
306 Ga0075368_10029147 3300006042 Bacteria 2133
307 Ga0075368_10085139 3300006042 Bacteria 1289
308 Ga0075363_100012530 3300006048 Bacteria 4092
309 Ga0075363_100055355 3300006048 Bacteria 2125
310 Ga0075363_100083253 3300006048 Bacteria 1753
311 Ga0075364_10043425 3300006051 Bacteria 2923
312 Ga0075364_10051051 3300006051 Bacteria 2700
313 Ga0075364_10117878 3300006051 Bacteria 1775
314 Ga0075364_10177790 3300006051 Bacteria 1440
315 Ga0075364_10186312 3300006051 Bacteria 1405
316 Ga0075432_10005080 3300006058 Bacteria 4482
317 Ga0070715_10000320 3300006163 Bacteria 11866
318 Ga0070716_100001867 3300006173 Bacteria 9562
319 Ga0070716_100039297 3300006173 Bacteria 2626
320 Ga0070712_100001878 3300006175 Bacteria 12816
321 Ga0070712_100006978 3300006175 Bacteria 7041
322 Ga0070712_100028750 3300006175 Bacteria 3721
323 Ga0070712_100183907 3300006175 Bacteria 1631
324 Ga0070712_100220017 3300006175 Bacteria 1503
325 Ga0070712_100412422 3300006175 Bacteria 1118
326 Ga0075362_10004511 3300006177 Bacteria 5014
327 Ga0075362_10016670 3300006177 Bacteria 3012
328 Ga0075362_10184085 3300006177 Bacteria 1013
329 Ga0075367_10012955 3300006178 Bacteria 4467
330 Ga0075367_10013796 3300006178 Bacteria 4357
331 Ga0075367_10025935 3300006178 Bacteria 3318
332 Ga0075369_10013732 3300006186 Bacteria 3222
333 Ga0075369_10032648 3300006186 Bacteria 2203
334 Ga0075366_10008657 3300006195 Bacteria 5665
335 Ga0075366_10163909 3300006195 Bacteria 1347
336 Ga0075366_10247745 3300006195 Bacteria 1087
337 Ga0075366_10314140 3300006195 Bacteria 959
338 Ga0097621_100106660 3300006237 Bacteria 2363
339 Ga0097621_100408495 3300006237 Bacteria 1217
340 Ga0075370_10025758 3300006353 Bacteria 3254
341 Ga0075370_10037869 3300006353 Bacteria 2713
342 Ga0075370_10049886 3300006353 Bacteria 2373
343 Ga0075370_10185373 3300006353 Bacteria 1225
344 Ga0068871_100028813 3300006358 Bacteria 4358
345 Ga0068871_100161239 3300006358 Bacteria 1918
346 Ga0068871_100272124 3300006358 Bacteria 1480
347 Ga0075428_100000103 3300006844 Bacteria 71205
348 Ga0075428_100005548 3300006844 Bacteria 14035
349 Ga0075428_100005908 3300006844 Bacteria 13603
350 Ga0075428_100009742 3300006844 Bacteria 10673
351 Ga0075428_100022110 3300006844 Bacteria 7041
352 Ga0075428_100092828 3300006844 Bacteria 3291
353 Ga0075428_100109159 3300006844 Bacteria 3015
354 Ga0075428_100109308 3300006844 Bacteria 3013
355 Ga0075428_100118910 3300006844 Bacteria 2877
356 Ga0075428_100189864 3300006844 Bacteria 2222
357 Ga0075428_100303162 3300006844 Bacteria 1717
358 Ga0075428_100446847 3300006844 Bacteria 1385
359 Ga0075430_100004771 3300006846 Bacteria 11408
360 Ga0075430_100053942 3300006846 Bacteria 3383
361 Ga0075430_100093588 3300006846 Bacteria 2512
362 Ga0075430_100100706 3300006846 Bacteria 2413
363 Ga0075430_100120620 3300006846 Bacteria 2186
364 Ga0075430_100208635 3300006846 Bacteria 1621
365 Ga0075430_100365116 3300006846 Bacteria 1192
366 Ga0075431_100001293 3300006847 Bacteria 22854
367 Ga0075431_100006070 3300006847 Bacteria 11977
368 Ga0075431_100031643 3300006847 Bacteria 5449
369 Ga0075431_100042861 3300006847 Bacteria 4668
370 Ga0075431_100048829 3300006847 Bacteria 4364
371 Ga0075431_100063577 3300006847 Bacteria 3809
372 Ga0075431_100170055 3300006847 Bacteria 2240
373 Ga0075431_100306893 3300006847 Bacteria 1602
374 Ga0075431_100318325 3300006847 Bacteria 1569
375 Ga0075433_10000090 3300006852 Bacteria 42150
376 Ga0075433_10000781 3300006852 Bacteria 21965
377 Ga0075433_10003084 3300006852 Bacteria 12811
378 Ga0075433_10026223 3300006852 Bacteria 4932
379 Ga0075433_10028948 3300006852 Bacteria 4714
380 Ga0075433_10049015 3300006852 Bacteria 3674
381 Ga0075433_10068973 3300006852 Bacteria 3104
382 Ga0075433_10076167 3300006852 Bacteria 2954
383 Ga0075433_10085987 3300006852 Bacteria 2777
384 Ga0075433_10242297 3300006852 Bacteria 1600
385 Ga0075433_10293189 3300006852 Bacteria 1441
386 Ga0075434_100001936 3300006871 Bacteria 17947
387 Ga0075434_100004709 3300006871 Bacteria 12330
388 Ga0075434_100011879 3300006871 Bacteria 8233
389 Ga0075434_100014750 3300006871 Bacteria 7475
390 Ga0075434_100040652 3300006871 Bacteria 4605
391 Ga0075434_100095898 3300006871 Bacteria 2971
392 Ga0075434_100231935 3300006871 Bacteria 1865
393 Ga0075434_100332433 3300006871 Bacteria 1540
394 Ga0075434_100402486 3300006871 Bacteria 1390
395 Ga0075429_100035774 3300006880 Bacteria 4319
396 Ga0075429_100051162 3300006880 Bacteria 3595
397 Ga0075429_100080528 3300006880 Bacteria 2839
398 Ga0075429_100095420 3300006880 Bacteria 2593
399 Ga0075429_100164325 3300006880 Bacteria 1945
400 Ga0068865_100012565 3300006881 Bacteria 5335
401 Ga0068865_100112158 3300006881 Bacteria 2013
402 Ga0068865_100172049 3300006881 Bacteria 1661
403 Ga0075436_100000168 3300006914 Bacteria 41115
404 Ga0075436_100009932 3300006914 Bacteria 6509
405 Ga0075436_100012546 3300006914 Bacteria 5808
406 Ga0075436_100012919 3300006914 Bacteria 5726
407 Ga0075436_100023235 3300006914 Bacteria 4259
408 Ga0075436_100125932 3300006914 Bacteria 1795
409 Ga0097620_100447029 3300006931 Bacteria 1389
410 Ga0099824_1022507 3300006942 Bacteria 4141
411 Ga0099823_1019469 3300006944 Bacteria 6478
412 Ga0079104_1000009 3300006946 Bacteria 367015
413 Ga0075435_100002088 3300007076 Bacteria 13118
414 Ga0075435_100007665 3300007076 Bacteria 7709
415 Ga0075435_100030311 3300007076 Bacteria 4251
416 Ga0075435_100033463 3300007076 Bacteria 4064
417 Ga0075435_100046354 3300007076 Bacteria 3487
418 Ga0075435_100048805 3300007076 Bacteria 3402
419 Ga0075435_100056294 3300007076 Bacteria 3178
420 Ga0075435_100109034 3300007076 Bacteria 2301
421 Ga0075435_100393262 3300007076 Bacteria 1192
422 Ga0099794_10000734 3300007265 Bacteria 11022
423 Ga0099794_10020028 3300007265 Bacteria 3024
424 Ga0099794_10056573 3300007265 Bacteria 1898
425 Ga0099794_10061464 3300007265 Bacteria 1825
426 Ga0099794_10157309 3300007265 Bacteria 1155
427 Ga0099795_10007542 3300007788 Bacteria 3044
428 Ga0099795_10012611 3300007788 Bacteria 2569
429 Ga0099795_10022863 3300007788 Bacteria 2068
430 Ga0099795_10075004 3300007788 Bacteria 1283
431 Ga0105251_10002065 3300009011 Bacteria 16214
432 Ga0105244_10053100 3300009036 Bacteria 2061
433 Ga0105250_10071833 3300009092 Bacteria 1398
434 Ga0105240_10003119 3300009093 Bacteria 26094
435 Ga0105240_10015980 3300009093 Bacteria 10175
436 Ga0111539_10005030 3300009094 Bacteria 17186
437 Ga0111539_10025207 3300009094 Bacteria 7290
438 Ga0111539_10033030 3300009094 Bacteria 6283
439 Ga0111539_10073832 3300009094 Bacteria 4020
440 Ga0111539_10137087 3300009094 Bacteria 2866
441 Ga0111539_10162201 3300009094 Bacteria 2614
442 Ga0111539_10627459 3300009094 Bacteria 1251
443 Ga0111539_10803545 3300009094 Bacteria 1095
444 Ga0105245_10108434 3300009098 Bacteria 2579
445 Ga0105245_10115897 3300009098 Bacteria 2498
446 Ga0105245_10233393 3300009098 Bacteria 1780
447 Ga0105247_10166020 3300009101 Bacteria 1465
448 Ga0114129_10000881 3300009147 Bacteria 39092
449 Ga0114129_10002331 3300009147 Bacteria 26353
450 Ga0114129_10015357 3300009147 Bacteria 10896
451 Ga0114129_10022173 3300009147 Bacteria 9015
452 Ga0114129_10048974 3300009147 Bacteria 5939
453 Ga0114129_10097656 3300009147 Bacteria 4066
454 Ga0114129_10106691 3300009147 Bacteria 3869
455 Ga0114129_10112688 3300009147 Bacteria 3751
456 Ga0114129_10119579 3300009147 Bacteria 3628
457 Ga0114129_10178412 3300009147 Bacteria 2892
458 Ga0114129_10207383 3300009147 Bacteria 2651
459 Ga0114129_10229472 3300009147 Bacteria 2501
460 Ga0114129_10286979 3300009147 Bacteria 2197
461 Ga0114129_10719075 3300009147 Bacteria 1282
462 Ga0105243_10077966 3300009148 Bacteria 2696
463 Ga0105243_10249751 3300009148 Bacteria 1583
464 Ga0105241_10012907 3300009174 Bacteria 6130
465 Ga0105242_10175319 3300009176 Bacteria 1887
466 Ga0105242_10686701 3300009176 Bacteria 1000
467 Ga0105248_10058098 3300009177 Bacteria 4343
468 Ga0105248_10095407 3300009177 Bacteria 3349
469 Ga0105248_10177251 3300009177 Bacteria 2402
470 Ga0105248_10471815 3300009177 Bacteria 1414
471 Ga0105248_10991186 3300009177 Bacteria 949
472 Ga0105237_10073094 3300009545 Bacteria 3421
473 Ga0105238_10003628 3300009551 Bacteria 15389
474 Ga0105238_10052431 3300009551 Bacteria 4101
475 Ga0105238_10271943 3300009551 Bacteria 1675
476 Ga0105249_10093198 3300009553 Bacteria 2821
477 Ga0105249_10288273 3300009553 Bacteria 1642
478 Ga0105249_10369412 3300009553 Bacteria 1458
479 Ga0105249_10663094 3300009553 Bacteria 1101
480 Ga0099796_10006609 3300010159 Bacteria 2981
481 Ga0105239_10044826 3300010375 Bacteria 4847
482 Ga0105239_10507958 3300010375 Bacteria 1371
483 Ga0105246_10271216 3300011119 Bacteria 1357
484 Ga0157347_1002731 3300012502 Bacteria 1536
485 Ga0157371_10004715 3300013102 Bacteria 11785
486 Ga0157371_10056102 3300013102 Bacteria 2794
487 Ga0157371_10191767 3300013102 Bacteria 1463
488 Ga0157374_10003804 3300013296 Bacteria 12691
489 Ga0157374_10025104 3300013296 Bacteria 5346
490 Ga0157374_10140934 3300013296 Bacteria 2340
491 Ga0157374_10185047 3300013296 Bacteria 2036
492 Ga0157374_10220651 3300013296 Bacteria 1860
493 Ga0157374_10355775 3300013296 Bacteria 1455
494 Ga0157374_10774927 3300013296 Bacteria 974
495 Ga0157378_10013539 3300013297 Bacteria 7135
496 Ga0157378_10079320 3300013297 Bacteria 2964
497 Ga0157378_10120618 3300013297 Bacteria 2417
498 Ga0157378_10140868 3300013297 Bacteria 2239
499 Ga0157372_10014793 3300013307 Bacteria 8353
500 Ga0157375_10046832 3300013308 Bacteria 4219
501 Ga0157375_10296547 3300013308 Bacteria 1780
502 Ga0157375_10483195 3300013308 Bacteria 1403
503 Ga0163163_10055535 3300014325 Bacteria 3914
504 Ga0163163_10172747 3300014325 Bacteria 2208
505 Ga0163163_10914649 3300014325 Bacteria 941
506 Ga0157380_10129944 3300014326 Bacteria 2147
507 Ga0157380_10149951 3300014326 Bacteria 2014
508 Ga0157380_10554798 3300014326 Bacteria 1128
509 Ga0182008_10005077 3300014497 Bacteria 7560
510 Ga0182008_10075669 3300014497 Bacteria 1656
511 Ga0182008_10130023 3300014497 Bacteria 1255
512 Ga0157377_10187223 3300014745 Bacteria 1306
513 Ga0157379_10243495 3300014968 Bacteria 1631
514 Ga0157376_10002959 3300014969 Bacteria 11657
515 Ga0157376_10015076 3300014969 Bacteria 5827
516 Ga0157376_10146677 3300014969 Bacteria 2123
517 Ga0157376_10286530 3300014969 Bacteria 1554
518 Ga0182006_1001196 3300015261 Bacteria 16214
519 Ga0182006_1015553 3300015261 Bacteria 3260
520 Ga0182007_10000252 3300015262 Bacteria 36019
521 Ga0163161_10019750 3300017792 Bacteria 4726
522 Ga0163161_10045052 3300017792 Bacteria 3179
523 Ga0163161_10055080 3300017792 Bacteria 2887
524 Ga0163161_10124347 3300017792 Bacteria 1941
525 Ga0214544_1000020 3300021320 Bacteria 178560
526 Ga0214542_1000024 3300021321 Bacteria 191218
527 Ga0214545_1000011 3300021324 Bacteria 190550
528 Ga0214543_1000033 3300021327 Bacteria 190419
529 Ga0213874_10009406 3300021377 Bacteria 2416
530 Ga0213876_10001998 3300021384 Bacteria 12203
531 Ga0213876_10193987 3300021384 Bacteria 1080
532 Ga0213871_10012528 3300021441 Bacteria 1973
533 Ga0209435_100040 3300025206 Bacteria 115475
534 Ga0209784_100002 3300025224 Bacteria 1753105
535 Ga0209566_100003 3300025225 Bacteria 1753105
536 Ga0209674_100004 3300025226 Bacteria 1753105
537 Ga0209672_100391 3300025228 Bacteria 26387
538 Ga0209147_100141 3300025229 Bacteria 115466
539 Ga0209563_100006 3300025230 Bacteria 1753105
540 Ga0209563_101304 3300025230 Bacteria 6806
541 Ga0209437_100229 3300025233 Bacteria 95900
542 Ga0209258_100009 3300025242 Bacteria 996276
543 Ga0209258_100657 3300025242 Bacteria 25150
544 Ga0207425_1000343 3300025245 Bacteria 32292
545 Ga0209646_1000204 3300025246 Bacteria 69552
546 Ga0209646_1000253 3300025246 Bacteria 53522
547 Ga0209026_1000306 3300025250 Bacteria 53524
548 Ga0209677_100003 3300025253 Bacteria 1753105
549 Ga0209677_102281 3300025253 Bacteria 7406
550 Ga0209148_1000007 3300025254 Bacteria 1592273
551 Ga0209759_1000298 3300025256 Bacteria 68472
552 Ga0209759_1000398 3300025256 Bacteria 53628
553 Ga0209129_1000024 3300025258 Bacteria 417268
554 Ga0209129_1000085 3300025258 Bacteria 181765
555 Ga0209233_1001066 3300025261 Bacteria 11357
556 Ga0209233_1004907 3300025261 Bacteria 4499
557 Ga0209233_1005718 3300025261 Bacteria 4099
558 Ga0209565_1000546 3300025263 Bacteria 26226
559 Ga0209455_1007559 3300025272 Bacteria 3053
560 Ga0209455_1012365 3300025272 Bacteria 2045
561 Ga0209673_1000571 3300025273 Bacteria 58695
562 Ga0209673_1002149 3300025273 Bacteria 14613
563 Ga0209673_1014952 3300025273 Bacteria 2976
564 Ga0209673_1044222 3300025273 Bacteria 1235
565 Ga0209130_1000103 3300025284 Bacteria 137115
566 Ga0209130_1000505 3300025284 Bacteria 39706
567 Ga0209675_1002642 3300025291 Bacteria 9054
568 Ga0209675_1013210 3300025291 Bacteria 2601
569 Ga0209676_1002143 3300025292 Bacteria 14987
570 Ga0209676_1006736 3300025292 Bacteria 5588
571 Ga0209025_1000267 3300025294 Bacteria 121798
572 Ga0209564_1000005 3300025295 Bacteria 1147192
573 Ga0209564_1000164 3300025295 Bacteria 160675
574 Ga0209564_1000183 3300025295 Bacteria 150409
575 Ga0209564_1014473 3300025295 Bacteria 3278
576 Ga0209564_1025658 3300025295 Bacteria 1974
577 Ga0209758_1000049 3300025297 Bacteria 345104
578 Ga0209758_1000407 3300025297 Bacteria 73945
579 Ga0209758_1000952 3300025297 Bacteria 39040
580 Ga0209758_1001983 3300025297 Bacteria 22130
581 Ga0209758_1034572 3300025297 Bacteria 2008
582 Ga0209758_1037687 3300025297 Bacteria 1865
583 Ga0209758_1073955 3300025297 Bacteria 1059
584 Ga0209050_1000925 3300025298 Bacteria 38696
585 Ga0209050_1001541 3300025298 Bacteria 24191
586 Ga0209050_1002687 3300025298 Bacteria 14479
587 Ga0209050_1014556 3300025298 Bacteria 3379
588 Ga0209256_1000019 3300025299 Bacteria 558627
589 Ga0209256_1000140 3300025299 Bacteria 152770
590 Ga0209256_1000545 3300025299 Bacteria 54076
591 Ga0209256_1006969 3300025299 Bacteria 5755
592 Ga0207426_1000053 3300025302 Bacteria 384818
593 Ga0207426_1000586 3300025302 Bacteria 48467
594 Ga0207426_1001388 3300025302 Bacteria 20462
595 Ga0207426_1006921 3300025302 Bacteria 4821
596 Ga0209051_1000004 3300025303 Bacteria 1155596
597 Ga0209051_1000059 3300025303 Bacteria 260307
598 Ga0209051_1000159 3300025303 Bacteria 126836
599 Ga0209051_1008640 3300025303 Bacteria 5362
600 Ga0209051_1009022 3300025303 Bacteria 5193
601 Ga0209051_1017422 3300025303 Bacteria 3211
602 Ga0209257_1000022 3300025304 Bacteria 765258
603 Ga0209257_1000038 3300025304 Bacteria 609032
604 Ga0209257_1000044 3300025304 Bacteria 486709
605 Ga0209257_1001136 3300025304 Bacteria 34058
606 Ga0209257_1006273 3300025304 Bacteria 7771
607 Ga0209257_1013152 3300025304 Bacteria 3718
608 Ga0207656_10004648 3300025321 Bacteria 4811
609 Ga0207656_10139610 3300025321 Bacteria 1141
610 Ga0207653_10085811 3300025885 Bacteria 1096
611 Ga0207682_10001102 3300025893 Bacteria 12493
612 Ga0207692_10008475 3300025898 Bacteria 4253
613 Ga0207692_10203433 3300025898 Bacteria 1165
614 Ga0207710_10018129 3300025900 Bacteria 2992
615 Ga0207710_10018417 3300025900 Bacteria 2969
616 Ga0207710_10045537 3300025900 Bacteria 1957
617 Ga0207688_10010399 3300025901 Bacteria 5064
618 Ga0207680_10045750 3300025903 Bacteria 2583
619 Ga0207647_10035209 3300025904 Bacteria 3192
620 Ga0207685_10018550 3300025905 Bacteria 2274
621 Ga0207685_10045335 3300025905 Bacteria 1667
622 Ga0207699_10001319 3300025906 Bacteria 11796
623 Ga0207699_10063949 3300025906 Bacteria 2225
624 Ga0207699_10100942 3300025906 Bacteria 1831
625 Ga0207645_10073442 3300025907 Bacteria 2190
626 Ga0207645_10076453 3300025907 Bacteria 2144
627 Ga0207645_10108673 3300025907 Bacteria 1794
628 Ga0207643_10000418 3300025908 Bacteria 28078
629 Ga0207643_10048218 3300025908 Bacteria 2413
630 Ga0207705_10066695 3300025909 Bacteria 2603
631 Ga0207684_10001444 3300025910 Bacteria 25714
632 Ga0207684_10008691 3300025910 Bacteria 9015
633 Ga0207684_10013538 3300025910 Bacteria 7053
634 Ga0207684_10020436 3300025910 Bacteria 5657
635 Ga0207684_10044620 3300025910 Bacteria 3760
636 Ga0207684_10057109 3300025910 Bacteria 3311
637 Ga0207684_10097598 3300025910 Bacteria 2509
638 Ga0207684_10171532 3300025910 Bacteria 1870
639 Ga0207684_10177590 3300025910 Bacteria 1836
640 Ga0207684_10613801 3300025910 Bacteria 928
641 Ga0207654_10017669 3300025911 Bacteria 3734
642 Ga0207707_10234841 3300025912 Bacteria 1595
643 Ga0207695_10001540 3300025913 Bacteria 37977
644 Ga0207695_10017000 3300025913 Bacteria 8486
645 Ga0207695_10023519 3300025913 Bacteria 6958
646 Ga0207671_10032015 3300025914 Bacteria 3915
647 Ga0207671_10112523 3300025914 Bacteria 2073
648 Ga0207671_10158057 3300025914 Bacteria 1754
649 Ga0207671_10326993 3300025914 Bacteria 1214
650 Ga0207693_10001385 3300025915 Bacteria 21487
651 Ga0207693_10011746 3300025915 Bacteria 7079
652 Ga0207693_10024719 3300025915 Bacteria 4764
653 Ga0207693_10056935 3300025915 Bacteria 3064
654 Ga0207693_10087300 3300025915 Bacteria 2444
655 Ga0207693_10207407 3300025915 Bacteria 1541
656 Ga0207663_10000136 3300025916 Bacteria 34085
657 Ga0207663_10006786 3300025916 Bacteria 5893
658 Ga0207663_10096997 3300025916 Bacteria 1971
659 Ga0207662_10072909 3300025918 Bacteria 2082
660 Ga0207662_10097728 3300025918 Bacteria 1815
661 Ga0207657_10012700 3300025919 Bacteria 8299
662 Ga0207657_10095571 3300025919 Bacteria 2472
663 Ga0207649_10049327 3300025920 Bacteria 2599
664 Ga0207646_10001349 3300025922 Bacteria 30452
665 Ga0207646_10001834 3300025922 Bacteria 25670
666 Ga0207646_10007486 3300025922 Bacteria 11082
667 Ga0207646_10013493 3300025922 Bacteria 7811
668 Ga0207646_10068747 3300025922 Bacteria 3164
669 Ga0207646_10140521 3300025922 Bacteria 2175
670 Ga0207646_10179344 3300025922 Bacteria 1913
671 Ga0207646_10462444 3300025922 Bacteria 1144
672 Ga0207681_10040181 3300025923 Bacteria 3111
673 Ga0207681_10058711 3300025923 Bacteria 2635
674 Ga0207681_10270210 3300025923 Bacteria 1334
675 Ga0207694_10014027 3300025924 Bacteria 6042
676 Ga0207694_10035008 3300025924 Bacteria 3851
677 Ga0207694_10280638 3300025924 Bacteria 1368
678 Ga0207650_10000288 3300025925 Bacteria 51267
679 Ga0207650_10001712 3300025925 Bacteria 15568
680 Ga0207650_10010063 3300025925 Bacteria 6478
681 Ga0207650_10049334 3300025925 Bacteria 3108
682 Ga0207650_10166275 3300025925 Bacteria 1751
683 Ga0207650_10425564 3300025925 Bacteria 1102
684 Ga0207659_10342115 3300025926 Bacteria 1239
685 Ga0207687_10171833 3300025927 Bacteria 1672
686 Ga0207700_10006688 3300025928 Bacteria 6994
687 Ga0207700_10032460 3300025928 Bacteria 3724
688 Ga0207700_10069437 3300025928 Bacteria 2704
689 Ga0207664_10012798 3300025929 Bacteria 6009
690 Ga0207664_10013549 3300025929 Bacteria 5857
691 Ga0207664_10181276 3300025929 Bacteria 1808
692 Ga0207644_10027565 3300025931 Bacteria 3926
693 Ga0207644_10041902 3300025931 Bacteria 3241
694 Ga0207644_10055845 3300025931 Bacteria 2847
695 Ga0207706_10014998 3300025933 Bacteria 7015
696 Ga0207706_10050736 3300025933 Bacteria 3666
697 Ga0207706_10070045 3300025933 Bacteria 3084
698 Ga0207706_10128126 3300025933 Bacteria 2232
699 Ga0207686_10213919 3300025934 Bacteria 1387
700 Ga0207709_10099344 3300025935 Bacteria 1921
701 Ga0207709_10174095 3300025935 Bacteria 1513
702 Ga0207670_10116122 3300025936 Bacteria 1937
703 Ga0207670_10268001 3300025936 Bacteria 1326
704 Ga0207669_10168271 3300025937 Bacteria 1557
705 Ga0207669_10290104 3300025937 Bacteria 1238
706 Ga0207669_10354712 3300025937 Bacteria 1134
707 Ga0207669_10402179 3300025937 Bacteria 1073
708 Ga0207669_10403072 3300025937 Bacteria 1072
709 Ga0207665_10000064 3300025939 Bacteria 68931
710 Ga0207665_10004269 3300025939 Bacteria 9499
711 Ga0207691_10061618 3300025940 Bacteria 3407
712 Ga0207691_10118628 3300025940 Bacteria 2347
713 Ga0207691_10145082 3300025940 Bacteria 2090
714 Ga0207691_10457121 3300025940 Bacteria 1086
715 Ga0207711_10111330 3300025941 Bacteria 2435
716 Ga0207711_10282686 3300025941 Bacteria 1528
717 Ga0207689_10039992 3300025942 Bacteria 3882
718 Ga0207689_10073209 3300025942 Bacteria 2814
719 Ga0207661_10169449 3300025944 Bacteria 1900
720 Ga0207679_10008273 3300025945 Bacteria 6625
721 Ga0207667_10088924 3300025949 Bacteria 3193
722 Ga0207651_10001703 3300025960 Bacteria 10145
723 Ga0207651_10172900 3300025960 Bacteria 1705
724 Ga0207712_10251495 3300025961 Bacteria 1429
725 Ga0207668_10194433 3300025972 Bacteria 1610
726 Ga0207640_10048315 3300025981 Bacteria 2750
727 Ga0207640_10061301 3300025981 Bacteria 2491
728 Ga0207640_10165095 3300025981 Bacteria 1643
729 Ga0207640_10218736 3300025981 Bacteria 1457
730 Ga0207658_10000466 3300025986 Bacteria 37801
731 Ga0207658_10357504 3300025986 Bacteria 1273
732 Ga0207658_10784033 3300025986 Bacteria 865
733 Ga0207677_10017339 3300026023 Bacteria 4291
734 Ga0207677_10115036 3300026023 Bacteria 2011
735 Ga0207677_10214991 3300026023 Bacteria 1538
736 Ga0207703_10159359 3300026035 Bacteria 1975
737 Ga0207703_10169795 3300026035 Bacteria 1917
738 Ga0207703_10242139 3300026035 Bacteria 1622
739 Ga0207639_10062071 3300026041 Bacteria 2888
740 Ga0207639_10278169 3300026041 Bacteria 1471
741 Ga0207639_10570532 3300026041 Bacteria 1041
742 Ga0207678_10100542 3300026067 Bacteria 2470
743 Ga0207678_10148846 3300026067 Bacteria 1999
744 Ga0207708_10002881 3300026075 Bacteria 12675
745 Ga0207708_10026254 3300026075 Bacteria 4406
746 Ga0207702_10039969 3300026078 Bacteria 3932
747 Ga0207702_10141568 3300026078 Bacteria 2177
748 Ga0207641_10000103 3300026088 Bacteria 122350
749 Ga0207641_10022737 3300026088 Bacteria 5162
750 Ga0207641_10314925 3300026088 Bacteria 1482
751 Ga0207648_10006999 3300026089 Bacteria 11151
752 Ga0207648_10009796 3300026089 Bacteria 9155
753 Ga0207648_10336172 3300026089 Bacteria 1359
754 Ga0207676_10000044 3300026095 Bacteria 161679
755 Ga0207676_10223852 3300026095 Bacteria 1677
756 Ga0207675_100042588 3300026118 Bacteria 4239
757 Ga0207675_100189232 3300026118 Bacteria 1973
758 Ga0207683_10014258 3300026121 Bacteria 6772
759 Ga0207683_10017123 3300026121 Bacteria 6169
760 Ga0207683_10030901 3300026121 Bacteria 4645
761 Ga0207683_10030958 3300026121 Bacteria 4641
762 Ga0207683_10105063 3300026121 Bacteria 2524
763 Ga0207683_10249155 3300026121 Bacteria 1621
764 Ga0207698_10000603 3300026142 Bacteria 21081
765 Ga0207698_10033824 3300026142 Bacteria 3719
766 Ga0209281_1000023 3300027111 Bacteria 519955
767 Ga0209389_1000011 3300027296 Bacteria 223265
768 Ga0209389_1000424 3300027296 Bacteria 25082
769 Ga0209371_1023377 3300027312 Bacteria 1456
770 Ga0209589_1004180 3300027357 Bacteria 25082
771 Ga0209489_100017 3300027361 Bacteria 223265
772 Ga0209489_104563 3300027361 Bacteria 25351
773 Ga0209700_100027 3300027363 Bacteria 223462
774 Ga0209981_1012200 3300027378 Bacteria 1188
775 Ga0209995_1017133 3300027471 Bacteria 1192
776 Ga0209179_1012786 3300027512 Bacteria 1514
777 Ga0209999_1000035 3300027543 Bacteria 14804
778 Ga0209999_1006003 3300027543 Bacteria 2181
779 Ga0209983_1007011 3300027665 Bacteria 2314
780 Ga0209588_1001890 3300027671 Bacteria 5595
781 Ga0209588_1018715 3300027671 Bacteria 2156
782 Ga0209588_1023117 3300027671 Bacteria 1958
783 Ga0209971_1012094 3300027682 Bacteria 2043
784 Ga0209966_1000046 3300027695 Bacteria 52323
785 Ga0209813_10013245 3300027866 Bacteria 2199
786 Ga0209974_10003197 3300027876 Bacteria 5923
787 Ga0207428_10028914 3300027907 Bacteria 4600
788 Ga0207428_10030850 3300027907 Bacteria 4428
789 Ga0207428_10071213 3300027907 Bacteria 2731
790 Ga0207428_10290463 3300027907 Bacteria 1212
791 Ga0268266_10100118 3300028379 Bacteria 2552
792 Ga0268265_10000142 3300028380 Bacteria 91165
793 Ga0268265_10067166 3300028380 Bacteria 2775
794 Ga0268265_10178279 3300028380 Bacteria 1823
795 Ga0268265_10186621 3300028380 Bacteria 1787
796 Ga0268265_10239028 3300028380 Bacteria 1601
797 Ga0268264_10000035 3300028381 Bacteria 398196
798 Ga0268264_10766013 3300028381 Bacteria 962
799 Ga0265326_10002505 3300028558 Bacteria 6188
800 Ga0265319_1001186 3300028563 Bacteria 16109
801 Ga0265334_10004555 3300028573 Bacteria 6143
802 Ga0265318_10002315 3300028577 Bacteria 10231
803 Ga0265323_10000768 3300028653 Bacteria 17199
804 Ga0265322_10003636 3300028654 Bacteria 4638
805 Ga0265336_10000106 3300028666 Bacteria 63839
806 Ga0307517_10000049 3300028786 Bacteria 160368
807 Ga0307515_10001611 3300028794 Bacteria 50308
808 Ga0307515_10006414 3300028794 Bacteria 23532
809 Ga0307515_10008473 3300028794 Bacteria 20029
810 Ga0307515_10008712 3300028794 Bacteria 19722
811 Ga0307515_10056637 3300028794 Bacteria 5692
812 Ga0307515_10062205 3300028794 Bacteria 5278
813 Ga0307515_10144962 3300028794 Bacteria 2522
814 Ga0307515_10152692 3300028794 Bacteria 2404
815 Ga0265338_10000065 3300028800 Bacteria 188966
816 Ga0265324_10001808 3300029957 Bacteria 11615
817 Ga0268256_1026489 3300030500 Bacteria 1456
818 Ga0316177_1191241 3300030731 Bacteria 5583
819 Ga0314311_1011733 3300030733 Bacteria 1676
820 Ga0316179_1030285 3300030734 Bacteria 3866
821 Ga0316178_1051116 3300030735 Bacteria 5558
822 Ga0316180_1047811 3300030736 Bacteria 3091
823 Ga0316183_1126188 3300030742 Bacteria 20738
824 Ga0316182_1174059 3300030745 Bacteria 5579
825 Ga0265330_10013442 3300031235 Bacteria 3814
826 Ga0265325_10081996 3300031241 Bacteria 1602
827 Ga0265339_10021009 3300031249 Bacteria 3807
828 Ga0265327_10021443 3300031251 Bacteria 3898
829 Ga0265327_10063988 3300031251 Bacteria 1866
830 Ga0307513_10000028 3300031456 Bacteria 193264
831 Ga0307513_10000568 3300031456 Bacteria 52926
832 Ga0307513_10004235 3300031456 Bacteria 19184
833 Ga0307513_10012841 3300031456 Bacteria 10312
834 Ga0307513_10046454 3300031456 Bacteria 4733
835 Ga0307513_10055014 3300031456 Bacteria 4261
836 Ga0307513_10069332 3300031456 Bacteria 3690
837 Ga0307513_10092185 3300031456 Bacteria 3085
838 Ga0307513_10335005 3300031456 Bacteria 1266
839 Ga0307509_10029697 3300031507 Bacteria 6062
840 Ga0307509_10111327 3300031507 Bacteria 2740
841 Ga0307509_10129637 3300031507 Bacteria 2481
842 Ga0307408_100000005 3300031548 Bacteria 529098
843 Ga0307408_100007613 3300031548 Bacteria 7162
844 Ga0307408_100040667 3300031548 Bacteria 3292
845 Ga0307408_100070704 3300031548 Bacteria 2577
846 Ga0307408_100180100 3300031548 Bacteria 1694
847 Ga0307408_100289875 3300031548 Bacteria 1366
848 Ga0307408_100573360 3300031548 Bacteria 999
849 Ga0307508_10000004 3300031616 Bacteria 287547
850 Ga0307508_10000090 3300031616 Bacteria 106893
851 Ga0307508_10000150 3300031616 Bacteria 83110
852 Ga0307508_10178022 3300031616 Bacteria 1729
853 Ga0307514_10000641 3300031649 Bacteria 63711
854 Ga0307514_10011703 3300031649 Bacteria 7299
855 Ga0307514_10028849 3300031649 Bacteria 4472
856 Ga0307514_10108177 3300031649 Bacteria 1978
857 Ga0316579_10007507 3300031691 Bacteria 4507
858 Ga0265314_10075462 3300031711 Bacteria 2243
859 Ga0265314_10158224 3300031711 Bacteria 1381
860 Ga0316578_10031741 3300031728 Bacteria 3013
861 Ga0307516_10005295 3300031730 Bacteria 15524
862 Ga0307405_10052767 3300031731 Bacteria 2530
863 Ga0307405_10090061 3300031731 Bacteria 2028
864 Ga0307413_10065803 3300031824 Bacteria 2258
865 Ga0307410_10319488 3300031852 Bacteria 1231
866 Ga0307406_10000463 3300031901 Bacteria 23502
867 Ga0307406_10001390 3300031901 Bacteria 13475
868 Ga0307407_10111539 3300031903 Bacteria 1718
869 Ga0307412_10014711 3300031911 Bacteria 4625
870 Ga0307412_10071231 3300031911 Bacteria 2372
871 Ga0307412_10128271 3300031911 Bacteria 1838
872 Ga0307412_10238555 3300031911 Bacteria 1405
873 Ga0307409_100136381 3300031995 Bacteria 2106
874 Ga0307416_100166125 3300032002 Bacteria 2047
875 Ga0307416_100166684 3300032002 Bacteria 2044
876 Ga0307416_100220569 3300032002 Bacteria 1818
877 Ga0307414_10095124 3300032004 Bacteria 2225
878 Ga0307414_10101810 3300032004 Bacteria 2163
879 Ga0307414_10161439 3300032004 Bacteria 1780
880 Ga0307411_10006346 3300032005 Bacteria 5911
881 Ga0307411_10009963 3300032005 Bacteria 5034
882 Ga0307411_10116554 3300032005 Bacteria 1923
883 Ga0307411_10348690 3300032005 Bacteria 1206
884 Ga0307415_100090459 3300032126 Bacteria 2214
885 Ga0307415_100191004 3300032126 Bacteria 1616
886 Ga0307507_10098971 3300033179 Bacteria 2452
887 Ga0307507_10146187 3300033179 Bacteria 1795
888 Ga0307507_10211383 3300033179 Bacteria 1322
889 Ga0307510_10001725 3300033180 Bacteria 24301
890 Ga0307510_10019318 3300033180 Bacteria 7995
891 Ga0307510_10033122 3300033180 Bacteria 5808
892 Ga0307510_10044427 3300033180 Bacteria 4812
893 Ga0307510_10075429 3300033180 Bacteria 3324
894 Ga0307510_10094555 3300033180 Bacteria 2813
895 Ga0307510_10236845 3300033180 Bacteria 1323
896 Ga0307510_10316544 3300033180 Bacteria 1018
897 Ga0315911_1000011 3300033442 Bacteria 264678
898 Ga0316214_1011677 3300033545 Bacteria 1197
899 Ga0373944_0011346 3300035089 Bacteria 2441
900 Ga0373944_0032737 3300035089 Bacteria 1572
901 Ga0373949_0016585 3300035090 Bacteria 1652
902 Ga0373923_0003802 3300035111 Bacteria 4905
903 Ga0373923_0010861 3300035111 Bacteria 3325
904 Ga0373932_0002652 3300035112 Bacteria 4459
905 Ga0373936_0035174 3300035113 Bacteria 1993
906 Ga0373936_0058316 3300035113 Bacteria 1572
907 Ga0373945_0022797 3300035116 Bacteria 2159
908 Ga0373953_0022563 3300035117 Bacteria 2374
909 Ga0373953_0058916 3300035117 Bacteria 1566
910 Ga0373954_0010242 3300035118 Bacteria 4134
911 Ga0373954_0024910 3300035118 Bacteria 2731
912 Ga0373954_0101884 3300035118 Bacteria 1386
913 Ga0373956_0012445 3300035119 Bacteria 3527
914 Ga0373956_0168971 3300035119 Bacteria 1032
915 Ga0373957_0000746 3300035120 Bacteria 8454
916 Ga0373957_0002972 3300035120 Bacteria 4918
917 Ga0373957_0020968 3300035120 Bacteria 2314
918 Ga0373943_0048743 3300035170 Bacteria 2076
919 Ga0373946_0015804 3300035171 Bacteria 2867
920 Ga0373946_0222052 3300035171 Bacteria 913
921 Ga0373955_0000360 3300035172 Bacteria 19140
922 Ga0373955_0008786 3300035172 Bacteria 4706
923 Ga0373955_0039759 3300035172 Bacteria 2512
924 Ga0373955_0105315 3300035172 Bacteria 1624
925 Ga0373942_0036963 3300035207 Bacteria 1318
926 Ga0373961_0006253 3300035241 Bacteria 2862
927 Ga0373962_0004069 3300035242 Bacteria 3527
928 Ga0373962_0019931 3300035242 Bacteria 1757
929 Ga0316574_0040978 3300035398 Bacteria 2853
930 Ga0373924_0087304 3300035410 Bacteria 1332
931 Ga0373931_0000242 3300035691 Bacteria 23253
932 Ga0373931_0024711 3300035691 Bacteria 3046
933 Ga0373931_0047379 3300035691 Bacteria 2275
934 Ga0373931_0311109 3300035691 Bacteria 975
935 Ga0373935_0002949 3300035692 Bacteria 9803
936 Ga0373935_0006508 3300035692 Bacteria 6980
937 Ga0373935_0009288 3300035692 Bacteria 5887
938 Ga0373935_0012293 3300035692 Bacteria 5150
939 Ga0373935_0289936 3300035692 Bacteria 1154
940 Ga0373927_0000950 3300035695 Bacteria 22071
941 Ga0373927_0034359 3300035695 Bacteria 3299
942 Ga0373927_0035579 3300035695 Bacteria 3238
943 Ga0373927_0171508 3300035695 Bacteria 1422
944 Ga0373927_0274979 3300035695 Bacteria 1107
945 Ga0373933_0003920 3300035724 Bacteria 8208
946 Ga0373933_0114823 3300035724 Bacteria 1682
947 Ga0373947_0000846 3300035725 Bacteria 18504
948 Ga0373947_0010653 3300035725 Bacteria 5276
949 Ga0373937_0000269 3300036401 Bacteria 50111
950 Ga0373937_0008436 3300036401 Bacteria 8955
951 Ga0373937_0031959 3300036401 Bacteria 4772
952 Ga0373937_0239485 3300036401 Bacteria 1709
953 Ga0372808_002242 3300036459 Bacteria 2195
954 Ga0316582_0009082 3300036647 Bacteria 5378
955 Ga0316582_0078104 3300036647 Bacteria 2156
956 Ga0316582_0217325 3300036647 Bacteria 1306
957 Ga0316584_0260446 3300036712 Bacteria 1265
958 Ga0373925_0000075 3300037068 Bacteria 105395
959 Ga0373925_0002196 3300037068 Bacteria 15850
960 Ga0373925_0016899 3300037068 Bacteria 5282
961 Ga0373925_0030229 3300037068 Bacteria 3976
962 Ga0373925_0163994 3300037068 Bacteria 1752
963 Ga0373925_0172510 3300037068 Bacteria 1708
964 Ga0373925_0273550 3300037068 Bacteria 1359
965 Ga0395900_0447224 3300037418 Bacteria 1249
966 Ga0395898_0125625 3300037466 Bacteria 2458
967 Ga0395898_0267108 3300037466 Bacteria 1632
968 Ga0395905_0039879 3300037471 Bacteria 4405
969 Ga0395905_0143784 3300037471 Bacteria 2244
970 Ga0395905_0342674 3300037471 Bacteria 1386
971 Ga0395905_0535264 3300037471 Bacteria 1072
972 Ga0316581_0040528 3300037588 Bacteria 1418
973 Ga0395901_0051193 3300038443 Bacteria 4293
974 Ga0395901_0222493 3300038443 Bacteria 1973
975 Ga0400490_13794 3300038726 Bacteria 3881
976 Ga0400490_20324 3300038726 Bacteria 7197
977 Ga0400490_45281 3300038726 Bacteria 70798
978 Ga0400491_16995 3300038727 Bacteria 2643
979 Ga0400488_23323 3300038741 Bacteria 6713
980 Ga0400488_38093 3300038741 Bacteria 2631
981 Ga0400486_06770 3300038742 Bacteria 10082
982 Ga0400486_28053 3300038742 Bacteria 14118
983 Ga0400483_027235 3300039062 Bacteria 3705
984 Ga0400483_119201 3300039062 Bacteria 6428
985 Ga0400483_208955 3300039062 Bacteria 5644
986 Ga0400483_259163 3300039062 Bacteria 9856
987 Ga0436365_0098421 3300039437 Bacteria 1188
988 Ga0436365_0240210 3300039437 Bacteria 20191
989 Ga0436365_0241740 3300039437 Bacteria 2361
990 Ga0436365_0642532 3300039437 Bacteria 3284
991 Ga0436365_0703504 3300039437 Bacteria 2062
992 Ga0436360_0260696 3300039438 Bacteria 1469
993 Ga0436360_0598803 3300039438 Bacteria 1232
994 Ga0436360_0638294 3300039438 Bacteria 1090
995 Ga0436361_0053786 3300039447 Bacteria 27680
996 Ga0436361_0356069 3300039447 Bacteria 2837
997 Ga0436363_0771056 3300039450 Bacteria 3332
998 Ga0436363_1181230 3300039450 Bacteria 1553
999 Ga0436363_1394953 3300039450 Bacteria 1495
1000 Ga0436362_0365725 3300039453 Bacteria 1315
1001 Ga0439453_0001117 3300041408 Bacteria 3346
1002 Ga0439465_0042200 3300041413 Bacteria 1478
1003 Ga0451853_3923888 3300041512 Bacteria 1247
1004 Ga0439441_005120 3300042001 Bacteria 2020
1005 Ga0439443_004522 3300042003 Bacteria 1817
1006 Ga0439449_0002308 3300042007 Bacteria 7469
1007 Ga0439449_0043482 3300042007 Bacteria 1668
1008 Ga0439456_028952 3300042013 Bacteria 1182
1009 Ga0450911_000717 3300042115 Bacteria 9642
1010 Ga0450890_002196 3300042127 Bacteria 2715
1011 Ga0439446_0024413 3300042156 Bacteria 1725
1012 Ga0439434_0022733 3300042435 Bacteria 1885
1013 Ga0439434_0029405 3300042435 Bacteria 1666
1014 Ga0439435_0000398 3300042436 Bacteria 6721
1015 Ga0439444_0000032 3300042437 Bacteria 10072
1016 Ga0439460_0003204 3300042461 Bacteria 3952
1017 Ga0450918_001083 3300042531 Bacteria 5609
1018 Ga0450893_0001826 3300042532 Bacteria 3279
1019 Ga0451577_0000206 3300042876 Bacteria 123278
1020 Ga0451577_0244892 3300042876 Bacteria 1622
1021 Ga0451577_0281251 3300042876 Bacteria 1507
1022 Ga0466972_0000371 3300044658 Bacteria 24281
1023 Ga0466972_0049275 3300044658 Bacteria 2034
1024 Ga0453683_0000252 3300044673 Bacteria 70926
1025 Ga0453683_0012589 3300044673 Bacteria 5542
1026 Ga0466966_0004865 3300044684 Bacteria 8833
1027 Ga0466961_0003875 3300044693 Bacteria 9345
1028 Ga0453684_0000063 3300044712 Bacteria 486079
1029 Ga0453684_0000218 3300044712 Bacteria 250267
1030 Ga0453684_0005314 3300044712 Bacteria 25677
1031 Ga0453684_0045710 3300044712 Bacteria 5835
1032 Ga0453684_0049519 3300044712 Bacteria 5539
1033 Ga0453684_0061368 3300044712 Bacteria 4826
1034 Ga0453684_0609261 3300044712 Bacteria 1196
1035 Ga0466957_0256682 3300044842 Bacteria 1164
1036 Ga0466960_0142187 3300044901 Bacteria 1275
1037 Ga0466959_0008411 3300045049 Bacteria 7295
1038 Ga0466959_0079291 3300045049 Bacteria 2368
1039 Ga0451576_0000621 3300045051 Bacteria 74139
1040 Ga0451576_0002043 3300045051 Bacteria 31773
1041 Ga0451576_0013397 3300045051 Bacteria 9175
1042 Ga0451576_0091312 3300045051 Bacteria 3168
1043 Ga0451576_0132049 3300045051 Bacteria 2603
1044 Ga0451576_0288831 3300045051 Bacteria 1714
1045 Ga0466958_0186496 3300045836 Bacteria 1317
1046 Ga0466967_0144847 3300045976 Bacteria 2216
1047 Ga0466967_0388207 3300045976 Bacteria 1357
1048 Ga0495617_016710 3300046452 Bacteria 2481
1049 Ga0495627_000004 3300046453 Bacteria 640612
1050 Ga0495592_0000060 3300046454 Bacteria 100113
1051 Ga0495592_0000553 3300046454 Bacteria 26681
1052 Ga0495592_0009069 3300046454 Bacteria 7481
1053 Ga0495592_0050267 3300046454 Bacteria 3097
1054 Ga0495592_0094668 3300046454 Bacteria 2137
1055 Ga0495603_0000200 3300046455 Bacteria 31435
1056 Ga0495603_0004845 3300046455 Bacteria 8045
1057 Ga0495603_0013905 3300046455 Bacteria 4869
1058 Ga0495603_0094293 3300046455 Bacteria 1749
1059 Ga0495590_0000149 3300046457 Bacteria 42250
1060 Ga0495629_0002535 3300046459 Bacteria 14008
1061 Ga0495629_0026394 3300046459 Bacteria 4126
1062 Ga0495638_0001295 3300046460 Bacteria 23270
1063 Ga0495638_0004444 3300046460 Bacteria 10621
1064 Ga0495638_0029593 3300046460 Bacteria 3532
1065 Ga0495638_0043120 3300046460 Bacteria 2847
1066 Ga0495641_0006637 3300046461 Bacteria 7446
1067 Ga0495641_0008896 3300046461 Bacteria 6042
1068 Ga0495651_0000181 3300046462 Bacteria 46803
1069 Ga0495651_0002101 3300046462 Bacteria 15375
1070 Ga0495651_0027827 3300046462 Bacteria 4405
1071 Ga0495651_0050887 3300046462 Bacteria 3195
1072 Ga0495651_0095887 3300046462 Bacteria 2217
1073 Ga0495653_0000129 3300046463 Bacteria 62515
1074 Ga0495653_0001070 3300046463 Bacteria 21097
1075 Ga0495653_0028701 3300046463 Bacteria 4448
1076 Ga0495653_0229745 3300046463 Bacteria 1242
1077 Ga0495650_0004948 3300046471 Bacteria 8889
1078 Ga0495650_0014057 3300046471 Bacteria 4192
1079 Ga0495650_0029154 3300046471 Bacteria 2520
1080 Ga0495580_0001269 3300046472 Bacteria 22275
1081 Ga0495580_0002104 3300046472 Bacteria 17472
1082 Ga0495580_0043472 3300046472 Bacteria 3198
1083 Ga0495580_0198352 3300046472 Bacteria 1383
1084 Ga0495580_0281458 3300046472 Bacteria 1134
1085 Ga0495580_0339238 3300046472 Bacteria 1019
1086 Ga0495582_0000354 3300046473 Bacteria 25130
1087 Ga0495582_0023610 3300046473 Bacteria 3363
1088 Ga0495605_0002509 3300046474 Bacteria 11344
1089 Ga0495605_0053460 3300046474 Bacteria 1959
1090 Ga0495605_0074102 3300046474 Bacteria 1603
1091 Ga0495639_0004987 3300046475 Bacteria 5696
1092 Ga0495639_0005177 3300046475 Bacteria 5601
1093 Ga0495662_0000590 3300046476 Bacteria 16763
1094 Ga0495662_0001324 3300046476 Bacteria 12266
1095 Ga0495664_0000003 3300046477 Bacteria 551602
1096 Ga0495664_0003641 3300046477 Bacteria 8403
1097 Ga0495664_0062180 3300046477 Bacteria 2223
1098 Ga0495664_0064611 3300046477 Bacteria 2181
1099 Ga0495664_0177127 3300046477 Bacteria 1293
1100 Ga0495585_0067849 3300046492 Bacteria 1950
1101 Ga0495585_0113489 3300046492 Bacteria 1439
1102 Ga0495594_0001396 3300046499 Bacteria 12540
1103 Ga0495594_0017864 3300046499 Bacteria 3752
1104 Ga0495594_0094237 3300046499 Bacteria 1680
1105 Ga0495594_0104651 3300046499 Bacteria 1593
1106 Ga0495596_0053025 3300046500 Bacteria 1587
1107 Ga0495607_0000018 3300046501 Bacteria 167673
1108 Ga0495607_0000109 3300046501 Bacteria 86702
1109 Ga0495607_0022482 3300046501 Bacteria 3960
1110 Ga0495583_0000370 3300046506 Bacteria 69938
1111 Ga0495606_0002687 3300046507 Bacteria 20107
1112 Ga0495606_0008571 3300046507 Bacteria 8847
1113 Ga0495606_0046693 3300046507 Bacteria 2861
1114 Ga0495608_0000005 3300046511 Bacteria 350726
1115 Ga0495608_0000832 3300046511 Bacteria 21541
1116 Ga0495608_0005335 3300046511 Bacteria 9184
1117 Ga0495608_0019297 3300046511 Bacteria 4694
1118 Ga0495608_0113220 3300046511 Bacteria 1743
1119 Ga0495610_0073587 3300046512 Bacteria 1587
1120 Ga0495610_0151393 3300046512 Bacteria 989
1121 Ga0495616_0007346 3300046513 Bacteria 6592
1122 Ga0495618_0000044 3300046514 Bacteria 95526
1123 Ga0495618_0003243 3300046514 Bacteria 10189
1124 Ga0495618_0019644 3300046514 Bacteria 4158
1125 Ga0495618_0046150 3300046514 Bacteria 2749
1126 Ga0495618_0194174 3300046514 Bacteria 1286
1127 Ga0495620_0000678 3300046515 Bacteria 21047
1128 Ga0495620_0012060 3300046515 Bacteria 4484
1129 Ga0495620_0032690 3300046515 Bacteria 2367
1130 Ga0495620_0051357 3300046515 Bacteria 1755
1131 Ga0495628_0000001 3300046516 Bacteria 917742
1132 Ga0495628_0014573 3300046516 Bacteria 6584
1133 Ga0495628_0077782 3300046516 Bacteria 2580
1134 Ga0495628_0080064 3300046516 Bacteria 2540
1135 Ga0495628_0187155 3300046516 Bacteria 1564
1136 Ga0495628_0232882 3300046516 Bacteria 1380
1137 Ga0495628_0324970 3300046516 Bacteria 1134
1138 Ga0495630_0000574 3300046517 Bacteria 26824
1139 Ga0495630_0030591 3300046517 Bacteria 4006
1140 Ga0495631_0000764 3300046518 Bacteria 20676
1141 Ga0495632_0000102 3300046519 Bacteria 87253
1142 Ga0495632_0064658 3300046519 Bacteria 1768
1143 Ga0495632_0071248 3300046519 Bacteria 1670
1144 Ga0495637_0000699 3300046520 Bacteria 23092
1145 Ga0495637_0004583 3300046520 Bacteria 7142
1146 Ga0495643_0027646 3300046522 Bacteria 3185
1147 Ga0495643_0056685 3300046522 Bacteria 2090
1148 Ga0495644_0016360 3300046523 Bacteria 2838
1149 Ga0495648_0000093 3300046524 Bacteria 111381
1150 Ga0495648_0000723 3300046524 Bacteria 35198
1151 Ga0495648_0005295 3300046524 Bacteria 10766
1152 Ga0495648_0008413 3300046524 Bacteria 8123
1153 Ga0495648_0010663 3300046524 Bacteria 6984
1154 Ga0495648_0013147 3300046524 Bacteria 6137
1155 Ga0495648_0033902 3300046524 Bacteria 3330
1156 Ga0495648_0083089 3300046524 Bacteria 1815
1157 Ga0495648_0102821 3300046524 Bacteria 1573
1158 Ga0495642_0014290 3300046528 Bacteria 3076
1159 Ga0495652_0000002 3300046529 Bacteria 946606
1160 Ga0495652_0001533 3300046529 Bacteria 25351
1161 Ga0495652_0006363 3300046529 Bacteria 10997
1162 Ga0495652_0023871 3300046529 Bacteria 5416
1163 Ga0495652_0037069 3300046529 Bacteria 4233
1164 Ga0495652_0091222 3300046529 Bacteria 2491
1165 Ga0495652_0388360 3300046529 Bacteria 991
1166 Ga0495654_0000014 3300046530 Bacteria 312126
1167 Ga0495654_0037178 3300046530 Bacteria 2444
1168 Ga0495654_0053522 3300046530 Bacteria 1961
1169 Ga0495665_0002572 3300046531 Bacteria 9795
1170 Ga0495665_0170077 3300046531 Bacteria 1134
1171 Ga0495640_0000001 3300046533 Bacteria 853827
1172 Ga0495640_0002001 3300046533 Bacteria 16252
1173 Ga0495640_0075246 3300046533 Bacteria 2255
1174 Ga0495640_0153547 3300046533 Bacteria 1478
1175 Ga0495587_0000001 3300046536 Bacteria 724132
1176 Ga0495587_0005325 3300046536 Bacteria 8413
1177 Ga0495587_0014270 3300046536 Bacteria 4985
1178 Ga0495587_0024566 3300046536 Bacteria 3691
1179 Ga0495587_0047368 3300046536 Bacteria 2549
1180 Ga0495609_0000650 3300046538 Bacteria 27040
1181 Ga0495609_0010985 3300046538 Bacteria 4325
1182 Ga0495609_0036919 3300046538 Bacteria 2205
1183 Ga0495645_0000002 3300046543 Bacteria 651644
1184 Ga0495645_0004058 3300046543 Bacteria 9999
1185 Ga0495645_0025205 3300046543 Bacteria 4315
1186 Ga0495645_0089014 3300046543 Bacteria 2207
1187 Ga0495645_0102213 3300046543 Bacteria 2037
1188 Ga0495622_0053566 3300046557 Bacteria 1872
1189 Ga0495622_0133979 3300046557 Bacteria 1127
1190 Ga0495633_0056250 3300046558 Bacteria 1849
1191 Ga0495667_0000039 3300046559 Bacteria 131308
1192 Ga0495667_0003082 3300046559 Bacteria 11183
1193 Ga0495667_0163575 3300046559 Bacteria 1431
1194 Ga0495656_0023075 3300046615 Bacteria 2445
1195 Ga0495656_0032291 3300046615 Bacteria 2129
1196 Ga0495668_0027182 3300046616 Bacteria 3242
1197 Ga0495668_0037116 3300046616 Bacteria 2728
1198 Ga0495668_0174159 3300046616 Bacteria 1179
1199 Ga0495634_0000010 3300046642 Bacteria 143792
1200 Ga0495634_0003609 3300046642 Bacteria 12362
1201 Ga0495634_0006837 3300046642 Bacteria 8630
1202 Ga0495634_0074682 3300046642 Bacteria 2227
1203 Ga0495611_0063919 3300046648 Bacteria 1675
1204 Ga0495625_0000657 3300046660 Bacteria 49342
1205 Ga0495625_0008614 3300046660 Bacteria 8681
1206 Ga0495635_0000001 3300046663 Bacteria 704901
1207 Ga0495635_0001348 3300046663 Bacteria 16335
1208 Ga0495635_0001667 3300046663 Bacteria 14944
1209 Ga0495635_0005872 3300046663 Bacteria 8558
1210 Ga0495635_0026385 3300046663 Bacteria 4043
1211 Ga0495659_0009843 3300046664 Bacteria 3058
1212 Ga0495659_0021736 3300046664 Bacteria 2165
1213 Ga0495661_0079084 3300046665 Bacteria 1901
1214 Ga0495588_0010550 3300046674 Bacteria 4301
1215 Ga0495657_0000042 3300046675 Bacteria 114669
1216 Ga0495657_0002643 3300046675 Bacteria 14975
1217 Ga0495657_0033520 3300046675 Bacteria 3574
1218 Ga0495599_0000013 3300046678 Bacteria 179828
1219 Ga0495599_0004148 3300046678 Bacteria 8559
1220 Ga0495599_0006501 3300046678 Bacteria 7052
1221 Ga0495599_0015314 3300046678 Bacteria 4758
1222 Ga0495599_0028956 3300046678 Bacteria 3471
1223 Ga0495599_0031977 3300046678 Bacteria 3303
1224 Ga0495623_0000050 3300046679 Bacteria 72959
1225 Ga0495623_0014984 3300046679 Bacteria 5011
1226 Ga0495623_0015826 3300046679 Bacteria 4875
1227 Ga0495623_0045431 3300046679 Bacteria 2790
1228 Ga0495646_0000009 3300046680 Bacteria 200698
1229 Ga0495646_0010792 3300046680 Bacteria 5803
1230 Ga0495646_0031676 3300046680 Bacteria 3294
1231 Ga0495646_0050016 3300046680 Bacteria 2535
1232 Ga0495658_0006057 3300046683 Bacteria 5941
1233 Ga0495658_0208822 3300046683 Bacteria 1219
1234 Ga0495669_0059993 3300046684 Bacteria 1719
1235 Ga0495613_0031324 3300046689 Bacteria 3950
1236 Ga0495613_0041413 3300046689 Bacteria 3411
1237 Ga0495613_0205691 3300046689 Bacteria 1386
1238 Ga0495624_0002275 3300046690 Bacteria 14611
1239 Ga0495624_0225932 3300046690 Bacteria 1134
1240 Ga0495670_0012537 3300046691 Bacteria 4171
1241 Ga0495671_0040020 3300046692 Bacteria 2365
1242 Ga0495649_0000149 3300046694 Bacteria 60998
1243 Ga0495649_0212609 3300046694 Bacteria 1002
1244 Ga0495600_0000035 3300046809 Bacteria 80552
1245 Ga0495600_0044768 3300046809 Bacteria 2886
1246 Ga0495600_0114324 3300046809 Bacteria 1757
1247 Ga0495600_0129701 3300046809 Bacteria 1639
1248 Ga0495581_0000851 3300047315 Bacteria 16242
1249 Ga0495581_0005368 3300047315 Bacteria 7416
1250 Ga0495581_0007779 3300047315 Bacteria 6205
1251 Ga0495604_0000069 3300047317 Bacteria 89935
1252 Ga0495604_0005569 3300047317 Bacteria 9982
1253 Ga0495604_0008438 3300047317 Bacteria 8136
1254 Ga0495604_0008853 3300047317 Bacteria 7954
1255 Ga0495604_0009053 3300047317 Bacteria 7876
1256 Ga0495604_0266501 3300047317 Bacteria 1162
1257 Ga0495636_0200176 3300047318 Bacteria 912
1258 Ga0495674_0000002 3300047319 Bacteria 642785
1259 Ga0495674_0000559 3300047319 Bacteria 34585
1260 Ga0495674_0034030 3300047319 Bacteria 4610
1261 Ga0495674_0059219 3300047319 Bacteria 3346
1262 Ga0495674_0073584 3300047319 Bacteria 2945
1263 Ga0495672_0007744 3300047320 Bacteria 8038
1264 Ga0495672_0200710 3300047320 Bacteria 997
1265 Ga0495676_0273696 3300047321 Bacteria 1145
1266 Ga0495680_0000328 3300047322 Bacteria 53287
1267 Ga0495680_0007181 3300047322 Bacteria 10259
1268 Ga0495680_0029436 3300047322 Bacteria 4497
1269 Ga0495680_0036826 3300047322 Bacteria 3923
1270 Ga0495680_0114428 3300047322 Bacteria 1996
1271 Ga0495683_0007187 3300047323 Bacteria 6040
1272 Ga0495683_0133685 3300047323 Bacteria 1168
1273 Ga0495687_004001 3300047443 Bacteria 10251
1274 Ga0495675_0000164 3300047444 Bacteria 47361
1275 Ga0495675_0010844 3300047444 Bacteria 5711
1276 Ga0495675_0024047 3300047444 Bacteria 3881
1277 Ga0495675_0064514 3300047444 Bacteria 2316
1278 Ga0495679_000392 3300047446 Bacteria 33216
1279 Ga0495679_058673 3300047446 Bacteria 1134
1280 Ga0495673_0000008 3300047469 Bacteria 752462
1281 Ga0495673_0000362 3300047469 Bacteria 55510
1282 Ga0495673_0002002 3300047469 Bacteria 14994
1283 Ga0495673_0035151 3300047469 Bacteria 2312
1284 Ga0495681_0041281 3300047470 Bacteria 2240
1285 Ga0495684_0000016 3300047471 Bacteria 169338
1286 Ga0495684_0005198 3300047471 Bacteria 10142
1287 Ga0495684_0005926 3300047471 Bacteria 9494
1288 Ga0495684_0028039 3300047471 Bacteria 4325
1289 Ga0495684_0032943 3300047471 Bacteria 3979
1290 Ga0495593_0000606 3300047673 Bacteria 20452
1291 Ga0495593_0000953 3300047673 Bacteria 16903
1292 Ga0495593_0048060 3300047673 Bacteria 2268
1293 Ga0495593_0077190 3300047673 Bacteria 1725
1294 Ga0495602_0000240 3300048088 Bacteria 51242
1295 Ga0495602_0002010 3300048088 Bacteria 20455
1296 Ga0495602_0061124 3300048088 Bacteria 3278
1297 Ga0495602_0077050 3300048088 Bacteria 2822
1298 Ga0495602_0317541 3300048088 Bacteria 1134
1299 Ga0495614_0011184 3300048089 Bacteria 3949
1300 Ga0495614_0016077 3300048089 Bacteria 3258
1301 Ga0495614_0026185 3300048089 Bacteria 2514
1302 Ga0495615_0031366 3300048090 Bacteria 1275
1303 Ga0495626_0024671 3300048091 Bacteria 2946
1304 Ga0496100_0040451 3300048903 Bacteria 2966
1305 Ga0496100_0047368 3300048903 Bacteria 2769
1306 Ga0496101_0051847 3300048904 Bacteria 2957
1307 Ga0496101_0170130 3300048904 Bacteria 1674
1308 Ga0496101_0177225 3300048904 Bacteria 1640
1309 Ga0496102_0002717 3300048905 Bacteria 15055
1310 Ga0496102_0002990 3300048905 Bacteria 14313
1311 Ga0496102_0134673 3300048905 Bacteria 2314
1312 Ga0496102_0219683 3300048905 Bacteria 1791
1313 Ga0496102_0223441 3300048905 Bacteria 1775
1314 Ga0496102_0695057 3300048905 Bacteria 940
1315 Ga0496103_0004038 3300048906 Bacteria 8917
1316 Ga0496103_0020222 3300048906 Bacteria 3998
1317 Ga0496103_0027506 3300048906 Bacteria 3446
1318 Ga0496104_0002505 3300048907 Bacteria 15804
1319 Ga0496104_0002941 3300048907 Bacteria 14675
1320 Ga0496104_0005997 3300048907 Bacteria 10649
1321 Ga0496105_0005733 3300048908 Bacteria 9457
1322 Ga0496105_0121104 3300048908 Bacteria 2157
1323 Ga0496106_0262661 3300048909 Bacteria 1381
1324 Ga0496106_0323591 3300048909 Bacteria 1238
1325 Ga0496106_0559315 3300048909 Bacteria 918
1326 Ga0496107_0001922 3300048910 Bacteria 13186
1327 Ga0496107_0063265 3300048910 Bacteria 2681
1328 Ga0496107_0195648 3300048910 Bacteria 1503
1329 Ga0496108_0000357 3300048911 Bacteria 38614
1330 Ga0496108_0232373 3300048911 Bacteria 1603
1331 Ga0496109_0002224 3300048912 Bacteria 16103
1332 Ga0496109_0059771 3300048912 Bacteria 3482
1333 Ga0496109_0144166 3300048912 Bacteria 2228
1334 Ga0496110_0000889 3300048913 Bacteria 21090
1335 Ga0496110_0032897 3300048913 Bacteria 4483
1336 Ga0496110_0039631 3300048913 Bacteria 4103
1337 Ga0496110_0045689 3300048913 Bacteria 3829
1338 Ga0496110_0045760 3300048913 Bacteria 3826
1339 Ga0496110_0052971 3300048913 Bacteria 3565
1340 Ga0496110_0333239 3300048913 Bacteria 1382
1341 Ga0496111_0116665 3300048914 Bacteria 1969
1342 Ga0496112_0000117 3300048915 Bacteria 49274
1343 Ga0496112_0006469 3300048915 Bacteria 10288
1344 Ga0496112_0024359 3300048915 Bacteria 5793
1345 Ga0496112_0034574 3300048915 Bacteria 4918
1346 Ga0496112_0072710 3300048915 Bacteria 3399
1347 Ga0496112_0094153 3300048915 Bacteria 2966
1348 Ga0496112_0154568 3300048915 Bacteria 2261
1349 Ga0496112_0191885 3300048915 Bacteria 2004
1350 Ga0496112_0192936 3300048915 Bacteria 1998
1351 Ga0496113_0010717 3300048916 Bacteria 6074
1352 Ga0496113_0174795 3300048916 Bacteria 1701
1353 Ga0496113_0259725 3300048916 Bacteria 1387
1354 Ga0496113_0462982 3300048916 Bacteria 1019
1355 Ga0496114_0037479 3300048917 Bacteria 4010
1356 Ga0496114_0047484 3300048917 Bacteria 3572
1357 Ga0496114_0070632 3300048917 Bacteria 2933
1358 Ga0496114_0230250 3300048917 Bacteria 1628
1359 Ga0496115_0002584 3300048918 Bacteria 12996
1360 Ga0496115_0117048 3300048918 Bacteria 2192
1361 Ga0496115_0132487 3300048918 Bacteria 2054
1362 Ga0496115_0174778 3300048918 Bacteria 1776
1363 Ga0496115_0212767 3300048918 Bacteria 1597
1364 Ga0496116_0003967 3300048919 Bacteria 14367
1365 Ga0496116_0006130 3300048919 Bacteria 10995
1366 Ga0496116_0007895 3300048919 Bacteria 9335
1367 Ga0496116_0049570 3300048919 Bacteria 2806
1368 Ga0496116_0071638 3300048919 Bacteria 2194
1369 Ga0496117_0013767 3300048920 Bacteria 7025
1370 Ga0496117_0098322 3300048920 Bacteria 1861
1371 Ga0496117_0187965 3300048920 Bacteria 1180
1372 Ga0496118_0001099 3300048921 Bacteria 42066
1373 Ga0496118_0013843 3300048921 Bacteria 7594
1374 Ga0496118_0022793 3300048921 Bacteria 5460
1375 Ga0496118_0094148 3300048921 Bacteria 2049
1376 Ga0496118_0100525 3300048921 Bacteria 1956
1377 Ga0496118_0138864 3300048921 Bacteria 1545
1378 Ga0496118_0145225 3300048921 Bacteria 1495
1379 Ga0496119_0016661 3300048922 Bacteria 5577
1380 Ga0496120_0020029 3300048923 Bacteria 4262
1381 Ga0496120_0054973 3300048923 Bacteria 2253
1382 Ga0496121_0000094 3300048924 Bacteria 212726
1383 Ga0496121_0001006 3300048924 Bacteria 50348
1384 Ga0496121_0001373 3300048924 Bacteria 41404
1385 Ga0496121_0003460 3300048924 Bacteria 22502
1386 Ga0496121_0004413 3300048924 Bacteria 18951
1387 Ga0496121_0034449 3300048924 Bacteria 4557
1388 Ga0496121_0053860 3300048924 Bacteria 3367
1389 Ga0496121_0072366 3300048924 Bacteria 2767
1390 Ga0496121_0098517 3300048924 Bacteria 2262
1391 Ga0496121_0134946 3300048924 Bacteria 1840
1392 Ga0496121_0136095 3300048924 Bacteria 1830
1393 Ga0496121_0167519 3300048924 Bacteria 1600
1394 Ga0496121_0185303 3300048924 Bacteria 1497
1395 Ga0496122_0000214 3300048925 Bacteria 129132
1396 Ga0496122_0000693 3300048925 Bacteria 67068
1397 Ga0496122_0001372 3300048925 Bacteria 39648
1398 Ga0496122_0017391 3300048925 Bacteria 6726
1399 Ga0496122_0045528 3300048925 Bacteria 3409
1400 Ga0496122_0124378 3300048925 Bacteria 1654
1401 Ga0496123_0000187 3300048926 Bacteria 125396
1402 Ga0496123_0000433 3300048926 Bacteria 75427
1403 Ga0496123_0004961 3300048926 Bacteria 13639
1404 Ga0496123_0012078 3300048926 Bacteria 7406
1405 Ga0496123_0025593 3300048926 Bacteria 4444
1406 Ga0496123_0133114 3300048926 Bacteria 1373
1407 Ga0496124_0000004 3300048927 Bacteria 976131
1408 Ga0496124_0000224 3300048927 Bacteria 110603
1409 Ga0496124_0009911 3300048927 Bacteria 9739
1410 Ga0496124_0024007 3300048927 Bacteria 5551
1411 Ga0496124_0031672 3300048927 Bacteria 4679
1412 Ga0496124_0069590 3300048927 Bacteria 2921
1413 Ga0496124_0078167 3300048927 Bacteria 2727
1414 Ga0496124_0078550 3300048927 Bacteria 2719
1415 Ga0496124_0085247 3300048927 Bacteria 2589
1416 Ga0496124_0209953 3300048927 Bacteria 1474
1417 Ga0496124_0218591 3300048927 Bacteria 1435
1418 Ga0496124_0378292 3300048927 Bacteria 991
1419 Ga0496125_0000063 3300048928 Bacteria 250260
1420 Ga0496125_0000363 3300048928 Bacteria 85601
1421 Ga0496125_0001879 3300048928 Bacteria 28856
1422 Ga0496125_0002076 3300048928 Bacteria 27038
1423 Ga0496125_0005173 3300048928 Bacteria 14671
1424 Ga0496125_0028136 3300048928 Bacteria 5082
1425 Ga0496125_0028421 3300048928 Bacteria 5051
1426 Ga0496125_0039397 3300048928 Bacteria 4070
1427 Ga0496125_0064305 3300048928 Bacteria 2916
1428 Ga0496125_0079365 3300048928 Bacteria 2518
1429 Ga0496126_0018230 3300048929 Bacteria 6965
1430 Ga0496126_0130226 3300048929 Bacteria 2174
1431 Ga0496126_0172406 3300048929 Bacteria 1842
1432 Ga0496126_0295942 3300048929 Bacteria 1337
1433 Ga0496126_0396589 3300048929 Bacteria 1120
1434 Ga0496126_0415424 3300048929 Bacteria 1089
1435 Ga0495678_000012 3300049459 Bacteria 333905
1436 Ga0495678_021406 3300049459 Bacteria 2848
1437 Ga0495682_0000087 3300049460 Bacteria 80534
1438 Ga0495682_0000605 3300049460 Bacteria 24195
1439 Ga0501034_0051746 3300049571 Bacteria 4141
1440 Ga0501036_0214582 3300049572 Bacteria 1617
1441 Ga0501040_0172442 3300049576 Bacteria 1532
1442 Ga0501041_0077892 3300049577 Bacteria 2040
1443 Ga0501042_0269581 3300049578 Bacteria 1229
1444 Ga0501046_0064299 3300049580 Bacteria 2864
1445 Ga0501048_0078999 3300049582 Bacteria 2322
1446 Ga0501048_0163479 3300049582 Bacteria 1576
1447 Ga0501071_0028125 3300049587 Bacteria 3960
1448 Ga0501072_0096552 3300049588 Bacteria 2348
1449 Ga0501073_0147546 3300049589 Bacteria 1630
1450 Ga0501075_0006354 3300049591 Bacteria 8128
1451 Ga0501076_0000981 3300049592 Bacteria 18652
1452 Ga0501076_0086870 3300049592 Bacteria 2514
1453 Ga0501227_023049 3300049665 Bacteria 1444
1454 Ga0501235_004060 3300049669 Bacteria 3167
1455 Ga0501258_004539 3300049687 Bacteria 1315
1456 Ga0501221_004443 3300049704 Bacteria 2327
1457 Ga0501229_000133 3300049706 Bacteria 7696
1458 Ga0501229_007113 3300049706 Bacteria 1389
1459 Ga0501079_0024279 3300049741 Bacteria 4652
1460 Ga0501079_0067138 3300049741 Bacteria 2768
1461 Ga0501080_0090377 3300049742 Bacteria 2845
1462 Ga0501080_0095492 3300049742 Bacteria 2761
1463 Ga0501081_0004564 3300049743 Bacteria 8894
1464 Ga0501081_0061629 3300049743 Bacteria 2601
1465 Ga0501081_0124671 3300049743 Bacteria 1837
1466 Ga0501267_001299 3300049764 Bacteria 2119
1467 Ga0501035_0352635 3300049822 Bacteria 1231
1468 Ga0501045_0086938 3300049824 Bacteria 2308
1469 Ga0501045_0104076 3300049824 Bacteria 2103
1470 nmdc:mga03683_134761_c1 3300050489 Bacteria 1107
1471 nmdc:mga03683_1535_c1 3300050489 Bacteria 6880
1472 nmdc:mga03683_3361_c2 3300050489 Bacteria 1734
1473 nmdc:mga03n38_159019_c1 3300050490 Bacteria 1143
1474 nmdc:mga03n38_1633_c1 3300050490 Bacteria 6559
1475 nmdc:mga00v17_101419_c1 3300050491 Bacteria 1817
1476 nmdc:mga00v17_112900_c1 3300050491 Bacteria 1725
1477 nmdc:mga00v17_184670_c1 3300050491 Bacteria 1346
1478 nmdc:mga00v17_210178_c1 3300050491 Bacteria 1259
1479 nmdc:mga00v17_240491_c1 3300050491 Bacteria 1174
1480 nmdc:mga00v17_6544_c1 3300050491 Bacteria 6184
1481 nmdc:mga00v17_97354_c1 3300050491 Bacteria 1340
1482 nmdc:mga0yw44_137180_c1 3300050492 Bacteria 1588
1483 nmdc:mga0yw44_190057_c1 3300050492 Bacteria 1354
1484 nmdc:mga0yw44_19046_c1 3300050492 Bacteria 3776
1485 nmdc:mga0yw44_20621_c1 3300050492 Bacteria 3662
1486 nmdc:mga0yw44_29154_c1 3300050492 Bacteria 3184
1487 nmdc:mga0k408_18076_c1 3300050493 Bacteria 3931
1488 nmdc:mga0k408_42865_c1 3300050493 Bacteria 2606
1489 nmdc:mga0k408_56087_c1 3300050493 Bacteria 2285
1490 nmdc:mga06z11_117198_c1 3300050494 Bacteria 1482
1491 nmdc:mga06z11_22668_c1 3300050494 Bacteria 2937
1492 nmdc:mga04h51_2271_c1 3300050495 Bacteria 4532
1493 nmdc:mga04h51_4146_c1 3300050495 Bacteria 3578
1494 nmdc:mga07m45_128110_c1 3300050496 Bacteria 1468
1495 nmdc:mga07m45_190150_c1 3300050496 Bacteria 1194
1496 nmdc:mga07m45_27827_c1 3300050496 Bacteria 3118
1497 nmdc:mga07m45_3642_c1 3300050496 Bacteria 7442
1498 nmdc:mga07m45_48928_c1 3300050496 Bacteria 2378
1499 nmdc:mga07m45_70372_c1 3300050496 Bacteria 1990
1500 nmdc:mga07m45_9639_c1 3300050496 Bacteria 5019
1501 nmdc:mga05p37_1204_c1 3300050507 Bacteria 29952
1502 nmdc:mga05p37_204614_c1 3300050507 Bacteria 2388
1503 nmdc:mga05p37_3429_c1 3300050507 Bacteria 18491
1504 nmdc:mga05p37_413_c1 3300050507 Bacteria 46142
1505 nmdc:mga05p37_47607_c1 3300050507 Bacteria 5272
1506 nmdc:mga05p37_57887_c1 3300050507 Bacteria 4773
1507 nmdc:mga05p37_60912_c1 3300050507 Bacteria 4647
1508 nmdc:mga05p37_69744_c1 3300050507 Bacteria 4324
1509 nmdc:mga05p37_74309_c1 3300050507 Bacteria 4183
1510 nmdc:mga09592_11500_c1 3300050508 Bacteria 6607
1511 nmdc:mga09592_136715_c1 3300050508 Bacteria 2111
1512 nmdc:mga09592_145719_c1 3300050508 Bacteria 2042
1513 nmdc:mga09592_17311_c1 3300050508 Bacteria 5904
1514 nmdc:mga09592_178482_c1 3300050508 Bacteria 1837
1515 nmdc:mga09592_304869_c1 3300050508 Bacteria 1381
1516 nmdc:mga09592_33905_c1 3300050508 Bacteria 4266
1517 nmdc:mga09592_41983_c1 3300050508 Bacteria 3848
1518 nmdc:mga09592_7869_c1 3300050508 Bacteria 8665
1519 nmdc:mga0qj67_141673_c1 3300050509 Bacteria 1950
1520 nmdc:mga0qj67_260295_c1 3300050509 Bacteria 1407
1521 nmdc:mga0qj67_404607_c1 3300050509 Bacteria 1101
1522 nmdc:mga0qj67_41611_c1 3300050509 Bacteria 3614
1523 nmdc:mga0qj67_48176_c1 3300050509 Bacteria 3367
1524 nmdc:mga0qj67_88207_c1 3300050509 Bacteria 2491
1525 nmdc:mga0qj67_933_c1 3300050509 Bacteria 20130
1526 nmdc:mga0qj67_97211_c1 3300050509 Bacteria 2371
1527 nmdc:mga06r32_104072_c1 3300050510 Bacteria 2788
1528 nmdc:mga06r32_109575_c1 3300050510 Bacteria 2716
1529 nmdc:mga06r32_16885_c1 3300050510 Bacteria 6659
1530 nmdc:mga06r32_201_c1 3300050510 Bacteria 26944
1531 nmdc:mga06r32_34997_c1 3300050510 Bacteria 4739
1532 nmdc:mga06r32_541381_c1 3300050510 Bacteria 1139
1533 nmdc:mga08y16_237415_c1 3300050511 Bacteria 1885
1534 nmdc:mga08y16_36005_c1 3300050511 Bacteria 3810
1535 nmdc:mga08y16_4141_c1 3300050511 Bacteria 15136
1536 nmdc:mga08y16_514132_c1 3300050511 Bacteria 1215
1537 nmdc:mga08y16_57115_c1 3300050511 Bacteria 4079
1538 nmdc:mga08y16_620076_c1 3300050511 Bacteria 1089
1539 nmdc:mga08y16_62145_c1 3300050511 Bacteria 3900
1540 nmdc:mga08y16_622724_c1 3300050511 Bacteria 1086
1541 nmdc:mga08y16_86448_c1 3300050511 Bacteria 3268
1542 nmdc:mga08y16_93457_c2 3300050511 Bacteria 2281
1543 nmdc:mga0n895_127_c1 3300050512 Bacteria 45097
1544 nmdc:mga0n895_19327_c1 3300050512 Bacteria 6331
1545 nmdc:mga0n895_231204_c1 3300050512 Bacteria 1877
1546 nmdc:mga0n895_35568_c1 3300050512 Bacteria 4803
1547 nmdc:mga0n895_38357_c1 3300050512 Bacteria 4642
1548 nmdc:mga0n895_410774_c1 3300050512 Bacteria 1369
1549 nmdc:mga0n895_4878_c1 3300050512 Bacteria 11111
1550 nmdc:mga0n895_523143_c1 3300050512 Bacteria 1194
1551 nmdc:mga0n895_57522_c1 3300050512 Bacteria 3833
1552 nmdc:mga0n895_75123_c1 3300050512 Bacteria 3359
1553 nmdc:mga0rr50_187163_c1 3300050513 Bacteria 1695
1554 nmdc:mga0rr50_22233_c1 3300050513 Bacteria 4349
1555 nmdc:mga0rr50_3231_c1 3300050513 Bacteria 9337
1556 nmdc:mga0rr50_34409_c1 3300050513 Bacteria 3628
1557 nmdc:mga0rr50_61461_c1 3300050513 Bacteria 2830
1558 nmdc:mga0rr50_771_c1 3300050513 Bacteria 17249
1559 nmdc:mga0rr50_8101_c1 3300050513 Bacteria 6522
1560 nmdc:mga08x19_16260_c1 3300050514 Bacteria 4536
1561 nmdc:mga08x19_17961_c1 3300050514 Bacteria 4332
1562 nmdc:mga08x19_258516_c1 3300050514 Bacteria 1203
1563 nmdc:mga08x19_30393_c1 3300050514 Bacteria 3393
1564 nmdc:mga08x19_59288_c1 3300050514 Bacteria 2478
1565 nmdc:mga08x19_66198_c1 3300050514 Bacteria 2348
1566 nmdc:mga0a205_1877_c1 3300050515 Bacteria 18205
1567 nmdc:mga0a205_2763_c1 3300050515 Bacteria 15503
1568 nmdc:mga0a205_29651_c1 3300050515 Bacteria 5237
1569 nmdc:mga0a205_30042_c1 3300050515 Bacteria 5201
1570 nmdc:mga0a205_433_c1 3300050515 Bacteria 32195
1571 nmdc:mga0a205_50973_c1 3300050515 Bacteria 3996
1572 nmdc:mga0a205_548_c1 3300050515 Bacteria 29744
1573 nmdc:mga0a205_56640_c1 3300050515 Bacteria 3784
1574 nmdc:mga0a205_5859_c1 3300050515 Bacteria 11069
1575 nmdc:mga0a205_65115_c1 3300050515 Bacteria 3521
1576 nmdc:mga0a205_681269_c1 3300050515 Bacteria 878
1577 nmdc:mga0a205_81202_c1 3300050515 Bacteria 3132
1578 nmdc:mga0a205_99184_c1 3300050515 Bacteria 2811
1579 nmdc:mga0sz30_105332_c1 3300050516 Bacteria 1234
1580 nmdc:mga0sz30_15041_c1 3300050516 Bacteria 3055
1581 nmdc:mga0sz30_155_c2 3300050516 Bacteria 13523
1582 nmdc:mga0sz30_70976_c1 3300050516 Bacteria 1499
1583 Ga0495601_0000001 3300053077 Bacteria 549454
1584 Ga0495601_0023258 3300053077 Bacteria 3807
1585 Ga0495601_0036750 3300053077 Bacteria 3060
1586 Ga0495601_0087522 3300053077 Bacteria 2003
1587 Ga0495601_0241353 3300053077 Bacteria 1180
1588 Ga0495612_0000017 3300053078 Bacteria 152112
1589 Ga0500610_0042322 3300053079 Bacteria 2356
1590 Ga0500635_0008589 3300053080 Bacteria 2805
1591 Ga0495595_0000010 3300053084 Bacteria 178819
1592 Ga0495595_0000696 3300053084 Bacteria 12842
1593 Ga0495595_0058530 3300053084 Bacteria 1799
1594 Ga0495619_0000014 3300053085 Bacteria 261449
1595 Ga0495619_0000966 3300053085 Bacteria 18840
1596 Ga0495619_0004720 3300053085 Bacteria 8676
1597 Ga0495619_0033264 3300053085 Bacteria 3348
1598 Ga0495619_0047645 3300053085 Bacteria 2823
1599 Ga0500578_0084710 3300053086 Bacteria 2014
1600 Ga0500643_000019 3300053087 Bacteria 294301
1601 Ga0500643_013129 3300053087 Bacteria 2938
1602 Ga0500644_0002483 3300053088 Bacteria 4609
1603 Ga0500647_0156860 3300053091 Bacteria 1059
1604 Ga0500651_0001077 3300053093 Bacteria 13470
1605 Ga0500651_0019640 3300053093 Bacteria 4201
1606 Ga0500651_0099442 3300053093 Bacteria 1784
1607 Ga0500566_0001407 3300053094 Bacteria 14073
1608 Ga0500566_0017963 3300053094 Bacteria 4152
1609 Ga0500566_0057431 3300053094 Bacteria 2210
1610 Ga0500641_0007284 3300053096 Bacteria 3943
1611 Ga0500641_0015643 3300053096 Bacteria 2820
1612 Ga0500641_0044214 3300053096 Bacteria 1811
1613 Ga0500554_002430 3300053102 Bacteria 3664
1614 Ga0500554_003583 3300053102 Bacteria 3200
1615 Ga0500555_004780 3300053103 Bacteria 3844
1616 Ga0500556_0000069 3300053104 Bacteria 101263
1617 Ga0500556_0081680 3300053104 Bacteria 1222
1618 Ga0500557_000039 3300053105 Bacteria 66862
1619 Ga0500569_007080 3300053109 Bacteria 2499
1620 Ga0500569_009038 3300053109 Bacteria 2302
1621 Ga0500571_044398 3300053110 Bacteria 2369
1622 Ga0500572_001849 3300053111 Bacteria 5366
1623 Ga0500595_008228 3300053119 Bacteria 4274
1624 Ga0500595_009536 3300053119 Bacteria 3913
1625 Ga0500595_028448 3300053119 Bacteria 1905
1626 Ga0500595_048130 3300053119 Bacteria 1333
1627 Ga0500595_059336 3300053119 Bacteria 1160
1628 Ga0500597_051774 3300053120 Bacteria 1751
1629 Ga0500614_052167 3300053123 Bacteria 1077
1630 Ga0500618_000088 3300053125 Bacteria 74892
1631 Ga0500618_000286 3300053125 Bacteria 38499
1632 Ga0500618_001413 3300053125 Bacteria 10762
1633 Ga0500642_0000032 3300053130 Bacteria 111097
1634 Ga0500642_0000285 3300053130 Bacteria 18457
1635 Ga0500642_0058734 3300053130 Bacteria 1720
1636 Ga0500652_005774 3300053131 Bacteria 3929
1637 Ga0500655_000880 3300053133 Bacteria 5835
1638 Ga0500658_0000645 3300053134 Bacteria 14429
1639 Ga0500658_0000750 3300053134 Bacteria 13400
1640 Ga0500658_0029431 3300053134 Bacteria 2136
1641 Ga0500658_0107985 3300053134 Bacteria 1222
1642 Ga0500559_0000107 3300053136 Bacteria 65560
1643 Ga0500559_0020758 3300053136 Bacteria 2779
1644 Ga0500559_0020926 3300053136 Bacteria 2768
1645 Ga0500559_0048585 3300053136 Bacteria 1866
1646 Ga0500568_0004264 3300053139 Bacteria 7684
1647 Ga0500568_0020039 3300053139 Bacteria 2900
1648 Ga0500568_0070664 3300053139 Bacteria 1337
1649 Ga0500568_0083281 3300053139 Bacteria 1212
1650 Ga0500574_007277 3300053141 Bacteria 2285
1651 Ga0500586_001308 3300053145 Bacteria 5231
1652 Ga0500604_0024805 3300053151 Bacteria 1719
1653 Ga0500604_0031788 3300053151 Bacteria 1552
1654 Ga0500604_0052567 3300053151 Bacteria 1261
1655 Ga0500616_0000028 3300053153 Bacteria 435722
1656 Ga0500616_0000332 3300053153 Bacteria 67840
1657 Ga0500616_0002011 3300053153 Bacteria 17989
1658 Ga0500616_0003426 3300053153 Bacteria 12139
1659 Ga0500622_0002230 3300053156 Bacteria 14254
1660 Ga0500622_0002594 3300053156 Bacteria 12875
1661 Ga0500622_0033061 3300053156 Bacteria 2711
1662 Ga0500627_0051009 3300053158 Bacteria 1803
1663 Ga0500630_000815 3300053159 Bacteria 14379
1664 Ga0500634_0037909 3300053161 Bacteria 2621
1665 Ga0500638_031056 3300053162 Bacteria 2575
1666 Ga0500638_034026 3300053162 Bacteria 2465
1667 Ga0500639_000221 3300053163 Bacteria 28281
1668 Ga0500636_0000313 3300053177 Bacteria 26675
1669 Ga0500636_0030709 3300053177 Bacteria 3180
1670 Ga0500636_0145360 3300053177 Bacteria 1308
1671 Ga0500637_0000655 3300053178 Bacteria 13752
1672 Ga0500637_0057330 3300053178 Bacteria 2227
1673 Ga0500645_000422 3300053730 Bacteria 29281
1674 Ga0500645_013729 3300053730 Bacteria 2594
1675 Ga0500601_000542 3300053737 Bacteria 5613
1676 Ga0501084_0120064 3300054114 Bacteria 2210
1677 Ga0501084_0280985 3300054114 Bacteria 1406
1678 Ga0501082_0013883 3300060353 Bacteria 6926
1679 Ga0501082_0338240 3300060353 Bacteria 1312

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046455 Ga0495603_0094293 Ga0495603_0094293_545_1327 229
2 3300046472 Ga0495580_0001269 Ga0495580_0001269_1551_2333 229
3 3300005937 Ga0081455_10001350 Ga0081455_100013505 230
4 3300005445 Ga0070708_100285818 Ga0070708_1002858182 232
5 3300005468 Ga0070707_100261262 Ga0070707_1002612622 232
6 3300005471 Ga0070698_100296995 Ga0070698_1002969951 232
7 3300005518 Ga0070699_100215687 Ga0070699_1002156872 232
8 3300005536 Ga0070697_100145288 Ga0070697_1001452882 232
9 3300005445 Ga0070708_100011367 Ga0070708_1000113674 236
10 3300005468 Ga0070707_100019372 Ga0070707_1000193726 236
11 3300005471 Ga0070698_100063521 Ga0070698_1000635212 236
12 3300005518 Ga0070699_100031521 Ga0070699_1000315214 236
13 3300005536 Ga0070697_100028321 Ga0070697_1000283213 236
14 3300007076 Ga0075435_100109034 Ga0075435_1001090342 236
15 3300025910 Ga0207684_10020436 Ga0207684_100204363 236
16 3300025922 Ga0207646_10179344 Ga0207646_101793442 236
17 3300050513 nmdc:mga0rr50_187163_c1 nmdc:mga0rr50_187163_c1_828_1607 236
18 3300006847 Ga0075431_100318325 Ga0075431_1003183252 238
19 3300050515 nmdc:mga0a205_681269_c1 nmdc:mga0a205_681269_c1_30_770 239
20 3300005536 Ga0070697_100021560 Ga0070697_1000215604 241
21 3300005546 Ga0070696_100186436 Ga0070696_1001864362 241
22 3300006173 Ga0070716_100039297 Ga0070716_1000392972 241
23 3300025906 Ga0207699_10063949 Ga0207699_100639492 241
24 3300050507 nmdc:mga05p37_57887_c1 nmdc:mga05p37_57887_c1_931_1692 241
25 3300050512 nmdc:mga0n895_38357_c1 nmdc:mga0n895_38357_c1_3825_4586 241
26 3300050513 nmdc:mga0rr50_8101_c1 nmdc:mga0rr50_8101_c1_3972_4733 241
27 3300050514 nmdc:mga08x19_30393_c1 nmdc:mga08x19_30393_c1_1813_2574 241
28 3300050515 nmdc:mga0a205_2763_c1 nmdc:mga0a205_2763_c1_1941_2702 241
29 3300007265 Ga0099794_10056573 Ga0099794_100565732 242
30 3300003203 JGI25406J46586_10059517 JGI25406J46586_100595171 243
31 3300005536 Ga0070697_100081756 Ga0070697_1000817562 243
32 3300005985 Ga0081539_10000009 Ga0081539_10000009486 243
33 3300005444 Ga0070694_100372257 Ga0070694_1003722572 244
34 3300007265 Ga0099794_10020028 Ga0099794_100200282 246
35 3300006852 Ga0075433_10085987 Ga0075433_100859872 248
36 3300007076 Ga0075435_100033463 Ga0075435_1000334633 248
37 3300050512 nmdc:mga0n895_231204_c1 nmdc:mga0n895_231204_c1_32_811 248
38 3300050515 nmdc:mga0a205_548_c1 nmdc:mga0a205_548_c1_3523_4302 248
39 3300005440 Ga0070705_100040250 Ga0070705_1000402502 249
40 3300005467 Ga0070706_100043592 Ga0070706_1000435923 249
41 3300006852 Ga0075433_10000781 Ga0075433_100007817 249
42 3300006871 Ga0075434_100001936 Ga0075434_10000193610 249
43 3300006881 Ga0068865_100112158 Ga0068865_1001121582 249
44 3300006914 Ga0075436_100012919 Ga0075436_1000129193 249
45 3300007076 Ga0075435_100002088 Ga0075435_10000208812 249
46 3300009553 Ga0105249_10663094 Ga0105249_106630942 249
47 3300013297 Ga0157378_10140868 Ga0157378_101408682 249
48 3300025910 Ga0207684_10057109 Ga0207684_100571093 249
49 3300046664 Ga0495659_0021736 Ga0495659_0021736_545_1327 249
50 3300047318 Ga0495636_0200176 Ga0495636_0200176_88_870 249
51 3300049572 Ga0501036_0214582 Ga0501036_0214582_236_1039 249
52 3300005549 Ga0070704_100526315 Ga0070704_1005263151 250
53 3300042876 Ga0451577_0281251 Ga0451577_0281251_142_939 250
54 3300044673 Ga0453683_0012589 Ga0453683_0012589_1996_2793 250
55 3300044712 Ga0453684_0061368 Ga0453684_0061368_1919_2716 250
56 3300046524 Ga0495648_0083089 Ga0495648_0083089_350_1249 250
57 3300046529 Ga0495652_0037069 Ga0495652_0037069_2630_3529 250
58 3300046559 Ga0495667_0163575 Ga0495667_0163575_196_1119 251
59 3300047444 Ga0495675_0064514 Ga0495675_0064514_1183_2106 251
60 3300047471 Ga0495684_0005926 Ga0495684_0005926_6681_7604 251
61 3300050515 nmdc:mga0a205_5859_c1 nmdc:mga0a205_5859_c1_8071_8829 251
62 3300048909 Ga0496106_0323591 Ga0496106_0323591_442_1203 252
63 3300005445 Ga0070708_100043141 Ga0070708_1000431415 253
64 3300005467 Ga0070706_100033419 Ga0070706_1000334192 253
65 3300005535 Ga0070684_100188390 Ga0070684_1001883901 253
66 3300006353 Ga0075370_10037869 Ga0075370_100378692 253
67 3300007076 Ga0075435_100393262 Ga0075435_1003932622 253
68 3300025937 Ga0207669_10402179 Ga0207669_104021792 253
69 3300026089 Ga0207648_10336172 Ga0207648_103361722 253
70 3300031456 Ga0307513_10055014 Ga0307513_100550144 253
71 3300050493 nmdc:mga0k408_18076_c1 nmdc:mga0k408_18076_c1_2561_3394 253
72 3300005445 Ga0070708_100020178 Ga0070708_1000201785 254
73 3300005471 Ga0070698_100701807 Ga0070698_1007018071 254
74 3300006871 Ga0075434_100332433 Ga0075434_1003324332 254
75 3300006914 Ga0075436_100023235 Ga0075436_1000232354 254
76 3300007076 Ga0075435_100056294 Ga0075435_1000562942 254
77 3300009147 Ga0114129_10178412 Ga0114129_101784122 254
78 3300021384 Ga0213876_10001998 Ga0213876_100019989 254
79 3300025914 Ga0207671_10158057 Ga0207671_101580572 254
80 3300039437 Ga0436365_0240210 Ga0436365_0240210_14969_15802 254
81 3300039437 Ga0436365_0241740 Ga0436365_0241740_1207_2040 254
82 3300039450 Ga0436363_1181230 Ga0436363_1181230_217_1056 254
83 3300045049 Ga0466959_0079291 Ga0466959_0079291_502_1335 254
84 3300050507 nmdc:mga05p37_204614_c1 nmdc:mga05p37_204614_c1_621_1460 254
85 3300050512 nmdc:mga0n895_410774_c1 nmdc:mga0n895_410774_c1_320_1123 254
86 3300050513 nmdc:mga0rr50_34409_c1 nmdc:mga0rr50_34409_c1_904_1743 254
87 3300050514 nmdc:mga08x19_17961_c1 nmdc:mga08x19_17961_c1_1623_2462 254
88 3300050515 nmdc:mga0a205_56640_c1 nmdc:mga0a205_56640_c1_1995_2834 254
89 3300053153 Ga0500616_0002011 Ga0500616_0002011_6881_7720 254
90 3300005434 Ga0070709_10345064 Ga0070709_103450641 255
91 3300005445 Ga0070708_100241926 Ga0070708_1002419262 255
92 3300005467 Ga0070706_100038072 Ga0070706_1000380724 255
93 3300006042 Ga0075368_10007140 Ga0075368_100071402 255
94 3300006048 Ga0075363_100055355 Ga0075363_1000553552 255
95 3300006051 Ga0075364_10043425 Ga0075364_100434254 255
96 3300006175 Ga0070712_100220017 Ga0070712_1002200172 255
97 3300006178 Ga0075367_10013796 Ga0075367_100137962 255
98 3300006844 Ga0075428_100446847 Ga0075428_1004468472 255
99 3300006846 Ga0075430_100004771 Ga0075430_1000047712 255
100 3300009092 Ga0105250_10071833 Ga0105250_100718332 255
101 3300025910 Ga0207684_10013538 Ga0207684_100135384 255
102 3300025922 Ga0207646_10462444 Ga0207646_104624442 255
103 3300027671 Ga0209588_1018715 Ga0209588_10187152 255
104 3300031456 Ga0307513_10046454 Ga0307513_100464542 255
105 3300031548 Ga0307408_100573360 Ga0307408_1005733602 255
106 3300046454 Ga0495592_0050267 Ga0495592_0050267_1668_2534 255
107 3300046473 Ga0495582_0023610 Ga0495582_0023610_1534_2400 255
108 3300046500 Ga0495596_0053025 Ga0495596_0053025_21_887 255
109 3300046511 Ga0495608_0113220 Ga0495608_0113220_365_1231 255
110 3300046516 Ga0495628_0324970 Ga0495628_0324970_192_1058 255
111 3300046520 Ga0495637_0000699 Ga0495637_0000699_7898_8767 255
112 3300046528 Ga0495642_0014290 Ga0495642_0014290_566_1432 255
113 3300046530 Ga0495654_0000014 Ga0495654_0000014_53285_54154 255
114 3300046531 Ga0495665_0170077 Ga0495665_0170077_77_943 255
115 3300046558 Ga0495633_0056250 Ga0495633_0056250_55_894 255
116 3300046642 Ga0495634_0074682 Ga0495634_0074682_1285_2151 255
117 3300046648 Ga0495611_0063919 Ga0495611_0063919_784_1650 255
118 3300046674 Ga0495588_0010550 Ga0495588_0010550_974_1840 255
119 3300046678 Ga0495599_0004148 Ga0495599_0004148_3490_4356 255
120 3300046690 Ga0495624_0225932 Ga0495624_0225932_77_943 255
121 3300048905 Ga0496102_0134673 Ga0496102_0134673_349_1287 255
122 3300048907 Ga0496104_0002505 Ga0496104_0002505_4883_5821 255
123 3300048908 Ga0496105_0121104 Ga0496105_0121104_37_975 255
124 3300048910 Ga0496107_0063265 Ga0496107_0063265_60_998 255
125 3300048911 Ga0496108_0000357 Ga0496108_0000357_10127_11065 255
126 3300048912 Ga0496109_0002224 Ga0496109_0002224_11864_12802 255
127 3300048913 Ga0496110_0052971 Ga0496110_0052971_2168_3106 255
128 3300048915 Ga0496112_0006469 Ga0496112_0006469_5934_6872 255
129 3300048916 Ga0496113_0259725 Ga0496113_0259725_266_1204 255
130 3300048925 Ga0496122_0045528 Ga0496122_0045528_515_1354 255
131 3300048926 Ga0496123_0025593 Ga0496123_0025593_1376_2215 255
132 3300048927 Ga0496124_0209953 Ga0496124_0209953_235_1074 255
133 3300050491 nmdc:mga00v17_112900_c1 nmdc:mga00v17_112900_c1_41_880 255
134 3300050509 nmdc:mga0qj67_933_c1 nmdc:mga0qj67_933_c1_10320_11159 255
135 3300053085 Ga0495619_0004720 Ga0495619_0004720_3853_4692 255
136 3300001990 JGI24737J22298_10054951 JGI24737J22298_100549512 256
137 3300001991 JGI24743J22301_10005012 JGI24743J22301_100050121 256
138 3300002070 JGI24750J21931_1012785 JGI24750J21931_10127851 256
139 3300002074 JGI24748J21848_1011408 JGI24748J21848_10114081 256
140 3300002075 JGI24738J21930_10035652 JGI24738J21930_100356521 256
141 3300002077 JGI24744J21845_10033281 JGI24744J21845_100332811 256
142 3300002239 JGI24034J26672_10028956 JGI24034J26672_100289561 256
143 3300002459 JGI24751J29686_10016259 JGI24751J29686_100162591 256
144 3300005328 Ga0070676_10125841 Ga0070676_101258412 256
145 3300005331 Ga0070670_100026578 Ga0070670_1000265781 256
146 3300005334 Ga0068869_100334238 Ga0068869_1003342381 256
147 3300005339 Ga0070660_100133685 Ga0070660_1001336852 256
148 3300005340 Ga0070689_100138815 Ga0070689_1001388152 256
149 3300005341 Ga0070691_10208285 Ga0070691_102082851 256
150 3300005343 Ga0070687_100101196 Ga0070687_1001011962 256
151 3300005344 Ga0070661_100129753 Ga0070661_1001297532 256
152 3300005345 Ga0070692_10119169 Ga0070692_101191692 256
153 3300005347 Ga0070668_100121847 Ga0070668_1001218472 256
154 3300005354 Ga0070675_100122468 Ga0070675_1001224682 256
155 3300005355 Ga0070671_100075919 Ga0070671_1000759192 256
156 3300005356 Ga0070674_100232129 Ga0070674_1002321292 256
157 3300005364 Ga0070673_100177483 Ga0070673_1001774832 256
158 3300005367 Ga0070667_100057841 Ga0070667_1000578412 256
159 3300005434 Ga0070709_10171549 Ga0070709_101715492 256
160 3300005435 Ga0070714_100023153 Ga0070714_1000231532 256
161 3300005436 Ga0070713_100003091 Ga0070713_10000309110 256
162 3300005436 Ga0070713_100132397 Ga0070713_1001323972 256
163 3300005437 Ga0070710_10255753 Ga0070710_102557531 256
164 3300005440 Ga0070705_100069391 Ga0070705_1000693912 256
165 3300005441 Ga0070700_100038270 Ga0070700_1000382702 256
166 3300005445 Ga0070708_100006881 Ga0070708_1000068816 256
167 3300005455 Ga0070663_100199585 Ga0070663_1001995852 256
168 3300005457 Ga0070662_100154396 Ga0070662_1001543962 256
169 3300005459 Ga0068867_100342847 Ga0068867_1003428471 256
170 3300005468 Ga0070707_100335690 Ga0070707_1003356902 256
171 3300005471 Ga0070698_100010988 Ga0070698_1000109886 256
172 3300005518 Ga0070699_100001365 Ga0070699_10000136517 256
173 3300005535 Ga0070684_100090112 Ga0070684_1000901122 256
174 3300005536 Ga0070697_100120397 Ga0070697_1001203972 256
175 3300005536 Ga0070697_100157509 Ga0070697_1001575091 256
176 3300005543 Ga0070672_100484313 Ga0070672_1004843131 256
177 3300005544 Ga0070686_100136507 Ga0070686_1001365072 256
178 3300005564 Ga0070664_100426367 Ga0070664_1004263671 256
179 3300005617 Ga0068859_100447057 Ga0068859_1004470571 256
180 3300005618 Ga0068864_100084285 Ga0068864_1000842852 256
181 3300005718 Ga0068866_10144321 Ga0068866_101443212 256
182 3300005719 Ga0068861_100322672 Ga0068861_1003226722 256
183 3300005840 Ga0068870_10006935 Ga0068870_100069352 256
184 3300005842 Ga0068858_100419515 Ga0068858_1004195152 256
185 3300005842 Ga0068858_100461051 Ga0068858_1004610511 256
186 3300005843 Ga0068860_100002390 Ga0068860_1000023903 256
187 3300005843 Ga0068860_100075903 Ga0068860_1000759032 256
188 3300005844 Ga0068862_100491316 Ga0068862_1004913162 256
189 3300005983 Ga0081540_1002554 Ga0081540_100255414 256
190 3300005983 Ga0081540_1129797 Ga0081540_11297972 256
191 3300006028 Ga0070717_10006636 Ga0070717_100066362 256
192 3300006028 Ga0070717_10058752 Ga0070717_100587522 256
193 3300006028 Ga0070717_10375862 Ga0070717_103758621 256
194 3300006175 Ga0070712_100006978 Ga0070712_1000069786 256
195 3300006358 Ga0068871_100161239 Ga0068871_1001612392 256
196 3300006881 Ga0068865_100172049 Ga0068865_1001720492 256
197 3300006931 Ga0097620_100447029 Ga0097620_1004470292 256
198 3300007788 Ga0099795_10075004 Ga0099795_100750042 256
199 3300009094 Ga0111539_10627459 Ga0111539_106274592 256
200 3300009101 Ga0105247_10166020 Ga0105247_101660202 256
201 3300009553 Ga0105249_10288273 Ga0105249_102882732 256
202 3300010159 Ga0099796_10006609 Ga0099796_100066092 256
203 3300010375 Ga0105239_10044826 Ga0105239_100448263 256
204 3300010375 Ga0105239_10507958 Ga0105239_105079582 256
205 3300011119 Ga0105246_10271216 Ga0105246_102712161 256
206 3300013102 Ga0157371_10191767 Ga0157371_101917672 256
207 3300013296 Ga0157374_10355775 Ga0157374_103557752 256
208 3300013297 Ga0157378_10079320 Ga0157378_100793202 256
209 3300014325 Ga0163163_10172747 Ga0163163_101727472 256
210 3300014326 Ga0157380_10149951 Ga0157380_101499512 256
211 3300014968 Ga0157379_10243495 Ga0157379_102434952 256
212 3300014969 Ga0157376_10286530 Ga0157376_102865302 256
213 3300017792 Ga0163161_10019750 Ga0163161_100197504 256
214 3300021377 Ga0213874_10009406 Ga0213874_100094062 256
215 3300021384 Ga0213876_10193987 Ga0213876_101939871 256
216 3300021441 Ga0213871_10012528 Ga0213871_100125283 256
217 3300025253 Ga0209677_102281 Ga0209677_1022813 256
218 3300025261 Ga0209233_1004907 Ga0209233_10049072 256
219 3300025261 Ga0209233_1005718 Ga0209233_10057184 256
220 3300025272 Ga0209455_1007559 Ga0209455_10075594 256
221 3300025900 Ga0207710_10018129 Ga0207710_100181293 256
222 3300025900 Ga0207710_10018417 Ga0207710_100184173 256
223 3300025901 Ga0207688_10010399 Ga0207688_100103993 256
224 3300025903 Ga0207680_10045750 Ga0207680_100457502 256
225 3300025904 Ga0207647_10035209 Ga0207647_100352093 256
226 3300025905 Ga0207685_10045335 Ga0207685_100453352 256
227 3300025908 Ga0207643_10000418 Ga0207643_1000041821 256
228 3300025910 Ga0207684_10171532 Ga0207684_101715321 256
229 3300025914 Ga0207671_10326993 Ga0207671_103269931 256
230 3300025915 Ga0207693_10024719 Ga0207693_100247196 256
231 3300025915 Ga0207693_10056935 Ga0207693_100569352 256
232 3300025918 Ga0207662_10097728 Ga0207662_100977282 256
233 3300025919 Ga0207657_10012700 Ga0207657_100127004 256
234 3300025923 Ga0207681_10040181 Ga0207681_100401812 256
235 3300025925 Ga0207650_10425564 Ga0207650_104255641 256
236 3300025926 Ga0207659_10342115 Ga0207659_103421151 256
237 3300025928 Ga0207700_10006688 Ga0207700_100066887 256
238 3300025928 Ga0207700_10032460 Ga0207700_100324603 256
239 3300025931 Ga0207644_10041902 Ga0207644_100419022 256
240 3300025933 Ga0207706_10014998 Ga0207706_100149985 256
241 3300025934 Ga0207686_10213919 Ga0207686_102139192 256
242 3300025940 Ga0207691_10145082 Ga0207691_101450821 256
243 3300025941 Ga0207711_10111330 Ga0207711_101113302 256
244 3300025961 Ga0207712_10251495 Ga0207712_102514952 256
245 3300025972 Ga0207668_10194433 Ga0207668_101944332 256
246 3300026023 Ga0207677_10115036 Ga0207677_101150362 256
247 3300026035 Ga0207703_10159359 Ga0207703_101593592 256
248 3300026035 Ga0207703_10169795 Ga0207703_101697951 256
249 3300026075 Ga0207708_10002881 Ga0207708_1000288110 256
250 3300026088 Ga0207641_10314925 Ga0207641_103149252 256
251 3300026089 Ga0207648_10009796 Ga0207648_100097965 256
252 3300026118 Ga0207675_100042588 Ga0207675_1000425883 256
253 3300026121 Ga0207683_10014258 Ga0207683_100142584 256
254 3300027907 Ga0207428_10290463 Ga0207428_102904631 256
255 3300028380 Ga0268265_10067166 Ga0268265_100671662 256
256 3300028381 Ga0268264_10000035 Ga0268264_1000003527 256
257 3300028558 Ga0265326_10002505 Ga0265326_100025059 256
258 3300028563 Ga0265319_1001186 Ga0265319_10011865 256
259 3300028573 Ga0265334_10004555 Ga0265334_100045554 256
260 3300028577 Ga0265318_10002315 Ga0265318_100023159 256
261 3300028653 Ga0265323_10000768 Ga0265323_1000076810 256
262 3300028654 Ga0265322_10003636 Ga0265322_100036364 256
263 3300028666 Ga0265336_10000106 Ga0265336_1000010620 256
264 3300028800 Ga0265338_10000065 Ga0265338_10000065111 256
265 3300029957 Ga0265324_10001808 Ga0265324_1000180810 256
266 3300031235 Ga0265330_10013442 Ga0265330_100134423 256
267 3300031249 Ga0265339_10021009 Ga0265339_100210093 256
268 3300031507 Ga0307509_10029697 Ga0307509_100296973 256
269 3300031507 Ga0307509_10129637 Ga0307509_101296372 256
270 3300031616 Ga0307508_10000090 Ga0307508_1000009082 256
271 3300031616 Ga0307508_10178022 Ga0307508_101780221 256
272 3300031711 Ga0265314_10158224 Ga0265314_101582242 256
273 3300033180 Ga0307510_10019318 Ga0307510_100193184 256
274 3300033545 Ga0316214_1011677 Ga0316214_10116772 256
275 3300035111 Ga0373923_0003802 Ga0373923_0003802_4000_4839 256
276 3300035117 Ga0373953_0058916 Ga0373953_0058916_103_942 256
277 3300035118 Ga0373954_0010242 Ga0373954_0010242_2627_3466 256
278 3300035118 Ga0373954_0101884 Ga0373954_0101884_186_1025 256
279 3300035119 Ga0373956_0012445 Ga0373956_0012445_1530_2369 256
280 3300035120 Ga0373957_0000746 Ga0373957_0000746_1080_1919 256
281 3300035171 Ga0373946_0222052 Ga0373946_0222052_31_870 256
282 3300035172 Ga0373955_0000360 Ga0373955_0000360_1496_2335 256
283 3300035172 Ga0373955_0039759 Ga0373955_0039759_1516_2355 256
284 3300035692 Ga0373935_0002949 Ga0373935_0002949_4465_5304 256
285 3300035695 Ga0373927_0000950 Ga0373927_0000950_11325_12164 256
286 3300035724 Ga0373933_0003920 Ga0373933_0003920_6780_7619 256
287 3300036401 Ga0373937_0008436 Ga0373937_0008436_463_1302 256
288 3300036401 Ga0373937_0031959 Ga0373937_0031959_397_1236 256
289 3300036459 Ga0372808_002242 Ga0372808_002242_1243_2082 256
290 3300037068 Ga0373925_0002196 Ga0373925_0002196_13583_14422 256
291 3300037068 Ga0373925_0030229 Ga0373925_0030229_1643_2482 256
292 3300039438 Ga0436360_0598803 Ga0436360_0598803_316_1155 256
293 3300039438 Ga0436360_0638294 Ga0436360_0638294_136_975 256
294 3300039447 Ga0436361_0356069 Ga0436361_0356069_1726_2565 256
295 3300039450 Ga0436363_0771056 Ga0436363_0771056_845_1684 256
296 3300039453 Ga0436362_0365725 Ga0436362_0365725_463_1302 256
297 3300046453 Ga0495627_000004 Ga0495627_000004_253289_254140 256
298 3300046454 Ga0495592_0009069 Ga0495592_0009069_4971_5810 256
299 3300046455 Ga0495603_0000200 Ga0495603_0000200_16479_17318 256
300 3300046455 Ga0495603_0004845 Ga0495603_0004845_5091_5930 256
301 3300046455 Ga0495603_0013905 Ga0495603_0013905_1623_2462 256
302 3300046457 Ga0495590_0000149 Ga0495590_0000149_36414_37337 256
303 3300046459 Ga0495629_0002535 Ga0495629_0002535_1988_2827 256
304 3300046461 Ga0495641_0008896 Ga0495641_0008896_3443_4282 256
305 3300046462 Ga0495651_0050887 Ga0495651_0050887_766_1605 256
306 3300046463 Ga0495653_0001070 Ga0495653_0001070_10816_11655 256
307 3300046463 Ga0495653_0229745 Ga0495653_0229745_107_946 256
308 3300046471 Ga0495650_0014057 Ga0495650_0014057_3240_4163 256
309 3300046472 Ga0495580_0002104 Ga0495580_0002104_16539_17378 256
310 3300046473 Ga0495582_0000354 Ga0495582_0000354_2478_3317 256
311 3300046474 Ga0495605_0002509 Ga0495605_0002509_6927_7850 256
312 3300046475 Ga0495639_0004987 Ga0495639_0004987_1381_2220 256
313 3300046476 Ga0495662_0001324 Ga0495662_0001324_1543_2382 256
314 3300046477 Ga0495664_0177127 Ga0495664_0177127_323_1162 256
315 3300046492 Ga0495585_0067849 Ga0495585_0067849_19_858 256
316 3300046499 Ga0495594_0001396 Ga0495594_0001396_11407_12246 256
317 3300046499 Ga0495594_0104651 Ga0495594_0104651_704_1543 256
318 3300046501 Ga0495607_0022482 Ga0495607_0022482_3080_3919 256
319 3300046506 Ga0495583_0000370 Ga0495583_0000370_48986_49909 256
320 3300046507 Ga0495606_0008571 Ga0495606_0008571_5103_6026 256
321 3300046511 Ga0495608_0000832 Ga0495608_0000832_5290_6129 256
322 3300046514 Ga0495618_0019644 Ga0495618_0019644_2269_3108 256
323 3300046514 Ga0495618_0194174 Ga0495618_0194174_363_1202 256
324 3300046515 Ga0495620_0012060 Ga0495620_0012060_2130_3053 256
325 3300046516 Ga0495628_0080064 Ga0495628_0080064_897_1736 256
326 3300046516 Ga0495628_0187155 Ga0495628_0187155_232_1071 256
327 3300046517 Ga0495630_0030591 Ga0495630_0030591_186_1025 256
328 3300046524 Ga0495648_0000723 Ga0495648_0000723_776_1699 256
329 3300046524 Ga0495648_0008413 Ga0495648_0008413_5490_6329 256
330 3300046529 Ga0495652_0023871 Ga0495652_0023871_2563_3402 256
331 3300046529 Ga0495652_0388360 Ga0495652_0388360_58_897 256
332 3300046531 Ga0495665_0002572 Ga0495665_0002572_5289_6128 256
333 3300046533 Ga0495640_0002001 Ga0495640_0002001_15156_15995 256
334 3300046533 Ga0495640_0153547 Ga0495640_0153547_577_1416 256
335 3300046536 Ga0495587_0014270 Ga0495587_0014270_1627_2466 256
336 3300046543 Ga0495645_0025205 Ga0495645_0025205_1046_1885 256
337 3300046559 Ga0495667_0003082 Ga0495667_0003082_8306_9145 256
338 3300046616 Ga0495668_0174159 Ga0495668_0174159_191_1030 256
339 3300046642 Ga0495634_0003609 Ga0495634_0003609_9764_10603 256
340 3300046642 Ga0495634_0006837 Ga0495634_0006837_1503_2342 256
341 3300046663 Ga0495635_0001348 Ga0495635_0001348_3738_4577 256
342 3300046663 Ga0495635_0001667 Ga0495635_0001667_11939_12778 256
343 3300046665 Ga0495661_0079084 Ga0495661_0079084_279_1118 256
344 3300046675 Ga0495657_0033520 Ga0495657_0033520_697_1536 256
345 3300046678 Ga0495599_0006501 Ga0495599_0006501_5751_6590 256
346 3300046680 Ga0495646_0010792 Ga0495646_0010792_2476_3315 256
347 3300046683 Ga0495658_0006057 Ga0495658_0006057_3649_4488 256
348 3300046689 Ga0495613_0031324 Ga0495613_0031324_1675_2514 256
349 3300046689 Ga0495613_0041413 Ga0495613_0041413_1044_1883 256
350 3300046690 Ga0495624_0002275 Ga0495624_0002275_12098_12937 256
351 3300046694 Ga0495649_0000149 Ga0495649_0000149_58581_59504 256
352 3300046809 Ga0495600_0044768 Ga0495600_0044768_2015_2854 256
353 3300047315 Ga0495581_0000851 Ga0495581_0000851_10938_11777 256
354 3300047317 Ga0495604_0009053 Ga0495604_0009053_6789_7628 256
355 3300047319 Ga0495674_0000559 Ga0495674_0000559_11746_12585 256
356 3300047320 Ga0495672_0007744 Ga0495672_0007744_4596_5519 256
357 3300047322 Ga0495680_0036826 Ga0495680_0036826_495_1334 256
358 3300047323 Ga0495683_0007187 Ga0495683_0007187_1754_2677 256
359 3300047444 Ga0495675_0024047 Ga0495675_0024047_2580_3419 256
360 3300047446 Ga0495679_000392 Ga0495679_000392_14_937 256
361 3300047469 Ga0495673_0000362 Ga0495673_0000362_22965_23888 256
362 3300047471 Ga0495684_0005198 Ga0495684_0005198_2039_2878 256
363 3300047471 Ga0495684_0032943 Ga0495684_0032943_1584_2423 256
364 3300047673 Ga0495593_0000606 Ga0495593_0000606_16516_17355 256
365 3300047673 Ga0495593_0000953 Ga0495593_0000953_5995_6834 256
366 3300048088 Ga0495602_0077050 Ga0495602_0077050_1287_2126 256
367 3300048089 Ga0495614_0011184 Ga0495614_0011184_2852_3691 256
368 3300048091 Ga0495626_0024671 Ga0495626_0024671_223_1146 256
369 3300048903 Ga0496100_0047368 Ga0496100_0047368_437_1276 256
370 3300048904 Ga0496101_0170130 Ga0496101_0170130_549_1388 256
371 3300048905 Ga0496102_0223441 Ga0496102_0223441_469_1308 256
372 3300048906 Ga0496103_0020222 Ga0496103_0020222_1511_2350 256
373 3300048909 Ga0496106_0262661 Ga0496106_0262661_45_884 256
374 3300048911 Ga0496108_0232373 Ga0496108_0232373_596_1435 256
375 3300048912 Ga0496109_0059771 Ga0496109_0059771_1459_2298 256
376 3300048913 Ga0496110_0039631 Ga0496110_0039631_1858_2739 256
377 3300048913 Ga0496110_0333239 Ga0496110_0333239_218_1057 256
378 3300048915 Ga0496112_0034574 Ga0496112_0034574_1613_2452 256
379 3300048915 Ga0496112_0191885 Ga0496112_0191885_222_1061 256
380 3300048916 Ga0496113_0174795 Ga0496113_0174795_400_1239 256
381 3300048917 Ga0496114_0070632 Ga0496114_0070632_452_1291 256
382 3300048918 Ga0496115_0132487 Ga0496115_0132487_156_995 256
383 3300048918 Ga0496115_0174778 Ga0496115_0174778_269_1108 256
384 3300048918 Ga0496115_0212767 Ga0496115_0212767_434_1273 256
385 3300048920 Ga0496117_0098322 Ga0496117_0098322_870_1709 256
386 3300048921 Ga0496118_0013843 Ga0496118_0013843_3581_4420 256
387 3300048921 Ga0496118_0022793 Ga0496118_0022793_4428_5267 256
388 3300048924 Ga0496121_0034449 Ga0496121_0034449_3295_4134 256
389 3300048924 Ga0496121_0072366 Ga0496121_0072366_59_898 256
390 3300048927 Ga0496124_0078167 Ga0496124_0078167_1007_1846 256
391 3300048927 Ga0496124_0085247 Ga0496124_0085247_1313_2164 256
392 3300048929 Ga0496126_0018230 Ga0496126_0018230_3325_4164 256
393 3300049459 Ga0495678_021406 Ga0495678_021406_1133_2056 256
394 3300049460 Ga0495682_0000605 Ga0495682_0000605_3244_4167 256
395 3300050491 nmdc:mga00v17_210178_c1 nmdc:mga00v17_210178_c1_404_1243 256
396 3300050511 nmdc:mga08y16_620076_c1 nmdc:mga08y16_620076_c1_85_924 256
397 3300053077 Ga0495601_0036750 Ga0495601_0036750_1640_2479 256
398 3300053077 Ga0495601_0087522 Ga0495601_0087522_143_982 256
399 3300053080 Ga0500635_0008589 Ga0500635_0008589_1452_2291 256
400 3300053084 Ga0495595_0000696 Ga0495595_0000696_2459_3298 256
401 3300053085 Ga0495619_0000966 Ga0495619_0000966_10817_11656 256
402 3300053091 Ga0500647_0156860 Ga0500647_0156860_19_858 256
403 3300053094 Ga0500566_0057431 Ga0500566_0057431_1126_1965 256
404 3300053102 Ga0500554_002430 Ga0500554_002430_991_1830 256
405 3300053111 Ga0500572_001849 Ga0500572_001849_150_989 256
406 3300053123 Ga0500614_052167 Ga0500614_052167_45_932 256
407 3300053136 Ga0500559_0020926 Ga0500559_0020926_1846_2685 256
408 3300053159 Ga0500630_000815 Ga0500630_000815_123_1010 256
409 3300053163 Ga0500639_000221 Ga0500639_000221_27287_28174 256
410 3300053177 Ga0500636_0030709 Ga0500636_0030709_2292_3131 256
411 3300053178 Ga0500637_0057330 Ga0500637_0057330_707_1546 256
412 3300005445 Ga0070708_100014186 Ga0070708_1000141865 257
413 3300005468 Ga0070707_100005430 Ga0070707_1000054308 257
414 3300005468 Ga0070707_100250116 Ga0070707_1002501161 257
415 3300005471 Ga0070698_100007110 Ga0070698_1000071107 257
416 3300005518 Ga0070699_100002979 Ga0070699_1000029796 257
417 3300005518 Ga0070699_100031502 Ga0070699_1000315022 257
418 3300005536 Ga0070697_100006480 Ga0070697_1000064803 257
419 3300005546 Ga0070696_100026289 Ga0070696_1000262892 257
420 3300005548 Ga0070665_100289452 Ga0070665_1002894521 257
421 3300005937 Ga0081455_10028316 Ga0081455_100283162 257
422 3300005983 Ga0081540_1002649 Ga0081540_10026499 257
423 3300005983 Ga0081540_1013996 Ga0081540_10139962 257
424 3300005985 Ga0081539_10063382 Ga0081539_100633823 257
425 3300005985 Ga0081539_10180159 Ga0081539_101801591 257
426 3300006042 Ga0075368_10085139 Ga0075368_100851392 257
427 3300006048 Ga0075363_100083253 Ga0075363_1000832532 257
428 3300006844 Ga0075428_100005548 Ga0075428_10000554812 257
429 3300006844 Ga0075428_100022110 Ga0075428_1000221105 257
430 3300006846 Ga0075430_100208635 Ga0075430_1002086351 257
431 3300006847 Ga0075431_100006070 Ga0075431_1000060707 257
432 3300006847 Ga0075431_100042861 Ga0075431_1000428613 257
433 3300006852 Ga0075433_10000090 Ga0075433_1000009012 257
434 3300006852 Ga0075433_10028948 Ga0075433_100289487 257
435 3300006852 Ga0075433_10076167 Ga0075433_100761674 257
436 3300006852 Ga0075433_10242297 Ga0075433_102422972 257
437 3300006871 Ga0075434_100011879 Ga0075434_1000118798 257
438 3300006871 Ga0075434_100014750 Ga0075434_1000147508 257
439 3300006871 Ga0075434_100402486 Ga0075434_1004024862 257
440 3300006914 Ga0075436_100000168 Ga0075436_10000016828 257
441 3300006914 Ga0075436_100012546 Ga0075436_1000125464 257
442 3300006914 Ga0075436_100125932 Ga0075436_1001259322 257
443 3300007076 Ga0075435_100007665 Ga0075435_1000076654 257
444 3300007076 Ga0075435_100046354 Ga0075435_1000463544 257
445 3300007076 Ga0075435_100048805 Ga0075435_1000488055 257
446 3300009094 Ga0111539_10073832 Ga0111539_100738325 257
447 3300009147 Ga0114129_10000881 Ga0114129_1000088122 257
448 3300009147 Ga0114129_10002331 Ga0114129_100023312 257
449 3300009147 Ga0114129_10015357 Ga0114129_100153574 257
450 3300009147 Ga0114129_10022173 Ga0114129_100221736 257
451 3300009147 Ga0114129_10097656 Ga0114129_100976562 257
452 3300009147 Ga0114129_10119579 Ga0114129_101195794 257
453 3300009147 Ga0114129_10286979 Ga0114129_102869792 257
454 3300009147 Ga0114129_10719075 Ga0114129_107190752 257
455 3300014745 Ga0157377_10187223 Ga0157377_101872232 257
456 3300025297 Ga0209758_1073955 Ga0209758_10739552 257
457 3300025910 Ga0207684_10001444 Ga0207684_1000144415 257
458 3300025910 Ga0207684_10044620 Ga0207684_100446203 257
459 3300025922 Ga0207646_10001834 Ga0207646_100018347 257
460 3300025922 Ga0207646_10013493 Ga0207646_100134934 257
461 3300026088 Ga0207641_10022737 Ga0207641_100227375 257
462 3300027907 Ga0207428_10071213 Ga0207428_100712132 257
463 3300028380 Ga0268265_10186621 Ga0268265_101866212 257
464 3300037418 Ga0395900_0447224 Ga0395900_0447224_208_987 257
465 3300037466 Ga0395898_0267108 Ga0395898_0267108_564_1343 257
466 3300037471 Ga0395905_0143784 Ga0395905_0143784_195_1034 257
467 3300037471 Ga0395905_0342674 Ga0395905_0342674_535_1314 257
468 3300038443 Ga0395901_0051193 Ga0395901_0051193_1618_2457 257
469 3300038443 Ga0395901_0222493 Ga0395901_0222493_999_1778 257
470 3300038742 Ga0400486_06770 Ga0400486_06770_1380_2159 257
471 3300044673 Ga0453683_0000252 Ga0453683_0000252_19879_20688 257
472 3300046461 Ga0495641_0006637 Ga0495641_0006637_5827_6750 257
473 3300046462 Ga0495651_0095887 Ga0495651_0095887_987_1910 257
474 3300046472 Ga0495580_0281458 Ga0495580_0281458_20_943 257
475 3300046499 Ga0495594_0017864 Ga0495594_0017864_1089_2012 257
476 3300046507 Ga0495606_0002687 Ga0495606_0002687_17813_18652 257
477 3300046514 Ga0495618_0003243 Ga0495618_0003243_1036_1959 257
478 3300046529 Ga0495652_0001533 Ga0495652_0001533_24237_25160 257
479 3300046536 Ga0495587_0005325 Ga0495587_0005325_6496_7419 257
480 3300046543 Ga0495645_0004058 Ga0495645_0004058_2139_3062 257
481 3300046557 Ga0495622_0133979 Ga0495622_0133979_165_1088 257
482 3300046663 Ga0495635_0005872 Ga0495635_0005872_827_1750 257
483 3300046679 Ga0495623_0015826 Ga0495623_0015826_1920_2843 257
484 3300046809 Ga0495600_0114324 Ga0495600_0114324_431_1354 257
485 3300047317 Ga0495604_0008853 Ga0495604_0008853_6125_7048 257
486 3300047322 Ga0495680_0114428 Ga0495680_0114428_882_1805 257
487 3300047446 Ga0495679_058673 Ga0495679_058673_192_1115 257
488 3300047470 Ga0495681_0041281 Ga0495681_0041281_895_1818 257
489 3300048088 Ga0495602_0317541 Ga0495602_0317541_20_943 257
490 3300048089 Ga0495614_0016077 Ga0495614_0016077_192_1115 257
491 3300048920 Ga0496117_0187965 Ga0496117_0187965_246_1085 257
492 3300048924 Ga0496121_0003460 Ga0496121_0003460_1759_2598 257
493 3300050507 nmdc:mga05p37_1204_c1 nmdc:mga05p37_1204_c1_25532_26311 257
494 3300050507 nmdc:mga05p37_413_c1 nmdc:mga05p37_413_c1_12182_12961 257
495 3300050507 nmdc:mga05p37_47607_c1 nmdc:mga05p37_47607_c1_2491_3270 257
496 3300050507 nmdc:mga05p37_74309_c1 nmdc:mga05p37_74309_c1_1458_2237 257
497 3300050508 nmdc:mga09592_33905_c1 nmdc:mga09592_33905_c1_1860_2639 257
498 3300050509 nmdc:mga0qj67_41611_c1 nmdc:mga0qj67_41611_c1_1944_2723 257
499 3300050511 nmdc:mga08y16_237415_c1 nmdc:mga08y16_237415_c1_220_999 257
500 3300050512 nmdc:mga0n895_127_c1 nmdc:mga0n895_127_c1_30331_31110 257
501 3300050512 nmdc:mga0n895_19327_c1 nmdc:mga0n895_19327_c1_4811_5590 257
502 3300050512 nmdc:mga0n895_35568_c1 nmdc:mga0n895_35568_c1_1327_2106 257
503 3300050512 nmdc:mga0n895_523143_c1 nmdc:mga0n895_523143_c1_64_843 257
504 3300050513 nmdc:mga0rr50_3231_c1 nmdc:mga0rr50_3231_c1_2355_3134 257
505 3300050513 nmdc:mga0rr50_771_c1 nmdc:mga0rr50_771_c1_15556_16335 257
506 3300050514 nmdc:mga08x19_258516_c1 nmdc:mga08x19_258516_c1_175_954 257
507 3300050514 nmdc:mga08x19_59288_c1 nmdc:mga08x19_59288_c1_915_1694 257
508 3300050514 nmdc:mga08x19_66198_c1 nmdc:mga08x19_66198_c1_1169_1948 257
509 3300050515 nmdc:mga0a205_433_c1 nmdc:mga0a205_433_c1_30317_31096 257
510 3300050515 nmdc:mga0a205_50973_c1 nmdc:mga0a205_50973_c1_1913_2692 257
511 3300050515 nmdc:mga0a205_81202_c1 nmdc:mga0a205_81202_c1_771_1550 257
512 3300050515 nmdc:mga0a205_99184_c1 nmdc:mga0a205_99184_c1_187_966 257
513 3300053093 Ga0500651_0019640 Ga0500651_0019640_885_1724 257
514 3300053119 Ga0500595_009536 Ga0500595_009536_443_1282 257
515 3300053130 Ga0500642_0058734 Ga0500642_0058734_212_1054 257
516 3300053153 Ga0500616_0000028 Ga0500616_0000028_195412_196251 257
517 3300003775 Ga0055524_1023756 Ga0055524_10237562 258
518 3300005434 Ga0070709_10068701 Ga0070709_100687012 258
519 3300005436 Ga0070713_100183887 Ga0070713_1001838872 258
520 3300005467 Ga0070706_100122782 Ga0070706_1001227823 258
521 3300005468 Ga0070707_100059338 Ga0070707_1000593382 258
522 3300005471 Ga0070698_100002784 Ga0070698_10000278414 258
523 3300005985 Ga0081539_10035862 Ga0081539_100358624 258
524 3300007265 Ga0099794_10061464 Ga0099794_100614642 258
525 3300013308 Ga0157375_10296547 Ga0157375_102965471 258
526 3300025299 Ga0209256_1000545 Ga0209256_100054529 258
527 3300025302 Ga0207426_1006921 Ga0207426_10069214 258
528 3300025910 Ga0207684_10097598 Ga0207684_100975982 258
529 3300025916 Ga0207663_10096997 Ga0207663_100969972 258
530 3300025922 Ga0207646_10068747 Ga0207646_100687472 258
531 3300025937 Ga0207669_10403072 Ga0207669_104030722 258
532 3300025986 Ga0207658_10784033 Ga0207658_107840331 258
533 3300026023 Ga0207677_10214991 Ga0207677_102149912 258
534 3300031241 Ga0265325_10081996 Ga0265325_100819962 258
535 3300035691 Ga0373931_0047379 Ga0373931_0047379_1150_1995 258
536 3300037068 Ga0373925_0163994 Ga0373925_0163994_638_1483 258
537 3300047469 Ga0495673_0000008 Ga0495673_0000008_503806_504654 258
538 3300050492 nmdc:mga0yw44_29154_c1 nmdc:mga0yw44_29154_c1_1237_2091 258
539 3300053153 Ga0500616_0003426 Ga0500616_0003426_8819_9664 258
540 3300053730 Ga0500645_013729 Ga0500645_013729_531_1376 258
541 3300006844 Ga0075428_100109308 Ga0075428_1001093082 259
542 3300006847 Ga0075431_100048829 Ga0075431_1000488294 259
543 3300006852 Ga0075433_10049015 Ga0075433_100490154 259
544 3300006871 Ga0075434_100095898 Ga0075434_1000958981 259
545 3300006880 Ga0075429_100035774 Ga0075429_1000357744 259
546 3300007076 Ga0075435_100030311 Ga0075435_1000303114 259
547 3300009147 Ga0114129_10106691 Ga0114129_101066914 259
548 3300050507 nmdc:mga05p37_60912_c1 nmdc:mga05p37_60912_c1_1749_2534 259
549 3300050508 nmdc:mga09592_17311_c1 nmdc:mga09592_17311_c1_3184_3969 259
550 3300050510 nmdc:mga06r32_34997_c1 nmdc:mga06r32_34997_c1_1878_2663 259
551 3300050512 nmdc:mga0n895_75123_c1 nmdc:mga0n895_75123_c1_47_832 259
552 3300050513 nmdc:mga0rr50_22233_c1 nmdc:mga0rr50_22233_c1_1710_2495 259
553 3300050515 nmdc:mga0a205_65115_c1 nmdc:mga0a205_65115_c1_527_1312 259
554 3300005440 Ga0070705_100211819 Ga0070705_1002118192 260
555 3300005467 Ga0070706_100225125 Ga0070706_1002251252 260
556 3300005518 Ga0070699_100586436 Ga0070699_1005864361 260
557 3300006852 Ga0075433_10003084 Ga0075433_1000308413 260
558 3300006871 Ga0075434_100040652 Ga0075434_1000406523 260
559 3300006914 Ga0075436_100009932 Ga0075436_1000099328 260
560 3300025910 Ga0207684_10177590 Ga0207684_101775902 260
561 3300033180 Ga0307510_10236845 Ga0307510_102368452 260
562 3300046522 Ga0495643_0056685 Ga0495643_0056685_94_945 260
563 3300046523 Ga0495644_0016360 Ga0495644_0016360_1593_2444 260
564 3300046538 Ga0495609_0000650 Ga0495609_0000650_8935_9786 260
565 3300046678 Ga0495599_0031977 Ga0495599_0031977_1003_1791 260
566 3300048927 Ga0496124_0024007 Ga0496124_0024007_3161_4012 260
567 3300049459 Ga0495678_000012 Ga0495678_000012_331536_332387 260
568 3300049571 Ga0501034_0051746 Ga0501034_0051746_1185_1973 260
569 3300050512 nmdc:mga0n895_57522_c1 nmdc:mga0n895_57522_c1_1453_2253 260
570 3300050513 nmdc:mga0rr50_61461_c1 nmdc:mga0rr50_61461_c1_253_1053 260
571 3300050514 nmdc:mga08x19_16260_c1 nmdc:mga08x19_16260_c1_218_1018 260
572 3300050515 nmdc:mga0a205_29651_c1 nmdc:mga0a205_29651_c1_2057_2857 260
573 3300053139 Ga0500568_0020039 Ga0500568_0020039_1205_2056 260
574 3300005335 Ga0070666_10248901 Ga0070666_102489011 261
575 3300005354 Ga0070675_100102270 Ga0070675_1001022703 261
576 3300005445 Ga0070708_100093833 Ga0070708_1000938332 261
577 3300005455 Ga0070663_100438427 Ga0070663_1004384272 261
578 3300005457 Ga0070662_100042847 Ga0070662_1000428472 261
579 3300005467 Ga0070706_100001066 Ga0070706_1000010662 261
580 3300005467 Ga0070706_100007018 Ga0070706_1000070186 261
581 3300005468 Ga0070707_100011879 Ga0070707_1000118796 261
582 3300005468 Ga0070707_100578364 Ga0070707_1005783641 261
583 3300005471 Ga0070698_100049237 Ga0070698_1000492375 261
584 3300005518 Ga0070699_100052038 Ga0070699_1000520383 261
585 3300005536 Ga0070697_100032132 Ga0070697_1000321322 261
586 3300013296 Ga0157374_10185047 Ga0157374_101850472 261
587 3300025893 Ga0207682_10001102 Ga0207682_1000110210 261
588 3300025910 Ga0207684_10008691 Ga0207684_100086912 261
589 3300025922 Ga0207646_10001349 Ga0207646_1000134926 261
590 3300025922 Ga0207646_10140521 Ga0207646_101405212 261
591 3300025941 Ga0207711_10282686 Ga0207711_102826862 261
592 3300026121 Ga0207683_10017123 Ga0207683_100171234 261
593 3300044712 Ga0453684_0049519 Ga0453684_0049519_991_1857 261
594 3300005331 Ga0070670_100096223 Ga0070670_1000962232 262
595 3300005347 Ga0070668_100411367 Ga0070668_1004113671 262
596 3300005467 Ga0070706_100569066 Ga0070706_1005690662 262
597 3300005471 Ga0070698_100044987 Ga0070698_1000449872 262
598 3300005549 Ga0070704_100380663 Ga0070704_1003806631 262
599 3300006852 Ga0075433_10026223 Ga0075433_100262232 262
600 3300006852 Ga0075433_10293189 Ga0075433_102931892 262
601 3300006871 Ga0075434_100231935 Ga0075434_1002319352 262
602 3300009177 Ga0105248_10058098 Ga0105248_100580984 262
603 3300025910 Ga0207684_10613801 Ga0207684_106138011 262
604 3300025925 Ga0207650_10166275 Ga0207650_101662752 262
605 3300044658 Ga0466972_0049275 Ga0466972_0049275_17_823 262
606 3300044901 Ga0466960_0142187 Ga0466960_0142187_19_825 262
607 3300046471 Ga0495650_0029154 Ga0495650_0029154_1203_2069 262
608 3300006353 Ga0075370_10025758 Ga0075370_100257582 263
609 3300007788 Ga0099795_10012611 Ga0099795_100126112 263
610 3300027512 Ga0209179_1012786 Ga0209179_10127862 263
611 3300031649 Ga0307514_10011703 Ga0307514_100117035 263
612 3300033180 Ga0307510_10033122 Ga0307510_100331224 263
613 3300033180 Ga0307510_10075429 Ga0307510_100754294 263
614 3300035113 Ga0373936_0058316 Ga0373936_0058316_692_1531 263
615 3300035410 Ga0373924_0087304 Ga0373924_0087304_367_1209 263
616 3300035692 Ga0373935_0012293 Ga0373935_0012293_75_917 263
617 3300037068 Ga0373925_0172510 Ga0373925_0172510_39_881 263
618 3300046454 Ga0495592_0000553 Ga0495592_0000553_16872_17738 263
619 3300046472 Ga0495580_0043472 Ga0495580_0043472_1982_2785 263
620 3300048928 Ga0496125_0001879 Ga0496125_0001879_21091_21945 263
621 3300049582 Ga0501048_0163479 Ga0501048_0163479_76_879 263
622 3300049587 Ga0501071_0028125 Ga0501071_0028125_1577_2380 263
623 3300049588 Ga0501072_0096552 Ga0501072_0096552_838_1641 263
624 3300049591 Ga0501075_0006354 Ga0501075_0006354_1631_2434 263
625 3300049592 Ga0501076_0000981 Ga0501076_0000981_16552_17355 263
626 3300049741 Ga0501079_0024279 Ga0501079_0024279_2183_2986 263
627 3300049742 Ga0501080_0095492 Ga0501080_0095492_1027_1830 263
628 3300049743 Ga0501081_0004564 Ga0501081_0004564_6423_7226 263
629 3300049824 Ga0501045_0104076 Ga0501045_0104076_1145_1948 263
630 3300050493 nmdc:mga0k408_42865_c1 nmdc:mga0k408_42865_c1_1423_2262 263
631 3300050496 nmdc:mga07m45_70372_c1 nmdc:mga07m45_70372_c1_931_1770 263
632 3300050509 nmdc:mga0qj67_404607_c1 nmdc:mga0qj67_404607_c1_224_1027 263
633 3300053136 Ga0500559_0000107 Ga0500559_0000107_19162_20028 263
634 3300054114 Ga0501084_0120064 Ga0501084_0120064_1322_2125 263
635 3300060353 Ga0501082_0013883 Ga0501082_0013883_2214_3017 263
636 3300006175 Ga0070712_100412422 Ga0070712_1004124221 264
637 3300033180 Ga0307510_10001725 Ga0307510_1000172513 264
638 3300035118 Ga0373954_0024910 Ga0373954_0024910_1491_2429 264
639 3300035119 Ga0373956_0168971 Ga0373956_0168971_160_999 264
640 3300035120 Ga0373957_0020968 Ga0373957_0020968_324_1262 264
641 3300035171 Ga0373946_0015804 Ga0373946_0015804_825_1763 264
642 3300035692 Ga0373935_0006508 Ga0373935_0006508_1869_2807 264
643 3300035695 Ga0373927_0035579 Ga0373927_0035579_1606_2544 264
644 3300035725 Ga0373947_0000846 Ga0373947_0000846_15891_16829 264
645 3300036401 Ga0373937_0000269 Ga0373937_0000269_40213_41151 264
646 3300037068 Ga0373925_0000075 Ga0373925_0000075_46663_47601 264
647 3300046454 Ga0495592_0000060 Ga0495592_0000060_42577_43515 264
648 3300046459 Ga0495629_0026394 Ga0495629_0026394_1458_2396 264
649 3300046462 Ga0495651_0000181 Ga0495651_0000181_3348_4286 264
650 3300046463 Ga0495653_0000129 Ga0495653_0000129_7652_8590 264
651 3300046476 Ga0495662_0000590 Ga0495662_0000590_12425_13363 264
652 3300046477 Ga0495664_0000003 Ga0495664_0000003_40218_41156 264
653 3300046511 Ga0495608_0000005 Ga0495608_0000005_12968_13906 264
654 3300046514 Ga0495618_0000044 Ga0495618_0000044_52051_52989 264
655 3300046516 Ga0495628_0000001 Ga0495628_0000001_529619_530557 264
656 3300046517 Ga0495630_0000574 Ga0495630_0000574_21177_22115 264
657 3300046529 Ga0495652_0000002 Ga0495652_0000002_744153_745091 264
658 3300046533 Ga0495640_0000001 Ga0495640_0000001_838157_839095 264
659 3300046536 Ga0495587_0000001 Ga0495587_0000001_56888_57826 264
660 3300046543 Ga0495645_0000002 Ga0495645_0000002_529632_530570 264
661 3300046559 Ga0495667_0000039 Ga0495667_0000039_87777_88715 264
662 3300046642 Ga0495634_0000010 Ga0495634_0000010_111925_112863 264
663 3300046663 Ga0495635_0000001 Ga0495635_0000001_42712_43650 264
664 3300046675 Ga0495657_0000042 Ga0495657_0000042_71298_72236 264
665 3300046678 Ga0495599_0000013 Ga0495599_0000013_121056_121994 264
666 3300046679 Ga0495623_0000050 Ga0495623_0000050_27307_28245 264
667 3300046680 Ga0495646_0000009 Ga0495646_0000009_57721_58659 264
668 3300046809 Ga0495600_0000035 Ga0495600_0000035_61271_62209 264
669 3300047315 Ga0495581_0007779 Ga0495581_0007779_84_1022 264
670 3300047317 Ga0495604_0000069 Ga0495604_0000069_31637_32575 264
671 3300047319 Ga0495674_0000002 Ga0495674_0000002_529620_530558 264
672 3300047322 Ga0495680_0000328 Ga0495680_0000328_9740_10678 264
673 3300047444 Ga0495675_0000164 Ga0495675_0000164_39223_40161 264
674 3300047471 Ga0495684_0000016 Ga0495684_0000016_121336_122274 264
675 3300048088 Ga0495602_0000240 Ga0495602_0000240_7549_8487 264
676 3300048927 Ga0496124_0009911 Ga0496124_0009911_1843_2730 264
677 3300053077 Ga0495601_0000001 Ga0495601_0000001_501769_502707 264
678 3300053078 Ga0495612_0000017 Ga0495612_0000017_93554_94492 264
679 3300053084 Ga0495595_0000010 Ga0495595_0000010_121032_121970 264
680 3300053085 Ga0495619_0000014 Ga0495619_0000014_1696_2634 264
681 3300005471 Ga0070698_100121348 Ga0070698_1001213482 265
682 3300007788 Ga0099795_10007542 Ga0099795_100075422 265
683 3300031456 Ga0307513_10000028 Ga0307513_1000002835 265
684 3300037068 Ga0373925_0273550 Ga0373925_0273550_356_1198 265
685 3300042461 Ga0439460_0003204 Ga0439460_0003204_17_814 265
686 3300046471 Ga0495650_0004948 Ga0495650_0004948_152_1021 265
687 3300046472 Ga0495580_0339238 Ga0495580_0339238_50_892 265
688 3300053125 Ga0500618_000088 Ga0500618_000088_19091_19987 265
689 3300039437 Ga0436365_0703504 Ga0436365_0703504_1176_2012 266
690 3300048921 Ga0496118_0094148 Ga0496118_0094148_187_1008 266
691 3300048924 Ga0496121_0053860 Ga0496121_0053860_1775_2656 266
692 3300048927 Ga0496124_0031672 Ga0496124_0031672_141_1022 266
693 3300027378 Ga0209981_1012200 Ga0209981_10122002 267
694 3300028794 Ga0307515_10144962 Ga0307515_101449623 267
695 3300031251 Ga0265327_10021443 Ga0265327_100214433 267
696 3300048905 Ga0496102_0695057 Ga0496102_0695057_15_821 267
697 3300048919 Ga0496116_0071638 Ga0496116_0071638_1135_1944 267
698 3300048924 Ga0496121_0001373 Ga0496121_0001373_17752_18561 267
699 3300048927 Ga0496124_0000224 Ga0496124_0000224_72170_72979 267
700 3300053125 Ga0500618_001413 Ga0500618_001413_4751_5617 267
701 3300005468 Ga0070707_100003645 Ga0070707_10000364510 268
702 3300025922 Ga0207646_10007486 Ga0207646_100074863 268
703 3300033179 Ga0307507_10098971 Ga0307507_100989711 268
704 3300046524 Ga0495648_0013147 Ga0495648_0013147_4697_5548 268
705 3300003203 JGI25406J46586_10000801 JGI25406J46586_100008012 269
706 3300005434 Ga0070709_10003602 Ga0070709_100036021 269
707 3300005435 Ga0070714_100263796 Ga0070714_1002637961 269
708 3300005437 Ga0070710_10001132 Ga0070710_1000113211 269
709 3300005439 Ga0070711_100003864 Ga0070711_1000038642 269
710 3300005985 Ga0081539_10000008 Ga0081539_10000008442 269
711 3300025898 Ga0207692_10203433 Ga0207692_102034331 269
712 3300025906 Ga0207699_10001319 Ga0207699_1000131911 269
713 3300025915 Ga0207693_10087300 Ga0207693_100873002 269
714 3300025916 Ga0207663_10006786 Ga0207663_100067866 269
715 3300025929 Ga0207664_10012798 Ga0207664_100127982 269
716 3300025939 Ga0207665_10004269 Ga0207665_1000426912 269
717 3300005262 Ga0065165_1000024 Ga0065165_100002424 270
718 3300048916 Ga0496113_0462982 Ga0496113_0462982_100_939 270
719 3300049576 Ga0501040_0172442 Ga0501040_0172442_333_1172 270
720 3300049577 Ga0501041_0077892 Ga0501041_0077892_13_852 270
721 3300049578 Ga0501042_0269581 Ga0501042_0269581_13_852 270
722 3300049580 Ga0501046_0064299 Ga0501046_0064299_1109_1948 270
723 3300049582 Ga0501048_0078999 Ga0501048_0078999_1409_2248 270
724 3300049592 Ga0501076_0086870 Ga0501076_0086870_208_1047 270
725 3300049741 Ga0501079_0067138 Ga0501079_0067138_368_1207 270
726 3300049743 Ga0501081_0061629 Ga0501081_0061629_421_1260 270
727 3300049824 Ga0501045_0086938 Ga0501045_0086938_1361_2200 270
728 3300031456 Ga0307513_10092185 Ga0307513_100921853 271
729 3300031616 Ga0307508_10000004 Ga0307508_1000000429 271
730 3300049589 Ga0501073_0147546 Ga0501073_0147546_641_1462 271
731 3300049742 Ga0501080_0090377 Ga0501080_0090377_17_838 271
732 3300003215 JGI25153J46596_10002589 JGI25153J46596_100025895 272
733 3300003215 JGI25153J46596_10021769 JGI25153J46596_100217692 272
734 3300003354 JGI25160J50197_1006259 JGI25160J50197_10062593 272
735 3300003354 JGI25160J50197_1006800 JGI25160J50197_10068003 272
736 3300003659 JGI25404J52841_10011082 JGI25404J52841_100110822 272
737 3300005262 Ga0065165_1001284 Ga0065165_100128413 272
738 3300005327 Ga0070658_10049317 Ga0070658_100493175 272
739 3300005328 Ga0070676_10106817 Ga0070676_101068172 272
740 3300005331 Ga0070670_100016676 Ga0070670_1000166763 272
741 3300005335 Ga0070666_10168377 Ga0070666_101683772 272
742 3300005338 Ga0068868_100072676 Ga0068868_1000726763 272
743 3300005339 Ga0070660_100301085 Ga0070660_1003010852 272
744 3300005354 Ga0070675_100005492 Ga0070675_1000054927 272
745 3300005355 Ga0070671_100011767 Ga0070671_1000117673 272
746 3300005364 Ga0070673_100009243 Ga0070673_1000092432 272
747 3300005366 Ga0070659_100235484 Ga0070659_1002354841 272
748 3300005455 Ga0070663_100197713 Ga0070663_1001977132 272
749 3300005455 Ga0070663_100303608 Ga0070663_1003036081 272
750 3300005456 Ga0070678_100033200 Ga0070678_1000332001 272
751 3300005456 Ga0070678_100068196 Ga0070678_1000681962 272
752 3300005457 Ga0070662_100092254 Ga0070662_1000922542 272
753 3300005468 Ga0070707_100059485 Ga0070707_1000594852 272
754 3300005539 Ga0068853_100033377 Ga0068853_1000333776 272
755 3300005539 Ga0068853_100200802 Ga0068853_1002008022 272
756 3300005543 Ga0070672_100037636 Ga0070672_1000376363 272
757 3300005545 Ga0070695_100065670 Ga0070695_1000656702 272
758 3300005547 Ga0070693_100083628 Ga0070693_1000836282 272
759 3300005548 Ga0070665_100785064 Ga0070665_1007850641 272
760 3300005549 Ga0070704_100440643 Ga0070704_1004406432 272
761 3300005564 Ga0070664_100043057 Ga0070664_1000430573 272
762 3300005578 Ga0068854_100066660 Ga0068854_1000666602 272
763 3300005614 Ga0068856_100144187 Ga0068856_1001441871 272
764 3300005616 Ga0068852_100020468 Ga0068852_1000204684 272
765 3300005618 Ga0068864_100086254 Ga0068864_1000862543 272
766 3300005718 Ga0068866_10011607 Ga0068866_100116072 272
767 3300005840 Ga0068870_10043461 Ga0068870_100434612 272
768 3300005843 Ga0068860_100179335 Ga0068860_1001793352 272
769 3300005844 Ga0068862_100204372 Ga0068862_1002043722 272
770 3300005983 Ga0081540_1003830 Ga0081540_100383013 272
771 3300005983 Ga0081540_1003910 Ga0081540_100391012 272
772 3300005983 Ga0081540_1024563 Ga0081540_10245633 272
773 3300006042 Ga0075368_10002361 Ga0075368_100023617 272
774 3300006042 Ga0075368_10029147 Ga0075368_100291472 272
775 3300006048 Ga0075363_100012530 Ga0075363_1000125302 272
776 3300006051 Ga0075364_10177790 Ga0075364_101777902 272
777 3300006175 Ga0070712_100183907 Ga0070712_1001839072 272
778 3300006178 Ga0075367_10012955 Ga0075367_100129552 272
779 3300006178 Ga0075367_10025935 Ga0075367_100259352 272
780 3300006237 Ga0097621_100106660 Ga0097621_1001066602 272
781 3300006353 Ga0075370_10185373 Ga0075370_101853731 272
782 3300006358 Ga0068871_100028813 Ga0068871_1000288134 272
783 3300006358 Ga0068871_100272124 Ga0068871_1002721241 272
784 3300006844 Ga0075428_100303162 Ga0075428_1003031622 272
785 3300006942 Ga0099824_1022507 Ga0099824_10225072 272
786 3300006944 Ga0099823_1019469 Ga0099823_10194692 272
787 3300009174 Ga0105241_10012907 Ga0105241_100129073 272
788 3300009176 Ga0105242_10175319 Ga0105242_101753192 272
789 3300009176 Ga0105242_10686701 Ga0105242_106867012 272
790 3300009177 Ga0105248_10095407 Ga0105248_100954072 272
791 3300009177 Ga0105248_10177251 Ga0105248_101772512 272
792 3300009177 Ga0105248_10471815 Ga0105248_104718151 272
793 3300009551 Ga0105238_10271943 Ga0105238_102719432 272
794 3300009553 Ga0105249_10093198 Ga0105249_100931982 272
795 3300013296 Ga0157374_10003804 Ga0157374_100038048 272
796 3300013296 Ga0157374_10140934 Ga0157374_101409342 272
797 3300013296 Ga0157374_10220651 Ga0157374_102206512 272
798 3300013296 Ga0157374_10774927 Ga0157374_107749271 272
799 3300013297 Ga0157378_10013539 Ga0157378_100135394 272
800 3300013308 Ga0157375_10483195 Ga0157375_104831951 272
801 3300014325 Ga0163163_10055535 Ga0163163_100555352 272
802 3300014969 Ga0157376_10015076 Ga0157376_100150766 272
803 3300014969 Ga0157376_10146677 Ga0157376_101466772 272
804 3300021320 Ga0214544_1000020 Ga0214544_100002085 272
805 3300021321 Ga0214542_1000024 Ga0214542_100002496 272
806 3300021324 Ga0214545_1000011 Ga0214545_100001196 272
807 3300021327 Ga0214543_1000033 Ga0214543_1000033108 272
808 3300025230 Ga0209563_101304 Ga0209563_1013045 272
809 3300025261 Ga0209233_1001066 Ga0209233_10010662 272
810 3300025273 Ga0209673_1044222 Ga0209673_10442221 272
811 3300025295 Ga0209564_1014473 Ga0209564_10144733 272
812 3300025297 Ga0209758_1000952 Ga0209758_100095236 272
813 3300025297 Ga0209758_1037687 Ga0209758_10376872 272
814 3300025304 Ga0209257_1013152 Ga0209257_10131522 272
815 3300025900 Ga0207710_10045537 Ga0207710_100455372 272
816 3300025907 Ga0207645_10073442 Ga0207645_100734422 272
817 3300025907 Ga0207645_10076453 Ga0207645_100764532 272
818 3300025909 Ga0207705_10066695 Ga0207705_100666952 272
819 3300025911 Ga0207654_10017669 Ga0207654_100176693 272
820 3300025912 Ga0207707_10234841 Ga0207707_102348411 272
821 3300025914 Ga0207671_10112523 Ga0207671_101125233 272
822 3300025915 Ga0207693_10207407 Ga0207693_102074072 272
823 3300025924 Ga0207694_10280638 Ga0207694_102806382 272
824 3300025925 Ga0207650_10001712 Ga0207650_1000171211 272
825 3300025931 Ga0207644_10027565 Ga0207644_100275655 272
826 3300025931 Ga0207644_10055845 Ga0207644_100558452 272
827 3300025933 Ga0207706_10128126 Ga0207706_101281262 272
828 3300025942 Ga0207689_10039992 Ga0207689_100399922 272
829 3300025942 Ga0207689_10073209 Ga0207689_100732092 272
830 3300025945 Ga0207679_10008273 Ga0207679_100082737 272
831 3300025960 Ga0207651_10001703 Ga0207651_100017037 272
832 3300025981 Ga0207640_10061301 Ga0207640_100613011 272
833 3300025981 Ga0207640_10218736 Ga0207640_102187362 272
834 3300026023 Ga0207677_10017339 Ga0207677_100173395 272
835 3300026041 Ga0207639_10278169 Ga0207639_102781691 272
836 3300026041 Ga0207639_10570532 Ga0207639_105705321 272
837 3300026067 Ga0207678_10100542 Ga0207678_101005423 272
838 3300026078 Ga0207702_10039969 Ga0207702_100399695 272
839 3300026095 Ga0207676_10223852 Ga0207676_102238522 272
840 3300026121 Ga0207683_10030958 Ga0207683_100309584 272
841 3300026142 Ga0207698_10000603 Ga0207698_1000060311 272
842 3300027296 Ga0209389_1000011 Ga0209389_1000011119 272
843 3300027296 Ga0209389_1000424 Ga0209389_100042410 272
844 3300027357 Ga0209589_1004180 Ga0209589_100418010 272
845 3300027361 Ga0209489_100017 Ga0209489_100017115 272
846 3300027361 Ga0209489_104563 Ga0209489_10456311 272
847 3300027363 Ga0209700_100027 Ga0209700_100027119 272
848 3300027866 Ga0209813_10013245 Ga0209813_100132453 272
849 3300028379 Ga0268266_10100118 Ga0268266_101001183 272
850 3300028381 Ga0268264_10766013 Ga0268264_107660132 272
851 3300028786 Ga0307517_10000049 Ga0307517_1000004936 272
852 3300028794 Ga0307515_10152692 Ga0307515_101526921 272
853 3300031711 Ga0265314_10075462 Ga0265314_100754622 272
854 3300031730 Ga0307516_10005295 Ga0307516_100052952 272
855 3300033180 Ga0307510_10044427 Ga0307510_100444273 272
856 3300035089 Ga0373944_0032737 Ga0373944_0032737_286_1125 272
857 3300035117 Ga0373953_0022563 Ga0373953_0022563_786_1625 272
858 3300035120 Ga0373957_0002972 Ga0373957_0002972_1528_2367 272
859 3300035172 Ga0373955_0008786 Ga0373955_0008786_3331_4170 272
860 3300035692 Ga0373935_0289936 Ga0373935_0289936_276_1115 272
861 3300035695 Ga0373927_0171508 Ga0373927_0171508_23_862 272
862 3300035724 Ga0373933_0114823 Ga0373933_0114823_522_1361 272
863 3300044684 Ga0466966_0004865 Ga0466966_0004865_7840_8679 272
864 3300044693 Ga0466961_0003875 Ga0466961_0003875_4203_5042 272
865 3300045049 Ga0466959_0008411 Ga0466959_0008411_1494_2333 272
866 3300046452 Ga0495617_016710 Ga0495617_016710_104_943 272
867 3300046454 Ga0495592_0094668 Ga0495592_0094668_839_1678 272
868 3300046460 Ga0495638_0004444 Ga0495638_0004444_9564_10403 272
869 3300046462 Ga0495651_0002101 Ga0495651_0002101_11767_12606 272
870 3300046462 Ga0495651_0027827 Ga0495651_0027827_3039_3878 272
871 3300046463 Ga0495653_0028701 Ga0495653_0028701_801_1640 272
872 3300046474 Ga0495605_0074102 Ga0495605_0074102_277_1116 272
873 3300046477 Ga0495664_0062180 Ga0495664_0062180_995_1834 272
874 3300046477 Ga0495664_0064611 Ga0495664_0064611_1097_1936 272
875 3300046507 Ga0495606_0046693 Ga0495606_0046693_789_1631 272
876 3300046511 Ga0495608_0005335 Ga0495608_0005335_1186_2025 272
877 3300046511 Ga0495608_0019297 Ga0495608_0019297_1517_2356 272
878 3300046512 Ga0495610_0151393 Ga0495610_0151393_70_909 272
879 3300046514 Ga0495618_0046150 Ga0495618_0046150_1332_2171 272
880 3300046516 Ga0495628_0014573 Ga0495628_0014573_2696_3535 272
881 3300046516 Ga0495628_0077782 Ga0495628_0077782_770_1609 272
882 3300046519 Ga0495632_0064658 Ga0495632_0064658_827_1666 272
883 3300046519 Ga0495632_0071248 Ga0495632_0071248_698_1537 272
884 3300046522 Ga0495643_0027646 Ga0495643_0027646_973_1815 272
885 3300046529 Ga0495652_0006363 Ga0495652_0006363_6600_7439 272
886 3300046529 Ga0495652_0091222 Ga0495652_0091222_656_1495 272
887 3300046533 Ga0495640_0075246 Ga0495640_0075246_425_1264 272
888 3300046536 Ga0495587_0024566 Ga0495587_0024566_1488_2327 272
889 3300046536 Ga0495587_0047368 Ga0495587_0047368_1053_1892 272
890 3300046538 Ga0495609_0036919 Ga0495609_0036919_351_1190 272
891 3300046543 Ga0495645_0089014 Ga0495645_0089014_668_1507 272
892 3300046615 Ga0495656_0023075 Ga0495656_0023075_1027_1848 272
893 3300046615 Ga0495656_0032291 Ga0495656_0032291_199_1038 272
894 3300046616 Ga0495668_0037116 Ga0495668_0037116_1716_2558 272
895 3300046663 Ga0495635_0026385 Ga0495635_0026385_1538_2377 272
896 3300046675 Ga0495657_0002643 Ga0495657_0002643_10793_11632 272
897 3300046678 Ga0495599_0015314 Ga0495599_0015314_2695_3534 272
898 3300046678 Ga0495599_0028956 Ga0495599_0028956_2483_3322 272
899 3300046679 Ga0495623_0014984 Ga0495623_0014984_77_916 272
900 3300046679 Ga0495623_0045431 Ga0495623_0045431_429_1268 272
901 3300046680 Ga0495646_0031676 Ga0495646_0031676_509_1348 272
902 3300046809 Ga0495600_0129701 Ga0495600_0129701_401_1240 272
903 3300047317 Ga0495604_0005569 Ga0495604_0005569_5238_6077 272
904 3300047317 Ga0495604_0008438 Ga0495604_0008438_1913_2752 272
905 3300047319 Ga0495674_0059219 Ga0495674_0059219_1929_2768 272
906 3300047319 Ga0495674_0073584 Ga0495674_0073584_370_1209 272
907 3300047321 Ga0495676_0273696 Ga0495676_0273696_50_889 272
908 3300047322 Ga0495680_0007181 Ga0495680_0007181_5218_6057 272
909 3300047322 Ga0495680_0029436 Ga0495680_0029436_989_1828 272
910 3300047323 Ga0495683_0133685 Ga0495683_0133685_197_1036 272
911 3300047443 Ga0495687_004001 Ga0495687_004001_7283_8125 272
912 3300047444 Ga0495675_0010844 Ga0495675_0010844_4002_4841 272
913 3300047471 Ga0495684_0028039 Ga0495684_0028039_553_1392 272
914 3300047673 Ga0495593_0048060 Ga0495593_0048060_419_1258 272
915 3300048088 Ga0495602_0002010 Ga0495602_0002010_12876_13715 272
916 3300048088 Ga0495602_0061124 Ga0495602_0061124_746_1585 272
917 3300048090 Ga0495615_0031366 Ga0495615_0031366_390_1229 272
918 3300048905 Ga0496102_0219683 Ga0496102_0219683_158_994 272
919 3300048906 Ga0496103_0027506 Ga0496103_0027506_1462_2304 272
920 3300048912 Ga0496109_0144166 Ga0496109_0144166_1189_2019 272
921 3300048913 Ga0496110_0032897 Ga0496110_0032897_1902_2732 272
922 3300048915 Ga0496112_0154568 Ga0496112_0154568_574_1416 272
923 3300048918 Ga0496115_0117048 Ga0496115_0117048_872_1711 272
924 3300048919 Ga0496116_0007895 Ga0496116_0007895_1948_2787 272
925 3300048921 Ga0496118_0145225 Ga0496118_0145225_316_1155 272
926 3300048924 Ga0496121_0004413 Ga0496121_0004413_16478_17317 272
927 3300048924 Ga0496121_0134946 Ga0496121_0134946_58_897 272
928 3300048927 Ga0496124_0218591 Ga0496124_0218591_286_1125 272
929 3300048928 Ga0496125_0079365 Ga0496125_0079365_1130_1969 272
930 3300048929 Ga0496126_0130226 Ga0496126_0130226_844_1683 272
931 3300050490 nmdc:mga03n38_1633_c1 nmdc:mga03n38_1633_c1_3344_4183 272
932 3300050492 nmdc:mga0yw44_137180_c1 nmdc:mga0yw44_137180_c1_655_1494 272
933 3300050494 nmdc:mga06z11_117198_c1 nmdc:mga06z11_117198_c1_114_953 272
934 3300050495 nmdc:mga04h51_2271_c1 nmdc:mga04h51_2271_c1_3525_4367 272
935 3300050496 nmdc:mga07m45_190150_c1 nmdc:mga07m45_190150_c1_191_1030 272
936 3300050496 nmdc:mga07m45_9639_c1 nmdc:mga07m45_9639_c1_1141_1983 272
937 3300050516 nmdc:mga0sz30_105332_c1 nmdc:mga0sz30_105332_c1_141_980 272
938 3300050516 nmdc:mga0sz30_15041_c1 nmdc:mga0sz30_15041_c1_595_1437 272
939 3300050516 nmdc:mga0sz30_70976_c1 nmdc:mga0sz30_70976_c1_376_1215 272
940 3300053077 Ga0495601_0023258 Ga0495601_0023258_2101_2940 272
941 3300053084 Ga0495595_0058530 Ga0495595_0058530_520_1359 272
942 3300053085 Ga0495619_0033264 Ga0495619_0033264_2187_3026 272
943 3300053085 Ga0495619_0047645 Ga0495619_0047645_876_1715 272
944 3300053093 Ga0500651_0099442 Ga0500651_0099442_225_1064 272
945 3300053104 Ga0500556_0000069 Ga0500556_0000069_24480_25319 272
946 3300053109 Ga0500569_007080 Ga0500569_007080_62_901 272
947 3300053119 Ga0500595_028448 Ga0500595_028448_25_864 272
948 3300053119 Ga0500595_059336 Ga0500595_059336_69_908 272
949 3300053130 Ga0500642_0000032 Ga0500642_0000032_35259_36098 272
950 3300053131 Ga0500652_005774 Ga0500652_005774_2915_3754 272
951 3300053134 Ga0500658_0107985 Ga0500658_0107985_295_1134 272
952 3300053139 Ga0500568_0070664 Ga0500568_0070664_26_865 272
953 3300053153 Ga0500616_0000332 Ga0500616_0000332_42782_43621 272
954 3300053156 Ga0500622_0002594 Ga0500622_0002594_54_893 272
955 iso_pu_bacteria 2600255389 2602008613 272
956 iso_pu_bacteria 2899275550 2899277767 272
957 iso_pu_bacteria 2904690495 2904693432 272
958 iso_pu_bacteria 8034962539 8034963474 272
959 iso_pu_bacteria 8056689827 8056691832 272
960 3300006844 Ga0075428_100005908 Ga0075428_1000059089 273
961 3300006846 Ga0075430_100053942 Ga0075430_1000539422 273
962 3300006847 Ga0075431_100031643 Ga0075431_1000316436 273
963 3300009147 Ga0114129_10229472 Ga0114129_102294723 273
964 3300027471 Ga0209995_1017133 Ga0209995_10171332 273
965 3300031548 Ga0307408_100000005 Ga0307408_10000000565 273
966 3300031728 Ga0316578_10031741 Ga0316578_100317412 273
967 3300031901 Ga0307406_10000463 Ga0307406_1000046311 273
968 3300035398 Ga0316574_0040978 Ga0316574_0040978_1309_2139 273
969 3300036647 Ga0316582_0009082 Ga0316582_0009082_3618_4448 273
970 3300036647 Ga0316582_0078104 Ga0316582_0078104_747_1577 273
971 3300036647 Ga0316582_0217325 Ga0316582_0217325_164_994 273
972 3300036712 Ga0316584_0260446 Ga0316584_0260446_349_1179 273
973 3300037588 Ga0316581_0040528 Ga0316581_0040528_451_1281 273
974 3300038726 Ga0400490_13794 Ga0400490_13794_1827_2657 273
975 3300038726 Ga0400490_20324 Ga0400490_20324_4004_4834 273
976 3300038726 Ga0400490_45281 Ga0400490_45281_28072_28902 273
977 3300038727 Ga0400491_16995 Ga0400491_16995_1314_2144 273
978 3300038741 Ga0400488_23323 Ga0400488_23323_5599_6429 273
979 3300038741 Ga0400488_38093 Ga0400488_38093_1096_1926 273
980 3300038742 Ga0400486_28053 Ga0400486_28053_11182_12012 273
981 3300039062 Ga0400483_027235 Ga0400483_027235_1162_1992 273
982 3300039062 Ga0400483_119201 Ga0400483_119201_960_1787 273
983 3300039062 Ga0400483_208955 Ga0400483_208955_1567_2397 273
984 3300039062 Ga0400483_259163 Ga0400483_259163_4925_5752 273
985 3300041408 Ga0439453_0001117 Ga0439453_0001117_948_1769 273
986 3300042001 Ga0439441_005120 Ga0439441_005120_337_1158 273
987 3300042003 Ga0439443_004522 Ga0439443_004522_889_1710 273
988 3300042013 Ga0439456_028952 Ga0439456_028952_49_870 273
989 3300042156 Ga0439446_0024413 Ga0439446_0024413_752_1573 273
990 3300042435 Ga0439434_0029405 Ga0439434_0029405_541_1362 273
991 3300042436 Ga0439435_0000398 Ga0439435_0000398_1178_1999 273
992 3300042437 Ga0439444_0000032 Ga0439444_0000032_6674_7495 273
993 3300050508 nmdc:mga09592_7869_c1 nmdc:mga09592_7869_c1_5732_6553 273
994 3300050509 nmdc:mga0qj67_88207_c1 nmdc:mga0qj67_88207_c1_261_1082 273
995 3300050510 nmdc:mga06r32_104072_c1 nmdc:mga06r32_104072_c1_1410_2231 273
996 iso_pu_bacteria 2885383462 2885390200 273
997 iso_pu_bacteria 8056681323 8056685047 273
998 3300005445 Ga0070708_100005534 Ga0070708_1000055349 274
999 3300005536 Ga0070697_100182558 Ga0070697_1001825582 274
1000 3300005614 Ga0068856_100203937 Ga0068856_1002039372 274
1001 3300007265 Ga0099794_10000734 Ga0099794_100007349 274
1002 3300007265 Ga0099794_10157309 Ga0099794_101573092 274
1003 3300009147 Ga0114129_10112688 Ga0114129_101126884 274
1004 3300025298 Ga0209050_1014556 Ga0209050_10145562 274
1005 3300025949 Ga0207667_10088924 Ga0207667_100889244 274
1006 3300026078 Ga0207702_10141568 Ga0207702_101415682 274
1007 3300027671 Ga0209588_1001890 Ga0209588_10018904 274
1008 3300027671 Ga0209588_1023117 Ga0209588_10231173 274
1009 3300048928 Ga0496125_0028421 Ga0496125_0028421_470_1327 274
1010 3300050491 nmdc:mga00v17_97354_c1 nmdc:mga00v17_97354_c1_71_922 274
1011 iso_pu_bacteria 2507262055 2507510102 274
1012 iso_pu_bacteria 2508501128 2509153534 274
1013 iso_pu_bacteria 2511231028 2511400835 274
1014 iso_pu_bacteria 2513237095 2513648930 274
1015 iso_pu_bacteria 2513237098 2513676463 274
1016 iso_pu_bacteria 2513237101 2513697013 274
1017 iso_pu_bacteria 2513237102 2513702056 274
1018 iso_pu_bacteria 2513237137 2513858195 274
1019 iso_pu_bacteria 2513237139 2513878039 274
1020 iso_pu_bacteria 2513237141 2513892004 274
1021 iso_pu_bacteria 2517093001 2517105160 274
1022 iso_pu_bacteria 2517572143 2517893916 274
1023 iso_pu_bacteria 2522572158 2523102996 274
1024 iso_pu_bacteria 2524023210 2524467067 274
1025 iso_pu_bacteria 2524023228 2524540685 274
1026 iso_pu_bacteria 2545555834 2545674443 274
1027 iso_pu_bacteria 2595698237 2596372892 274
1028 iso_pu_bacteria 2602042107 2603860979 274
1029 iso_pu_bacteria 2617270735 2617352561 274
1030 iso_pu_bacteria 2617270741 2617379029 274
1031 iso_pu_bacteria 2667528175 2671122907 274
1032 iso_pu_bacteria 2687453129 2687579123 274
1033 iso_pu_bacteria 2721755755 2723846457 274
1034 iso_pu_bacteria 2738541281 2738744125 274
1035 iso_pu_bacteria 2738543032 2739353355 274
1036 iso_pu_bacteria 2791355196 2793059916 274
1037 iso_pu_bacteria 2791355199 2793076882 274
1038 iso_pu_bacteria 2802429603 2805919999 274
1039 iso_pu_bacteria 2816332527 2818241666 274
1040 iso_pu_bacteria 2824617872 2824622787 274
1041 iso_pu_bacteria 2824626560 2824632380 274
1042 iso_pu_bacteria 2824635225 2824640399 274
1043 iso_pu_bacteria 2824644064 2824647388 274
1044 iso_pu_bacteria 2824671348 2824674263 274
1045 iso_pu_bacteria 2824679649 2824682548 274
1046 iso_pu_bacteria 2824687955 2824690885 274
1047 iso_pu_bacteria 2824696289 2824698541 274
1048 iso_pu_bacteria 2824714736 2824718917 274
1049 iso_pu_bacteria 2824723954 2824729421 274
1050 iso_pu_bacteria 2824732956 2824737811 274
1051 iso_pu_bacteria 2824746037 2824749969 274
1052 iso_pu_bacteria 2824773399 2824778198 274
1053 iso_pu_bacteria 2829745981 2829747716 274
1054 iso_pu_bacteria 2841941048 2841941597 274
1055 iso_pu_bacteria 2841949485 2841952387 274
1056 iso_pu_bacteria 2841966195 2841967742 274
1057 iso_pu_bacteria 2841974524 2841982094 274
1058 iso_pu_bacteria 2842038055 2842038179 274
1059 iso_pu_bacteria 2842045827 2842048875 274
1060 iso_pu_bacteria 2842698319 2842699592 274
1061 iso_pu_bacteria 2847930680 2847934449 274
1062 iso_pu_bacteria 2847939898 2847945044 274
1063 iso_pu_bacteria 2849076700 2849080760 274
1064 iso_pu_bacteria 2857509624 2857509875 274
1065 iso_pu_bacteria 2857524615 2857528892 274
1066 iso_pu_bacteria 2861691609 2861694134 274
1067 iso_pu_bacteria 2874604998 2874610577 274
1068 iso_pu_bacteria 2874612657 2874618148 274
1069 iso_pu_bacteria 2874620515 2874623141 274
1070 iso_pu_bacteria 2874628541 2874636119 274
1071 iso_pu_bacteria 2876808645 2876810064 274
1072 iso_pu_bacteria 2879083081 2879089642 274
1073 iso_pu_bacteria 2879110137 2879118635 274
1074 iso_pu_bacteria 2881364244 2881367673 274
1075 iso_pu_bacteria 2881665667 2881670897 274
1076 iso_pu_bacteria 2888378607 2888382383 274
1077 iso_pu_bacteria 2889033259 2889039028 274
1078 iso_pu_bacteria 2893066018 2893069089 274
1079 iso_pu_bacteria 2903748898 2903751923 274
1080 iso_pu_bacteria 2903768456 2903771706 274
1081 iso_pu_bacteria 2904666416 2904669961 274
1082 iso_pu_bacteria 2904699407 2904700665 274
1083 iso_pu_bacteria 2906610324 2906610806 274
1084 iso_pu_bacteria 2906626472 2906634817 274
1085 iso_pu_bacteria 2906635258 2906635966 274
1086 iso_pu_bacteria 2906643746 2906646680 274
1087 iso_pu_bacteria 2906660503 2906663936 274
1088 iso_pu_bacteria 2908756301 2908761757 274
1089 iso_pu_bacteria 2908775508 2908778630 274
1090 iso_pu_bacteria 2919073203 2919079316 274
1091 iso_pu_bacteria 2922361189 2922362270 274
1092 iso_pu_bacteria 2922386360 2922387977 274
1093 iso_pu_bacteria 2922393267 2922394903 274
1094 iso_pu_bacteria 2922425934 2922428521 274
1095 iso_pu_bacteria 2928125067 2928125749 274
1096 iso_pu_bacteria 2935630451 2935634501 274
1097 iso_pu_bacteria 2935908558 2935911713 274
1098 iso_pu_bacteria 2935916978 2935919368 274
1099 iso_pu_bacteria 2935926038 2935928742 274
1100 iso_pu_bacteria 2935934488 2935938387 274
1101 iso_pu_bacteria 2935942939 2935945721 274
1102 iso_pu_bacteria 2935951376 2935954672 274
1103 iso_pu_bacteria 2935967501 2935970559 274
1104 iso_pu_bacteria 2941507105 2941508987 274
1105 iso_pu_bacteria 2941515067 2941516816 274
1106 iso_pu_bacteria 2941523033 2941525089 274
1107 iso_pu_bacteria 3003665799 3003669388 274
1108 iso_pu_bacteria 3005474847 3005478649 274
1109 iso_pu_bacteria 3005483717 3005487861 274
1110 iso_pu_bacteria 3005587118 3005589360 274
1111 iso_pu_bacteria 3005594810 3005597396 274
1112 iso_pu_bacteria 3005710791 3005713421 274
1113 iso_pu_bacteria 641522639 641644954 274
1114 iso_pu_bacteria 8006933436 8006942715 274
1115 iso_pu_bacteria 8006964411 8006964844 274
1116 iso_pu_bacteria 8006973647 8006982438 274
1117 iso_pu_bacteria 8006984368 8006991760 274
1118 iso_pu_bacteria 8006994254 8006995579 274
1119 iso_pu_bacteria 8016583857 8016590758 274
1120 iso_pu_bacteria 8019555841 8019558476 274
1121 iso_pu_bacteria 8019565922 8019566821 274
1122 iso_pu_bacteria 8019687851 8019688359 274
1123 iso_pu_bacteria 8054002106 8054005746 274
1124 iso_pu_bacteria 8056673599 8056676374 274
1125 3300005577 Ga0068857_100071409 Ga0068857_1000714093 275
1126 3300006847 Ga0075431_100001293 Ga0075431_10000129311 275
1127 3300006880 Ga0075429_100051162 Ga0075429_1000511622 275
1128 3300039438 Ga0436360_0260696 Ga0436360_0260696_441_1274 275
1129 3300042115 Ga0450911_000717 Ga0450911_000717_8341_9198 275
1130 3300048925 Ga0496122_0017391 Ga0496122_0017391_483_1346 275
1131 3300048926 Ga0496123_0004961 Ga0496123_0004961_11365_12228 275
1132 3300049743 Ga0501081_0124671 Ga0501081_0124671_434_1267 275
1133 3300049822 Ga0501035_0352635 Ga0501035_0352635_378_1211 275
1134 3300050508 nmdc:mga09592_41983_c1 nmdc:mga09592_41983_c1_2348_3181 275
1135 3300050510 nmdc:mga06r32_201_c1 nmdc:mga06r32_201_c1_16662_17495 275
1136 3300054114 Ga0501084_0280985 Ga0501084_0280985_514_1347 275
1137 3300060353 Ga0501082_0338240 Ga0501082_0338240_79_912 275
1138 iso_pu_bacteria 2508501009 2508544104 275
1139 iso_pu_bacteria 2508501042 2508697956 275
1140 iso_pu_bacteria 2513237092 2513628336 275
1141 iso_pu_bacteria 2513237161 2514012664 275
1142 iso_pu_bacteria 2599185292 2599907642 275
1143 iso_pu_bacteria 2643221569 2643860941 275
1144 iso_pu_bacteria 2643221594 2643981186 275
1145 iso_pu_bacteria 2643221621 2644124240 275
1146 iso_pu_bacteria 2808606395 2809035035 275
1147 iso_pu_bacteria 2828305725 2828308235 275
1148 iso_pu_bacteria 2838122688 2838127450 275
1149 iso_pu_bacteria 2841957949 2841959408 275
1150 iso_pu_bacteria 2841983080 2841986411 275
1151 iso_pu_bacteria 2857537821 2857540374 275
1152 iso_pu_bacteria 2857542790 2857547414 275
1153 iso_pu_bacteria 2885366525 2885368858 275
1154 iso_pu_bacteria 2888388044 2888388309 275
1155 iso_pu_bacteria 2917699015 2917705400 275
1156 iso_pu_bacteria 2932794094 2932797248 275
1157 iso_pu_bacteria 2932801729 2932804867 275
1158 iso_pu_bacteria 2935608549 2935610992 275
1159 iso_pu_bacteria 2935648319 2935648424 275
1160 iso_pu_bacteria 2935656913 2935657588 275
1161 iso_pu_bacteria 2935819856 2935820477 275
1162 iso_pu_bacteria 2935847175 2935849514 275
1163 iso_pu_bacteria 2935883170 2935884897 275
1164 iso_pu_bacteria 2935959822 2935963272 275
1165 iso_pu_bacteria 2935984226 2935987783 275
1166 iso_pu_bacteria 2936011229 2936011334 275
1167 iso_pu_bacteria 2936019824 2936019929 275
1168 iso_pu_bacteria 2936028420 2936028525 275
1169 iso_pu_bacteria 2936046547 2936046652 275
1170 iso_pu_bacteria 2936055302 2936062345 275
1171 iso_pu_bacteria 2941479691 2941484554 275
1172 iso_pu_bacteria 8016630954 8016632661 275
1173 iso_pu_bacteria 8055225921 8055228326 275
1174 3300014326 Ga0157380_10554798 Ga0157380_105547982 276
1175 3300048919 Ga0496116_0006130 Ga0496116_0006130_2024_2857 276
1176 3300048924 Ga0496121_0098517 Ga0496121_0098517_496_1329 276
1177 3300048925 Ga0496122_0000214 Ga0496122_0000214_109266_110099 276
1178 3300048926 Ga0496123_0000187 Ga0496123_0000187_120913_121746 276
1179 3300048927 Ga0496124_0078550 Ga0496124_0078550_225_1058 276
1180 3300048927 Ga0496124_0378292 Ga0496124_0378292_46_879 276
1181 3300048928 Ga0496125_0028136 Ga0496125_0028136_1739_2572 276
1182 3300053156 Ga0500622_0002230 Ga0500622_0002230_13069_14004 276
1183 iso_pu_bacteria 2842694124 2842697015 276
1184 iso_pu_bacteria 2894772417 2894775122 276
1185 3300003203 JGI25406J46586_10003389 JGI25406J46586_100033895 277
1186 3300003203 JGI25406J46586_10003524 JGI25406J46586_100035247 277
1187 3300003215 JGI25153J46596_10003283 JGI25153J46596_100032833 277
1188 3300003215 JGI25153J46596_10006877 JGI25153J46596_100068775 277
1189 3300003354 JGI25160J50197_1003455 JGI25160J50197_10034552 277
1190 3300003659 JGI25404J52841_10003095 JGI25404J52841_100030953 277
1191 3300004625 Ga0055543_1002979 Ga0055543_10029794 277
1192 3300005329 Ga0070683_100248408 Ga0070683_1002484082 277
1193 3300005330 Ga0070690_100265153 Ga0070690_1002651532 277
1194 3300005334 Ga0068869_100207306 Ga0068869_1002073062 277
1195 3300005339 Ga0070660_100325719 Ga0070660_1003257191 277
1196 3300005340 Ga0070689_100165875 Ga0070689_1001658752 277
1197 3300005341 Ga0070691_10045042 Ga0070691_100450422 277
1198 3300005347 Ga0070668_100132137 Ga0070668_1001321372 277
1199 3300005353 Ga0070669_100233525 Ga0070669_1002335252 277
1200 3300005354 Ga0070675_100256412 Ga0070675_1002564121 277
1201 3300005356 Ga0070674_100218180 Ga0070674_1002181802 277
1202 3300005366 Ga0070659_100473553 Ga0070659_1004735531 277
1203 3300005367 Ga0070667_100446422 Ga0070667_1004464221 277
1204 3300005406 Ga0070703_10092812 Ga0070703_100928121 277
1205 3300005434 Ga0070709_10001642 Ga0070709_100016425 277
1206 3300005434 Ga0070709_10039766 Ga0070709_100397662 277
1207 3300005435 Ga0070714_100013820 Ga0070714_1000138205 277
1208 3300005435 Ga0070714_100459311 Ga0070714_1004593112 277
1209 3300005437 Ga0070710_10003655 Ga0070710_100036553 277
1210 3300005439 Ga0070711_100007426 Ga0070711_1000074268 277
1211 3300005440 Ga0070705_100021640 Ga0070705_1000216402 277
1212 3300005441 Ga0070700_100195026 Ga0070700_1001950261 277
1213 3300005444 Ga0070694_100099262 Ga0070694_1000992622 277
1214 3300005455 Ga0070663_100212417 Ga0070663_1002124172 277
1215 3300005456 Ga0070678_100098017 Ga0070678_1000980172 277
1216 3300005543 Ga0070672_100453596 Ga0070672_1004535962 277
1217 3300005545 Ga0070695_100006466 Ga0070695_1000064668 277
1218 3300005545 Ga0070695_100059478 Ga0070695_1000594782 277
1219 3300005546 Ga0070696_100054561 Ga0070696_1000545613 277
1220 3300005548 Ga0070665_100404253 Ga0070665_1004042532 277
1221 3300005549 Ga0070704_100027019 Ga0070704_1000270195 277
1222 3300005549 Ga0070704_100255345 Ga0070704_1002553452 277
1223 3300005618 Ga0068864_100127422 Ga0068864_1001274222 277
1224 3300005719 Ga0068861_100531127 Ga0068861_1005311271 277
1225 3300005840 Ga0068870_10089405 Ga0068870_100894051 277
1226 3300005937 Ga0081455_10005811 Ga0081455_1000581113 277
1227 3300005937 Ga0081455_10081940 Ga0081455_100819402 277
1228 3300005937 Ga0081455_10121092 Ga0081455_101210922 277
1229 3300005983 Ga0081540_1011713 Ga0081540_10117131 277
1230 3300005985 Ga0081539_10000747 Ga0081539_1000074775 277
1231 3300005985 Ga0081539_10039464 Ga0081539_100394642 277
1232 3300006028 Ga0070717_10018588 Ga0070717_100185883 277
1233 3300006038 Ga0075365_10152046 Ga0075365_101520462 277
1234 3300006038 Ga0075365_10170351 Ga0075365_101703512 277
1235 3300006038 Ga0075365_10237258 Ga0075365_102372582 277
1236 3300006042 Ga0075368_10028947 Ga0075368_100289471 277
1237 3300006051 Ga0075364_10117878 Ga0075364_101178782 277
1238 3300006163 Ga0070715_10000320 Ga0070715_100003209 277
1239 3300006173 Ga0070716_100001867 Ga0070716_1000018678 277
1240 3300006175 Ga0070712_100001878 Ga0070712_10000187814 277
1241 3300006175 Ga0070712_100028750 Ga0070712_1000287503 277
1242 3300006177 Ga0075362_10184085 Ga0075362_101840852 277
1243 3300006237 Ga0097621_100408495 Ga0097621_1004084952 277
1244 3300006844 Ga0075428_100009742 Ga0075428_1000097422 277
1245 3300006844 Ga0075428_100092828 Ga0075428_1000928284 277
1246 3300006844 Ga0075428_100109159 Ga0075428_1001091593 277
1247 3300006844 Ga0075428_100118910 Ga0075428_1001189104 277
1248 3300006844 Ga0075428_100189864 Ga0075428_1001898642 277
1249 3300006846 Ga0075430_100093588 Ga0075430_1000935882 277
1250 3300006846 Ga0075430_100100706 Ga0075430_1001007061 277
1251 3300006847 Ga0075431_100170055 Ga0075431_1001700552 277
1252 3300006847 Ga0075431_100306893 Ga0075431_1003068932 277
1253 3300006852 Ga0075433_10068973 Ga0075433_100689732 277
1254 3300006871 Ga0075434_100004709 Ga0075434_1000047093 277
1255 3300006880 Ga0075429_100080528 Ga0075429_1000805284 277
1256 3300006880 Ga0075429_100164325 Ga0075429_1001643251 277
1257 3300006881 Ga0068865_100012565 Ga0068865_1000125651 277
1258 3300007788 Ga0099795_10022863 Ga0099795_100228632 277
1259 3300009094 Ga0111539_10025207 Ga0111539_100252075 277
1260 3300009094 Ga0111539_10033030 Ga0111539_100330304 277
1261 3300009094 Ga0111539_10137087 Ga0111539_101370872 277
1262 3300009094 Ga0111539_10803545 Ga0111539_108035452 277
1263 3300009098 Ga0105245_10108434 Ga0105245_101084342 277
1264 3300009098 Ga0105245_10233393 Ga0105245_102333932 277
1265 3300009147 Ga0114129_10207383 Ga0114129_102073832 277
1266 3300009177 Ga0105248_10991186 Ga0105248_109911861 277
1267 3300009553 Ga0105249_10369412 Ga0105249_103694122 277
1268 3300013296 Ga0157374_10025104 Ga0157374_100251042 277
1269 3300013308 Ga0157375_10046832 Ga0157375_100468325 277
1270 3300014325 Ga0163163_10914649 Ga0163163_109146491 277
1271 3300014326 Ga0157380_10129944 Ga0157380_101299442 277
1272 3300014969 Ga0157376_10002959 Ga0157376_100029599 277
1273 3300017792 Ga0163161_10055080 Ga0163161_100550802 277
1274 3300017792 Ga0163161_10124347 Ga0163161_101243472 277
1275 3300025295 Ga0209564_1000164 Ga0209564_100016462 277
1276 3300025295 Ga0209564_1025658 Ga0209564_10256582 277
1277 3300025297 Ga0209758_1000407 Ga0209758_100040760 277
1278 3300025297 Ga0209758_1001983 Ga0209758_10019833 277
1279 3300025297 Ga0209758_1034572 Ga0209758_10345722 277
1280 3300025299 Ga0209256_1006969 Ga0209256_10069695 277
1281 3300025302 Ga0207426_1001388 Ga0207426_10013887 277
1282 3300025304 Ga0209257_1001136 Ga0209257_100113628 277
1283 3300025885 Ga0207653_10085811 Ga0207653_100858112 277
1284 3300025898 Ga0207692_10008475 Ga0207692_100084753 277
1285 3300025905 Ga0207685_10018550 Ga0207685_100185501 277
1286 3300025906 Ga0207699_10100942 Ga0207699_101009421 277
1287 3300025907 Ga0207645_10108673 Ga0207645_101086732 277
1288 3300025908 Ga0207643_10048218 Ga0207643_100482183 277
1289 3300025915 Ga0207693_10001385 Ga0207693_100013857 277
1290 3300025915 Ga0207693_10011746 Ga0207693_100117466 277
1291 3300025916 Ga0207663_10000136 Ga0207663_100001362 277
1292 3300025918 Ga0207662_10072909 Ga0207662_100729092 277
1293 3300025919 Ga0207657_10095571 Ga0207657_100955713 277
1294 3300025927 Ga0207687_10171833 Ga0207687_101718332 277
1295 3300025928 Ga0207700_10069437 Ga0207700_100694374 277
1296 3300025929 Ga0207664_10013549 Ga0207664_100135496 277
1297 3300025929 Ga0207664_10181276 Ga0207664_101812762 277
1298 3300025933 Ga0207706_10070045 Ga0207706_100700454 277
1299 3300025935 Ga0207709_10099344 Ga0207709_100993441 277
1300 3300025935 Ga0207709_10174095 Ga0207709_101740952 277
1301 3300025936 Ga0207670_10116122 Ga0207670_101161222 277
1302 3300025936 Ga0207670_10268001 Ga0207670_102680012 277
1303 3300025937 Ga0207669_10290104 Ga0207669_102901042 277
1304 3300025937 Ga0207669_10354712 Ga0207669_103547122 277
1305 3300025939 Ga0207665_10000064 Ga0207665_1000006468 277
1306 3300025940 Ga0207691_10061618 Ga0207691_100616181 277
1307 3300025940 Ga0207691_10457121 Ga0207691_104571211 277
1308 3300025944 Ga0207661_10169449 Ga0207661_101694492 277
1309 3300025981 Ga0207640_10165095 Ga0207640_101650951 277
1310 3300025986 Ga0207658_10357504 Ga0207658_103575041 277
1311 3300026035 Ga0207703_10242139 Ga0207703_102421392 277
1312 3300026067 Ga0207678_10148846 Ga0207678_101488462 277
1313 3300026075 Ga0207708_10026254 Ga0207708_100262542 277
1314 3300026089 Ga0207648_10006999 Ga0207648_100069997 277
1315 3300026121 Ga0207683_10030901 Ga0207683_100309016 277
1316 3300026121 Ga0207683_10105063 Ga0207683_101050632 277
1317 3300026121 Ga0207683_10249155 Ga0207683_102491552 277
1318 3300027907 Ga0207428_10028914 Ga0207428_100289144 277
1319 3300027907 Ga0207428_10030850 Ga0207428_100308503 277
1320 3300028380 Ga0268265_10178279 Ga0268265_101782791 277
1321 3300028380 Ga0268265_10239028 Ga0268265_102390282 277
1322 3300028794 Ga0307515_10008473 Ga0307515_1000847316 277
1323 3300031548 Ga0307408_100289875 Ga0307408_1002898752 277
1324 3300031911 Ga0307412_10014711 Ga0307412_100147117 277
1325 3300031995 Ga0307409_100136381 Ga0307409_1001363812 277
1326 3300032002 Ga0307416_100166125 Ga0307416_1001661253 277
1327 3300032002 Ga0307416_100166684 Ga0307416_1001666842 277
1328 3300032126 Ga0307415_100090459 Ga0307415_1000904592 277
1329 3300033442 Ga0315911_1000011 Ga0315911_1000011105 277
1330 3300035089 Ga0373944_0011346 Ga0373944_0011346_1274_2113 277
1331 3300035111 Ga0373923_0010861 Ga0373923_0010861_1164_2003 277
1332 3300035113 Ga0373936_0035174 Ga0373936_0035174_1019_1858 277
1333 3300035116 Ga0373945_0022797 Ga0373945_0022797_13_852 277
1334 3300035170 Ga0373943_0048743 Ga0373943_0048743_353_1192 277
1335 3300035172 Ga0373955_0105315 Ga0373955_0105315_764_1603 277
1336 3300035207 Ga0373942_0036963 Ga0373942_0036963_131_970 277
1337 3300035242 Ga0373962_0019931 Ga0373962_0019931_824_1666 277
1338 3300035691 Ga0373931_0024711 Ga0373931_0024711_1991_2833 277
1339 3300035691 Ga0373931_0311109 Ga0373931_0311109_39_878 277
1340 3300035692 Ga0373935_0009288 Ga0373935_0009288_4323_5162 277
1341 3300035695 Ga0373927_0034359 Ga0373927_0034359_596_1435 277
1342 3300035695 Ga0373927_0274979 Ga0373927_0274979_257_1096 277
1343 3300035725 Ga0373947_0010653 Ga0373947_0010653_384_1223 277
1344 3300036401 Ga0373937_0239485 Ga0373937_0239485_222_1061 277
1345 3300037068 Ga0373925_0016899 Ga0373925_0016899_1511_2350 277
1346 3300037466 Ga0395898_0125625 Ga0395898_0125625_206_1108 277
1347 3300037471 Ga0395905_0039879 Ga0395905_0039879_1462_2364 277
1348 3300037471 Ga0395905_0535264 Ga0395905_0535264_78_917 277
1349 3300039437 Ga0436365_0642532 Ga0436365_0642532_351_1190 277
1350 3300039450 Ga0436363_1394953 Ga0436363_1394953_127_963 277
1351 3300041413 Ga0439465_0042200 Ga0439465_0042200_19_861 277
1352 3300044658 Ga0466972_0000371 Ga0466972_0000371_9841_10680 277
1353 3300044842 Ga0466957_0256682 Ga0466957_0256682_83_922 277
1354 3300045836 Ga0466958_0186496 Ga0466958_0186496_104_943 277
1355 3300045976 Ga0466967_0144847 Ga0466967_0144847_1204_2043 277
1356 3300045976 Ga0466967_0388207 Ga0466967_0388207_165_1004 277
1357 3300046460 Ga0495638_0001295 Ga0495638_0001295_11499_12338 277
1358 3300046460 Ga0495638_0029593 Ga0495638_0029593_1692_2531 277
1359 3300046472 Ga0495580_0198352 Ga0495580_0198352_385_1224 277
1360 3300046474 Ga0495605_0053460 Ga0495605_0053460_954_1793 277
1361 3300046475 Ga0495639_0005177 Ga0495639_0005177_2313_3152 277
1362 3300046477 Ga0495664_0003641 Ga0495664_0003641_6194_7033 277
1363 3300046492 Ga0495585_0113489 Ga0495585_0113489_185_1024 277
1364 3300046499 Ga0495594_0094237 Ga0495594_0094237_480_1319 277
1365 3300046515 Ga0495620_0051357 Ga0495620_0051357_697_1536 277
1366 3300046516 Ga0495628_0232882 Ga0495628_0232882_67_906 277
1367 3300046524 Ga0495648_0033902 Ga0495648_0033902_833_1795 277
1368 3300046524 Ga0495648_0102821 Ga0495648_0102821_288_1130 277
1369 3300046530 Ga0495654_0053522 Ga0495654_0053522_332_1171 277
1370 3300046664 Ga0495659_0009843 Ga0495659_0009843_938_1774 277
1371 3300046680 Ga0495646_0050016 Ga0495646_0050016_711_1550 277
1372 3300046683 Ga0495658_0208822 Ga0495658_0208822_50_889 277
1373 3300046684 Ga0495669_0059993 Ga0495669_0059993_647_1486 277
1374 3300046689 Ga0495613_0205691 Ga0495613_0205691_286_1125 277
1375 3300046694 Ga0495649_0212609 Ga0495649_0212609_149_991 277
1376 3300047315 Ga0495581_0005368 Ga0495581_0005368_2199_3038 277
1377 3300047317 Ga0495604_0266501 Ga0495604_0266501_144_983 277
1378 3300047319 Ga0495674_0034030 Ga0495674_0034030_1317_2156 277
1379 3300047320 Ga0495672_0200710 Ga0495672_0200710_127_966 277
1380 3300047673 Ga0495593_0077190 Ga0495593_0077190_874_1713 277
1381 3300048903 Ga0496100_0040451 Ga0496100_0040451_1392_2231 277
1382 3300048904 Ga0496101_0051847 Ga0496101_0051847_282_1121 277
1383 3300048905 Ga0496102_0002717 Ga0496102_0002717_33_872 277
1384 3300048907 Ga0496104_0002941 Ga0496104_0002941_12972_13811 277
1385 3300048907 Ga0496104_0005997 Ga0496104_0005997_7733_8572 277
1386 3300048908 Ga0496105_0005733 Ga0496105_0005733_454_1293 277
1387 3300048909 Ga0496106_0559315 Ga0496106_0559315_22_861 277
1388 3300048910 Ga0496107_0001922 Ga0496107_0001922_4250_5089 277
1389 3300048910 Ga0496107_0195648 Ga0496107_0195648_353_1192 277
1390 3300048913 Ga0496110_0000889 Ga0496110_0000889_4992_5831 277
1391 3300048913 Ga0496110_0045689 Ga0496110_0045689_2617_3456 277
1392 3300048913 Ga0496110_0045760 Ga0496110_0045760_1488_2327 277
1393 3300048914 Ga0496111_0116665 Ga0496111_0116665_366_1205 277
1394 3300048915 Ga0496112_0000117 Ga0496112_0000117_37010_37849 277
1395 3300048915 Ga0496112_0024359 Ga0496112_0024359_4785_5624 277
1396 3300048915 Ga0496112_0072710 Ga0496112_0072710_1536_2375 277
1397 3300048915 Ga0496112_0094153 Ga0496112_0094153_506_1345 277
1398 3300048915 Ga0496112_0192936 Ga0496112_0192936_79_918 277
1399 3300048916 Ga0496113_0010717 Ga0496113_0010717_4930_5769 277
1400 3300048917 Ga0496114_0037479 Ga0496114_0037479_814_1653 277
1401 3300048917 Ga0496114_0230250 Ga0496114_0230250_605_1444 277
1402 3300048918 Ga0496115_0002584 Ga0496115_0002584_2178_3017 277
1403 3300048923 Ga0496120_0054973 Ga0496120_0054973_53_892 277
1404 3300048924 Ga0496121_0001006 Ga0496121_0001006_37172_38011 277
1405 3300048925 Ga0496122_0124378 Ga0496122_0124378_80_919 277
1406 3300048928 Ga0496125_0000063 Ga0496125_0000063_31314_32153 277
1407 3300048928 Ga0496125_0005173 Ga0496125_0005173_11185_12024 277
1408 3300048928 Ga0496125_0039397 Ga0496125_0039397_316_1155 277
1409 3300048928 Ga0496125_0064305 Ga0496125_0064305_169_1008 277
1410 3300048929 Ga0496126_0172406 Ga0496126_0172406_393_1232 277
1411 3300048929 Ga0496126_0295942 Ga0496126_0295942_168_1007 277
1412 3300050489 nmdc:mga03683_134761_c1 nmdc:mga03683_134761_c1_19_858 277
1413 3300050491 nmdc:mga00v17_240491_c1 nmdc:mga00v17_240491_c1_92_931 277
1414 3300050492 nmdc:mga0yw44_190057_c1 nmdc:mga0yw44_190057_c1_403_1242 277
1415 3300050492 nmdc:mga0yw44_19046_c1 nmdc:mga0yw44_19046_c1_467_1309 277
1416 3300050494 nmdc:mga06z11_22668_c1 nmdc:mga06z11_22668_c1_24_863 277
1417 3300050495 nmdc:mga04h51_4146_c1 nmdc:mga04h51_4146_c1_2542_3381 277
1418 3300050496 nmdc:mga07m45_128110_c1 nmdc:mga07m45_128110_c1_190_1029 277
1419 3300050507 nmdc:mga05p37_69744_c1 nmdc:mga05p37_69744_c1_1659_2501 277
1420 3300050508 nmdc:mga09592_145719_c1 nmdc:mga09592_145719_c1_712_1554 277
1421 3300050508 nmdc:mga09592_178482_c1 nmdc:mga09592_178482_c1_560_1396 277
1422 3300050509 nmdc:mga0qj67_141673_c1 nmdc:mga0qj67_141673_c1_906_1748 277
1423 3300050509 nmdc:mga0qj67_48176_c1 nmdc:mga0qj67_48176_c1_978_1814 277
1424 3300050510 nmdc:mga06r32_109575_c1 nmdc:mga06r32_109575_c1_469_1311 277
1425 3300050510 nmdc:mga06r32_541381_c1 nmdc:mga06r32_541381_c1_140_979 277
1426 3300050511 nmdc:mga08y16_36005_c1 nmdc:mga08y16_36005_c1_1674_2513 277
1427 3300050511 nmdc:mga08y16_514132_c1 nmdc:mga08y16_514132_c1_255_1094 277
1428 3300050511 nmdc:mga08y16_57115_c1 nmdc:mga08y16_57115_c1_1085_1927 277
1429 3300050511 nmdc:mga08y16_62145_c1 nmdc:mga08y16_62145_c1_700_1542 277
1430 3300050511 nmdc:mga08y16_622724_c1 nmdc:mga08y16_622724_c1_112_951 277
1431 3300050512 nmdc:mga0n895_4878_c1 nmdc:mga0n895_4878_c1_1532_2371 277
1432 3300050515 nmdc:mga0a205_1877_c1 nmdc:mga0a205_1877_c1_10966_11805 277
1433 3300050515 nmdc:mga0a205_30042_c1 nmdc:mga0a205_30042_c1_530_1372 277
1434 3300053077 Ga0495601_0241353 Ga0495601_0241353_158_997 277
1435 3300053086 Ga0500578_0084710 Ga0500578_0084710_1047_1886 277
1436 3300053087 Ga0500643_000019 Ga0500643_000019_164680_165522 277
1437 3300053094 Ga0500566_0001407 Ga0500566_0001407_13191_14030 277
1438 3300053094 Ga0500566_0017963 Ga0500566_0017963_663_1502 277
1439 3300053096 Ga0500641_0007284 Ga0500641_0007284_809_1648 277
1440 3300053096 Ga0500641_0015643 Ga0500641_0015643_1303_2142 277
1441 3300053096 Ga0500641_0044214 Ga0500641_0044214_74_913 277
1442 3300053102 Ga0500554_003583 Ga0500554_003583_1075_1914 277
1443 3300053103 Ga0500555_004780 Ga0500555_004780_1224_2066 277
1444 3300053104 Ga0500556_0081680 Ga0500556_0081680_350_1189 277
1445 3300053105 Ga0500557_000039 Ga0500557_000039_38774_39613 277
1446 3300053109 Ga0500569_009038 Ga0500569_009038_751_1590 277
1447 3300053119 Ga0500595_008228 Ga0500595_008228_854_1693 277
1448 3300053119 Ga0500595_048130 Ga0500595_048130_53_892 277
1449 3300053130 Ga0500642_0000285 Ga0500642_0000285_4291_5130 277
1450 3300053134 Ga0500658_0029431 Ga0500658_0029431_604_1443 277
1451 3300053136 Ga0500559_0020758 Ga0500559_0020758_1219_2058 277
1452 3300053139 Ga0500568_0004264 Ga0500568_0004264_3878_4720 277
1453 3300053139 Ga0500568_0083281 Ga0500568_0083281_190_1029 277
1454 3300053145 Ga0500586_001308 Ga0500586_001308_2572_3411 277
1455 3300053151 Ga0500604_0024805 Ga0500604_0024805_868_1707 277
1456 3300053151 Ga0500604_0031788 Ga0500604_0031788_296_1135 277
1457 3300053151 Ga0500604_0052567 Ga0500604_0052567_314_1156 277
1458 3300053156 Ga0500622_0033061 Ga0500622_0033061_888_1730 277
1459 3300053158 Ga0500627_0051009 Ga0500627_0051009_913_1752 277
1460 3300053162 Ga0500638_031056 Ga0500638_031056_1090_1929 277
1461 3300053177 Ga0500636_0000313 Ga0500636_0000313_4702_5544 277
1462 3300053177 Ga0500636_0145360 Ga0500636_0145360_417_1256 277
1463 3300053178 Ga0500637_0000655 Ga0500637_0000655_10004_10843 277
1464 3300053737 Ga0500601_000542 Ga0500601_000542_53_895 277
1465 iso_pu_bacteria 2513237087 2513592132 277
1466 iso_pu_bacteria 2929199973 2929202433 277
1467 iso_pu_bacteria 8055909800 8055915835 277
1468 3300013102 Ga0157371_10056102 Ga0157371_100561023 278
1469 3300025292 Ga0209676_1002143 Ga0209676_10021435 278
1470 3300025298 Ga0209050_1000925 Ga0209050_10009257 278
1471 3300025303 Ga0209051_1009022 Ga0209051_10090227 278
1472 3300027312 Ga0209371_1023377 Ga0209371_10233771 278
1473 3300028794 Ga0307515_10062205 Ga0307515_100622056 278
1474 3300030500 Ga0268256_1026489 Ga0268256_10264892 278
1475 3300031456 Ga0307513_10004235 Ga0307513_100042359 278
1476 3300044712 Ga0453684_0005314 Ga0453684_0005314_17301_18143 278
1477 3300044712 Ga0453684_0045710 Ga0453684_0045710_1864_2706 278
1478 3300044712 Ga0453684_0609261 Ga0453684_0609261_141_1019 278
1479 3300045051 Ga0451576_0132049 Ga0451576_0132049_964_1806 278
1480 3300048919 Ga0496116_0049570 Ga0496116_0049570_535_1377 278
1481 3300048921 Ga0496118_0100525 Ga0496118_0100525_257_1099 278
1482 3300048922 Ga0496119_0016661 Ga0496119_0016661_524_1366 278
1483 3300048923 Ga0496120_0020029 Ga0496120_0020029_107_949 278
1484 3300048924 Ga0496121_0000094 Ga0496121_0000094_199469_200311 278
1485 3300048924 Ga0496121_0167519 Ga0496121_0167519_202_1044 278
1486 3300048927 Ga0496124_0000004 Ga0496124_0000004_904480_905322 278
1487 3300048927 Ga0496124_0069590 Ga0496124_0069590_130_972 278
1488 3300048928 Ga0496125_0000363 Ga0496125_0000363_4695_5537 278
1489 3300050491 nmdc:mga00v17_101419_c1 nmdc:mga00v17_101419_c1_833_1675 278
1490 3300050491 nmdc:mga00v17_6544_c1 nmdc:mga00v17_6544_c1_1797_2639 278
1491 iso_pu_bacteria 2521172590 2521559257 278
1492 iso_pu_bacteria 2808606386 2808981295 278
1493 iso_pu_bacteria 2808606415 2809128881 278
1494 iso_pu_bacteria 2808606419 2809148502 278
1495 iso_pu_bacteria 2818991449 2819615762 278
1496 iso_pu_bacteria 2821131069 2821134903 278
1497 iso_pu_bacteria 2852618963 2852621036 278
1498 iso_pu_bacteria 2857553236 2857558181 278
1499 iso_pu_bacteria 2904439833 2904443634 278
1500 iso_pu_bacteria 2904530477 2904532551 278
1501 iso_pu_bacteria 2904584206 2904585020 278
1502 iso_pu_bacteria 2904589729 2904593369 278
1503 iso_pu_bacteria 2904601388 2904605563 278
1504 iso_pu_bacteria 2919079590 2919081336 278
1505 3300003792 Ga0055540_1002994 Ga0055540_10029945 279
1506 3300005295 Ga0065707_10014575 Ga0065707_100145752 279
1507 3300005340 Ga0070689_100136116 Ga0070689_1001361162 279
1508 3300005444 Ga0070694_100277030 Ga0070694_1002770301 279
1509 3300005937 Ga0081455_10258385 Ga0081455_102583852 279
1510 3300006186 Ga0075369_10013732 Ga0075369_100137323 279
1511 3300006844 Ga0075428_100000103 Ga0075428_10000010314 279
1512 3300006846 Ga0075430_100120620 Ga0075430_1001206202 279
1513 3300006846 Ga0075430_100365116 Ga0075430_1003651162 279
1514 3300006847 Ga0075431_100063577 Ga0075431_1000635772 279
1515 3300006880 Ga0075429_100095420 Ga0075429_1000954202 279
1516 3300009094 Ga0111539_10005030 Ga0111539_1000503012 279
1517 3300009094 Ga0111539_10162201 Ga0111539_101622012 279
1518 3300009147 Ga0114129_10048974 Ga0114129_100489742 279
1519 3300025273 Ga0209673_1014952 Ga0209673_10149522 279
1520 3300025303 Ga0209051_1000059 Ga0209051_1000059172 279
1521 3300025304 Ga0209257_1000022 Ga0209257_1000022228 279
1522 3300027543 Ga0209999_1000035 Ga0209999_10000358 279
1523 3300027665 Ga0209983_1007011 Ga0209983_10070112 279
1524 3300027682 Ga0209971_1012094 Ga0209971_10120942 279
1525 3300027876 Ga0209974_10003197 Ga0209974_100031976 279
1526 3300031251 Ga0265327_10063988 Ga0265327_100639882 279
1527 3300031456 Ga0307513_10069332 Ga0307513_100693322 279
1528 3300031691 Ga0316579_10007507 Ga0316579_100075074 279
1529 3300031852 Ga0307410_10319488 Ga0307410_103194882 279
1530 3300031903 Ga0307407_10111539 Ga0307407_101115392 279
1531 3300031911 Ga0307412_10238555 Ga0307412_102385552 279
1532 3300032002 Ga0307416_100220569 Ga0307416_1002205692 279
1533 3300032005 Ga0307411_10116554 Ga0307411_101165542 279
1534 3300032126 Ga0307415_100191004 Ga0307415_1001910042 279
1535 3300035090 Ga0373949_0016585 Ga0373949_0016585_360_1202 279
1536 3300035112 Ga0373932_0002652 Ga0373932_0002652_2145_2987 279
1537 3300035241 Ga0373961_0006253 Ga0373961_0006253_926_1768 279
1538 3300035242 Ga0373962_0004069 Ga0373962_0004069_954_1796 279
1539 3300035691 Ga0373931_0000242 Ga0373931_0000242_4102_4944 279
1540 3300039437 Ga0436365_0098421 Ga0436365_0098421_60_902 279
1541 3300045051 Ga0451576_0013397 Ga0451576_0013397_8124_8966 279
1542 3300047469 Ga0495673_0035151 Ga0495673_0035151_700_1554 279
1543 3300050489 nmdc:mga03683_3361_c2 nmdc:mga03683_3361_c2_608_1462 279
1544 3300050496 nmdc:mga07m45_27827_c1 nmdc:mga07m45_27827_c1_1599_2453 279
1545 3300050507 nmdc:mga05p37_3429_c1 nmdc:mga05p37_3429_c1_16447_17289 279
1546 3300050508 nmdc:mga09592_11500_c1 nmdc:mga09592_11500_c1_2121_2963 279
1547 3300050508 nmdc:mga09592_136715_c1 nmdc:mga09592_136715_c1_571_1413 279
1548 3300050508 nmdc:mga09592_304869_c1 nmdc:mga09592_304869_c1_276_1118 279
1549 3300050509 nmdc:mga0qj67_260295_c1 nmdc:mga0qj67_260295_c1_266_1111 279
1550 3300050509 nmdc:mga0qj67_97211_c1 nmdc:mga0qj67_97211_c1_641_1483 279
1551 3300050510 nmdc:mga06r32_16885_c1 nmdc:mga06r32_16885_c1_4133_4975 279
1552 3300050511 nmdc:mga08y16_4141_c1 nmdc:mga08y16_4141_c1_14108_14950 279
1553 3300050511 nmdc:mga08y16_86448_c1 nmdc:mga08y16_86448_c1_2176_3018 279
1554 3300050511 nmdc:mga08y16_93457_c2 nmdc:mga08y16_93457_c2_214_1056 279
1555 3300050516 nmdc:mga0sz30_155_c2 nmdc:mga0sz30_155_c2_10920_11774 279
1556 iso_pu_bacteria 2548876994 2550693792 279
1557 iso_pu_bacteria 2765235838 2765568570 279
1558 iso_pu_bacteria 2839094727 2839096550 279
1559 iso_pu_bacteria 2919046199 2919048138 279
1560 3300006051 Ga0075364_10186312 Ga0075364_101863122 280
1561 3300006186 Ga0075369_10032648 Ga0075369_100326482 280
1562 3300006195 Ga0075366_10163909 Ga0075366_101639092 280
1563 3300006195 Ga0075366_10247745 Ga0075366_102477452 280
1564 3300006195 Ga0075366_10314140 Ga0075366_103141402 280
1565 3300006353 Ga0075370_10049886 Ga0075370_100498862 280
1566 3300031507 Ga0307509_10111327 Ga0307509_101113272 280
1567 3300033179 Ga0307507_10146187 Ga0307507_101461872 280
1568 3300045051 Ga0451576_0288831 Ga0451576_0288831_279_1157 280
1569 3300050496 nmdc:mga07m45_48928_c1 nmdc:mga07m45_48928_c1_622_1467 280
1570 iso_pu_bacteria 2919046199 2919049616 280
1571 3300003751 Ga0055538_1000054 Ga0055538_100005464 281
1572 3300003752 Ga0055539_1000066 Ga0055539_100006664 281
1573 3300003756 Ga0055533_1000076 Ga0055533_100007664 281
1574 3300003759 Ga0055525_1000098 Ga0055525_100009864 281
1575 3300003841 Ga0055541_1000056 Ga0055541_100005664 281
1576 3300005331 Ga0070670_100000081 Ga0070670_10000008112 281
1577 3300005367 Ga0070667_100001429 Ga0070667_10000142914 281
1578 3300005578 Ga0068854_100006416 Ga0068854_1000064164 281
1579 3300005618 Ga0068864_100000016 Ga0068864_10000001613 281
1580 3300005841 Ga0068863_100001887 Ga0068863_10000188711 281
1581 3300005844 Ga0068862_100000068 Ga0068862_10000006813 281
1582 3300009011 Ga0105251_10002065 Ga0105251_100020653 281
1583 3300009036 Ga0105244_10053100 Ga0105244_100531002 281
1584 3300009545 Ga0105237_10073094 Ga0105237_100730942 281
1585 3300009551 Ga0105238_10003628 Ga0105238_1000362811 281
1586 3300015261 Ga0182006_1001196 Ga0182006_10011969 281
1587 3300025224 Ga0209784_100002 Ga0209784_1000021551 281
1588 3300025225 Ga0209566_100003 Ga0209566_1000031551 281
1589 3300025226 Ga0209674_100004 Ga0209674_1000041551 281
1590 3300025230 Ga0209563_100006 Ga0209563_1000061551 281
1591 3300025253 Ga0209677_100003 Ga0209677_1000031551 281
1592 3300025913 Ga0207695_10001540 Ga0207695_1000154049 281
1593 3300025914 Ga0207671_10032015 Ga0207671_100320154 281
1594 3300025924 Ga0207694_10014027 Ga0207694_100140272 281
1595 3300025925 Ga0207650_10000288 Ga0207650_1000028848 281
1596 3300025986 Ga0207658_10000466 Ga0207658_1000046629 281
1597 3300026088 Ga0207641_10000103 Ga0207641_1000010312 281
1598 3300026095 Ga0207676_10000044 Ga0207676_1000004412 281
1599 3300028380 Ga0268265_10000142 Ga0268265_1000014212 281
1600 3300031548 Ga0307408_100180100 Ga0307408_1001801002 281
1601 3300031616 Ga0307508_10000150 Ga0307508_1000015053 281
1602 3300031731 Ga0307405_10052767 Ga0307405_100527672 281
1603 3300033179 Ga0307507_10211383 Ga0307507_102113832 281
1604 3300033180 Ga0307510_10316544 Ga0307510_103165441 281
1605 3300039447 Ga0436361_0053786 Ga0436361_0053786_16791_17639 281
1606 3300044712 Ga0453684_0000063 Ga0453684_0000063_243986_244837 281
1607 3300046501 Ga0495607_0000018 Ga0495607_0000018_18788_19639 281
1608 3300046515 Ga0495620_0000678 Ga0495620_0000678_1507_2358 281
1609 3300046515 Ga0495620_0032690 Ga0495620_0032690_13_864 281
1610 3300046519 Ga0495632_0000102 Ga0495632_0000102_31388_32239 281
1611 3300046524 Ga0495648_0000093 Ga0495648_0000093_40254_41105 281
1612 3300046538 Ga0495609_0010985 Ga0495609_0010985_3113_3964 281
1613 3300046557 Ga0495622_0053566 Ga0495622_0053566_905_1756 281
1614 3300046616 Ga0495668_0027182 Ga0495668_0027182_495_1346 281
1615 3300047469 Ga0495673_0002002 Ga0495673_0002002_3914_4765 281
1616 3300048906 Ga0496103_0004038 Ga0496103_0004038_3087_3938 281
1617 3300048920 Ga0496117_0013767 Ga0496117_0013767_2929_3780 281
1618 3300048921 Ga0496118_0001099 Ga0496118_0001099_10914_11765 281
1619 3300049460 Ga0495682_0000087 Ga0495682_0000087_18290_19141 281
1620 3300053125 Ga0500618_000286 Ga0500618_000286_27558_28406 281
1621 iso_pu_bacteria 2643221544 2643746030 281
1622 iso_pu_bacteria 2643221585 2643936995 281
1623 iso_pu_bacteria 2643221639 2644218041 281
1624 iso_pu_bacteria 2643221656 2644318160 281
1625 iso_pu_bacteria 2738543013 2739250193 281
1626 iso_pu_bacteria 2818991445 2819595073 281
1627 3300046660 Ga0495625_0000657 Ga0495625_0000657_36332_37207 282
1628 3300048928 Ga0496125_0002076 Ga0496125_0002076_279_1154 282
1629 3300048929 Ga0496126_0415424 Ga0496126_0415424_32_907 282
1630 iso_pu_bacteria 2511231002 2511244993 282
1631 iso_pu_bacteria 2511231003 2511252131 282
1632 iso_pu_bacteria 2643221646 2644258218 282
1633 iso_pu_bacteria 2831864461 2831866719 282
1634 iso_pu_bacteria 2857564685 2857569715 282
1635 iso_pu_bacteria 2884811622 2884814939 282
1636 iso_pu_bacteria 2884836552 2884836775 282
1637 iso_pu_bacteria 2884852848 2884853066 282
1638 iso_pu_bacteria 2896154374 2896155816 282
1639 3300027543 Ga0209999_1006003 Ga0209999_10060032 283
1640 3300027695 Ga0209966_1000046 Ga0209966_100004620 283
1641 iso_pu_bacteria 2738541337 2739057176 283
1642 iso_pu_bacteria 2857576091 2857576595 283
1643 iso_pu_bacteria 2919704043 2919708155 283
1644 3300002704 JGI25155J39150_1000188 JGI25155J39150_100018823 284
1645 3300002705 JGI25156J39149_1000150 JGI25156J39149_100015025 284
1646 3300002738 JGI25154J39366_1000165 JGI25154J39366_100016525 284
1647 3300002741 JGI25157J39369_1000383 JGI25157J39369_10003838 284
1648 3300003758 Ga0055532_1000097 Ga0055532_100009762 284
1649 3300003761 Ga0055535_1003562 Ga0055535_10035622 284
1650 3300003791 Ga0055530_10008420 Ga0055530_100084204 284
1651 3300003792 Ga0055540_1000007 Ga0055540_10000075 284
1652 3300005331 Ga0070670_100056875 Ga0070670_1000568754 284
1653 3300005719 Ga0068861_100196620 Ga0068861_1001966202 284
1654 3300005844 Ga0068862_100004260 Ga0068862_10000426012 284
1655 3300006038 Ga0075365_10025380 Ga0075365_100253803 284
1656 3300006946 Ga0079104_1000009 Ga0079104_1000009275 284
1657 3300009093 Ga0105240_10003119 Ga0105240_1000311912 284
1658 3300009551 Ga0105238_10052431 Ga0105238_100524312 284
1659 3300025206 Ga0209435_100040 Ga0209435_10004022 284
1660 3300025229 Ga0209147_100141 Ga0209147_10014177 284
1661 3300025242 Ga0209258_100657 Ga0209258_10065717 284
1662 3300025246 Ga0209646_1000253 Ga0209646_100025322 284
1663 3300025250 Ga0209026_1000306 Ga0209026_100030627 284
1664 3300025256 Ga0209759_1000398 Ga0209759_100039827 284
1665 3300025272 Ga0209455_1012365 Ga0209455_10123652 284
1666 3300025298 Ga0209050_1001541 Ga0209050_10015415 284
1667 3300025303 Ga0209051_1000004 Ga0209051_100000458 284
1668 3300025304 Ga0209257_1000038 Ga0209257_1000038192 284
1669 3300025304 Ga0209257_1000044 Ga0209257_1000044368 284
1670 3300025913 Ga0207695_10023519 Ga0207695_100235192 284
1671 3300025924 Ga0207694_10035008 Ga0207694_100350082 284
1672 3300025925 Ga0207650_10049334 Ga0207650_100493343 284
1673 3300026118 Ga0207675_100189232 Ga0207675_1001892322 284
1674 3300026142 Ga0207698_10033824 Ga0207698_100338244 284
1675 3300027111 Ga0209281_1000023 Ga0209281_1000023112 284
1676 3300031548 Ga0307408_100007613 Ga0307408_1000076132 284
1677 3300031911 Ga0307412_10128271 Ga0307412_101282712 284
1678 3300042876 Ga0451577_0244892 Ga0451577_0244892_471_1340 284
1679 3300045051 Ga0451576_0091312 Ga0451576_0091312_160_1029 284
1680 3300046524 Ga0495648_0010663 Ga0495648_0010663_5494_6357 284
1681 3300048905 Ga0496102_0002990 Ga0496102_0002990_1679_2548 284
1682 3300048919 Ga0496116_0003967 Ga0496116_0003967_12374_13255 284
1683 3300048924 Ga0496121_0136095 Ga0496121_0136095_539_1420 284
1684 3300048925 Ga0496122_0000693 Ga0496122_0000693_38095_38976 284
1685 3300048926 Ga0496123_0000433 Ga0496123_0000433_46339_47220 284
1686 iso_pu_bacteria 2643221570 2643866285 284
1687 iso_pu_bacteria 2643221596 2643994275 284
1688 iso_pu_bacteria 2643221609 2644057469 284
1689 iso_pu_bacteria 2643221611 2644072442 284
1690 iso_pu_bacteria 2643221652 2644293105 284
1691 iso_pu_bacteria 2738543012 2739241740 284
1692 iso_pu_bacteria 2816332133 2816470955 284
1693 iso_pu_bacteria 2842718218 2842718236 284
1694 iso_pu_bacteria 2842733646 2842736913 284
1695 iso_pu_bacteria 2990710928 2990714339 284
1696 3300002704 JGI25155J39150_1000538 JGI25155J39150_10005387 285
1697 3300002738 JGI25154J39366_1000210 JGI25154J39366_100021024 285
1698 3300003354 JGI25160J50197_1000198 JGI25160J50197_100019835 285
1699 3300003374 JGI25161J50226_1000021 JGI25161J50226_1000021138 285
1700 3300003775 Ga0055524_1000033 Ga0055524_100003359 285
1701 3300004625 Ga0055543_1000238 Ga0055543_100023818 285
1702 3300005262 Ga0065165_1002756 Ga0065165_100275610 285
1703 3300005577 Ga0068857_100725251 Ga0068857_1007252511 285
1704 3300009093 Ga0105240_10015980 Ga0105240_100159808 285
1705 3300014497 Ga0182008_10130023 Ga0182008_101300232 285
1706 3300015261 Ga0182006_1015553 Ga0182006_10155534 285
1707 3300025233 Ga0209437_100229 Ga0209437_1002298 285
1708 3300025246 Ga0209646_1000204 Ga0209646_100020438 285
1709 3300025256 Ga0209759_1000298 Ga0209759_100029838 285
1710 3300025284 Ga0209130_1000103 Ga0209130_100010326 285
1711 3300025291 Ga0209675_1013210 Ga0209675_10132102 285
1712 3300025298 Ga0209050_1002687 Ga0209050_10026872 285
1713 3300025299 Ga0209256_1000019 Ga0209256_1000019336 285
1714 3300025302 Ga0207426_1000586 Ga0207426_100058626 285
1715 3300025913 Ga0207695_10017000 Ga0207695_100170002 285
1716 3300031456 Ga0307513_10000568 Ga0307513_1000056829 285
1717 3300032004 Ga0307414_10161439 Ga0307414_101614392 285
1718 3300032005 Ga0307411_10009963 Ga0307411_100099633 285
1719 3300042127 Ga0450890_002196 Ga0450890_002196_1106_1975 285
1720 3300042532 Ga0450893_0001826 Ga0450893_0001826_1600_2469 285
1721 3300046524 Ga0495648_0005295 Ga0495648_0005295_2944_3807 285
1722 3300048917 Ga0496114_0047484 Ga0496114_0047484_2066_2935 285
1723 3300049665 Ga0501227_023049 Ga0501227_023049_263_1132 285
1724 3300049669 Ga0501235_004060 Ga0501235_004060_749_1618 285
1725 3300049687 Ga0501258_004539 Ga0501258_004539_139_1008 285
1726 3300049704 Ga0501221_004443 Ga0501221_004443_853_1722 285
1727 3300049706 Ga0501229_000133 Ga0501229_000133_5861_6730 285
1728 3300049706 Ga0501229_007113 Ga0501229_007113_85_954 285
1729 3300049764 Ga0501267_001299 Ga0501267_001299_556_1425 285
1730 3300050493 nmdc:mga0k408_56087_c1 nmdc:mga0k408_56087_c1_349_1206 285
1731 3300053088 Ga0500644_0002483 Ga0500644_0002483_3497_4360 285
1732 3300053730 Ga0500645_000422 Ga0500645_000422_7658_8521 285
1733 iso_pu_bacteria 2599185214 2599625545 285
1734 iso_pu_bacteria 2599185226 2599673558 285
1735 iso_pu_bacteria 2599185227 2599683228 285
1736 iso_pu_bacteria 2599185229 2599695284 285
1737 iso_pu_bacteria 2738541277 2738719160 285
1738 iso_pu_bacteria 2738543019 2739281922 285
1739 iso_pu_bacteria 2818991446 2819599647 285
1740 iso_pu_bacteria 2831265667 2831271081 285
1741 iso_pu_bacteria 2838054893 2838055671 285
1742 iso_pu_bacteria 2842677519 2842680806 285
1743 iso_pu_bacteria 2885198086 2885200792 285
1744 iso_pu_bacteria 2885211737 2885214425 285
1745 iso_pu_bacteria 2899924645 2899927720 285
1746 iso_pu_bacteria 2904449895 2904450593 285
1747 iso_pu_bacteria 2904456579 2904456585 285
1748 iso_pu_bacteria 2928037797 2928042002 285
1749 iso_pu_bacteria 2928044640 2928049566 285
1750 iso_pu_bacteria 2928051484 2928051759 285
1751 iso_pu_bacteria 2928064002 2928065548 285
1752 iso_pu_bacteria 2928070936 2928073007 285
1753 iso_pu_bacteria 2928084124 2928086806 285
1754 iso_pu_bacteria 2929520902 2929521310 285
1755 iso_pu_bacteria 2945945610 2945949328 285
1756 3300003322 rootL2_10019891 rootL2_1001989112 286
1757 3300003771 Ga0055526_1002491 Ga0055526_10024914 286
1758 3300006038 Ga0075365_10006622 Ga0075365_100066225 286
1759 3300006051 Ga0075364_10051051 Ga0075364_100510514 286
1760 3300006058 Ga0075432_10005080 Ga0075432_100050805 286
1761 3300006177 Ga0075362_10016670 Ga0075362_100166702 286
1762 3300006195 Ga0075366_10008657 Ga0075366_100086574 286
1763 3300014497 Ga0182008_10075669 Ga0182008_100756692 286
1764 3300015262 Ga0182007_10000252 Ga0182007_100002525 286
1765 3300025273 Ga0209673_1002149 Ga0209673_10021497 286
1766 3300025295 Ga0209564_1000005 Ga0209564_1000005396 286
1767 3300028794 Ga0307515_10001611 Ga0307515_1000161127 286
1768 3300028794 Ga0307515_10006414 Ga0307515_1000641413 286
1769 3300028794 Ga0307515_10008712 Ga0307515_1000871214 286
1770 3300028794 Ga0307515_10056637 Ga0307515_100566373 286
1771 3300031456 Ga0307513_10012841 Ga0307513_100128414 286
1772 3300031456 Ga0307513_10335005 Ga0307513_103350052 286
1773 3300031548 Ga0307408_100070704 Ga0307408_1000707042 286
1774 3300031649 Ga0307514_10000641 Ga0307514_1000064119 286
1775 3300031649 Ga0307514_10108177 Ga0307514_101081772 286
1776 3300031731 Ga0307405_10090061 Ga0307405_100900612 286
1777 3300031824 Ga0307413_10065803 Ga0307413_100658032 286
1778 3300031911 Ga0307412_10071231 Ga0307412_100712311 286
1779 3300032004 Ga0307414_10101810 Ga0307414_101018103 286
1780 3300032005 Ga0307411_10006346 Ga0307411_100063465 286
1781 3300033180 Ga0307510_10094555 Ga0307510_100945552 286
1782 3300041512 Ga0451853_3923888 Ga0451853_3923888_198_1058 286
1783 3300042007 Ga0439449_0002308 Ga0439449_0002308_358_1221 286
1784 3300042435 Ga0439434_0022733 Ga0439434_0022733_689_1549 286
1785 3300042531 Ga0450918_001083 Ga0450918_001083_2311_3171 286
1786 3300045051 Ga0451576_0000621 Ga0451576_0000621_23102_23983 286
1787 3300050489 nmdc:mga03683_1535_c1 nmdc:mga03683_1535_c1_293_1153 286
1788 3300050490 nmdc:mga03n38_159019_c1 nmdc:mga03n38_159019_c1_92_952 286
1789 3300050491 nmdc:mga00v17_184670_c1 nmdc:mga00v17_184670_c1_458_1318 286
1790 3300050492 nmdc:mga0yw44_20621_c1 nmdc:mga0yw44_20621_c1_503_1363 286
1791 3300005327 Ga0070658_10029383 Ga0070658_100293831 287
1792 3300005338 Ga0068868_100066740 Ga0068868_1000667402 287
1793 3300005355 Ga0070671_100098374 Ga0070671_1000983742 287
1794 3300005539 Ga0068853_100302143 Ga0068853_1003021432 287
1795 3300005543 Ga0070672_100043233 Ga0070672_1000432334 287
1796 3300005616 Ga0068852_100025410 Ga0068852_1000254102 287
1797 3300005840 Ga0068870_10069906 Ga0068870_100699062 287
1798 3300005841 Ga0068863_100153961 Ga0068863_1001539612 287
1799 3300009098 Ga0105245_10115897 Ga0105245_101158972 287
1800 3300013297 Ga0157378_10120618 Ga0157378_101206182 287
1801 3300025321 Ga0207656_10139610 Ga0207656_101396102 287
1802 3300025920 Ga0207649_10049327 Ga0207649_100493272 287
1803 3300025923 Ga0207681_10270210 Ga0207681_102702102 287
1804 3300025925 Ga0207650_10010063 Ga0207650_100100631 287
1805 3300025933 Ga0207706_10050736 Ga0207706_100507362 287
1806 3300025937 Ga0207669_10168271 Ga0207669_101682712 287
1807 3300025940 Ga0207691_10118628 Ga0207691_101186282 287
1808 3300025960 Ga0207651_10172900 Ga0207651_101729002 287
1809 3300025981 Ga0207640_10048315 Ga0207640_100483153 287
1810 3300042876 Ga0451577_0000206 Ga0451577_0000206_90681_91544 287
1811 3300044712 Ga0453684_0000218 Ga0453684_0000218_190433_191296 287
1812 3300045051 Ga0451576_0002043 Ga0451576_0002043_30378_31241 287
1813 3300046501 Ga0495607_0000109 Ga0495607_0000109_26553_27422 287
1814 3300046543 Ga0495645_0102213 Ga0495645_0102213_893_1765 287
1815 iso_pu_bacteria 2928115317 2928115934 287
1816 3300003792 Ga0055540_1000784 Ga0055540_10007843 288
1817 3300005289 Ga0065704_10104316 Ga0065704_101043161 288
1818 3300005353 Ga0070669_100029055 Ga0070669_1000290553 288
1819 3300006177 Ga0075362_10004511 Ga0075362_100045114 288
1820 3300012502 Ga0157347_1002731 Ga0157347_10027312 288
1821 3300025303 Ga0209051_1000159 Ga0209051_100015960 288
1822 3300025923 Ga0207681_10058711 Ga0207681_100587113 288
1823 3300030731 Ga0316177_1191241 Ga0316177_11912414 288
1824 3300030733 Ga0314311_1011733 Ga0314311_10117332 288
1825 3300030734 Ga0316179_1030285 Ga0316179_10302851 288
1826 3300030735 Ga0316178_1051116 Ga0316178_10511162 288
1827 3300030736 Ga0316180_1047811 Ga0316180_10478114 288
1828 3300030742 Ga0316183_1126188 Ga0316183_112618820 288
1829 3300030745 Ga0316182_1174059 Ga0316182_11740596 288
1830 3300031548 Ga0307408_100040667 Ga0307408_1000406674 288
1831 3300031649 Ga0307514_10028849 Ga0307514_100288494 288
1832 3300031901 Ga0307406_10001390 Ga0307406_100013903 288
1833 3300032004 Ga0307414_10095124 Ga0307414_100951243 288
1834 3300032005 Ga0307411_10348690 Ga0307411_103486902 288
1835 3300042007 Ga0439449_0043482 Ga0439449_0043482_502_1371 288
1836 3300046520 Ga0495637_0004583 Ga0495637_0004583_5572_6441 288
1837 3300046691 Ga0495670_0012537 Ga0495670_0012537_2955_3824 288
1838 3300048925 Ga0496122_0001372 Ga0496122_0001372_32731_33600 288
1839 3300048926 Ga0496123_0012078 Ga0496123_0012078_5949_6818 288
1840 3300001979 JGI24740J21852_10015890 JGI24740J21852_100158903 289
1841 3300002774 JGI25150J39212_1001161 JGI25150J39212_10011617 289
1842 3300003187 JGI25151J46595_10005432 JGI25151J46595_100054325 289
1843 3300003215 JGI25153J46596_10005567 JGI25153J46596_100055675 289
1844 3300003323 rootH1_10025745 rootH1_100257456 289
1845 3300003354 JGI25160J50197_1007179 JGI25160J50197_10071792 289
1846 3300003374 JGI25161J50226_1001755 JGI25161J50226_10017554 289
1847 3300003761 Ga0055535_1000858 Ga0055535_100085824 289
1848 3300003762 Ga0055542_1000022 Ga0055542_1000022111 289
1849 3300003771 Ga0055526_1006184 Ga0055526_10061845 289
1850 3300003773 Ga0055537_1002281 Ga0055537_10022815 289
1851 3300003775 Ga0055524_1004325 Ga0055524_10043255 289
1852 3300003781 Ga0055536_1032314 Ga0055536_10323141 289
1853 3300003784 Ga0055534_1002365 Ga0055534_10023655 289
1854 3300003790 Ga0055528_1004626 Ga0055528_10046265 289
1855 3300003792 Ga0055540_1020504 Ga0055540_10205042 289
1856 3300003794 Ga0055531_10007095 Ga0055531_100070954 289
1857 3300004625 Ga0055543_1003612 Ga0055543_10036124 289
1858 3300005539 Ga0068853_100049035 Ga0068853_1000490354 289
1859 3300005834 Ga0068851_10001866 Ga0068851_100018665 289
1860 3300009148 Ga0105243_10077966 Ga0105243_100779663 289
1861 3300009148 Ga0105243_10249751 Ga0105243_102497512 289
1862 3300013102 Ga0157371_10004715 Ga0157371_100047156 289
1863 3300013307 Ga0157372_10014793 Ga0157372_100147932 289
1864 3300014497 Ga0182008_10005077 Ga0182008_100050771 289
1865 3300017792 Ga0163161_10045052 Ga0163161_100450522 289
1866 3300025228 Ga0209672_100391 Ga0209672_10039120 289
1867 3300025242 Ga0209258_100009 Ga0209258_100009774 289
1868 3300025245 Ga0207425_1000343 Ga0207425_10003439 289
1869 3300025254 Ga0209148_1000007 Ga0209148_1000007774 289
1870 3300025258 Ga0209129_1000024 Ga0209129_1000024301 289
1871 3300025258 Ga0209129_1000085 Ga0209129_100008581 289
1872 3300025263 Ga0209565_1000546 Ga0209565_100054626 289
1873 3300025273 Ga0209673_1000571 Ga0209673_100057156 289
1874 3300025284 Ga0209130_1000505 Ga0209130_100050538 289
1875 3300025291 Ga0209675_1002642 Ga0209675_10026427 289
1876 3300025292 Ga0209676_1006736 Ga0209676_10067362 289
1877 3300025294 Ga0209025_1000267 Ga0209025_100026764 289
1878 3300025295 Ga0209564_1000183 Ga0209564_100018337 289
1879 3300025297 Ga0209758_1000049 Ga0209758_1000049220 289
1880 3300025299 Ga0209256_1000140 Ga0209256_100014037 289
1881 3300025302 Ga0207426_1000053 Ga0207426_1000053256 289
1882 3300025303 Ga0209051_1008640 Ga0209051_10086404 289
1883 3300025303 Ga0209051_1017422 Ga0209051_10174222 289
1884 3300025304 Ga0209257_1006273 Ga0209257_10062737 289
1885 3300025321 Ga0207656_10004648 Ga0207656_100046485 289
1886 3300026041 Ga0207639_10062071 Ga0207639_100620712 289
1887 3300046460 Ga0495638_0043120 Ga0495638_0043120_628_1497 289
1888 3300046512 Ga0495610_0073587 Ga0495610_0073587_132_1001 289
1889 3300046513 Ga0495616_0007346 Ga0495616_0007346_5135_6004 289
1890 3300046518 Ga0495631_0000764 Ga0495631_0000764_14279_15148 289
1891 3300046530 Ga0495654_0037178 Ga0495654_0037178_1387_2256 289
1892 3300046660 Ga0495625_0008614 Ga0495625_0008614_2345_3214 289
1893 3300046692 Ga0495671_0040020 Ga0495671_0040020_1049_1921 289
1894 3300048089 Ga0495614_0026185 Ga0495614_0026185_1269_2138 289
1895 3300048904 Ga0496101_0177225 Ga0496101_0177225_233_1111 289
1896 3300048921 Ga0496118_0138864 Ga0496118_0138864_120_989 289
1897 3300048924 Ga0496121_0185303 Ga0496121_0185303_343_1212 289
1898 3300048926 Ga0496123_0133114 Ga0496123_0133114_269_1138 289
1899 3300048929 Ga0496126_0396589 Ga0496126_0396589_207_1076 289
1900 3300050496 nmdc:mga07m45_3642_c1 nmdc:mga07m45_3642_c1_445_1326 289
1901 3300053079 Ga0500610_0042322 Ga0500610_0042322_1135_2007 289
1902 3300053087 Ga0500643_013129 Ga0500643_013129_257_1126 289
1903 3300053093 Ga0500651_0001077 Ga0500651_0001077_398_1267 289
1904 3300053110 Ga0500571_044398 Ga0500571_044398_1208_2077 289
1905 3300053120 Ga0500597_051774 Ga0500597_051774_481_1350 289
1906 3300053133 Ga0500655_000880 Ga0500655_000880_1867_2736 289
1907 3300053134 Ga0500658_0000645 Ga0500658_0000645_8274_9143 289
1908 3300053134 Ga0500658_0000750 Ga0500658_0000750_379_1248 289
1909 3300053136 Ga0500559_0048585 Ga0500559_0048585_779_1651 289
1910 3300053141 Ga0500574_007277 Ga0500574_007277_767_1636 289
1911 3300053161 Ga0500634_0037909 Ga0500634_0037909_568_1440 289
1912 3300053162 Ga0500638_034026 Ga0500638_034026_434_1303 289

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

147

317

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ahc-assembly1.cif.gz_B opua apo inward-facing 0.8929 97 282
3tui-assembly2.cif.gz_E inward facing conformations of the metni methionine abc transporter: cy5 native crystal form 0.808 97 287
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.8069 94 287
7ahd-assembly1.cif.gz_B opua (e190q) occluded 0.7943 64 282
3dhw-assembly1.cif.gz_B crystal structure of methionine importer metni 0.792 97 277
ID Description Score Start End Superfamily
af_Q2G1I4_54_251_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9483 94 285 1.10.3720.10
af_Q57856_64_258_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9458 97 283 1.10.3720.10
af_Q47539_71_268_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.944 91 286 1.10.3720.10
af_P75851_53_247_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9336 94 282 1.10.3720.10
af_Q47539_71_268_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9303 91 286 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A2N2UDI5-F1-model_v4 deleted 0.9672 69 289
AF-A0A2N2UDI5-F1-model_v4 deleted 0.9587 69 289
AF-A0A6J4KGY1-F1-model_v4 Nitrate ABC transporter, permease protein 0.9586 81 287 GO:0005886
GO:0006811
GO:0015112
AF-A0A3N5MR33-F1-model_v4 Nitrate ABC transporter, permease protein 0.9546 93 286 GO:0005886
GO:0006811
GO:0015112
AF-A0A355B7I0-F1-model_v4 Nitrate ABC transporter, permease protein 0.9529 79 289 GO:0005886
GO:0006811
GO:0015112

Feature Viewer

pLDDT pTM Quality
83.5 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map