F495796
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1821 | 691 | 3642 | 145 |
Family's Representative Sequence
| Representative Sequence | 3300005456|Ga0070678_101940904|Ga0070678_1019409041 |
| Length | 161 |
| Sequence | MLPNSLIIQLKKKKMAKKVFKMVKLQVKGGAANPSPPVGPALGSAGVNIMEFCKQFNGRTQDKPGQVLPVVITVYEDKSFEFVIKTPPAAIQLMDAAKIKGGSGEPNRNKVGSVSWDQVKKIAEDKMVDLNCFTLDSALSMVAGTARSMGLRVTGTKPANA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 2 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 4 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 5 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 6 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 7 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 8 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 9 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 10 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 11 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 12 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 13 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 14 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 15 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 16 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 17 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 18 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 19 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 20 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 21 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 22 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 23 | 3300003405 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM | Metagenome | Rhizosphere |
| 24 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 25 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 26 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 27 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 28 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 29 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 30 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 31 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 32 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 33 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 34 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 35 | 3300005276 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 | Metagenome | Rhizosphere |
| 36 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 37 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 38 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 39 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 40 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 41 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 46 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 50 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 52 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 62 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 74 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 75 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 76 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 80 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 81 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 83 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 87 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 89 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 90 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 91 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 93 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 94 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 95 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 96 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 97 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 98 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 99 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 100 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 101 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 102 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 104 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 105 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 106 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 107 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 109 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 110 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 111 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 112 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 113 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 114 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 115 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 116 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 117 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 119 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300012485 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 | Metagenome | Rhizosphere |
| 136 | 3300012487 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 | Metagenome | Rhizosphere |
| 137 | 3300012491 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 | Metagenome | Rhizosphere |
| 138 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 139 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 140 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 152 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 155 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 156 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 157 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 159 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 160 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 161 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 162 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 163 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 164 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 165 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 166 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 167 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 168 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 169 | 3300023309 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctcc.R1 | Metatranscriptome | Rhizosphere |
| 170 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 176 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 177 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 179 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 184 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 187 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 188 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 189 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 254 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 256 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 260 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 264 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 265 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 266 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 267 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 268 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 269 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 270 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 271 | 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 272 | 3300031011 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 273 | 3300031043 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 274 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 275 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 276 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 277 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 278 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 279 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 280 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 281 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 282 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 283 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 284 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 285 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 286 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 287 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 288 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 289 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 290 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 291 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 292 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 293 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 294 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 295 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 296 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 297 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 298 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 299 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 300 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 301 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 302 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 303 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 304 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 305 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 306 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 307 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 308 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 309 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 310 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 311 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 312 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 313 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 314 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 315 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 316 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 317 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 318 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 319 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 320 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 321 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 322 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 323 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 324 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 325 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 326 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 327 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 328 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 329 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 330 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 331 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 332 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 333 | 3300041442 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaT | Metatranscriptome | Rhizoplane |
| 334 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 335 | 3300041444 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT | Metatranscriptome | Rhizoplane |
| 336 | 3300041445 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaT | Metatranscriptome | Rhizoplane |
| 337 | 3300041446 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT | Metatranscriptome | Rhizoplane |
| 338 | 3300041450 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaT | Metatranscriptome | Rhizoplane |
| 339 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 340 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 341 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 342 | 3300041454 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaT | Metatranscriptome | Rhizoplane |
| 343 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 344 | 3300041457 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaT | Metatranscriptome | Rhizoplane |
| 345 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 346 | 3300041461 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT | Metatranscriptome | Rhizoplane |
| 347 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 348 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 349 | 3300041464 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaT | Metatranscriptome | Rhizoplane |
| 350 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 351 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 352 | 3300041493 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaT | Metatranscriptome | Unclassified |
| 353 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 354 | 3300041497 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT | Metatranscriptome | Unclassified |
| 355 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 356 | 3300041502 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT | Metatranscriptome | Unclassified |
| 357 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 358 | 3300041506 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT | Metatranscriptome | Unclassified |
| 359 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 360 | 3300041508 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaT | Metatranscriptome | Unclassified |
| 361 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 362 | 3300041510 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT | Metatranscriptome | Unclassified |
| 363 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 364 | 3300041907 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT_extra_run | Metatranscriptome | Unclassified |
| 365 | 3300041908 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaT_extra_run | Metatranscriptome | Unclassified |
| 366 | 3300041916 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run | Metatranscriptome | Unclassified |
| 367 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 368 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 369 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 370 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 371 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 372 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 373 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 374 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 375 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 376 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 377 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 378 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 379 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 380 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 381 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 382 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 383 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 384 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 385 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 437 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 438 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 439 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 440 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 441 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 442 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 443 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 444 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 445 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 446 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 447 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 448 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 449 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 450 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 451 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 452 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 453 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 454 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 455 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 456 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 457 | 3300049131 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 458 | 3300049132 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 459 | 3300049133 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 460 | 3300049134 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 461 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 462 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 463 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 464 | 3300049163 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 465 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 468 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 469 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 470 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 471 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 472 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 473 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 474 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 475 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 476 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 477 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 478 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 479 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 480 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 481 | 3300049542 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 482 | 3300049543 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 483 | 3300049544 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 484 | 3300049545 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 485 | 3300049546 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 486 | 3300049547 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 487 | 3300049548 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 488 | 3300049550 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 489 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 490 | 3300049552 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 491 | 3300049553 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 492 | 3300049556 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 493 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 494 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 495 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 496 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 497 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 498 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 499 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 500 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 501 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 502 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 503 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 504 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 505 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 506 | 3300049689 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought | Metagenome | Rhizosphere |
| 507 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 508 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 509 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 510 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 511 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 512 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 513 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 514 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 515 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 516 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 517 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 518 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 519 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 520 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 521 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 522 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 523 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 524 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 525 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 526 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 527 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 528 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 529 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 530 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 531 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 532 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 533 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 534 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 535 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 536 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 537 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 538 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 539 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 540 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 541 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 542 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 543 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 544 | 3300053726 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere | Metagenome | Endosphere |
| 545 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 546 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 547 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 548 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 549 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 550 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 551 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 552 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 553 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 554 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 555 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 556 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 557 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 558 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 559 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 560 | 3300059607 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 561 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 562 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 563 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 564 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 565 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 566 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 567 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 568 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 569 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 570 | 3300059648 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 571 | 3300059651 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 572 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 573 | 3300059653 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 574 | 3300059660 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 575 | 3300060243 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 1R_CW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 576 | 3300060244 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 2R_CW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 577 | 3300060246 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 22R_SD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 578 | 2511231000 | Chryseobacterium populi CF314 | Isolate | Rhizosphere |
| 579 | 2513020052 | Flavobacterium sp. CF136 | Isolate | Rhizosphere |
| 580 | 2519899754 | Flavobacterium sp. F52 | Isolate | Rhizosphere |
| 581 | 2522125168 | Dyadobacter beijingensis DSM 21582 | Isolate | Rhizosphere |
| 582 | 2523533629 | Kaistella palustris DSM 21579 | Isolate | Rhizosphere |
| 583 | 2582581278 | Chryseobacterium sp. CF365 | Isolate | Rhizosphere |
| 584 | 2582581281 | Chryseobacterium sp. CF284 | Isolate | Rhizosphere |
| 585 | 2582581282 | Chryseobacterium sp. CF299 | Isolate | Rhizosphere |
| 586 | 2585427687 | Pedobacter borealis DSM 19626 | Isolate | Rhizosphere |
| 587 | 2585428045 | Chryseobacterium sp. OV705 | Isolate | Rhizosphere |
| 588 | 2585428060 | Chryseobacterium sp. OV715 | Isolate | Rhizosphere |
| 589 | 2585428061 | Chryseobacterium sp. CF356 | Isolate | Rhizosphere |
| 590 | 2585428095 | Chryseobacterium sp. YR005 | Isolate | Rhizosphere |
| 591 | 2585428115 | Chryseobacterium sp. YR561 | Isolate | Rhizosphere |
| 592 | 2585428182 | Chryseobacterium sp. YR477 | Isolate | Rhizosphere |
| 593 | 2585428183 | Chryseobacterium sp. YR485 | Isolate | Rhizosphere |
| 594 | 2585428184 | Chryseobacterium sp. YR480 | Isolate | Rhizosphere |
| 595 | 2585428185 | Chryseobacterium sp. YR459 | Isolate | Rhizosphere |
| 596 | 2585428187 | Chryseobacterium sp. YR460 | Isolate | Rhizosphere |
| 597 | 2588253712 | Chryseobacterium sp. OV279 | Isolate | Rhizosphere |
| 598 | 2588254255 | Chryseobacterium sp. YR221 | Isolate | Rhizosphere |
| 599 | 2588254257 | Chryseobacterium sp. YR203 | Isolate | Rhizosphere |
| 600 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 601 | 2643221600 | Flavobacterium sp. Root186 | Isolate | Unclassified |
| 602 | 2643221667 | Flavobacterium sp. Root420 | Isolate | Unclassified |
| 603 | 2643221716 | Flavobacterium sp. Root901 | Isolate | Unclassified |
| 604 | 2643221725 | Flavobacterium sp. Root935 | Isolate | Unclassified |
| 605 | 2721755487 | Sphingobacterium sp. B29 | Isolate | Rhizosphere |
| 606 | 2728369107 | Chryseobacterium kwangjuense KJ1R5 | Isolate | Unclassified |
| 607 | 2738541273 | Elizabethkingia sp. YR214 | Isolate | Unclassified |
| 608 | 2738541279 | Flavobacterium sp. GV069 | Isolate | Unclassified |
| 609 | 2738541283 | Pedobacter sp. OK701 | Isolate | Unclassified |
| 610 | 2738541284 | Pedobacter sp. YR016 | Isolate | Unclassified |
| 611 | 2738541285 | Flavobacterium sp. GV030 | Isolate | Unclassified |
| 612 | 2738541302 | Pedobacter sp. CF074 | Isolate | Unclassified |
| 613 | 2738543007 | Flavobacterium sp. GV063 | Isolate | Unclassified |
| 614 | 2738543014 | Elizabethkingia sp. YR191 | Isolate | Unclassified |
| 615 | 2738543023 | Pedobacter sp. OK628 | Isolate | Unclassified |
| 616 | 2739367651 | Pedobacter sp. OK291 | Isolate | Unclassified |
| 617 | 2739367656 | Pedobacter sp. CF523 | Isolate | Unclassified |
| 618 | 2739367663 | Pedobacter sp. YR510 | Isolate | Unclassified |
| 619 | 2739367857 | Flavobacterium sp. GV029 | Isolate | Unclassified |
| 620 | 2739367858 | Flavobacterium sp. GV028 | Isolate | Unclassified |
| 621 | 2739367874 | Chryseobacterium sp. T16E-39 | Isolate | Unclassified |
| 622 | 2751185877 | Chryseobacterium artocarpi UTM-3 | Isolate | Rhizosphere |
| 623 | 2765235839 | Chryseobacterium indologenes AA5 | Isolate | Unclassified |
| 624 | 2772190705 | Chryseobacterium contaminans C-26 | Isolate | Rhizosphere |
| 625 | 2775506739 | Chryseobacterium sp. 1335 | Isolate | Unclassified |
| 626 | 2775506987 | Pedobacter ginsengisoli T01R-27 | Isolate | Unclassified |
| 627 | 2802428842 | Flavobacterium sp. S87F.05.LMB.W.Kidney.N | Isolate | Unclassified |
| 628 | 2816332188 | Chryseobacterium aquifrigidense 110 (version 2) | Isolate | Unclassified |
| 629 | 2816332280 | Flavobacterium johnsoniae GSE09 | Isolate | Unclassified |
| 630 | 2818991437 | Pedobacter terrae 518 | Isolate | Unclassified |
| 631 | 2818991442 | Chitinophaga pinensis 1204 | Isolate | Unclassified |
| 632 | 2821136567 | Chitinophaga sancti 1232 | Isolate | Unclassified |
| 633 | 2833640130 | Mariniflexile sp. TRM1-10 | Isolate | Rhizosphere |
| 634 | 2842083920 | Chryseobacterium lathyri KCTC 22544 | Isolate | Rhizosphere |
| 635 | 2842722452 | Pedobacter sp. R-72249 | Isolate | Unclassified |
| 636 | 2842909656 | Pedobacter sp. R-72393 | Isolate | Unclassified |
| 637 | 2849281842 | Pedobacter sp. AK013 | Isolate | Rhizosphere |
| 638 | 2852627209 | Pedobacter sp. AK017 | Isolate | Rhizosphere |
| 639 | 2857613821 | Flavobacterium sp. R-72247 | Isolate | Unclassified |
| 640 | 2857618242 | Flavobacterium sp. R-74482 | Isolate | Unclassified |
| 641 | 2857627736 | Pedobacter sp. R-74587 | Isolate | Unclassified |
| 642 | 2871720351 | Chryseobacterium sp. KLBC 52 | Isolate | Nodule |
| 643 | 2881247448 | Flavobacterium beibuense RSKm HC5 | Isolate | Rhizosphere |
| 644 | 2881359912 | Flavobacterium ustbae T13 | Isolate | Rhizosphere |
| 645 | 2889290771 | Chryseobacterium sp. PvR013 | Isolate | Rhizosphere |
| 646 | 2890737413 | Parapedobacter sp. SGR-10 | Isolate | Rhizosphere |
| 647 | 2896317667 | Sphingobacterium sp. SGR-19 | Isolate | Rhizosphere |
| 648 | 2896344016 | Sphingobacterium sp. SGL-16 | Isolate | Rhizosphere |
| 649 | 2898713307 | Sphingobacterium sp. SGG-5 | Isolate | Rhizosphere |
| 650 | 2902048731 | Pedobacter ureilyticus THG-T11 | Isolate | Rhizosphere |
| 651 | 2903895155 | Flavobacterium sp. HBTb2-11-1 | Isolate | Rhizosphere |
| 652 | 2904419702 | Flavobacterium sp. 1355 | Isolate | Rhizosphere |
| 653 | 2904445276 | Pedobacter terrae 1734 | Isolate | Rhizosphere |
| 654 | 2904467357 | Chitinophaga sancti 3198 | Isolate | Unclassified |
| 655 | 2904555929 | Flavobacterium sp. 1750 | Isolate | Rhizosphere |
| 656 | 2904780799 | Sphingobacterium sp. 1304 | Isolate | Rhizosphere |
| 657 | 2905999023 | Chryseobacterium elymi KCTC 22547 | Isolate | Rhizosphere |
| 658 | 2919097161 | Chryseobacterium ginsenosidimutans 1394 | Isolate | Rhizosphere |
| 659 | 2919177583 | Sphingobacterium sp. 2149 | Isolate | Rhizosphere |
| 660 | 2919186247 | Pedobacter africanus 2697 | Isolate | Rhizosphere |
| 661 | 2919191525 | Flavobacterium sp. 2755 | Isolate | Rhizosphere |
| 662 | 2919399522 | Chryseobacterium sp. 2987 | Isolate | Unclassified |
| 663 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 664 | 2919509842 | Flavobacterium arsenatis 3773 | Isolate | Unclassified |
| 665 | 2919683626 | Flavobacterium piscis 4129 | Isolate | Unclassified |
| 666 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 667 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 668 | 2929150217 | Flavobacterium sp. R-74510 Hybrid assembly | Isolate | Unclassified |
| 669 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 670 | 2939664404 | Pedobacter africanus 2990 | Isolate | Rhizosphere |
| 671 | 2945924605 | Chryseobacterium ginsenosidimutans W1I9 | Isolate | Rhizosphere |
| 672 | 2945997725 | Pedobacter sp. W3I1 | Isolate | Rhizosphere |
| 673 | 2946019816 | Chryseobacterium sp. W4I1 | Isolate | Rhizosphere |
| 674 | 2954016120 | Flavobacterium sp. W4I14 | Isolate | Rhizosphere |
| 675 | 2958458903 | Flavobacterium anhuiense RCM74 | Isolate | Rhizosphere |
| 676 | 2958512119 | Flavobacterium sp. Sd200 | Isolate | Rhizosphere |
| 677 | 2965320100 | Flavobacterium agri MAH-1 | Isolate | Rhizosphere |
| 678 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
| 679 | 2977243572 | Chryseobacterium sp. SORGH_AS 447 | Isolate | Unclassified |
| 680 | 2977268062 | Flavobacterium sp. SORGH_AS 622 | Isolate | Unclassified |
| 681 | 2984572630 | Chryseobacterium sp. SORGH_AS909 | Isolate | Aerial Root |
| 682 | 2984606641 | Chryseobacterium sp. SORGH_AS1175 | Isolate | Aerial Root |
| 683 | 2993372514 | Chryseobacterium sp. SLBN-27 | Isolate | Rhizosphere |
| 684 | 2993480792 | Chryseobacterium nepalense SLBN-92 | Isolate | Rhizosphere |
| 685 | 3003233435 | Sphingobacterium shayense CrR18 | Isolate | Unclassified |
| 686 | 8036736890 | Flavobacterium dauae TCH3-2 | Isolate | Rhizosphere |
| 687 | 8054307821 | Flavobacterium soyae SCIV07 | Isolate | Rhizosphere |
| 688 | 8055419101 | Flavobacterium tyrosinilyticum KCTC 42726 | Isolate | Rhizosphere |
| 689 | 8055588893 | Parapedobacter lycopersici KACC 18788 | Isolate | Rhizosphere |
| 690 | 8055592153 | Flavobacterium panacis DCY106 | Isolate | Rhizosphere |
| 691 | 8056440228 | Flavobacterium hibisci THG-HG1.4 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 71.44 |
| Metatranscriptomes | 22.3 |
| Isolates | 6.26 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.11 |
| Bulb | 0 |
| Endosphere | 4.45 |
| Nodule | 0.16 |
| Rhizoplane | 3.57 |
| Rhizosphere | 82.92 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.33 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070678_101940904 | 3300005456 | Bacteria | 556 |
| 2 | MRS2a_Contig_9405 | 2124908027 | Bacteria | 1869 |
| 3 | SwRhRL2b_contig_2240772 | 2162886007 | Bacteria | 1434 |
| 4 | SwRhRL2b_contig_2684773 | 2162886007 | Bacteria | 2886 |
| 5 | SwRhRL2b_contig_534079 | 2162886007 | Bacteria | 3423 |
| 6 | SwRhRL2b_contig_908903 | 2162886007 | Bacteria | 1008 |
| 7 | JGI24741J21665_1000115 | 3300001915 | Bacteria | 21692 |
| 8 | JGI24741J21665_1061020 | 3300001915 | Bacteria | 556 |
| 9 | JGI24740J21852_10015326 | 3300001979 | Bacteria | 2803 |
| 10 | JGI24740J21852_10053646 | 3300001979 | Bacteria | 1142 |
| 11 | JGI24739J22299_10047850 | 3300001989 | Bacteria | 1393 |
| 12 | JGI24739J22299_10166146 | 3300001989 | Bacteria | 650 |
| 13 | JGI24737J22298_10000614 | 3300001990 | Bacteria | 12575 |
| 14 | JGI24737J22298_10001905 | 3300001990 | Bacteria | 7459 |
| 15 | JGI24737J22298_10003582 | 3300001990 | Bacteria | 5476 |
| 16 | JGI24737J22298_10148067 | 3300001990 | Bacteria | 693 |
| 17 | JGI24743J22301_10020627 | 3300001991 | Bacteria | 1255 |
| 18 | JGI24735J21928_10000009 | 3300002067 | Bacteria | 247425 |
| 19 | JGI24735J21928_10021163 | 3300002067 | Bacteria | 1988 |
| 20 | JGI24735J21928_10042167 | 3300002067 | Bacteria | 1329 |
| 21 | JGI24744J21845_10008899 | 3300002077 | Bacteria | 2063 |
| 22 | JGI24034J26672_10101796 | 3300002239 | Bacteria | 542 |
| 23 | JGI25162J39368_1000120 | 3300002737 | Bacteria | 86031 |
| 24 | JGI25162J39368_1001524 | 3300002737 | Bacteria | 11972 |
| 25 | JGI25157J39369_1002820 | 3300002741 | Bacteria | 3946 |
| 26 | JGI25157J39369_1004397 | 3300002741 | Bacteria | 2564 |
| 27 | JGI25157J39369_1031034 | 3300002741 | Bacteria | 609 |
| 28 | JGI25164J39214_1000824 | 3300002772 | Bacteria | 10827 |
| 29 | JGI25150J39212_1000001 | 3300002774 | Bacteria | 1318726 |
| 30 | Ga0006759J45824_1125488 | 3300003163 | Unclassified | 727 |
| 31 | JGI25151J46595_10000001 | 3300003187 | Bacteria | 887211 |
| 32 | JGI25165J46597_1000923 | 3300003214 | Bacteria | 20349 |
| 33 | JGI25153J46596_10000001 | 3300003215 | Bacteria | 748985 |
| 34 | rootH2_10012942 | 3300003320 | Bacteria | 1545 |
| 35 | rootH2_10298437 | 3300003320 | Bacteria | 1012 |
| 36 | rootL2_10051773 | 3300003322 | Bacteria | 3799 |
| 37 | rootL2_10150346 | 3300003322 | Bacteria | 2920 |
| 38 | rootL2_10285627 | 3300003322 | Bacteria | 3159 |
| 39 | rootH1_10107846 | 3300003323 | Bacteria | 1569 |
| 40 | rootH1_10125727 | 3300003323 | Bacteria | 1872 |
| 41 | JGI26132J50249_101713 | 3300003405 | Bacteria | 750 |
| 42 | Ga0007409J51694_1078244 | 3300003575 | Bacteria | 1684 |
| 43 | Ga0006562J51391_1002124 | 3300003578 | Bacteria | 4457 |
| 44 | Ga0055536_1013448 | 3300003781 | Bacteria | 2951 |
| 45 | Ga0055534_1012830 | 3300003784 | Bacteria | 1639 |
| 46 | Ga0055531_10002043 | 3300003794 | Bacteria | 13930 |
| 47 | Ga0058859_11302483 | 3300004798 | Bacteria | 673 |
| 48 | Ga0058863_11953297 | 3300004799 | Bacteria | 801 |
| 49 | Ga0058863_11963325 | 3300004799 | Bacteria | 880 |
| 50 | Ga0058861_10088285 | 3300004800 | Bacteria | 3413 |
| 51 | Ga0058861_12069072 | 3300004800 | Bacteria | 746 |
| 52 | Ga0058860_10018004 | 3300004801 | Bacteria | 5911 |
| 53 | Ga0058860_11803557 | 3300004801 | Bacteria | 768 |
| 54 | Ga0058860_11880010 | 3300004801 | Bacteria | 1056 |
| 55 | Ga0058862_10247728 | 3300004803 | Bacteria | 8738 |
| 56 | Ga0058862_12706272 | 3300004803 | Bacteria | 798 |
| 57 | Ga0058862_12779971 | 3300004803 | Bacteria | 1326 |
| 58 | Ga0065165_1002853 | 3300005262 | Bacteria | 13414 |
| 59 | Ga0065717_1002063 | 3300005276 | Bacteria | 3205 |
| 60 | Ga0065714_10005413 | 3300005288 | Bacteria | 4818 |
| 61 | Ga0065714_10007805 | 3300005288 | Bacteria | 3491 |
| 62 | Ga0065714_10011283 | 3300005288 | Bacteria | 2115 |
| 63 | Ga0065714_10020754 | 3300005288 | Bacteria | 1772 |
| 64 | Ga0065714_10083664 | 3300005288 | Bacteria | 2221 |
| 65 | Ga0065714_10089556 | 3300005288 | Bacteria | 1975 |
| 66 | Ga0065714_10089647 | 3300005288 | Bacteria | 1971 |
| 67 | Ga0065714_10118833 | 3300005288 | Bacteria | 1374 |
| 68 | Ga0065714_10216369 | 3300005288 | Bacteria | 852 |
| 69 | Ga0065714_10217047 | 3300005288 | Bacteria | 826 |
| 70 | Ga0065714_10288794 | 3300005288 | Bacteria | 711 |
| 71 | Ga0065714_10382470 | 3300005288 | Bacteria | 605 |
| 72 | Ga0065704_10000757 | 3300005289 | Bacteria | 16510 |
| 73 | Ga0065704_10013526 | 3300005289 | Bacteria | 1496 |
| 74 | Ga0065704_10072003 | 3300005289 | Bacteria | 9408 |
| 75 | Ga0065704_10085384 | 3300005289 | Bacteria | 3228 |
| 76 | Ga0065704_10093408 | 3300005289 | Bacteria | 2596 |
| 77 | Ga0065704_10231864 | 3300005289 | Bacteria | 1040 |
| 78 | Ga0065712_10224894 | 3300005290 | Bacteria | 1028 |
| 79 | Ga0065712_10768292 | 3300005290 | Bacteria | 523 |
| 80 | Ga0065715_10015955 | 3300005293 | Bacteria | 1697 |
| 81 | Ga0065715_10109002 | 3300005293 | Bacteria | 2690 |
| 82 | Ga0065715_10118594 | 3300005293 | Bacteria | 2312 |
| 83 | Ga0065715_10142356 | 3300005293 | Bacteria | 1834 |
| 84 | Ga0065715_10938245 | 3300005293 | Bacteria | 563 |
| 85 | Ga0065707_10108988 | 3300005295 | Bacteria | 2486 |
| 86 | Ga0070658_10000014 | 3300005327 | Bacteria | 244978 |
| 87 | Ga0070658_10474022 | 3300005327 | Bacteria | 1080 |
| 88 | Ga0070676_10000852 | 3300005328 | Bacteria | 15089 |
| 89 | Ga0070676_10004106 | 3300005328 | Bacteria | 7650 |
| 90 | Ga0070683_100003409 | 3300005329 | Bacteria | 12889 |
| 91 | Ga0070683_100091959 | 3300005329 | Bacteria | 2849 |
| 92 | Ga0070670_100128832 | 3300005331 | Bacteria | 2184 |
| 93 | Ga0070670_100472812 | 3300005331 | Bacteria | 1112 |
| 94 | Ga0068869_100006678 | 3300005334 | Bacteria | 7327 |
| 95 | Ga0070666_10176639 | 3300005335 | Bacteria | 1497 |
| 96 | Ga0070680_100002006 | 3300005336 | Bacteria | 14996 |
| 97 | Ga0070680_100062159 | 3300005336 | Bacteria | 3057 |
| 98 | Ga0070680_100302481 | 3300005336 | Bacteria | 1357 |
| 99 | Ga0070680_100681878 | 3300005336 | Bacteria | 884 |
| 100 | Ga0070682_100000087 | 3300005337 | Bacteria | 83686 |
| 101 | Ga0070682_100171019 | 3300005337 | Bacteria | 1510 |
| 102 | Ga0070682_100173333 | 3300005337 | Bacteria | 1501 |
| 103 | Ga0070682_100322988 | 3300005337 | Bacteria | 1141 |
| 104 | Ga0070682_100676261 | 3300005337 | Bacteria | 825 |
| 105 | Ga0068868_100866915 | 3300005338 | Bacteria | 819 |
| 106 | Ga0070660_100028188 | 3300005339 | Bacteria | 4199 |
| 107 | Ga0070660_100082225 | 3300005339 | Bacteria | 2529 |
| 108 | Ga0070660_100100250 | 3300005339 | Bacteria | 2294 |
| 109 | Ga0070660_100197618 | 3300005339 | Bacteria | 1631 |
| 110 | Ga0070689_100055251 | 3300005340 | Bacteria | 3076 |
| 111 | Ga0070689_100074007 | 3300005340 | Bacteria | 2665 |
| 112 | Ga0070689_100451148 | 3300005340 | Bacteria | 1094 |
| 113 | Ga0070689_100581681 | 3300005340 | Bacteria | 968 |
| 114 | Ga0070687_100309619 | 3300005343 | Bacteria | 1005 |
| 115 | Ga0070661_100060578 | 3300005344 | Bacteria | 2777 |
| 116 | Ga0070661_100073348 | 3300005344 | Bacteria | 2520 |
| 117 | Ga0070661_100590876 | 3300005344 | Bacteria | 897 |
| 118 | Ga0070692_10028172 | 3300005345 | Bacteria | 2791 |
| 119 | Ga0070692_10145738 | 3300005345 | Bacteria | 1344 |
| 120 | Ga0070668_100017094 | 3300005347 | Bacteria | 5428 |
| 121 | Ga0070668_100204111 | 3300005347 | Bacteria | 1623 |
| 122 | Ga0070669_100005808 | 3300005353 | Bacteria | 8898 |
| 123 | Ga0070669_100051832 | 3300005353 | Bacteria | 3000 |
| 124 | Ga0070669_100093042 | 3300005353 | Bacteria | 2263 |
| 125 | Ga0070675_100029347 | 3300005354 | Bacteria | 4435 |
| 126 | Ga0070675_100053172 | 3300005354 | Bacteria | 3330 |
| 127 | Ga0070675_100171639 | 3300005354 | Bacteria | 1870 |
| 128 | Ga0070675_100967478 | 3300005354 | Bacteria | 781 |
| 129 | Ga0070671_100003462 | 3300005355 | Bacteria | 12327 |
| 130 | Ga0070671_100005487 | 3300005355 | Bacteria | 10117 |
| 131 | Ga0070674_100086265 | 3300005356 | Bacteria | 2254 |
| 132 | Ga0070673_100015276 | 3300005364 | Bacteria | 5387 |
| 133 | Ga0070673_100049506 | 3300005364 | Bacteria | 3281 |
| 134 | Ga0070673_100068302 | 3300005364 | Bacteria | 2845 |
| 135 | Ga0070673_100070036 | 3300005364 | Bacteria | 2813 |
| 136 | Ga0070688_100019652 | 3300005365 | Bacteria | 3916 |
| 137 | Ga0070659_100000402 | 3300005366 | Bacteria | 32771 |
| 138 | Ga0070659_100016784 | 3300005366 | Bacteria | 5501 |
| 139 | Ga0070659_100023709 | 3300005366 | Bacteria | 4699 |
| 140 | Ga0070659_100061430 | 3300005366 | Bacteria | 2969 |
| 141 | Ga0070659_100898031 | 3300005366 | Bacteria | 774 |
| 142 | Ga0070659_101468645 | 3300005366 | Bacteria | 607 |
| 143 | Ga0070667_100024096 | 3300005367 | Bacteria | 5054 |
| 144 | Ga0070667_100302485 | 3300005367 | Bacteria | 1440 |
| 145 | Ga0070714_100173670 | 3300005435 | Bacteria | 1957 |
| 146 | Ga0070714_102037064 | 3300005435 | Bacteria | 560 |
| 147 | Ga0070713_100273715 | 3300005436 | Bacteria | 1547 |
| 148 | Ga0070701_10031401 | 3300005438 | Bacteria | 2635 |
| 149 | Ga0070711_100021768 | 3300005439 | Bacteria | 4149 |
| 150 | Ga0070705_100095390 | 3300005440 | Bacteria | 1865 |
| 151 | Ga0070700_100009943 | 3300005441 | Bacteria | 5235 |
| 152 | Ga0070694_100103391 | 3300005444 | Bacteria | 2018 |
| 153 | Ga0070694_100238117 | 3300005444 | Bacteria | 1372 |
| 154 | Ga0070694_100957891 | 3300005444 | Bacteria | 709 |
| 155 | Ga0070663_100035412 | 3300005455 | Bacteria | 3464 |
| 156 | Ga0070663_100311088 | 3300005455 | Bacteria | 1264 |
| 157 | Ga0070663_100637672 | 3300005455 | Bacteria | 900 |
| 158 | Ga0070678_100001822 | 3300005456 | Bacteria | 11482 |
| 159 | Ga0070662_100014975 | 3300005457 | Bacteria | 5187 |
| 160 | Ga0070662_100059100 | 3300005457 | Bacteria | 2792 |
| 161 | Ga0070662_100323843 | 3300005457 | Bacteria | 1257 |
| 162 | Ga0070662_100328983 | 3300005457 | Bacteria | 1248 |
| 163 | Ga0070662_100472900 | 3300005457 | Bacteria | 1043 |
| 164 | Ga0070681_10003472 | 3300005458 | Bacteria | 14770 |
| 165 | Ga0070681_10008372 | 3300005458 | Bacteria | 10130 |
| 166 | Ga0070681_11508704 | 3300005458 | Bacteria | 597 |
| 167 | Ga0068867_100001197 | 3300005459 | Bacteria | 17799 |
| 168 | Ga0068867_100225030 | 3300005459 | Bacteria | 1514 |
| 169 | Ga0070685_10023543 | 3300005466 | Bacteria | 3372 |
| 170 | Ga0070685_10054316 | 3300005466 | Bacteria | 2323 |
| 171 | Ga0070685_10102990 | 3300005466 | Bacteria | 1746 |
| 172 | Ga0070706_100032249 | 3300005467 | Bacteria | 4832 |
| 173 | Ga0070706_101901071 | 3300005467 | Bacteria | 540 |
| 174 | Ga0070698_100011319 | 3300005471 | Bacteria | 9473 |
| 175 | Ga0070699_100060134 | 3300005518 | Bacteria | 3292 |
| 176 | Ga0070679_100014038 | 3300005530 | Bacteria | 7681 |
| 177 | Ga0070679_100017069 | 3300005530 | Bacteria | 7017 |
| 178 | Ga0070679_100087502 | 3300005530 | Bacteria | 3102 |
| 179 | Ga0070679_100122160 | 3300005530 | Bacteria | 2589 |
| 180 | Ga0070679_100358998 | 3300005530 | Bacteria | 1404 |
| 181 | Ga0070684_100054640 | 3300005535 | Bacteria | 3480 |
| 182 | Ga0070684_100108229 | 3300005535 | Bacteria | 2490 |
| 183 | Ga0070684_100129440 | 3300005535 | Bacteria | 2276 |
| 184 | Ga0070684_100637665 | 3300005535 | Bacteria | 991 |
| 185 | Ga0070697_100412354 | 3300005536 | Bacteria | 1173 |
| 186 | Ga0068853_100080677 | 3300005539 | Bacteria | 2847 |
| 187 | Ga0068853_100090995 | 3300005539 | Bacteria | 2682 |
| 188 | Ga0068853_100334591 | 3300005539 | Bacteria | 1406 |
| 189 | Ga0070672_100026322 | 3300005543 | Bacteria | 4326 |
| 190 | Ga0070672_100292590 | 3300005543 | Bacteria | 1379 |
| 191 | Ga0070693_100050514 | 3300005547 | Bacteria | 2377 |
| 192 | Ga0070693_100268601 | 3300005547 | Bacteria | 1138 |
| 193 | Ga0070693_100675544 | 3300005547 | Bacteria | 754 |
| 194 | Ga0070665_100000032 | 3300005548 | Bacteria | 333352 |
| 195 | Ga0070665_100202373 | 3300005548 | Bacteria | 1986 |
| 196 | Ga0070665_101146757 | 3300005548 | Bacteria | 788 |
| 197 | Ga0068855_100000026 | 3300005563 | Bacteria | 175140 |
| 198 | Ga0068855_100042965 | 3300005563 | Bacteria | 5355 |
| 199 | Ga0068855_100079811 | 3300005563 | Bacteria | 3794 |
| 200 | Ga0068855_100088358 | 3300005563 | Bacteria | 3580 |
| 201 | Ga0068855_100153698 | 3300005563 | Bacteria | 2615 |
| 202 | Ga0068855_100337587 | 3300005563 | Bacteria | 1662 |
| 203 | Ga0068855_100579060 | 3300005563 | Bacteria | 1212 |
| 204 | Ga0068855_100681485 | 3300005563 | Bacteria | 1101 |
| 205 | Ga0068855_101056822 | 3300005563 | Bacteria | 851 |
| 206 | Ga0070664_100071441 | 3300005564 | Bacteria | 2974 |
| 207 | Ga0068857_100140153 | 3300005577 | Bacteria | 2185 |
| 208 | Ga0068857_100669386 | 3300005577 | Bacteria | 985 |
| 209 | Ga0068857_101362068 | 3300005577 | Bacteria | 690 |
| 210 | Ga0068854_100049164 | 3300005578 | Bacteria | 3011 |
| 211 | Ga0068854_101222578 | 3300005578 | Bacteria | 674 |
| 212 | Ga0068854_102016889 | 3300005578 | Bacteria | 532 |
| 213 | Ga0068856_100000014 | 3300005614 | Bacteria | 163480 |
| 214 | Ga0068856_100003360 | 3300005614 | Bacteria | 16215 |
| 215 | Ga0068856_100039856 | 3300005614 | Bacteria | 4612 |
| 216 | Ga0068856_100123168 | 3300005614 | Bacteria | 2595 |
| 217 | Ga0068856_100173722 | 3300005614 | Bacteria | 2167 |
| 218 | Ga0068856_100526112 | 3300005614 | Bacteria | 1204 |
| 219 | Ga0068856_100614725 | 3300005614 | Bacteria | 1108 |
| 220 | Ga0070702_101058628 | 3300005615 | Bacteria | 646 |
| 221 | Ga0068852_100001456 | 3300005616 | Bacteria | 15984 |
| 222 | Ga0068852_100021426 | 3300005616 | Bacteria | 5160 |
| 223 | Ga0068852_100751085 | 3300005616 | Bacteria | 988 |
| 224 | Ga0068859_100079340 | 3300005617 | Bacteria | 3322 |
| 225 | Ga0068859_100107960 | 3300005617 | Bacteria | 2844 |
| 226 | Ga0068859_100180854 | 3300005617 | Bacteria | 2191 |
| 227 | Ga0068859_101109496 | 3300005617 | Bacteria | 870 |
| 228 | Ga0068859_101349300 | 3300005617 | Bacteria | 786 |
| 229 | Ga0068864_100263279 | 3300005618 | Bacteria | 1604 |
| 230 | Ga0068864_100343112 | 3300005618 | Bacteria | 1408 |
| 231 | Ga0068864_100579521 | 3300005618 | Bacteria | 1087 |
| 232 | Ga0068866_10034749 | 3300005718 | Bacteria | 2458 |
| 233 | Ga0068861_100000562 | 3300005719 | Bacteria | 22006 |
| 234 | Ga0068861_100000975 | 3300005719 | Bacteria | 17448 |
| 235 | Ga0068861_101149382 | 3300005719 | Bacteria | 748 |
| 236 | Ga0068861_101227399 | 3300005719 | Bacteria | 726 |
| 237 | Ga0068851_10000357 | 3300005834 | Bacteria | 20609 |
| 238 | Ga0068851_10203485 | 3300005834 | Bacteria | 1106 |
| 239 | Ga0068851_10641888 | 3300005834 | Bacteria | 649 |
| 240 | Ga0068863_100000969 | 3300005841 | Bacteria | 28867 |
| 241 | Ga0068863_100051547 | 3300005841 | Bacteria | 3900 |
| 242 | Ga0068863_100326755 | 3300005841 | Bacteria | 1491 |
| 243 | Ga0068863_100635317 | 3300005841 | Bacteria | 1058 |
| 244 | Ga0068863_100906656 | 3300005841 | Bacteria | 882 |
| 245 | Ga0068863_102736433 | 3300005841 | Bacteria | 502 |
| 246 | Ga0068858_100031724 | 3300005842 | Bacteria | 4910 |
| 247 | Ga0068858_100071033 | 3300005842 | Bacteria | 3228 |
| 248 | Ga0068858_100072941 | 3300005842 | Bacteria | 3186 |
| 249 | Ga0068858_100256656 | 3300005842 | Bacteria | 1661 |
| 250 | Ga0068860_100004188 | 3300005843 | Bacteria | 14782 |
| 251 | Ga0068860_100131686 | 3300005843 | Bacteria | 2400 |
| 252 | Ga0068860_100229215 | 3300005843 | Bacteria | 1805 |
| 253 | Ga0068860_102491524 | 3300005843 | Bacteria | 537 |
| 254 | Ga0068862_100013561 | 3300005844 | Bacteria | 6752 |
| 255 | Ga0068862_101367029 | 3300005844 | Bacteria | 711 |
| 256 | Ga0070717_11705124 | 3300006028 | Bacteria | 570 |
| 257 | Ga0070716_100351276 | 3300006173 | Bacteria | 1044 |
| 258 | Ga0070716_100800406 | 3300006173 | Bacteria | 730 |
| 259 | Ga0070712_100083391 | 3300006175 | Bacteria | 2321 |
| 260 | Ga0070712_100135523 | 3300006175 | Bacteria | 1872 |
| 261 | Ga0075369_10436126 | 3300006186 | Bacteria | 620 |
| 262 | Ga0075366_10000812 | 3300006195 | Bacteria | 14982 |
| 263 | Ga0075366_10140973 | 3300006195 | Bacteria | 1457 |
| 264 | Ga0075366_10566369 | 3300006195 | Bacteria | 704 |
| 265 | Ga0097621_100000057 | 3300006237 | Bacteria | 58430 |
| 266 | Ga0097621_100020011 | 3300006237 | Bacteria | 5152 |
| 267 | Ga0097621_101030470 | 3300006237 | Bacteria | 771 |
| 268 | Ga0075370_10119059 | 3300006353 | Bacteria | 1536 |
| 269 | Ga0075370_10528481 | 3300006353 | Bacteria | 713 |
| 270 | Ga0075370_10530814 | 3300006353 | Bacteria | 711 |
| 271 | Ga0068871_100000094 | 3300006358 | Bacteria | 52461 |
| 272 | Ga0068871_100013592 | 3300006358 | Bacteria | 6044 |
| 273 | Ga0068871_100849862 | 3300006358 | Bacteria | 844 |
| 274 | Ga0075428_100003457 | 3300006844 | Bacteria | 17282 |
| 275 | Ga0075428_100032084 | 3300006844 | Bacteria | 5804 |
| 276 | Ga0075428_100144106 | 3300006844 | Bacteria | 2589 |
| 277 | Ga0075428_100698736 | 3300006844 | Bacteria | 1080 |
| 278 | Ga0075430_100001414 | 3300006846 | Bacteria | 19526 |
| 279 | Ga0075430_100030156 | 3300006846 | Bacteria | 4605 |
| 280 | Ga0075430_100094296 | 3300006846 | Bacteria | 2502 |
| 281 | Ga0075430_100096433 | 3300006846 | Bacteria | 2471 |
| 282 | Ga0075431_100002689 | 3300006847 | Bacteria | 17232 |
| 283 | Ga0075431_100088689 | 3300006847 | Bacteria | 3192 |
| 284 | Ga0075431_100287042 | 3300006847 | Bacteria | 1665 |
| 285 | Ga0075431_100880819 | 3300006847 | Bacteria | 865 |
| 286 | Ga0075431_101086602 | 3300006847 | Bacteria | 765 |
| 287 | Ga0075433_10155235 | 3300006852 | Bacteria | 2036 |
| 288 | Ga0075434_100192776 | 3300006871 | Bacteria | 2058 |
| 289 | Ga0075434_100413611 | 3300006871 | Bacteria | 1370 |
| 290 | Ga0075429_100002173 | 3300006880 | Bacteria | 16374 |
| 291 | Ga0075429_100009872 | 3300006880 | Bacteria | 8276 |
| 292 | Ga0075429_100917206 | 3300006880 | Bacteria | 766 |
| 293 | Ga0075429_101098667 | 3300006880 | Bacteria | 694 |
| 294 | Ga0075429_101334970 | 3300006880 | Bacteria | 625 |
| 295 | Ga0068865_100000200 | 3300006881 | Bacteria | 33423 |
| 296 | Ga0068865_100026446 | 3300006881 | Bacteria | 3826 |
| 297 | Ga0097620_100079345 | 3300006931 | Bacteria | 3322 |
| 298 | Ga0097620_100107978 | 3300006931 | Bacteria | 2844 |
| 299 | Ga0097620_100180865 | 3300006931 | Bacteria | 2191 |
| 300 | Ga0097620_101109567 | 3300006931 | Bacteria | 870 |
| 301 | Ga0097620_101349199 | 3300006931 | Bacteria | 786 |
| 302 | Ga0075435_100115545 | 3300007076 | Bacteria | 2235 |
| 303 | Ga0105251_10012672 | 3300009011 | Bacteria | 4758 |
| 304 | Ga0105251_10149065 | 3300009011 | Bacteria | 1057 |
| 305 | Ga0105244_10000001 | 3300009036 | Bacteria | 1034899 |
| 306 | Ga0105244_10013287 | 3300009036 | Bacteria | 4822 |
| 307 | Ga0105244_10020501 | 3300009036 | Bacteria | 3671 |
| 308 | Ga0105244_10219993 | 3300009036 | Bacteria | 891 |
| 309 | Ga0105250_10025692 | 3300009092 | Bacteria | 2373 |
| 310 | Ga0105250_10119615 | 3300009092 | Bacteria | 1082 |
| 311 | Ga0105240_10015703 | 3300009093 | Bacteria | 10276 |
| 312 | Ga0105240_10067718 | 3300009093 | Bacteria | 4425 |
| 313 | Ga0105240_10129348 | 3300009093 | Bacteria | 3030 |
| 314 | Ga0105240_10140553 | 3300009093 | Bacteria | 2887 |
| 315 | Ga0105240_10221121 | 3300009093 | Bacteria | 2206 |
| 316 | Ga0105240_10260499 | 3300009093 | Bacteria | 2001 |
| 317 | Ga0105240_10276735 | 3300009093 | Bacteria | 1930 |
| 318 | Ga0105240_10429871 | 3300009093 | Bacteria | 1482 |
| 319 | Ga0105240_10654945 | 3300009093 | Bacteria | 1151 |
| 320 | Ga0105240_10877236 | 3300009093 | Bacteria | 967 |
| 321 | Ga0111539_10158570 | 3300009094 | Bacteria | 2647 |
| 322 | Ga0111539_10159065 | 3300009094 | Bacteria | 2642 |
| 323 | Ga0111539_10365710 | 3300009094 | Bacteria | 1679 |
| 324 | Ga0111539_10776634 | 3300009094 | Bacteria | 1115 |
| 325 | Ga0111539_11773332 | 3300009094 | Bacteria | 716 |
| 326 | Ga0111539_11837627 | 3300009094 | Bacteria | 702 |
| 327 | Ga0105247_10085212 | 3300009101 | Bacteria | 1998 |
| 328 | Ga0105247_10127594 | 3300009101 | Bacteria | 1655 |
| 329 | Ga0114129_10004634 | 3300009147 | Bacteria | 19404 |
| 330 | Ga0114129_10030165 | 3300009147 | Bacteria | 7680 |
| 331 | Ga0114129_10303183 | 3300009147 | Bacteria | 2128 |
| 332 | Ga0105243_10000018 | 3300009148 | Bacteria | 227618 |
| 333 | Ga0105243_10368164 | 3300009148 | Bacteria | 1325 |
| 334 | Ga0105243_10880714 | 3300009148 | Bacteria | 889 |
| 335 | Ga0105241_10019243 | 3300009174 | Bacteria | 5034 |
| 336 | Ga0105241_10127780 | 3300009174 | Bacteria | 2054 |
| 337 | Ga0105241_10152542 | 3300009174 | Bacteria | 1891 |
| 338 | Ga0105241_10218230 | 3300009174 | Bacteria | 1601 |
| 339 | Ga0105241_11532111 | 3300009174 | Bacteria | 643 |
| 340 | Ga0105241_12131542 | 3300009174 | Bacteria | 555 |
| 341 | Ga0105242_10040711 | 3300009176 | Bacteria | 3745 |
| 342 | Ga0105242_10158277 | 3300009176 | Bacteria | 1980 |
| 343 | Ga0105242_10259463 | 3300009176 | Bacteria | 1569 |
| 344 | Ga0105242_12059936 | 3300009176 | Bacteria | 614 |
| 345 | Ga0105248_10001106 | 3300009177 | Bacteria | 29895 |
| 346 | Ga0105248_10052133 | 3300009177 | Bacteria | 4591 |
| 347 | Ga0105248_10977514 | 3300009177 | Bacteria | 956 |
| 348 | Ga0105248_11746004 | 3300009177 | Bacteria | 705 |
| 349 | Ga0105248_12115238 | 3300009177 | Bacteria | 640 |
| 350 | Ga0105237_10001287 | 3300009545 | Bacteria | 33378 |
| 351 | Ga0105237_10001321 | 3300009545 | Bacteria | 32889 |
| 352 | Ga0105237_10012788 | 3300009545 | Bacteria | 8828 |
| 353 | Ga0105237_10060769 | 3300009545 | Bacteria | 3779 |
| 354 | Ga0105237_10075128 | 3300009545 | Bacteria | 3371 |
| 355 | Ga0105237_10131048 | 3300009545 | Bacteria | 2502 |
| 356 | Ga0105237_10224782 | 3300009545 | Bacteria | 1878 |
| 357 | Ga0105237_10307141 | 3300009545 | Bacteria | 1589 |
| 358 | Ga0105237_10511742 | 3300009545 | Bacteria | 1207 |
| 359 | Ga0105237_10549691 | 3300009545 | Bacteria | 1161 |
| 360 | Ga0105237_10556101 | 3300009545 | Bacteria | 1154 |
| 361 | Ga0105237_10568819 | 3300009545 | Bacteria | 1140 |
| 362 | Ga0105237_11485236 | 3300009545 | Bacteria | 684 |
| 363 | Ga0105237_12054660 | 3300009545 | Bacteria | 580 |
| 364 | Ga0105238_10003742 | 3300009551 | Bacteria | 15125 |
| 365 | Ga0105238_10097306 | 3300009551 | Bacteria | 2929 |
| 366 | Ga0105238_10128234 | 3300009551 | Bacteria | 2515 |
| 367 | Ga0105238_10645026 | 3300009551 | Bacteria | 1069 |
| 368 | Ga0105238_10719173 | 3300009551 | Bacteria | 1011 |
| 369 | Ga0105249_10006060 | 3300009553 | Bacteria | 10478 |
| 370 | Ga0105249_10008223 | 3300009553 | Bacteria | 9087 |
| 371 | Ga0105249_10479239 | 3300009553 | Bacteria | 1287 |
| 372 | Ga0105239_10000001 | 3300010375 | Bacteria | 617353 |
| 373 | Ga0105239_10001363 | 3300010375 | Bacteria | 32814 |
| 374 | Ga0105239_10005053 | 3300010375 | Bacteria | 15586 |
| 375 | Ga0105239_10023806 | 3300010375 | Bacteria | 6743 |
| 376 | Ga0105239_10192411 | 3300010375 | Bacteria | 2283 |
| 377 | Ga0105239_10622805 | 3300010375 | Bacteria | 1231 |
| 378 | Ga0105239_10844655 | 3300010375 | Bacteria | 1050 |
| 379 | Ga0105239_11040978 | 3300010375 | Bacteria | 941 |
| 380 | Ga0105239_11124118 | 3300010375 | Bacteria | 905 |
| 381 | Ga0105239_12832608 | 3300010375 | Bacteria | 566 |
| 382 | Ga0105239_13253544 | 3300010375 | Bacteria | 529 |
| 383 | Ga0105246_10112043 | 3300011119 | Bacteria | 2006 |
| 384 | Ga0105246_10234751 | 3300011119 | Bacteria | 1446 |
| 385 | Ga0105246_10828799 | 3300011119 | Bacteria | 823 |
| 386 | Ga0157325_1008804 | 3300012485 | Bacteria | 708 |
| 387 | Ga0157321_1017992 | 3300012487 | Bacteria | 621 |
| 388 | Ga0157329_1013074 | 3300012491 | Bacteria | 688 |
| 389 | Ga0157319_1019331 | 3300012497 | Bacteria | 647 |
| 390 | Ga0157327_1003754 | 3300012512 | Bacteria | 1139 |
| 391 | Ga0157373_10000054 | 3300013100 | Bacteria | 103861 |
| 392 | Ga0157373_10000448 | 3300013100 | Bacteria | 32580 |
| 393 | Ga0157373_10016881 | 3300013100 | Bacteria | 5323 |
| 394 | Ga0157373_10018002 | 3300013100 | Bacteria | 5145 |
| 395 | Ga0157373_10061203 | 3300013100 | Bacteria | 2666 |
| 396 | Ga0157373_10068921 | 3300013100 | Bacteria | 2501 |
| 397 | Ga0157373_10171486 | 3300013100 | Bacteria | 1527 |
| 398 | Ga0157373_10172455 | 3300013100 | Bacteria | 1522 |
| 399 | Ga0157373_10225466 | 3300013100 | Bacteria | 1323 |
| 400 | Ga0157373_10476989 | 3300013100 | Bacteria | 900 |
| 401 | Ga0157373_10668179 | 3300013100 | Bacteria | 760 |
| 402 | Ga0157373_11440186 | 3300013100 | Bacteria | 525 |
| 403 | Ga0157371_10000052 | 3300013102 | Bacteria | 179522 |
| 404 | Ga0157371_10002095 | 3300013102 | Bacteria | 19477 |
| 405 | Ga0157371_10009982 | 3300013102 | Bacteria | 7432 |
| 406 | Ga0157371_10012727 | 3300013102 | Bacteria | 6414 |
| 407 | Ga0157371_10132755 | 3300013102 | Bacteria | 1772 |
| 408 | Ga0157371_10182884 | 3300013102 | Bacteria | 1499 |
| 409 | Ga0157371_10237127 | 3300013102 | Bacteria | 1312 |
| 410 | Ga0157371_10242405 | 3300013102 | Bacteria | 1297 |
| 411 | Ga0157371_10487143 | 3300013102 | Bacteria | 910 |
| 412 | Ga0157371_11012007 | 3300013102 | Bacteria | 634 |
| 413 | Ga0157370_10014970 | 3300013104 | Bacteria | 7909 |
| 414 | Ga0157370_10043162 | 3300013104 | Bacteria | 4341 |
| 415 | Ga0157370_10044584 | 3300013104 | Bacteria | 4261 |
| 416 | Ga0157370_10114453 | 3300013104 | Bacteria | 2520 |
| 417 | Ga0157370_10163773 | 3300013104 | Bacteria | 2069 |
| 418 | Ga0157370_10176265 | 3300013104 | Bacteria | 1987 |
| 419 | Ga0157370_10320873 | 3300013104 | Bacteria | 1429 |
| 420 | Ga0157370_10470573 | 3300013104 | Bacteria | 1155 |
| 421 | Ga0157370_10658017 | 3300013104 | Bacteria | 957 |
| 422 | Ga0157370_10670684 | 3300013104 | Bacteria | 947 |
| 423 | Ga0157370_10857595 | 3300013104 | Bacteria | 825 |
| 424 | Ga0157370_11041377 | 3300013104 | Bacteria | 740 |
| 425 | Ga0157370_12059448 | 3300013104 | Bacteria | 511 |
| 426 | Ga0157369_10000355 | 3300013105 | Bacteria | 60997 |
| 427 | Ga0157369_10058386 | 3300013105 | Bacteria | 4162 |
| 428 | Ga0157369_10064414 | 3300013105 | Bacteria | 3948 |
| 429 | Ga0157369_10241115 | 3300013105 | Bacteria | 1888 |
| 430 | Ga0157369_10307020 | 3300013105 | Bacteria | 1650 |
| 431 | Ga0157369_10437331 | 3300013105 | Bacteria | 1355 |
| 432 | Ga0157369_11430714 | 3300013105 | Bacteria | 704 |
| 433 | Ga0157374_10092042 | 3300013296 | Bacteria | 2892 |
| 434 | Ga0157374_10150180 | 3300013296 | Bacteria | 2265 |
| 435 | Ga0157374_10240694 | 3300013296 | Bacteria | 1779 |
| 436 | Ga0157374_11247236 | 3300013296 | Bacteria | 765 |
| 437 | Ga0157374_12052736 | 3300013296 | Bacteria | 598 |
| 438 | Ga0157378_10022748 | 3300013297 | Bacteria | 5516 |
| 439 | Ga0157378_10041902 | 3300013297 | Bacteria | 4062 |
| 440 | Ga0157378_10160320 | 3300013297 | Bacteria | 2103 |
| 441 | Ga0157378_11438049 | 3300013297 | Bacteria | 733 |
| 442 | Ga0163162_10000052 | 3300013306 | Bacteria | 112651 |
| 443 | Ga0163162_10004579 | 3300013306 | Bacteria | 13316 |
| 444 | Ga0163162_10006136 | 3300013306 | Bacteria | 11634 |
| 445 | Ga0163162_10038959 | 3300013306 | Bacteria | 4746 |
| 446 | Ga0163162_10090809 | 3300013306 | Bacteria | 3136 |
| 447 | Ga0163162_10224456 | 3300013306 | Bacteria | 2008 |
| 448 | Ga0163162_10878452 | 3300013306 | Bacteria | 1011 |
| 449 | Ga0163162_12000926 | 3300013306 | Bacteria | 664 |
| 450 | Ga0157372_10000254 | 3300013307 | Bacteria | 59194 |
| 451 | Ga0157372_10001280 | 3300013307 | Bacteria | 27216 |
| 452 | Ga0157372_10042429 | 3300013307 | Bacteria | 5032 |
| 453 | Ga0157372_10122899 | 3300013307 | Bacteria | 2983 |
| 454 | Ga0157372_10151310 | 3300013307 | Bacteria | 2679 |
| 455 | Ga0157372_10153165 | 3300013307 | Bacteria | 2662 |
| 456 | Ga0157372_10265687 | 3300013307 | Bacteria | 1993 |
| 457 | Ga0157372_10372742 | 3300013307 | Bacteria | 1663 |
| 458 | Ga0157372_10481125 | 3300013307 | Bacteria | 1447 |
| 459 | Ga0157372_10914657 | 3300013307 | Bacteria | 1018 |
| 460 | Ga0157372_10946815 | 3300013307 | Bacteria | 998 |
| 461 | Ga0157372_11204962 | 3300013307 | Bacteria | 875 |
| 462 | Ga0157372_11267669 | 3300013307 | Bacteria | 851 |
| 463 | Ga0157375_10008115 | 3300013308 | Bacteria | 9188 |
| 464 | Ga0157375_10013846 | 3300013308 | Bacteria | 7190 |
| 465 | Ga0157375_10044048 | 3300013308 | Bacteria | 4331 |
| 466 | Ga0157375_10106910 | 3300013308 | Bacteria | 2891 |
| 467 | Ga0157375_10169512 | 3300013308 | Bacteria | 2330 |
| 468 | Ga0157375_10469799 | 3300013308 | Bacteria | 1423 |
| 469 | Ga0163163_10060719 | 3300014325 | Bacteria | 3744 |
| 470 | Ga0163163_10280146 | 3300014325 | Bacteria | 1719 |
| 471 | Ga0157380_10000015 | 3300014326 | Bacteria | 129842 |
| 472 | Ga0157380_10046242 | 3300014326 | Bacteria | 3417 |
| 473 | Ga0157380_10339685 | 3300014326 | Bacteria | 1400 |
| 474 | Ga0157380_10585040 | 3300014326 | Bacteria | 1101 |
| 475 | Ga0157380_12000718 | 3300014326 | Bacteria | 641 |
| 476 | Ga0157380_12570396 | 3300014326 | Bacteria | 575 |
| 477 | Ga0182008_10000030 | 3300014497 | Bacteria | 169168 |
| 478 | Ga0182008_10000062 | 3300014497 | Bacteria | 90671 |
| 479 | Ga0182008_10006054 | 3300014497 | Bacteria | 6805 |
| 480 | Ga0182008_10021142 | 3300014497 | Bacteria | 3345 |
| 481 | Ga0182008_10090076 | 3300014497 | Bacteria | 1512 |
| 482 | Ga0157379_10000562 | 3300014968 | Bacteria | 29935 |
| 483 | Ga0157379_10009212 | 3300014968 | Bacteria | 8597 |
| 484 | Ga0157379_10268826 | 3300014968 | Bacteria | 1550 |
| 485 | Ga0157376_10074456 | 3300014969 | Bacteria | 2894 |
| 486 | Ga0157376_10279806 | 3300014969 | Bacteria | 1571 |
| 487 | Ga0157376_10525825 | 3300014969 | Bacteria | 1167 |
| 488 | Ga0157376_10575405 | 3300014969 | Bacteria | 1118 |
| 489 | Ga0182006_1000003 | 3300015261 | Bacteria | 826681 |
| 490 | Ga0182006_1002415 | 3300015261 | Bacteria | 10209 |
| 491 | Ga0182006_1070067 | 3300015261 | Bacteria | 1302 |
| 492 | Ga0182007_10000003 | 3300015262 | Bacteria | 548244 |
| 493 | Ga0182007_10049861 | 3300015262 | Bacteria | 1382 |
| 494 | Ga0182005_1000076 | 3300015265 | Bacteria | 79167 |
| 495 | Ga0163161_10000009 | 3300017792 | Bacteria | 287918 |
| 496 | Ga0163161_10000641 | 3300017792 | Bacteria | 27918 |
| 497 | Ga0163161_10000862 | 3300017792 | Bacteria | 23670 |
| 498 | Ga0163161_10025292 | 3300017792 | Bacteria | 4201 |
| 499 | Ga0163161_10030399 | 3300017792 | Bacteria | 3844 |
| 500 | Ga0163161_10035920 | 3300017792 | Bacteria | 3548 |
| 501 | Ga0163161_10037844 | 3300017792 | Bacteria | 3458 |
| 502 | Ga0163161_10041013 | 3300017792 | Bacteria | 3325 |
| 503 | Ga0163161_10054458 | 3300017792 | Bacteria | 2903 |
| 504 | Ga0163161_10075458 | 3300017792 | Bacteria | 2474 |
| 505 | Ga0163161_10099208 | 3300017792 | Bacteria | 2165 |
| 506 | Ga0163161_10481887 | 3300017792 | Bacteria | 1007 |
| 507 | Ga0163161_11056009 | 3300017792 | Bacteria | 696 |
| 508 | Ga0197907_10502577 | 3300020069 | Bacteria | 1836 |
| 509 | Ga0197907_10706642 | 3300020069 | Bacteria | 2159 |
| 510 | Ga0197907_10819694 | 3300020069 | Bacteria | 4207 |
| 511 | Ga0197907_11339442 | 3300020069 | Bacteria | 821 |
| 512 | Ga0206356_10266805 | 3300020070 | Bacteria | 1129 |
| 513 | Ga0206356_10319799 | 3300020070 | Bacteria | 2513 |
| 514 | Ga0206356_10781816 | 3300020070 | Bacteria | 700 |
| 515 | Ga0206356_11054826 | 3300020070 | Bacteria | 3985 |
| 516 | Ga0206356_11795532 | 3300020070 | Bacteria | 2420 |
| 517 | Ga0206356_11849337 | 3300020070 | Bacteria | 1449 |
| 518 | Ga0206349_1678553 | 3300020075 | Bacteria | 686 |
| 519 | Ga0206349_1906000 | 3300020075 | Bacteria | 629 |
| 520 | Ga0206355_1389572 | 3300020076 | Bacteria | 514 |
| 521 | Ga0206355_1710056 | 3300020076 | Bacteria | 1509 |
| 522 | Ga0206351_10106046 | 3300020077 | Bacteria | 13123 |
| 523 | Ga0206351_10453586 | 3300020077 | Bacteria | 1408 |
| 524 | Ga0206351_10462283 | 3300020077 | Bacteria | 11313 |
| 525 | Ga0206351_10586730 | 3300020077 | Bacteria | 2505 |
| 526 | Ga0206351_10776079 | 3300020077 | Bacteria | 649 |
| 527 | Ga0206352_10195467 | 3300020078 | Bacteria | 639 |
| 528 | Ga0206352_10639884 | 3300020078 | Bacteria | 976 |
| 529 | Ga0206352_11093239 | 3300020078 | Bacteria | 539 |
| 530 | Ga0206352_11147567 | 3300020078 | Bacteria | 665 |
| 531 | Ga0206352_11257836 | 3300020078 | Bacteria | 1298 |
| 532 | Ga0206350_10111961 | 3300020080 | Bacteria | 11279 |
| 533 | Ga0206350_10297200 | 3300020080 | Bacteria | 8943 |
| 534 | Ga0206350_10464794 | 3300020080 | Bacteria | 555 |
| 535 | Ga0206350_10530843 | 3300020080 | Bacteria | 669 |
| 536 | Ga0206350_10647756 | 3300020080 | Bacteria | 730 |
| 537 | Ga0206354_10771971 | 3300020081 | Bacteria | 2472 |
| 538 | Ga0206354_10796355 | 3300020081 | Bacteria | 3126 |
| 539 | Ga0206354_11204833 | 3300020081 | Bacteria | 1496 |
| 540 | Ga0206354_11237852 | 3300020081 | Bacteria | 921 |
| 541 | Ga0206353_10800764 | 3300020082 | Bacteria | 2247 |
| 542 | Ga0206353_11117576 | 3300020082 | Bacteria | 3238 |
| 543 | Ga0206353_11125333 | 3300020082 | Bacteria | 3606 |
| 544 | Ga0206353_11264094 | 3300020082 | Bacteria | 628 |
| 545 | Ga0206353_11831860 | 3300020082 | Bacteria | 639 |
| 546 | Ga0206353_12062741 | 3300020082 | Bacteria | 1520 |
| 547 | Ga0154015_1153066 | 3300020610 | Bacteria | 6861 |
| 548 | Ga0154015_1236635 | 3300020610 | Bacteria | 10577 |
| 549 | Ga0154015_1602182 | 3300020610 | Bacteria | 1296 |
| 550 | Ga0224712_10005983 | 3300022467 | Bacteria | 3435 |
| 551 | Ga0224712_10267272 | 3300022467 | Bacteria | 793 |
| 552 | Ga0256744_137381 | 3300023309 | Bacteria | 554 |
| 553 | Ga0209436_101300 | 3300025208 | Bacteria | 8890 |
| 554 | Ga0209563_107118 | 3300025230 | Bacteria | 1861 |
| 555 | Ga0207427_100236 | 3300025231 | Bacteria | 45297 |
| 556 | Ga0207427_122187 | 3300025231 | Bacteria | 565 |
| 557 | Ga0209437_100034 | 3300025233 | Bacteria | 494007 |
| 558 | Ga0209437_100143 | 3300025233 | Bacteria | 164970 |
| 559 | Ga0209258_118342 | 3300025242 | Bacteria | 756 |
| 560 | Ga0207425_1000002 | 3300025245 | Bacteria | 1362590 |
| 561 | Ga0209026_1000463 | 3300025250 | Bacteria | 31275 |
| 562 | Ga0209026_1002304 | 3300025250 | Bacteria | 7279 |
| 563 | Ga0209026_1004428 | 3300025250 | Bacteria | 4158 |
| 564 | Ga0209148_1017590 | 3300025254 | Bacteria | 1211 |
| 565 | Ga0209129_1000002 | 3300025258 | Bacteria | 1359086 |
| 566 | Ga0209129_1013234 | 3300025258 | Bacteria | 1829 |
| 567 | Ga0209233_1000038 | 3300025261 | Bacteria | 548972 |
| 568 | Ga0209233_1019928 | 3300025261 | Bacteria | 1771 |
| 569 | Ga0207666_1014994 | 3300025271 | Bacteria | 1100 |
| 570 | Ga0209455_1001279 | 3300025272 | Bacteria | 11764 |
| 571 | Ga0207673_1028041 | 3300025290 | Bacteria | 775 |
| 572 | Ga0209675_1000059 | 3300025291 | Bacteria | 184781 |
| 573 | Ga0209676_1000294 | 3300025292 | Bacteria | 101100 |
| 574 | Ga0209025_1000004 | 3300025294 | Bacteria | 1361782 |
| 575 | Ga0209758_1000006 | 3300025297 | Bacteria | 1359562 |
| 576 | Ga0207426_1003126 | 3300025302 | Bacteria | 9435 |
| 577 | Ga0209257_1000023 | 3300025304 | Bacteria | 753019 |
| 578 | Ga0207697_10147388 | 3300025315 | Bacteria | 1023 |
| 579 | Ga0207656_10000220 | 3300025321 | Bacteria | 20616 |
| 580 | Ga0207656_10030400 | 3300025321 | Bacteria | 2231 |
| 581 | Ga0207656_10082248 | 3300025321 | Bacteria | 1449 |
| 582 | Ga0207696_1087382 | 3300025711 | Bacteria | 856 |
| 583 | Ga0207696_1134549 | 3300025711 | Bacteria | 663 |
| 584 | Ga0207655_1000018 | 3300025728 | Bacteria | 537129 |
| 585 | Ga0207655_1000093 | 3300025728 | Bacteria | 196813 |
| 586 | Ga0207655_1059925 | 3300025728 | Bacteria | 1478 |
| 587 | Ga0207713_1055674 | 3300025735 | Bacteria | 1542 |
| 588 | Ga0207642_10582530 | 3300025899 | Bacteria | 694 |
| 589 | Ga0207710_10107597 | 3300025900 | Bacteria | 1321 |
| 590 | Ga0207688_10060048 | 3300025901 | Bacteria | 2141 |
| 591 | Ga0207680_10130973 | 3300025903 | Bacteria | 1653 |
| 592 | Ga0207680_10162725 | 3300025903 | Bacteria | 1498 |
| 593 | Ga0207647_10003884 | 3300025904 | Bacteria | 11172 |
| 594 | Ga0207647_10007050 | 3300025904 | Bacteria | 8148 |
| 595 | Ga0207647_10063060 | 3300025904 | Bacteria | 2255 |
| 596 | Ga0207647_10086388 | 3300025904 | Bacteria | 1875 |
| 597 | Ga0207645_10000909 | 3300025907 | Bacteria | 24558 |
| 598 | Ga0207645_10002281 | 3300025907 | Bacteria | 15210 |
| 599 | Ga0207643_10973824 | 3300025908 | Bacteria | 549 |
| 600 | Ga0207705_10000043 | 3300025909 | Bacteria | 181491 |
| 601 | Ga0207705_10377593 | 3300025909 | Bacteria | 1095 |
| 602 | Ga0207705_10469959 | 3300025909 | Bacteria | 976 |
| 603 | Ga0207705_10559224 | 3300025909 | Bacteria | 889 |
| 604 | Ga0207684_10006660 | 3300025910 | Bacteria | 10497 |
| 605 | Ga0207654_10005184 | 3300025911 | Bacteria | 6575 |
| 606 | Ga0207654_10518295 | 3300025911 | Bacteria | 844 |
| 607 | Ga0207654_11252249 | 3300025911 | Bacteria | 541 |
| 608 | Ga0207707_10005257 | 3300025912 | Bacteria | 11339 |
| 609 | Ga0207707_10055872 | 3300025912 | Bacteria | 3434 |
| 610 | Ga0207707_10213426 | 3300025912 | Bacteria | 1681 |
| 611 | Ga0207707_10904110 | 3300025912 | Bacteria | 730 |
| 612 | Ga0207695_10000053 | 3300025913 | Bacteria | 396740 |
| 613 | Ga0207695_10020568 | 3300025913 | Bacteria | 7555 |
| 614 | Ga0207695_10029659 | 3300025913 | Bacteria | 6038 |
| 615 | Ga0207695_10034034 | 3300025913 | Bacteria | 5548 |
| 616 | Ga0207695_10044139 | 3300025913 | Bacteria | 4744 |
| 617 | Ga0207695_10088255 | 3300025913 | Bacteria | 3122 |
| 618 | Ga0207695_10088720 | 3300025913 | Bacteria | 3112 |
| 619 | Ga0207695_10196503 | 3300025913 | Bacteria | 1933 |
| 620 | Ga0207695_10287337 | 3300025913 | Bacteria | 1537 |
| 621 | Ga0207695_10530382 | 3300025913 | Bacteria | 1059 |
| 622 | Ga0207695_10807302 | 3300025913 | Bacteria | 818 |
| 623 | Ga0207671_10002869 | 3300025914 | Bacteria | 17871 |
| 624 | Ga0207671_10003103 | 3300025914 | Bacteria | 16910 |
| 625 | Ga0207671_10007516 | 3300025914 | Bacteria | 9448 |
| 626 | Ga0207671_10012211 | 3300025914 | Bacteria | 6926 |
| 627 | Ga0207671_10032530 | 3300025914 | Bacteria | 3882 |
| 628 | Ga0207671_10037359 | 3300025914 | Bacteria | 3602 |
| 629 | Ga0207671_10069032 | 3300025914 | Bacteria | 2635 |
| 630 | Ga0207671_10961347 | 3300025914 | Bacteria | 674 |
| 631 | Ga0207693_10049593 | 3300025915 | Bacteria | 3297 |
| 632 | Ga0207693_10081649 | 3300025915 | Bacteria | 2531 |
| 633 | Ga0207660_10083829 | 3300025917 | Bacteria | 2348 |
| 634 | Ga0207660_10092024 | 3300025917 | Bacteria | 2250 |
| 635 | Ga0207662_10000695 | 3300025918 | Bacteria | 15329 |
| 636 | Ga0207657_10020514 | 3300025919 | Bacteria | 6243 |
| 637 | Ga0207657_10091410 | 3300025919 | Bacteria | 2538 |
| 638 | Ga0207657_10220731 | 3300025919 | Bacteria | 1519 |
| 639 | Ga0207657_10245093 | 3300025919 | Bacteria | 1430 |
| 640 | Ga0207649_10018776 | 3300025920 | Bacteria | 3940 |
| 641 | Ga0207649_10028375 | 3300025920 | Bacteria | 3294 |
| 642 | Ga0207649_10056686 | 3300025920 | Bacteria | 2448 |
| 643 | Ga0207652_10004160 | 3300025921 | Bacteria | 11800 |
| 644 | Ga0207652_10022531 | 3300025921 | Bacteria | 5212 |
| 645 | Ga0207652_10026145 | 3300025921 | Bacteria | 4858 |
| 646 | Ga0207652_10257275 | 3300025921 | Bacteria | 1575 |
| 647 | Ga0207652_11854710 | 3300025921 | Bacteria | 508 |
| 648 | Ga0207681_10000921 | 3300025923 | Bacteria | 19202 |
| 649 | Ga0207681_10031056 | 3300025923 | Bacteria | 3486 |
| 650 | Ga0207694_10022814 | 3300025924 | Bacteria | 4747 |
| 651 | Ga0207694_10083340 | 3300025924 | Bacteria | 2514 |
| 652 | Ga0207694_10464667 | 3300025924 | Bacteria | 1057 |
| 653 | Ga0207694_10686066 | 3300025924 | Bacteria | 864 |
| 654 | Ga0207694_10779327 | 3300025924 | Bacteria | 808 |
| 655 | Ga0207650_10095058 | 3300025925 | Bacteria | 2284 |
| 656 | Ga0207650_10320790 | 3300025925 | Bacteria | 1269 |
| 657 | Ga0207659_10000169 | 3300025926 | Bacteria | 39159 |
| 658 | Ga0207659_10000843 | 3300025926 | Bacteria | 18152 |
| 659 | Ga0207659_10070326 | 3300025926 | Bacteria | 2552 |
| 660 | Ga0207659_10435990 | 3300025926 | Bacteria | 1101 |
| 661 | Ga0207687_10105232 | 3300025927 | Bacteria | 2084 |
| 662 | Ga0207700_11601388 | 3300025928 | Bacteria | 576 |
| 663 | Ga0207664_10833667 | 3300025929 | Bacteria | 829 |
| 664 | Ga0207644_10001196 | 3300025931 | Bacteria | 16709 |
| 665 | Ga0207644_10010204 | 3300025931 | Bacteria | 6189 |
| 666 | Ga0207644_10296214 | 3300025931 | Bacteria | 1302 |
| 667 | Ga0207644_10677170 | 3300025931 | Bacteria | 859 |
| 668 | Ga0207690_10000365 | 3300025932 | Bacteria | 30004 |
| 669 | Ga0207690_10063455 | 3300025932 | Bacteria | 2519 |
| 670 | Ga0207690_11265899 | 3300025932 | Bacteria | 616 |
| 671 | Ga0207706_10000057 | 3300025933 | Bacteria | 112805 |
| 672 | Ga0207706_10002035 | 3300025933 | Bacteria | 19832 |
| 673 | Ga0207706_10169742 | 3300025933 | Bacteria | 1917 |
| 674 | Ga0207706_10266418 | 3300025933 | Bacteria | 1495 |
| 675 | Ga0207686_10007982 | 3300025934 | Bacteria | 5706 |
| 676 | Ga0207686_10125683 | 3300025934 | Bacteria | 1752 |
| 677 | Ga0207686_10450592 | 3300025934 | Bacteria | 990 |
| 678 | Ga0207686_11301119 | 3300025934 | Bacteria | 597 |
| 679 | Ga0207709_10000021 | 3300025935 | Bacteria | 386722 |
| 680 | Ga0207709_10000628 | 3300025935 | Bacteria | 28907 |
| 681 | Ga0207670_10007709 | 3300025936 | Bacteria | 6033 |
| 682 | Ga0207670_10082497 | 3300025936 | Bacteria | 2253 |
| 683 | Ga0207670_10454751 | 3300025936 | Bacteria | 1033 |
| 684 | Ga0207669_10099554 | 3300025937 | Bacteria | 1917 |
| 685 | Ga0207704_10000052 | 3300025938 | Bacteria | 80866 |
| 686 | Ga0207704_10003676 | 3300025938 | Bacteria | 6974 |
| 687 | Ga0207665_10045738 | 3300025939 | Bacteria | 2931 |
| 688 | Ga0207665_10116996 | 3300025939 | Bacteria | 1879 |
| 689 | Ga0207665_10165633 | 3300025939 | Bacteria | 1593 |
| 690 | Ga0207691_10031365 | 3300025940 | Bacteria | 4961 |
| 691 | Ga0207691_10896985 | 3300025940 | Bacteria | 742 |
| 692 | Ga0207711_10002561 | 3300025941 | Bacteria | 16200 |
| 693 | Ga0207689_10004653 | 3300025942 | Bacteria | 12412 |
| 694 | Ga0207689_10080823 | 3300025942 | Bacteria | 2672 |
| 695 | Ga0207661_10007883 | 3300025944 | Bacteria | 7589 |
| 696 | Ga0207661_10007950 | 3300025944 | Bacteria | 7561 |
| 697 | Ga0207661_10090386 | 3300025944 | Bacteria | 2549 |
| 698 | Ga0207661_10252019 | 3300025944 | Bacteria | 1569 |
| 699 | Ga0207679_10002943 | 3300025945 | Bacteria | 10549 |
| 700 | Ga0207679_10003915 | 3300025945 | Bacteria | 9241 |
| 701 | Ga0207679_10188504 | 3300025945 | Bacteria | 1712 |
| 702 | Ga0207667_10000022 | 3300025949 | Bacteria | 369570 |
| 703 | Ga0207667_10001325 | 3300025949 | Bacteria | 31070 |
| 704 | Ga0207667_10012833 | 3300025949 | Bacteria | 9627 |
| 705 | Ga0207667_10073046 | 3300025949 | Bacteria | 3565 |
| 706 | Ga0207667_10152790 | 3300025949 | Bacteria | 2376 |
| 707 | Ga0207667_10419233 | 3300025949 | Bacteria | 1362 |
| 708 | Ga0207667_10800527 | 3300025949 | Bacteria | 939 |
| 709 | Ga0207651_10027165 | 3300025960 | Bacteria | 3590 |
| 710 | Ga0207651_10039011 | 3300025960 | Bacteria | 3127 |
| 711 | Ga0207712_10009138 | 3300025961 | Bacteria | 6272 |
| 712 | Ga0207712_10030186 | 3300025961 | Bacteria | 3642 |
| 713 | Ga0207712_10578305 | 3300025961 | Bacteria | 969 |
| 714 | Ga0207668_10046737 | 3300025972 | Bacteria | 2959 |
| 715 | Ga0207668_10051640 | 3300025972 | Bacteria | 2840 |
| 716 | Ga0207640_10033694 | 3300025981 | Bacteria | 3189 |
| 717 | Ga0207640_10984577 | 3300025981 | Bacteria | 741 |
| 718 | Ga0207640_11093045 | 3300025981 | Bacteria | 705 |
| 719 | Ga0207640_11596769 | 3300025981 | Bacteria | 587 |
| 720 | Ga0207640_11660664 | 3300025981 | Bacteria | 576 |
| 721 | Ga0207658_10030281 | 3300025986 | Bacteria | 3830 |
| 722 | Ga0207658_10048536 | 3300025986 | Bacteria | 3113 |
| 723 | Ga0207658_10323473 | 3300025986 | Bacteria | 1336 |
| 724 | Ga0207677_10076079 | 3300026023 | Bacteria | 2388 |
| 725 | Ga0207703_10005252 | 3300026035 | Bacteria | 10445 |
| 726 | Ga0207703_10008320 | 3300026035 | Bacteria | 8196 |
| 727 | Ga0207703_10031399 | 3300026035 | Bacteria | 4200 |
| 728 | Ga0207703_11067542 | 3300026035 | Bacteria | 775 |
| 729 | Ga0207703_11630091 | 3300026035 | Bacteria | 621 |
| 730 | Ga0207639_10030610 | 3300026041 | Bacteria | 3948 |
| 731 | Ga0207639_10157453 | 3300026041 | Bacteria | 1910 |
| 732 | Ga0207639_10287311 | 3300026041 | Bacteria | 1449 |
| 733 | Ga0207639_10610595 | 3300026041 | Bacteria | 1006 |
| 734 | Ga0207678_10310685 | 3300026067 | Bacteria | 1355 |
| 735 | Ga0207708_10004898 | 3300026075 | Bacteria | 9870 |
| 736 | Ga0207708_10296528 | 3300026075 | Bacteria | 1314 |
| 737 | Ga0207708_10663202 | 3300026075 | Bacteria | 889 |
| 738 | Ga0207702_10000036 | 3300026078 | Bacteria | 154106 |
| 739 | Ga0207702_10034672 | 3300026078 | Bacteria | 4220 |
| 740 | Ga0207702_10052280 | 3300026078 | Bacteria | 3456 |
| 741 | Ga0207702_10089289 | 3300026078 | Bacteria | 2695 |
| 742 | Ga0207702_10144049 | 3300026078 | Bacteria | 2160 |
| 743 | Ga0207702_10982685 | 3300026078 | Bacteria | 837 |
| 744 | Ga0207641_10000293 | 3300026088 | Bacteria | 62674 |
| 745 | Ga0207641_10011831 | 3300026088 | Bacteria | 7160 |
| 746 | Ga0207641_10593628 | 3300026088 | Bacteria | 1084 |
| 747 | Ga0207648_10002788 | 3300026089 | Bacteria | 18537 |
| 748 | Ga0207676_10060399 | 3300026095 | Bacteria | 2998 |
| 749 | Ga0207676_10238990 | 3300026095 | Bacteria | 1628 |
| 750 | Ga0207676_10258511 | 3300026095 | Bacteria | 1571 |
| 751 | Ga0207674_10127668 | 3300026116 | Bacteria | 2508 |
| 752 | Ga0207674_10521044 | 3300026116 | Bacteria | 1148 |
| 753 | Ga0207675_100003884 | 3300026118 | Bacteria | 14525 |
| 754 | Ga0207675_100066788 | 3300026118 | Bacteria | 3361 |
| 755 | Ga0207683_10010796 | 3300026121 | Bacteria | 7788 |
| 756 | Ga0207683_11373484 | 3300026121 | Bacteria | 653 |
| 757 | Ga0207683_11831365 | 3300026121 | Bacteria | 556 |
| 758 | Ga0207683_12069707 | 3300026121 | Bacteria | 517 |
| 759 | Ga0207698_10003054 | 3300026142 | Bacteria | 10034 |
| 760 | Ga0207698_10005473 | 3300026142 | Bacteria | 7852 |
| 761 | Ga0207698_10031644 | 3300026142 | Bacteria | 3822 |
| 762 | Ga0207698_10401696 | 3300026142 | Bacteria | 1310 |
| 763 | Ga0207698_10567760 | 3300026142 | Bacteria | 1114 |
| 764 | Ga0207698_11049840 | 3300026142 | Bacteria | 826 |
| 765 | Ga0209281_1000158 | 3300027111 | Bacteria | 162280 |
| 766 | Ga0209969_1021884 | 3300027360 | Bacteria | 955 |
| 767 | Ga0209969_1027942 | 3300027360 | Bacteria | 856 |
| 768 | Ga0209489_116311 | 3300027361 | Bacteria | 4031 |
| 769 | Ga0209995_1002344 | 3300027471 | Bacteria | 2991 |
| 770 | Ga0209968_1001388 | 3300027526 | Bacteria | 3666 |
| 771 | Ga0209974_10022486 | 3300027876 | Bacteria | 2089 |
| 772 | Ga0207428_10570692 | 3300027907 | Bacteria | 817 |
| 773 | Ga0268266_10000030 | 3300028379 | Bacteria | 417120 |
| 774 | Ga0268265_10004276 | 3300028380 | Bacteria | 9964 |
| 775 | Ga0268265_10122397 | 3300028380 | Bacteria | 2146 |
| 776 | Ga0268265_11064869 | 3300028380 | Bacteria | 801 |
| 777 | Ga0268264_10028955 | 3300028381 | Bacteria | 4534 |
| 778 | Ga0268264_10116808 | 3300028381 | Bacteria | 2346 |
| 779 | Ga0268264_10687715 | 3300028381 | Bacteria | 1015 |
| 780 | Ga0265318_10153980 | 3300028577 | Bacteria | 843 |
| 781 | Ga0265323_10000038 | 3300028653 | Bacteria | 70544 |
| 782 | Ga0265323_10015327 | 3300028653 | Unclassified | 3018 |
| 783 | Ga0307517_10006168 | 3300028786 | Bacteria | 17856 |
| 784 | Ga0307517_10262260 | 3300028786 | Bacteria | 1002 |
| 785 | Ga0307515_10000009 | 3300028794 | Bacteria | 653206 |
| 786 | Ga0307515_10049612 | 3300028794 | Bacteria | 6307 |
| 787 | Ga0307515_10244807 | 3300028794 | Bacteria | 1556 |
| 788 | Ga0307515_10486209 | 3300028794 | Bacteria | 846 |
| 789 | Ga0307515_10689333 | 3300028794 | Bacteria | 637 |
| 790 | Ga0265338_10000920 | 3300028800 | Bacteria | 49610 |
| 791 | Ga0265338_10049114 | 3300028800 | Bacteria | 3829 |
| 792 | Ga0316177_1136623 | 3300030731 | Bacteria | 824 |
| 793 | Ga0316181_1034012 | 3300030744 | Bacteria | 902 |
| 794 | Ga0316181_1133526 | 3300030744 | Bacteria | 837 |
| 795 | Ga0316181_1201818 | 3300030744 | Bacteria | 1920 |
| 796 | Ga0316181_1282363 | 3300030744 | Bacteria | 2852 |
| 797 | Ga0316182_1171482 | 3300030745 | Bacteria | 4017 |
| 798 | Ga0265766_1009546 | 3300030863 | Bacteria | 681 |
| 799 | Ga0265774_104937 | 3300031011 | Bacteria | 573 |
| 800 | Ga0265779_112346 | 3300031043 | Bacteria | 540 |
| 801 | Ga0265327_10017918 | 3300031251 | Bacteria | 4417 |
| 802 | Ga0265327_10054874 | 3300031251 | Bacteria | 2061 |
| 803 | Ga0265327_10059485 | 3300031251 | Bacteria | 1957 |
| 804 | Ga0265316_10000481 | 3300031344 | Bacteria | 45334 |
| 805 | Ga0265316_10002116 | 3300031344 | Bacteria | 20863 |
| 806 | Ga0265316_10541036 | 3300031344 | Bacteria | 830 |
| 807 | Ga0307513_10494596 | 3300031456 | Bacteria | 941 |
| 808 | Ga0307513_10840906 | 3300031456 | Bacteria | 624 |
| 809 | Ga0307509_10007266 | 3300031507 | Bacteria | 14552 |
| 810 | Ga0307509_10101371 | 3300031507 | Bacteria | 2914 |
| 811 | Ga0307509_10372105 | 3300031507 | Bacteria | 1145 |
| 812 | Ga0307408_100002257 | 3300031548 | Bacteria | 13743 |
| 813 | Ga0307408_100037589 | 3300031548 | Bacteria | 3411 |
| 814 | Ga0307408_100070397 | 3300031548 | Bacteria | 2582 |
| 815 | Ga0307408_102048102 | 3300031548 | Bacteria | 551 |
| 816 | Ga0307508_10389351 | 3300031616 | Bacteria | 985 |
| 817 | Ga0307514_10113935 | 3300031649 | Bacteria | 1907 |
| 818 | Ga0307514_10407243 | 3300031649 | Bacteria | 691 |
| 819 | Ga0265342_10203717 | 3300031712 | Unclassified | 1073 |
| 820 | Ga0265342_10311692 | 3300031712 | Bacteria | 827 |
| 821 | Ga0316576_10012743 | 3300031727 | Bacteria | 5562 |
| 822 | Ga0316576_10027864 | 3300031727 | Bacteria | 3975 |
| 823 | Ga0316576_10050475 | 3300031727 | Bacteria | 3026 |
| 824 | Ga0316576_10080691 | 3300031727 | Bacteria | 2413 |
| 825 | Ga0316576_10176552 | 3300031727 | Bacteria | 1611 |
| 826 | Ga0316576_10259036 | 3300031727 | Bacteria | 1305 |
| 827 | Ga0316576_10269349 | 3300031727 | Bacteria | 1277 |
| 828 | Ga0316576_10969568 | 3300031727 | Bacteria | 607 |
| 829 | Ga0316578_10520202 | 3300031728 | Bacteria | 700 |
| 830 | Ga0307516_10131017 | 3300031730 | Bacteria | 2287 |
| 831 | Ga0307405_10000001 | 3300031731 | Bacteria | 1731270 |
| 832 | Ga0307405_10000003 | 3300031731 | Bacteria | 569064 |
| 833 | Ga0307405_10001399 | 3300031731 | Bacteria | 10145 |
| 834 | Ga0307405_10036088 | 3300031731 | Bacteria | 2959 |
| 835 | Ga0307405_10051289 | 3300031731 | Bacteria | 2559 |
| 836 | Ga0307405_10387160 | 3300031731 | Bacteria | 1090 |
| 837 | Ga0307405_11196301 | 3300031731 | Bacteria | 657 |
| 838 | Ga0316577_10579840 | 3300031733 | Bacteria | 638 |
| 839 | Ga0307413_10000568 | 3300031824 | Bacteria | 12415 |
| 840 | Ga0307413_10816658 | 3300031824 | Bacteria | 785 |
| 841 | Ga0307410_10020508 | 3300031852 | Bacteria | 4044 |
| 842 | Ga0307410_10556354 | 3300031852 | Bacteria | 951 |
| 843 | Ga0307406_10002275 | 3300031901 | Bacteria | 10446 |
| 844 | Ga0307406_10083679 | 3300031901 | Bacteria | 2128 |
| 845 | Ga0307406_10116079 | 3300031901 | Bacteria | 1851 |
| 846 | Ga0307406_10306128 | 3300031901 | Bacteria | 1223 |
| 847 | Ga0307407_10000030 | 3300031903 | Bacteria | 97416 |
| 848 | Ga0307407_10030089 | 3300031903 | Bacteria | 2925 |
| 849 | Ga0307412_10000065 | 3300031911 | Bacteria | 122279 |
| 850 | Ga0307412_10000072 | 3300031911 | Bacteria | 105576 |
| 851 | Ga0307412_10000385 | 3300031911 | Bacteria | 27410 |
| 852 | Ga0307412_10000925 | 3300031911 | Bacteria | 16779 |
| 853 | Ga0307412_10002592 | 3300031911 | Bacteria | 10043 |
| 854 | Ga0307412_10007236 | 3300031911 | Bacteria | 6294 |
| 855 | Ga0307412_10120538 | 3300031911 | Bacteria | 1888 |
| 856 | Ga0307412_10529903 | 3300031911 | Bacteria | 986 |
| 857 | Ga0307412_10806344 | 3300031911 | Bacteria | 815 |
| 858 | Ga0307412_10826948 | 3300031911 | Bacteria | 806 |
| 859 | Ga0307412_11062801 | 3300031911 | Bacteria | 718 |
| 860 | Ga0307409_101921563 | 3300031995 | Bacteria | 621 |
| 861 | Ga0307416_100000013 | 3300032002 | Bacteria | 283585 |
| 862 | Ga0307416_100000014 | 3300032002 | Bacteria | 249053 |
| 863 | Ga0307416_100007927 | 3300032002 | Bacteria | 6802 |
| 864 | Ga0307416_100090547 | 3300032002 | Bacteria | 2623 |
| 865 | Ga0307416_100330333 | 3300032002 | Bacteria | 1532 |
| 866 | Ga0307416_100506789 | 3300032002 | Bacteria | 1272 |
| 867 | Ga0307416_100828746 | 3300032002 | Bacteria | 1022 |
| 868 | Ga0307416_102443421 | 3300032002 | Bacteria | 622 |
| 869 | Ga0307414_10000140 | 3300032004 | Bacteria | 49611 |
| 870 | Ga0307414_10007780 | 3300032004 | Bacteria | 6041 |
| 871 | Ga0307414_10010548 | 3300032004 | Bacteria | 5369 |
| 872 | Ga0307414_10043088 | 3300032004 | Bacteria | 3071 |
| 873 | Ga0307414_10073019 | 3300032004 | Bacteria | 2480 |
| 874 | Ga0307414_10079883 | 3300032004 | Bacteria | 2389 |
| 875 | Ga0307414_10100000 | 3300032004 | Bacteria | 2180 |
| 876 | Ga0307414_10100320 | 3300032004 | Bacteria | 2177 |
| 877 | Ga0307414_10120028 | 3300032004 | Bacteria | 2019 |
| 878 | Ga0307414_10131990 | 3300032004 | Bacteria | 1940 |
| 879 | Ga0307414_10141810 | 3300032004 | Bacteria | 1882 |
| 880 | Ga0307414_10191977 | 3300032004 | Bacteria | 1653 |
| 881 | Ga0307414_10279941 | 3300032004 | Bacteria | 1401 |
| 882 | Ga0307414_10281196 | 3300032004 | Bacteria | 1398 |
| 883 | Ga0307414_10318639 | 3300032004 | Bacteria | 1322 |
| 884 | Ga0307414_10528899 | 3300032004 | Bacteria | 1048 |
| 885 | Ga0307414_10662742 | 3300032004 | Bacteria | 942 |
| 886 | Ga0307414_10767053 | 3300032004 | Bacteria | 877 |
| 887 | Ga0307414_10790271 | 3300032004 | Bacteria | 865 |
| 888 | Ga0307414_11422815 | 3300032004 | Bacteria | 644 |
| 889 | Ga0307411_10000010 | 3300032005 | Bacteria | 238134 |
| 890 | Ga0307411_10037802 | 3300032005 | Bacteria | 3039 |
| 891 | Ga0307411_10116047 | 3300032005 | Bacteria | 1927 |
| 892 | Ga0307415_100149326 | 3300032126 | Bacteria | 1796 |
| 893 | Ga0307415_101670334 | 3300032126 | Bacteria | 613 |
| 894 | Ga0307415_101849028 | 3300032126 | Bacteria | 585 |
| 895 | Ga0316585_10044695 | 3300032137 | Bacteria | 1416 |
| 896 | Ga0316585_10076681 | 3300032137 | Bacteria | 1088 |
| 897 | Ga0316580_10058497 | 3300032139 | Bacteria | 1184 |
| 898 | Ga0316580_10119047 | 3300032139 | Bacteria | 809 |
| 899 | Ga0316593_10001317 | 3300032168 | Bacteria | 5411 |
| 900 | Ga0316593_10001424 | 3300032168 | Bacteria | 5268 |
| 901 | Ga0316593_10005401 | 3300032168 | Bacteria | 3366 |
| 902 | Ga0316593_10007056 | 3300032168 | Bacteria | 3067 |
| 903 | Ga0316593_10010871 | 3300032168 | Bacteria | 2627 |
| 904 | Ga0316593_10019016 | 3300032168 | Bacteria | 2118 |
| 905 | Ga0316593_10022431 | 3300032168 | Bacteria | 1983 |
| 906 | Ga0316593_10023475 | 3300032168 | Bacteria | 1946 |
| 907 | Ga0316593_10047964 | 3300032168 | Bacteria | 1437 |
| 908 | Ga0316593_10053466 | 3300032168 | Bacteria | 1368 |
| 909 | Ga0316593_10061455 | 3300032168 | Bacteria | 1285 |
| 910 | Ga0316593_10139556 | 3300032168 | Bacteria | 878 |
| 911 | Ga0316593_10239907 | 3300032168 | Bacteria | 676 |
| 912 | Ga0316593_10337803 | 3300032168 | Bacteria | 575 |
| 913 | Ga0307507_10000032 | 3300033179 | Bacteria | 194155 |
| 914 | Ga0307510_10005905 | 3300033180 | Bacteria | 14606 |
| 915 | Ga0307510_10022058 | 3300033180 | Bacteria | 7402 |
| 916 | Ga0316592_1000944 | 3300033524 | Bacteria | 4451 |
| 917 | Ga0316592_1001500 | 3300033524 | Bacteria | 3781 |
| 918 | Ga0316592_1001667 | 3300033524 | Bacteria | 3663 |
| 919 | Ga0316592_1003832 | 3300033524 | Bacteria | 2756 |
| 920 | Ga0316592_1005390 | 3300033524 | Bacteria | 2427 |
| 921 | Ga0316592_1010904 | 3300033524 | Bacteria | 1838 |
| 922 | Ga0316592_1011737 | 3300033524 | Bacteria | 1787 |
| 923 | Ga0316592_1017679 | 3300033524 | Bacteria | 1498 |
| 924 | Ga0316592_1021309 | 3300033524 | Bacteria | 1380 |
| 925 | Ga0316592_1024241 | 3300033524 | Bacteria | 1305 |
| 926 | Ga0316592_1032646 | 3300033524 | Bacteria | 1136 |
| 927 | Ga0316592_1055538 | 3300033524 | Bacteria | 886 |
| 928 | Ga0316592_1075461 | 3300033524 | Bacteria | 764 |
| 929 | Ga0316592_1088032 | 3300033524 | Bacteria | 709 |
| 930 | Ga0316592_1113262 | 3300033524 | Bacteria | 628 |
| 931 | Ga0316592_1129750 | 3300033524 | Bacteria | 588 |
| 932 | Ga0316592_1133454 | 3300033524 | Bacteria | 580 |
| 933 | Ga0316586_1000972 | 3300033527 | Bacteria | 3063 |
| 934 | Ga0316586_1002316 | 3300033527 | Bacteria | 2357 |
| 935 | Ga0316586_1007006 | 3300033527 | Bacteria | 1634 |
| 936 | Ga0316586_1047132 | 3300033527 | Bacteria | 766 |
| 937 | Ga0316586_1104026 | 3300033527 | Bacteria | 544 |
| 938 | Ga0316588_1001715 | 3300033528 | Bacteria | 3675 |
| 939 | Ga0316588_1016176 | 3300033528 | Bacteria | 1650 |
| 940 | Ga0316588_1021501 | 3300033528 | Bacteria | 1468 |
| 941 | Ga0316588_1025332 | 3300033528 | Bacteria | 1370 |
| 942 | Ga0316588_1035028 | 3300033528 | Bacteria | 1188 |
| 943 | Ga0316588_1114550 | 3300033528 | Bacteria | 680 |
| 944 | Ga0316588_1129337 | 3300033528 | Bacteria | 642 |
| 945 | Ga0316588_1129532 | 3300033528 | Bacteria | 641 |
| 946 | Ga0316596_1000933 | 3300033541 | Bacteria | 5561 |
| 947 | Ga0316596_1001316 | 3300033541 | Bacteria | 4945 |
| 948 | Ga0316596_1003631 | 3300033541 | Bacteria | 3400 |
| 949 | Ga0316596_1004659 | 3300033541 | Bacteria | 3093 |
| 950 | Ga0316596_1005709 | 3300033541 | Bacteria | 2857 |
| 951 | Ga0316596_1009273 | 3300033541 | Bacteria | 2359 |
| 952 | Ga0316596_1009752 | 3300033541 | Bacteria | 2308 |
| 953 | Ga0316596_1015300 | 3300033541 | Bacteria | 1910 |
| 954 | Ga0316596_1017392 | 3300033541 | Bacteria | 1808 |
| 955 | Ga0316596_1021017 | 3300033541 | Bacteria | 1662 |
| 956 | Ga0316596_1028750 | 3300033541 | Bacteria | 1437 |
| 957 | Ga0316596_1032378 | 3300033541 | Bacteria | 1360 |
| 958 | Ga0316596_1037825 | 3300033541 | Bacteria | 1263 |
| 959 | Ga0316596_1041213 | 3300033541 | Bacteria | 1213 |
| 960 | Ga0316596_1089556 | 3300033541 | Bacteria | 829 |
| 961 | Ga0316596_1090694 | 3300033541 | Bacteria | 824 |
| 962 | Ga0316596_1133003 | 3300033541 | Bacteria | 679 |
| 963 | Ga0316596_1148215 | 3300033541 | Bacteria | 644 |
| 964 | Ga0316596_1242811 | 3300033541 | Bacteria | 507 |
| 965 | Ga0373959_0160283 | 3300034820 | Bacteria | 574 |
| 966 | Ga0373944_0087759 | 3300035089 | Bacteria | 1036 |
| 967 | Ga0373951_0061742 | 3300035091 | Bacteria | 940 |
| 968 | Ga0373954_0408307 | 3300035118 | Bacteria | 672 |
| 969 | Ga0373960_0013130 | 3300035121 | Bacteria | 2072 |
| 970 | Ga0373942_0108523 | 3300035207 | Bacteria | 856 |
| 971 | Ga0316574_0079726 | 3300035398 | Bacteria | 2077 |
| 972 | Ga0316574_0168258 | 3300035398 | Bacteria | 1411 |
| 973 | Ga0316574_0244732 | 3300035398 | Bacteria | 1146 |
| 974 | Ga0373935_0645599 | 3300035692 | Bacteria | 776 |
| 975 | Ga0373927_0246332 | 3300035695 | Bacteria | 1175 |
| 976 | Ga0373937_0394787 | 3300036401 | Bacteria | 1312 |
| 977 | Ga0265778_001249 | 3300036457 | Bacteria | 2277 |
| 978 | Ga0316582_0005208 | 3300036647 | Bacteria | 6663 |
| 979 | Ga0316582_0012374 | 3300036647 | Bacteria | 4759 |
| 980 | Ga0316582_0456969 | 3300036647 | Bacteria | 880 |
| 981 | Ga0316582_0763131 | 3300036647 | Bacteria | 663 |
| 982 | Ga0316584_0001736 | 3300036712 | Bacteria | 13379 |
| 983 | Ga0316584_0004533 | 3300036712 | Bacteria | 9200 |
| 984 | Ga0316584_0018160 | 3300036712 | Bacteria | 5071 |
| 985 | Ga0316584_0126509 | 3300036712 | Bacteria | 1908 |
| 986 | Ga0316584_0817308 | 3300036712 | Bacteria | 632 |
| 987 | Ga0373925_1404430 | 3300037068 | Bacteria | 572 |
| 988 | Ga0395899_0000002 | 3300037312 | Bacteria | 1324310 |
| 989 | Ga0395899_0000061 | 3300037312 | Bacteria | 212002 |
| 990 | Ga0395899_0012421 | 3300037312 | Bacteria | 6524 |
| 991 | Ga0395899_0046276 | 3300037312 | Bacteria | 3241 |
| 992 | Ga0395899_0490756 | 3300037312 | Bacteria | 798 |
| 993 | Ga0395900_0000143 | 3300037418 | Bacteria | 120234 |
| 994 | Ga0395900_0000284 | 3300037418 | Bacteria | 75852 |
| 995 | Ga0395900_0125611 | 3300037418 | Bacteria | 2631 |
| 996 | Ga0395900_0258745 | 3300037418 | Bacteria | 1739 |
| 997 | Ga0395898_0049674 | 3300037466 | Bacteria | 4109 |
| 998 | Ga0395898_0059816 | 3300037466 | Bacteria | 3705 |
| 999 | Ga0395905_0000045 | 3300037471 | Bacteria | 241370 |
| 1000 | Ga0395905_0001507 | 3300037471 | Bacteria | 27862 |
| 1001 | Ga0395905_0003630 | 3300037471 | Bacteria | 16393 |
| 1002 | Ga0395905_0164245 | 3300037471 | Bacteria | 2086 |
| 1003 | Ga0395905_1684294 | 3300037471 | Bacteria | 539 |
| 1004 | Ga0395901_0000976 | 3300038443 | Bacteria | 31051 |
| 1005 | Ga0395901_0003957 | 3300038443 | Bacteria | 14901 |
| 1006 | Ga0395901_0056763 | 3300038443 | Bacteria | 4073 |
| 1007 | Ga0395901_0237197 | 3300038443 | Bacteria | 1903 |
| 1008 | Ga0395901_0276349 | 3300038443 | Bacteria | 1746 |
| 1009 | Ga0400483_029390 | 3300039062 | Bacteria | 48364 |
| 1010 | Ga0400483_050403 | 3300039062 | Bacteria | 1329 |
| 1011 | Ga0400483_124011 | 3300039062 | Bacteria | 2626 |
| 1012 | Ga0400483_195876 | 3300039062 | Bacteria | 1274 |
| 1013 | Ga0400483_226961 | 3300039062 | Bacteria | 47833 |
| 1014 | Ga0400489_00166 | 3300039093 | Bacteria | 1648 |
| 1015 | Ga0436365_0622767 | 3300039437 | Bacteria | 2913 |
| 1016 | Ga0436365_1899993 | 3300039437 | Bacteria | 762 |
| 1017 | Ga0436361_0285047 | 3300039447 | Bacteria | 6372 |
| 1018 | Ga0436361_1065956 | 3300039447 | Bacteria | 1310 |
| 1019 | Ga0439447_000448 | 3300041407 | Bacteria | 15364 |
| 1020 | Ga0439453_0030344 | 3300041408 | Bacteria | 1022 |
| 1021 | Ga0439465_0000059 | 3300041413 | Bacteria | 23849 |
| 1022 | Ga0451787_190884 | 3300041441 | Bacteria | 1502 |
| 1023 | Ga0451787_260319 | 3300041441 | Bacteria | 591 |
| 1024 | Ga0451787_275413 | 3300041441 | Bacteria | 532 |
| 1025 | Ga0451788_06079 | 3300041442 | Bacteria | 624 |
| 1026 | Ga0451788_08994 | 3300041442 | Bacteria | 702 |
| 1027 | Ga0451789_0910149 | 3300041443 | Bacteria | 1042 |
| 1028 | Ga0451789_1121600 | 3300041443 | Bacteria | 910 |
| 1029 | Ga0451790_02189 | 3300041444 | Bacteria | 1789 |
| 1030 | Ga0451790_02818 | 3300041444 | Bacteria | 1385 |
| 1031 | Ga0451790_07784 | 3300041444 | Bacteria | 681 |
| 1032 | Ga0451790_08466 | 3300041444 | Bacteria | 881 |
| 1033 | Ga0451790_08648 | 3300041444 | Bacteria | 576 |
| 1034 | Ga0451790_27903 | 3300041444 | Bacteria | 612 |
| 1035 | Ga0451790_29633 | 3300041444 | Bacteria | 681 |
| 1036 | Ga0451792_04669 | 3300041445 | Bacteria | 607 |
| 1037 | Ga0451792_14905 | 3300041445 | Bacteria | 1301 |
| 1038 | Ga0451794_07486 | 3300041446 | Bacteria | 660 |
| 1039 | Ga0451794_12521 | 3300041446 | Bacteria | 671 |
| 1040 | Ga0451794_28924 | 3300041446 | Bacteria | 1122 |
| 1041 | Ga0451794_30763 | 3300041446 | Bacteria | 582 |
| 1042 | Ga0451794_36379 | 3300041446 | Bacteria | 500 |
| 1043 | Ga0451794_38207 | 3300041446 | Bacteria | 697 |
| 1044 | Ga0451794_41130 | 3300041446 | Bacteria | 936 |
| 1045 | Ga0451794_46656 | 3300041446 | Bacteria | 1016 |
| 1046 | Ga0451796_14267 | 3300041450 | Bacteria | 772 |
| 1047 | Ga0451791_0638065 | 3300041451 | Bacteria | 1041 |
| 1048 | Ga0451791_1422218 | 3300041451 | Bacteria | 1921 |
| 1049 | Ga0451793_1805624 | 3300041452 | Bacteria | 756 |
| 1050 | Ga0451797_0299663 | 3300041453 | Bacteria | 681 |
| 1051 | Ga0451797_0547988 | 3300041453 | Bacteria | 844 |
| 1052 | Ga0451797_0843647 | 3300041453 | Bacteria | 800 |
| 1053 | Ga0451799_34312 | 3300041454 | Bacteria | 597 |
| 1054 | Ga0451795_0287747 | 3300041456 | Bacteria | 809 |
| 1055 | Ga0451795_0330379 | 3300041456 | Bacteria | 651 |
| 1056 | Ga0451795_0366728 | 3300041456 | Bacteria | 1568 |
| 1057 | Ga0451795_0531346 | 3300041456 | Bacteria | 3201 |
| 1058 | Ga0451795_0712291 | 3300041456 | Bacteria | 802 |
| 1059 | Ga0451795_0944706 | 3300041456 | Bacteria | 1101 |
| 1060 | Ga0451795_1233880 | 3300041456 | Bacteria | 3095 |
| 1061 | Ga0451795_1279062 | 3300041456 | Bacteria | 675 |
| 1062 | Ga0451795_1367261 | 3300041456 | Bacteria | 1198 |
| 1063 | Ga0451795_1448660 | 3300041456 | Bacteria | 689 |
| 1064 | Ga0451795_1631148 | 3300041456 | Bacteria | 1279 |
| 1065 | Ga0451803_12559 | 3300041457 | Bacteria | 649 |
| 1066 | Ga0451802_0278220 | 3300041460 | Bacteria | 834 |
| 1067 | Ga0451802_2099772 | 3300041460 | Bacteria | 1028 |
| 1068 | Ga0451805_071652 | 3300041461 | Bacteria | 976 |
| 1069 | Ga0451805_080062 | 3300041461 | Bacteria | 606 |
| 1070 | Ga0451805_090433 | 3300041461 | Bacteria | 1204 |
| 1071 | Ga0451805_090728 | 3300041461 | Bacteria | 770 |
| 1072 | Ga0451806_626055 | 3300041462 | Bacteria | 646 |
| 1073 | Ga0451804_0537731 | 3300041463 | Bacteria | 577 |
| 1074 | Ga0451808_04048 | 3300041464 | Bacteria | 582 |
| 1075 | Ga0451807_0716238 | 3300041486 | Bacteria | 869 |
| 1076 | Ga0451807_2059496 | 3300041486 | Bacteria | 1623 |
| 1077 | Ga0451807_2675568 | 3300041486 | Bacteria | 1064 |
| 1078 | Ga0451833_1205465 | 3300041491 | Bacteria | 1011 |
| 1079 | Ga0451836_08780 | 3300041493 | Bacteria | 530 |
| 1080 | Ga0451837_0040229 | 3300041494 | Bacteria | 2161 |
| 1081 | Ga0451837_0608429 | 3300041494 | Bacteria | 878 |
| 1082 | Ga0451837_0813853 | 3300041494 | Bacteria | 787 |
| 1083 | Ga0451837_1109650 | 3300041494 | Bacteria | 1096 |
| 1084 | Ga0451840_01673 | 3300041497 | Bacteria | 564 |
| 1085 | Ga0451841_1223165 | 3300041498 | Bacteria | 693 |
| 1086 | Ga0451846_27502 | 3300041502 | Bacteria | 559 |
| 1087 | Ga0451847_0250895 | 3300041503 | Bacteria | 817 |
| 1088 | Ga0451847_0611722 | 3300041503 | Bacteria | 518 |
| 1089 | Ga0451850_54086 | 3300041506 | Bacteria | 701 |
| 1090 | Ga0451851_0814099 | 3300041507 | Bacteria | 857 |
| 1091 | Ga0451851_0960257 | 3300041507 | Bacteria | 518 |
| 1092 | Ga0451852_06555 | 3300041508 | Bacteria | 702 |
| 1093 | Ga0451852_36362 | 3300041508 | Bacteria | 939 |
| 1094 | Ga0451852_44034 | 3300041508 | Bacteria | 2681 |
| 1095 | Ga0451843_0050032 | 3300041509 | Bacteria | 768 |
| 1096 | Ga0451843_0575012 | 3300041509 | Bacteria | 748 |
| 1097 | Ga0451843_1460174 | 3300041509 | Bacteria | 537 |
| 1098 | Ga0451854_21462 | 3300041510 | Bacteria | 1378 |
| 1099 | Ga0451855_0044321 | 3300041511 | Bacteria | 1755 |
| 1100 | Ga0451855_0129181 | 3300041511 | Bacteria | 4451 |
| 1101 | Ga0451855_0274826 | 3300041511 | Bacteria | 601 |
| 1102 | Ga0451855_0368377 | 3300041511 | Bacteria | 993 |
| 1103 | Ga0451855_0517858 | 3300041511 | Bacteria | 1525 |
| 1104 | Ga0451855_0696871 | 3300041511 | Bacteria | 675 |
| 1105 | Ga0451855_0991025 | 3300041511 | Bacteria | 530 |
| 1106 | Ga0451855_1020551 | 3300041511 | Bacteria | 662 |
| 1107 | Ga0452268_13769 | 3300041907 | Bacteria | 554 |
| 1108 | Ga0452268_16729 | 3300041907 | Bacteria | 864 |
| 1109 | Ga0452268_21896 | 3300041907 | Bacteria | 511 |
| 1110 | Ga0452268_35472 | 3300041907 | Bacteria | 900 |
| 1111 | Ga0452269_1053 | 3300041908 | Bacteria | 553 |
| 1112 | Ga0452271_05642 | 3300041916 | Bacteria | 561 |
| 1113 | Ga0452271_28809 | 3300041916 | Bacteria | 679 |
| 1114 | Ga0439433_0021808 | 3300041999 | Bacteria | 1434 |
| 1115 | Ga0439445_0000513 | 3300042004 | Bacteria | 7833 |
| 1116 | Ga0439445_0100589 | 3300042004 | Bacteria | 820 |
| 1117 | Ga0439448_0007567 | 3300042005 | Bacteria | 3153 |
| 1118 | Ga0439448_0029702 | 3300042005 | Bacteria | 1731 |
| 1119 | Ga0439450_019604 | 3300042008 | Bacteria | 1435 |
| 1120 | Ga0439455_0009871 | 3300042012 | Bacteria | 2084 |
| 1121 | Ga0439455_0056405 | 3300042012 | Bacteria | 1035 |
| 1122 | Ga0439457_009023 | 3300042014 | Bacteria | 2332 |
| 1123 | Ga0439462_0082276 | 3300042015 | Bacteria | 880 |
| 1124 | Ga0450890_012146 | 3300042127 | Bacteria | 1116 |
| 1125 | Ga0439446_0026548 | 3300042156 | Bacteria | 1660 |
| 1126 | Ga0439460_0249123 | 3300042461 | Bacteria | 614 |
| 1127 | Ga0450893_0004983 | 3300042532 | Bacteria | 2121 |
| 1128 | Ga0451577_0000854 | 3300042876 | Bacteria | 45411 |
| 1129 | Ga0451577_0001297 | 3300042876 | Bacteria | 34391 |
| 1130 | Ga0451577_0003726 | 3300042876 | Bacteria | 16640 |
| 1131 | Ga0451577_0011827 | 3300042876 | Bacteria | 8233 |
| 1132 | Ga0451577_0022661 | 3300042876 | Bacteria | 5734 |
| 1133 | Ga0451577_0025338 | 3300042876 | Bacteria | 5383 |
| 1134 | Ga0451577_0031270 | 3300042876 | Bacteria | 4804 |
| 1135 | Ga0451577_0057422 | 3300042876 | Bacteria | 3470 |
| 1136 | Ga0451577_0075809 | 3300042876 | Bacteria | 2999 |
| 1137 | Ga0451577_0079353 | 3300042876 | Bacteria | 2926 |
| 1138 | Ga0451577_0182065 | 3300042876 | Bacteria | 1894 |
| 1139 | Ga0451577_0246633 | 3300042876 | Bacteria | 1616 |
| 1140 | Ga0451577_0264702 | 3300042876 | Bacteria | 1557 |
| 1141 | Ga0451577_0273441 | 3300042876 | Bacteria | 1530 |
| 1142 | Ga0451577_0274429 | 3300042876 | Unclassified | 1527 |
| 1143 | Ga0451577_0435209 | 3300042876 | Bacteria | 1191 |
| 1144 | Ga0451577_0485948 | 3300042876 | Bacteria | 1121 |
| 1145 | Ga0451577_0580449 | 3300042876 | Bacteria | 1018 |
| 1146 | Ga0451577_1266591 | 3300042876 | Bacteria | 656 |
| 1147 | Ga0451577_1678341 | 3300042876 | Bacteria | 559 |
| 1148 | Ga0453683_0014479 | 3300044673 | Bacteria | 5118 |
| 1149 | Ga0453683_0032774 | 3300044673 | Bacteria | 3276 |
| 1150 | Ga0453683_0033895 | 3300044673 | Bacteria | 3220 |
| 1151 | Ga0453683_0038384 | 3300044673 | Bacteria | 3010 |
| 1152 | Ga0453683_0042488 | 3300044673 | Bacteria | 2854 |
| 1153 | Ga0453683_0056977 | 3300044673 | Bacteria | 2445 |
| 1154 | Ga0453683_0089489 | 3300044673 | Bacteria | 1929 |
| 1155 | Ga0453683_0206789 | 3300044673 | Bacteria | 1246 |
| 1156 | Ga0453683_0222554 | 3300044673 | Bacteria | 1200 |
| 1157 | Ga0453683_0499328 | 3300044673 | Bacteria | 789 |
| 1158 | Ga0453683_0624968 | 3300044673 | Bacteria | 703 |
| 1159 | Ga0453683_0821136 | 3300044673 | Bacteria | 613 |
| 1160 | Ga0466964_0042874 | 3300044706 | Bacteria | 1834 |
| 1161 | Ga0453684_0000011 | 3300044712 | Bacteria | 1108399 |
| 1162 | Ga0453684_0000194 | 3300044712 | Bacteria | 265783 |
| 1163 | Ga0453684_0000197 | 3300044712 | Bacteria | 264445 |
| 1164 | Ga0453684_0000779 | 3300044712 | Bacteria | 109902 |
| 1165 | Ga0453684_0001358 | 3300044712 | Bacteria | 71434 |
| 1166 | Ga0453684_0001456 | 3300044712 | Bacteria | 67220 |
| 1167 | Ga0453684_0001891 | 3300044712 | Bacteria | 54349 |
| 1168 | Ga0453684_0002943 | 3300044712 | Bacteria | 39941 |
| 1169 | Ga0453684_0004073 | 3300044712 | Bacteria | 31745 |
| 1170 | Ga0453684_0006165 | 3300044712 | Bacteria | 23060 |
| 1171 | Ga0453684_0009847 | 3300044712 | Bacteria | 16550 |
| 1172 | Ga0453684_0024439 | 3300044712 | Bacteria | 8830 |
| 1173 | Ga0453684_0037423 | 3300044712 | Bacteria | 6661 |
| 1174 | Ga0453684_0046511 | 3300044712 | Bacteria | 5770 |
| 1175 | Ga0453684_0057481 | 3300044712 | Bacteria | 5034 |
| 1176 | Ga0453684_0058092 | 3300044712 | Bacteria | 5000 |
| 1177 | Ga0453684_0060601 | 3300044712 | Bacteria | 4864 |
| 1178 | Ga0453684_0064802 | 3300044712 | Bacteria | 4664 |
| 1179 | Ga0453684_0127015 | 3300044712 | Bacteria | 3067 |
| 1180 | Ga0453684_0140381 | 3300044712 | Bacteria | 2886 |
| 1181 | Ga0453684_0180136 | 3300044712 | Bacteria | 2481 |
| 1182 | Ga0453684_0253166 | 3300044712 | Bacteria | 2021 |
| 1183 | Ga0453684_0308865 | 3300044712 | Bacteria | 1795 |
| 1184 | Ga0453684_0375729 | 3300044712 | Bacteria | 1597 |
| 1185 | Ga0453684_0425574 | 3300044712 | Bacteria | 1482 |
| 1186 | Ga0453684_0467645 | 3300044712 | Bacteria | 1401 |
| 1187 | Ga0453684_0614489 | 3300044712 | Bacteria | 1190 |
| 1188 | Ga0453684_0817984 | 3300044712 | Bacteria | 1003 |
| 1189 | Ga0453684_0919404 | 3300044712 | Bacteria | 936 |
| 1190 | Ga0453684_1055676 | 3300044712 | Unclassified | 861 |
| 1191 | Ga0453684_1456891 | 3300044712 | Bacteria | 708 |
| 1192 | Ga0453684_1461441 | 3300044712 | Bacteria | 707 |
| 1193 | Ga0453684_1778979 | 3300044712 | Unclassified | 627 |
| 1194 | Ga0453684_1998358 | 3300044712 | Bacteria | 584 |
| 1195 | Ga0466959_0260439 | 3300045049 | Bacteria | 1194 |
| 1196 | Ga0451576_0000003 | 3300045051 | Bacteria | 1550573 |
| 1197 | Ga0451576_0004347 | 3300045051 | Bacteria | 18488 |
| 1198 | Ga0451576_0006577 | 3300045051 | Bacteria | 14217 |
| 1199 | Ga0451576_0007377 | 3300045051 | Bacteria | 13170 |
| 1200 | Ga0451576_0010553 | 3300045051 | Bacteria | 10581 |
| 1201 | Ga0451576_0013829 | 3300045051 | Bacteria | 9016 |
| 1202 | Ga0451576_0022593 | 3300045051 | Bacteria | 6819 |
| 1203 | Ga0451576_0044632 | 3300045051 | Bacteria | 4672 |
| 1204 | Ga0451576_0062300 | 3300045051 | Bacteria | 3888 |
| 1205 | Ga0451576_0100168 | 3300045051 | Bacteria | 3013 |
| 1206 | Ga0451576_0161739 | 3300045051 | Bacteria | 2337 |
| 1207 | Ga0451576_0189408 | 3300045051 | Bacteria | 2148 |
| 1208 | Ga0451576_0225019 | 3300045051 | Bacteria | 1959 |
| 1209 | Ga0451576_0226040 | 3300045051 | Bacteria | 1954 |
| 1210 | Ga0451576_1001280 | 3300045051 | Bacteria | 876 |
| 1211 | Ga0451576_1153877 | 3300045051 | Bacteria | 810 |
| 1212 | Ga0451576_1732574 | 3300045051 | Bacteria | 647 |
| 1213 | Ga0451576_1827137 | 3300045051 | Bacteria | 628 |
| 1214 | Ga0451576_1846626 | 3300045051 | Bacteria | 624 |
| 1215 | Ga0451576_1976816 | 3300045051 | Bacteria | 601 |
| 1216 | Ga0451576_2139450 | 3300045051 | Bacteria | 575 |
| 1217 | Ga0466967_0039117 | 3300045976 | Bacteria | 4074 |
| 1218 | Ga0466967_0084399 | 3300045976 | Bacteria | 2874 |
| 1219 | Ga0495627_000067 | 3300046453 | Bacteria | 130165 |
| 1220 | Ga0495627_002663 | 3300046453 | Bacteria | 8378 |
| 1221 | Ga0495590_0042540 | 3300046457 | Bacteria | 1584 |
| 1222 | Ga0495629_0121662 | 3300046459 | Bacteria | 1818 |
| 1223 | Ga0495629_0126330 | 3300046459 | Bacteria | 1781 |
| 1224 | Ga0495638_0098466 | 3300046460 | Bacteria | 1752 |
| 1225 | Ga0495638_0122692 | 3300046460 | Bacteria | 1534 |
| 1226 | Ga0495638_0136173 | 3300046460 | Bacteria | 1438 |
| 1227 | Ga0495638_0231104 | 3300046460 | Bacteria | 1029 |
| 1228 | Ga0495641_0314106 | 3300046461 | Bacteria | 707 |
| 1229 | Ga0495651_0032684 | 3300046462 | Bacteria | 4057 |
| 1230 | Ga0495651_0230749 | 3300046462 | Bacteria | 1275 |
| 1231 | Ga0495650_0000594 | 3300046471 | Bacteria | 49931 |
| 1232 | Ga0495580_0118598 | 3300046472 | Bacteria | 1837 |
| 1233 | Ga0495605_0239097 | 3300046474 | Bacteria | 780 |
| 1234 | Ga0495664_0000007 | 3300046477 | Bacteria | 386710 |
| 1235 | Ga0495585_0003458 | 3300046492 | Bacteria | 10667 |
| 1236 | Ga0495585_0004171 | 3300046492 | Bacteria | 9440 |
| 1237 | Ga0495585_0258813 | 3300046492 | Bacteria | 866 |
| 1238 | Ga0495596_0022478 | 3300046500 | Bacteria | 2567 |
| 1239 | Ga0495607_0034827 | 3300046501 | Bacteria | 3052 |
| 1240 | Ga0495607_0100116 | 3300046501 | Bacteria | 1554 |
| 1241 | Ga0495607_0254487 | 3300046501 | Bacteria | 844 |
| 1242 | Ga0495607_0328816 | 3300046501 | Bacteria | 711 |
| 1243 | Ga0495607_0360535 | 3300046501 | Bacteria | 669 |
| 1244 | Ga0495583_0028887 | 3300046506 | Bacteria | 2720 |
| 1245 | Ga0495606_0027164 | 3300046507 | Bacteria | 4064 |
| 1246 | Ga0495606_0030744 | 3300046507 | Bacteria | 3745 |
| 1247 | Ga0495606_0037734 | 3300046507 | Bacteria | 3278 |
| 1248 | Ga0495606_0057780 | 3300046507 | Bacteria | 2497 |
| 1249 | Ga0495606_0085902 | 3300046507 | Bacteria | 1945 |
| 1250 | Ga0495606_0089225 | 3300046507 | Bacteria | 1900 |
| 1251 | Ga0495606_0477622 | 3300046507 | Bacteria | 633 |
| 1252 | Ga0495608_0174230 | 3300046511 | Bacteria | 1363 |
| 1253 | Ga0495608_0570398 | 3300046511 | Bacteria | 681 |
| 1254 | Ga0495610_0000006 | 3300046512 | Bacteria | 856822 |
| 1255 | Ga0495610_0001861 | 3300046512 | Bacteria | 18285 |
| 1256 | Ga0495610_0007560 | 3300046512 | Bacteria | 7198 |
| 1257 | Ga0495610_0052876 | 3300046512 | Bacteria | 1970 |
| 1258 | Ga0495610_0224928 | 3300046512 | Bacteria | 756 |
| 1259 | Ga0495616_0006133 | 3300046513 | Bacteria | 7319 |
| 1260 | Ga0495616_0010134 | 3300046513 | Bacteria | 5469 |
| 1261 | Ga0495616_0010222 | 3300046513 | Bacteria | 5443 |
| 1262 | Ga0495618_0126846 | 3300046514 | Bacteria | 1634 |
| 1263 | Ga0495628_0282519 | 3300046516 | Bacteria | 1232 |
| 1264 | Ga0495631_0025389 | 3300046518 | Bacteria | 2728 |
| 1265 | Ga0495631_0122889 | 3300046518 | Bacteria | 1116 |
| 1266 | Ga0495632_0009820 | 3300046519 | Bacteria | 5727 |
| 1267 | Ga0495632_0158702 | 3300046519 | Bacteria | 1043 |
| 1268 | Ga0495637_0021088 | 3300046520 | Bacteria | 2990 |
| 1269 | Ga0495637_0099456 | 3300046520 | Bacteria | 1138 |
| 1270 | Ga0495643_0000948 | 3300046522 | Bacteria | 30016 |
| 1271 | Ga0495643_0007748 | 3300046522 | Bacteria | 6876 |
| 1272 | Ga0495643_0266685 | 3300046522 | Bacteria | 793 |
| 1273 | Ga0495643_0318438 | 3300046522 | Bacteria | 704 |
| 1274 | Ga0495648_0004657 | 3300046524 | Bacteria | 11632 |
| 1275 | Ga0495663_0000043 | 3300046525 | Bacteria | 63128 |
| 1276 | Ga0495663_0010896 | 3300046525 | Bacteria | 2529 |
| 1277 | Ga0495663_0026521 | 3300046525 | Bacteria | 1697 |
| 1278 | Ga0495652_0185809 | 3300046529 | Bacteria | 1590 |
| 1279 | Ga0495654_0000017 | 3300046530 | Bacteria | 295999 |
| 1280 | Ga0495654_0011017 | 3300046530 | Bacteria | 4910 |
| 1281 | Ga0495654_0071533 | 3300046530 | Bacteria | 1643 |
| 1282 | Ga0495609_0000780 | 3300046538 | Bacteria | 23818 |
| 1283 | Ga0495609_0005251 | 3300046538 | Bacteria | 6875 |
| 1284 | Ga0495621_0111333 | 3300046539 | Bacteria | 1050 |
| 1285 | Ga0495645_0326213 | 3300046543 | Bacteria | 995 |
| 1286 | Ga0495622_0026339 | 3300046557 | Bacteria | 2716 |
| 1287 | Ga0495633_0000021 | 3300046558 | Bacteria | 227171 |
| 1288 | Ga0495633_0000680 | 3300046558 | Bacteria | 31336 |
| 1289 | Ga0495633_0096896 | 3300046558 | Bacteria | 1370 |
| 1290 | Ga0495668_0000673 | 3300046616 | Bacteria | 41193 |
| 1291 | Ga0495668_0110755 | 3300046616 | Bacteria | 1502 |
| 1292 | Ga0495625_0000021 | 3300046660 | Bacteria | 282133 |
| 1293 | Ga0495625_0004265 | 3300046660 | Bacteria | 13612 |
| 1294 | Ga0495625_0033407 | 3300046660 | Bacteria | 3805 |
| 1295 | Ga0495625_0047911 | 3300046660 | Bacteria | 3080 |
| 1296 | Ga0495625_0110420 | 3300046660 | Bacteria | 1880 |
| 1297 | Ga0495625_0159974 | 3300046660 | Bacteria | 1509 |
| 1298 | Ga0495625_0287222 | 3300046660 | Bacteria | 1056 |
| 1299 | Ga0495661_0000739 | 3300046665 | Bacteria | 31861 |
| 1300 | Ga0495661_0008232 | 3300046665 | Bacteria | 7223 |
| 1301 | Ga0495588_0182890 | 3300046674 | Bacteria | 1108 |
| 1302 | Ga0495657_0455975 | 3300046675 | Bacteria | 748 |
| 1303 | Ga0495658_0141088 | 3300046683 | Bacteria | 1473 |
| 1304 | Ga0495670_0119049 | 3300046691 | Bacteria | 1371 |
| 1305 | Ga0495671_0072492 | 3300046692 | Bacteria | 1691 |
| 1306 | Ga0495671_0136005 | 3300046692 | Bacteria | 1198 |
| 1307 | Ga0495649_0000009 | 3300046694 | Bacteria | 451725 |
| 1308 | Ga0495649_0023066 | 3300046694 | Bacteria | 3477 |
| 1309 | Ga0495660_0005455 | 3300046810 | Bacteria | 7616 |
| 1310 | Ga0495660_0050714 | 3300046810 | Bacteria | 2260 |
| 1311 | Ga0495660_0079118 | 3300046810 | Bacteria | 1727 |
| 1312 | Ga0495581_0660112 | 3300047315 | Bacteria | 604 |
| 1313 | Ga0495680_0539006 | 3300047322 | Bacteria | 788 |
| 1314 | Ga0495683_0291568 | 3300047323 | Bacteria | 703 |
| 1315 | Ga0495687_001340 | 3300047443 | Bacteria | 22938 |
| 1316 | Ga0495687_020359 | 3300047443 | Bacteria | 3233 |
| 1317 | Ga0495673_0016437 | 3300047469 | Bacteria | 3783 |
| 1318 | Ga0495681_0230989 | 3300047470 | Bacteria | 738 |
| 1319 | Ga0495686_0021467 | 3300047472 | Bacteria | 4287 |
| 1320 | Ga0495686_0060699 | 3300047472 | Bacteria | 2350 |
| 1321 | Ga0495686_0129726 | 3300047472 | Bacteria | 1496 |
| 1322 | Ga0495686_0131215 | 3300047472 | Bacteria | 1485 |
| 1323 | Ga0495686_0384665 | 3300047472 | Bacteria | 756 |
| 1324 | Ga0495615_0042524 | 3300048090 | Bacteria | 1140 |
| 1325 | Ga0496102_0238774 | 3300048905 | Bacteria | 1714 |
| 1326 | Ga0496105_0435175 | 3300048908 | Bacteria | 1037 |
| 1327 | Ga0496108_0460348 | 3300048911 | Bacteria | 1111 |
| 1328 | Ga0496110_0612555 | 3300048913 | Bacteria | 987 |
| 1329 | Ga0496113_0085785 | 3300048916 | Bacteria | 2419 |
| 1330 | Ga0496113_0695514 | 3300048916 | Bacteria | 812 |
| 1331 | Ga0496114_0599002 | 3300048917 | Bacteria | 972 |
| 1332 | Ga0496115_0002997 | 3300048918 | Bacteria | 12131 |
| 1333 | Ga0496116_0000156 | 3300048919 | Bacteria | 140734 |
| 1334 | Ga0496116_0000199 | 3300048919 | Bacteria | 116470 |
| 1335 | Ga0496116_0005208 | 3300048919 | Bacteria | 12179 |
| 1336 | Ga0496117_0000076 | 3300048920 | Bacteria | 232366 |
| 1337 | Ga0496117_0015077 | 3300048920 | Bacteria | 6618 |
| 1338 | Ga0496118_0001659 | 3300048921 | Bacteria | 32694 |
| 1339 | Ga0496118_0070500 | 3300048921 | Bacteria | 2523 |
| 1340 | Ga0496119_0000021 | 3300048922 | Bacteria | 277056 |
| 1341 | Ga0496121_0000030 | 3300048924 | Bacteria | 412079 |
| 1342 | Ga0496121_0075674 | 3300048924 | Bacteria | 2688 |
| 1343 | Ga0496121_0394902 | 3300048924 | Bacteria | 908 |
| 1344 | Ga0496122_0000625 | 3300048925 | Bacteria | 72309 |
| 1345 | Ga0496122_0011897 | 3300048925 | Bacteria | 8742 |
| 1346 | Ga0496122_0013994 | 3300048925 | Bacteria | 7794 |
| 1347 | Ga0496122_0026712 | 3300048925 | Bacteria | 4965 |
| 1348 | Ga0496122_0032264 | 3300048925 | Bacteria | 4335 |
| 1349 | Ga0496122_0244208 | 3300048925 | Bacteria | 1009 |
| 1350 | Ga0496123_0003734 | 3300048926 | Bacteria | 16722 |
| 1351 | Ga0496123_0015161 | 3300048926 | Bacteria | 6341 |
| 1352 | Ga0496123_0015827 | 3300048926 | Bacteria | 6161 |
| 1353 | Ga0496123_0064856 | 3300048926 | Bacteria | 2325 |
| 1354 | Ga0496124_0002475 | 3300048927 | Bacteria | 24121 |
| 1355 | Ga0496124_0040283 | 3300048927 | Bacteria | 4043 |
| 1356 | Ga0496125_0000062 | 3300048928 | Bacteria | 259277 |
| 1357 | Ga0496125_0000452 | 3300048928 | Bacteria | 74236 |
| 1358 | Ga0496125_0045300 | 3300048928 | Bacteria | 3704 |
| 1359 | Ga0496125_0065617 | 3300048928 | Bacteria | 2874 |
| 1360 | Ga0496125_0100691 | 3300048928 | Bacteria | 2129 |
| 1361 | Ga0496125_0156945 | 3300048928 | Bacteria | 1553 |
| 1362 | Ga0496125_0443612 | 3300048928 | Bacteria | 746 |
| 1363 | Ga0496126_0001324 | 3300048929 | Bacteria | 39392 |
| 1364 | Ga0496126_0026501 | 3300048929 | Bacteria | 5557 |
| 1365 | Ga0496126_0031118 | 3300048929 | Bacteria | 5047 |
| 1366 | Ga0496126_0390404 | 3300048929 | Bacteria | 1131 |
| 1367 | Ga0501306_000090 | 3300049127 | Bacteria | 4994 |
| 1368 | Ga0501306_003219 | 3300049127 | Bacteria | 1743 |
| 1369 | Ga0501306_003286 | 3300049127 | Bacteria | 1731 |
| 1370 | Ga0501306_007803 | 3300049127 | Bacteria | 1290 |
| 1371 | Ga0501306_036287 | 3300049127 | Bacteria | 751 |
| 1372 | Ga0501306_037179 | 3300049127 | Bacteria | 744 |
| 1373 | Ga0501306_056119 | 3300049127 | Bacteria | 641 |
| 1374 | Ga0501308_001515 | 3300049128 | Bacteria | 1877 |
| 1375 | Ga0501308_004388 | 3300049128 | Bacteria | 1358 |
| 1376 | Ga0501308_008086 | 3300049128 | Bacteria | 1117 |
| 1377 | Ga0501308_046871 | 3300049128 | Bacteria | 623 |
| 1378 | Ga0501309_001209 | 3300049129 | Bacteria | 2455 |
| 1379 | Ga0501309_006960 | 3300049129 | Bacteria | 1391 |
| 1380 | Ga0501309_076406 | 3300049129 | Bacteria | 557 |
| 1381 | Ga0501310_000037 | 3300049130 | Bacteria | 13386 |
| 1382 | Ga0501310_000916 | 3300049130 | Bacteria | 2624 |
| 1383 | Ga0501310_007733 | 3300049130 | Bacteria | 1153 |
| 1384 | Ga0501310_012147 | 3300049130 | Bacteria | 984 |
| 1385 | Ga0501310_017354 | 3300049130 | Bacteria | 870 |
| 1386 | Ga0501341_00790 | 3300049131 | Bacteria | 1438 |
| 1387 | Ga0501341_01701 | 3300049131 | Bacteria | 1128 |
| 1388 | Ga0501341_04030 | 3300049131 | Bacteria | 847 |
| 1389 | Ga0501341_09538 | 3300049131 | Bacteria | 630 |
| 1390 | Ga0501343_002150 | 3300049132 | Bacteria | 1393 |
| 1391 | Ga0501343_005438 | 3300049132 | Bacteria | 977 |
| 1392 | Ga0501343_014719 | 3300049132 | Bacteria | 662 |
| 1393 | Ga0501343_020106 | 3300049132 | Bacteria | 587 |
| 1394 | Ga0501344_04193 | 3300049133 | Bacteria | 786 |
| 1395 | Ga0501345_01540 | 3300049134 | Bacteria | 892 |
| 1396 | Ga0501304_007086 | 3300049160 | Bacteria | 918 |
| 1397 | Ga0501304_007801 | 3300049160 | Bacteria | 891 |
| 1398 | Ga0501304_008375 | 3300049160 | Bacteria | 870 |
| 1399 | Ga0501304_018661 | 3300049160 | Bacteria | 672 |
| 1400 | Ga0501304_026738 | 3300049160 | Bacteria | 596 |
| 1401 | Ga0501305_000794 | 3300049161 | Bacteria | 2794 |
| 1402 | Ga0501305_001549 | 3300049161 | Bacteria | 2277 |
| 1403 | Ga0501305_001909 | 3300049161 | Bacteria | 2150 |
| 1404 | Ga0501305_002800 | 3300049161 | Bacteria | 1920 |
| 1405 | Ga0501305_033759 | 3300049161 | Bacteria | 809 |
| 1406 | Ga0501305_035163 | 3300049161 | Bacteria | 797 |
| 1407 | Ga0501305_048762 | 3300049161 | Bacteria | 706 |
| 1408 | Ga0501305_052529 | 3300049161 | Bacteria | 687 |
| 1409 | Ga0501305_066695 | 3300049161 | Bacteria | 627 |
| 1410 | Ga0501307_000560 | 3300049162 | Bacteria | 2636 |
| 1411 | Ga0501307_000602 | 3300049162 | Bacteria | 2573 |
| 1412 | Ga0501307_008962 | 3300049162 | Bacteria | 1135 |
| 1413 | Ga0501307_013824 | 3300049162 | Bacteria | 979 |
| 1414 | Ga0501307_027966 | 3300049162 | Bacteria | 769 |
| 1415 | Ga0501307_029260 | 3300049162 | Bacteria | 757 |
| 1416 | Ga0501307_057024 | 3300049162 | Bacteria | 599 |
| 1417 | Ga0501307_061293 | 3300049162 | Bacteria | 584 |
| 1418 | Ga0501342_01634 | 3300049163 | Bacteria | 724 |
| 1419 | Ga0501342_03433 | 3300049163 | Bacteria | 560 |
| 1420 | Ga0501342_03506 | 3300049163 | Bacteria | 556 |
| 1421 | Ga0495678_033405 | 3300049459 | Bacteria | 2124 |
| 1422 | Ga0495682_0041703 | 3300049460 | Bacteria | 1682 |
| 1423 | Ga0501311_009489 | 3300049527 | Bacteria | 1163 |
| 1424 | Ga0501311_012558 | 3300049527 | Bacteria | 1058 |
| 1425 | Ga0501311_013964 | 3300049527 | Bacteria | 1020 |
| 1426 | Ga0501311_015846 | 3300049527 | Bacteria | 977 |
| 1427 | Ga0501311_050040 | 3300049527 | Bacteria | 653 |
| 1428 | Ga0501312_000226 | 3300049528 | Bacteria | 4004 |
| 1429 | Ga0501312_000486 | 3300049528 | Bacteria | 3226 |
| 1430 | Ga0501312_007844 | 3300049528 | Bacteria | 1371 |
| 1431 | Ga0501312_013626 | 3300049528 | Bacteria | 1133 |
| 1432 | Ga0501312_025871 | 3300049528 | Bacteria | 897 |
| 1433 | Ga0501312_041004 | 3300049528 | Bacteria | 757 |
| 1434 | Ga0501312_048843 | 3300049528 | Bacteria | 709 |
| 1435 | Ga0501312_055713 | 3300049528 | Bacteria | 676 |
| 1436 | Ga0501312_060610 | 3300049528 | Bacteria | 655 |
| 1437 | Ga0501313_000829 | 3300049529 | Bacteria | 2374 |
| 1438 | Ga0501313_001041 | 3300049529 | Bacteria | 2239 |
| 1439 | Ga0501313_023195 | 3300049529 | Bacteria | 777 |
| 1440 | Ga0501313_029125 | 3300049529 | Bacteria | 710 |
| 1441 | Ga0501313_035218 | 3300049529 | Bacteria | 660 |
| 1442 | Ga0501313_042735 | 3300049529 | Bacteria | 613 |
| 1443 | Ga0501314_000485 | 3300049530 | Bacteria | 2490 |
| 1444 | Ga0501314_001176 | 3300049530 | Bacteria | 1845 |
| 1445 | Ga0501314_003861 | 3300049530 | Bacteria | 1223 |
| 1446 | Ga0501314_005415 | 3300049530 | Bacteria | 1086 |
| 1447 | Ga0501314_012624 | 3300049530 | Bacteria | 812 |
| 1448 | Ga0501314_023345 | 3300049530 | Bacteria | 655 |
| 1449 | Ga0501314_039590 | 3300049530 | Bacteria | 546 |
| 1450 | Ga0501315_000064 | 3300049531 | Bacteria | 4778 |
| 1451 | Ga0501315_000629 | 3300049531 | Bacteria | 2561 |
| 1452 | Ga0501315_001579 | 3300049531 | Bacteria | 1985 |
| 1453 | Ga0501315_011574 | 3300049531 | Bacteria | 1079 |
| 1454 | Ga0501315_047206 | 3300049531 | Bacteria | 668 |
| 1455 | Ga0501315_080912 | 3300049531 | Bacteria | 552 |
| 1456 | Ga0501315_093331 | 3300049531 | Bacteria | 524 |
| 1457 | Ga0501316_000650 | 3300049532 | Bacteria | 2551 |
| 1458 | Ga0501316_004246 | 3300049532 | Bacteria | 1430 |
| 1459 | Ga0501316_024839 | 3300049532 | Bacteria | 776 |
| 1460 | Ga0501316_036380 | 3300049532 | Bacteria | 674 |
| 1461 | Ga0501316_057394 | 3300049532 | Bacteria | 570 |
| 1462 | Ga0501317_001389 | 3300049533 | Bacteria | 2081 |
| 1463 | Ga0501317_020207 | 3300049533 | Bacteria | 896 |
| 1464 | Ga0501317_030347 | 3300049533 | Bacteria | 781 |
| 1465 | Ga0501317_034208 | 3300049533 | Bacteria | 751 |
| 1466 | Ga0501317_062792 | 3300049533 | Bacteria | 613 |
| 1467 | Ga0501317_109971 | 3300049533 | Bacteria | 505 |
| 1468 | Ga0501318_013246 | 3300049534 | Bacteria | 956 |
| 1469 | Ga0501318_018041 | 3300049534 | Bacteria | 868 |
| 1470 | Ga0501318_033966 | 3300049534 | Bacteria | 705 |
| 1471 | Ga0501319_000006 | 3300049535 | Bacteria | 8644 |
| 1472 | Ga0501319_000068 | 3300049535 | Bacteria | 3484 |
| 1473 | Ga0501319_000383 | 3300049535 | Bacteria | 2045 |
| 1474 | Ga0501319_000428 | 3300049535 | Bacteria | 1988 |
| 1475 | Ga0501319_007320 | 3300049535 | Bacteria | 832 |
| 1476 | Ga0501319_008963 | 3300049535 | Bacteria | 778 |
| 1477 | Ga0501319_010268 | 3300049535 | Bacteria | 744 |
| 1478 | Ga0501319_012847 | 3300049535 | Bacteria | 690 |
| 1479 | Ga0501319_017561 | 3300049535 | Bacteria | 622 |
| 1480 | Ga0501320_000264 | 3300049536 | Bacteria | 2816 |
| 1481 | Ga0501320_000540 | 3300049536 | Bacteria | 2271 |
| 1482 | Ga0501320_003081 | 3300049536 | Bacteria | 1387 |
| 1483 | Ga0501320_004332 | 3300049536 | Bacteria | 1248 |
| 1484 | Ga0501320_015745 | 3300049536 | Bacteria | 830 |
| 1485 | Ga0501320_023241 | 3300049536 | Bacteria | 732 |
| 1486 | Ga0501320_023596 | 3300049536 | Bacteria | 728 |
| 1487 | Ga0501320_027211 | 3300049536 | Bacteria | 694 |
| 1488 | Ga0501321_013675 | 3300049537 | Bacteria | 935 |
| 1489 | Ga0501321_018418 | 3300049537 | Bacteria | 848 |
| 1490 | Ga0501321_021060 | 3300049537 | Bacteria | 811 |
| 1491 | Ga0501321_027635 | 3300049537 | Bacteria | 742 |
| 1492 | Ga0501321_031517 | 3300049537 | Bacteria | 711 |
| 1493 | Ga0501321_033178 | 3300049537 | Bacteria | 699 |
| 1494 | Ga0501321_089192 | 3300049537 | Bacteria | 501 |
| 1495 | Ga0501323_000717 | 3300049539 | Bacteria | 2607 |
| 1496 | Ga0501323_001002 | 3300049539 | Bacteria | 2347 |
| 1497 | Ga0501323_001783 | 3300049539 | Bacteria | 1983 |
| 1498 | Ga0501323_002460 | 3300049539 | Bacteria | 1796 |
| 1499 | Ga0501323_005626 | 3300049539 | Bacteria | 1378 |
| 1500 | Ga0501323_011315 | 3300049539 | Bacteria | 1075 |
| 1501 | Ga0501323_015120 | 3300049539 | Bacteria | 971 |
| 1502 | Ga0501323_022411 | 3300049539 | Bacteria | 841 |
| 1503 | Ga0501323_027020 | 3300049539 | Bacteria | 788 |
| 1504 | Ga0501323_060436 | 3300049539 | Bacteria | 591 |
| 1505 | Ga0501324_002531 | 3300049540 | Bacteria | 1330 |
| 1506 | Ga0501324_003092 | 3300049540 | Bacteria | 1254 |
| 1507 | Ga0501324_022717 | 3300049540 | Bacteria | 650 |
| 1508 | Ga0501324_026087 | 3300049540 | Bacteria | 619 |
| 1509 | Ga0501324_047264 | 3300049540 | Bacteria | 503 |
| 1510 | Ga0501325_011584 | 3300049541 | Bacteria | 818 |
| 1511 | Ga0501325_019734 | 3300049541 | Bacteria | 701 |
| 1512 | Ga0501325_034807 | 3300049541 | Bacteria | 592 |
| 1513 | Ga0501325_043087 | 3300049541 | Bacteria | 555 |
| 1514 | Ga0501326_09759 | 3300049542 | Bacteria | 570 |
| 1515 | Ga0501326_11467 | 3300049542 | Bacteria | 540 |
| 1516 | Ga0501327_09345 | 3300049543 | Bacteria | 634 |
| 1517 | Ga0501328_03265 | 3300049544 | Bacteria | 746 |
| 1518 | Ga0501328_03694 | 3300049544 | Bacteria | 719 |
| 1519 | Ga0501328_07964 | 3300049544 | Bacteria | 570 |
| 1520 | Ga0501329_00132 | 3300049545 | Bacteria | 1975 |
| 1521 | Ga0501329_03571 | 3300049545 | Bacteria | 796 |
| 1522 | Ga0501329_04205 | 3300049545 | Bacteria | 762 |
| 1523 | Ga0501330_004977 | 3300049546 | Bacteria | 836 |
| 1524 | Ga0501330_008315 | 3300049546 | Bacteria | 710 |
| 1525 | Ga0501331_01194 | 3300049547 | Bacteria | 1228 |
| 1526 | Ga0501331_02908 | 3300049547 | Bacteria | 904 |
| 1527 | Ga0501331_05306 | 3300049547 | Bacteria | 733 |
| 1528 | Ga0501332_05328 | 3300049548 | Bacteria | 786 |
| 1529 | Ga0501334_00025 | 3300049550 | Bacteria | 4715 |
| 1530 | Ga0501334_00211 | 3300049550 | Bacteria | 2345 |
| 1531 | Ga0501334_02889 | 3300049550 | Bacteria | 1042 |
| 1532 | Ga0501334_05362 | 3300049550 | Bacteria | 845 |
| 1533 | Ga0501335_000748 | 3300049551 | Bacteria | 2239 |
| 1534 | Ga0501335_000798 | 3300049551 | Bacteria | 2199 |
| 1535 | Ga0501335_005233 | 3300049551 | Bacteria | 1154 |
| 1536 | Ga0501335_010801 | 3300049551 | Bacteria | 886 |
| 1537 | Ga0501335_011976 | 3300049551 | Bacteria | 852 |
| 1538 | Ga0501335_014245 | 3300049551 | Bacteria | 801 |
| 1539 | Ga0501336_000444 | 3300049552 | Bacteria | 2044 |
| 1540 | Ga0501336_001556 | 3300049552 | Bacteria | 1384 |
| 1541 | Ga0501337_004420 | 3300049553 | Bacteria | 919 |
| 1542 | Ga0501337_015152 | 3300049553 | Bacteria | 594 |
| 1543 | Ga0501340_002106 | 3300049556 | Bacteria | 1132 |
| 1544 | Ga0501340_003356 | 3300049556 | Bacteria | 967 |
| 1545 | Ga0501032_0000353 | 3300049569 | Bacteria | 38266 |
| 1546 | Ga0501034_0000001 | 3300049571 | Bacteria | 2184493 |
| 1547 | Ga0501034_0112090 | 3300049571 | Bacteria | 2718 |
| 1548 | Ga0501036_0141855 | 3300049572 | Bacteria | 2027 |
| 1549 | Ga0501039_0000169 | 3300049575 | Bacteria | 45709 |
| 1550 | Ga0501047_0150432 | 3300049581 | Bacteria | 2204 |
| 1551 | Ga0501223_002278 | 3300049663 | Bacteria | 4288 |
| 1552 | Ga0501238_015660 | 3300049671 | Bacteria | 1047 |
| 1553 | Ga0501238_030760 | 3300049671 | Bacteria | 776 |
| 1554 | Ga0501240_000074 | 3300049673 | Bacteria | 6037 |
| 1555 | Ga0501243_052474 | 3300049675 | Bacteria | 739 |
| 1556 | Ga0501243_057375 | 3300049675 | Bacteria | 715 |
| 1557 | Ga0501243_095078 | 3300049675 | Bacteria | 595 |
| 1558 | Ga0501249_000797 | 3300049679 | Bacteria | 7031 |
| 1559 | Ga0501249_005929 | 3300049679 | Bacteria | 2505 |
| 1560 | Ga0501249_086232 | 3300049679 | Bacteria | 741 |
| 1561 | Ga0501251_001354 | 3300049681 | Bacteria | 2281 |
| 1562 | Ga0501252_057595 | 3300049682 | Bacteria | 600 |
| 1563 | Ga0501257_204875 | 3300049686 | Bacteria | 569 |
| 1564 | Ga0501260_004986 | 3300049689 | Bacteria | 1238 |
| 1565 | Ga0501219_025063 | 3300049703 | Bacteria | 538 |
| 1566 | Ga0501225_0026515 | 3300049705 | Bacteria | 1593 |
| 1567 | Ga0501241_000017 | 3300049758 | Bacteria | 96324 |
| 1568 | Ga0501241_001570 | 3300049758 | Bacteria | 4587 |
| 1569 | Ga0501241_007664 | 3300049758 | Bacteria | 1978 |
| 1570 | Ga0501266_000009 | 3300049763 | Bacteria | 233584 |
| 1571 | Ga0501269_001154 | 3300049766 | Bacteria | 3643 |
| 1572 | Ga0501280_034090 | 3300049776 | Bacteria | 804 |
| 1573 | Ga0501035_0114203 | 3300049822 | Bacteria | 2365 |
| 1574 | Ga0501035_0668587 | 3300049822 | Bacteria | 840 |
| 1575 | Ga0501035_1405445 | 3300049822 | Bacteria | 535 |
| 1576 | nmdc:mga0k408_173043_c1 | 3300050493 | Bacteria | 1287 |
| 1577 | nmdc:mga0k408_234301_c1 | 3300050493 | Bacteria | 1096 |
| 1578 | nmdc:mga0k408_350_c1 | 3300050493 | Bacteria | 25267 |
| 1579 | nmdc:mga0k408_38765_c1 | 3300050493 | Bacteria | 2736 |
| 1580 | nmdc:mga0k408_4120_c1 | 3300050493 | Bacteria | 7721 |
| 1581 | nmdc:mga07m45_164171_c1 | 3300050496 | Bacteria | 1290 |
| 1582 | nmdc:mga07m45_248103_c1 | 3300050496 | Bacteria | 1036 |
| 1583 | nmdc:mga07m45_361836_c1 | 3300050496 | Bacteria | 843 |
| 1584 | nmdc:mga07m45_446713_c1 | 3300050496 | Bacteria | 750 |
| 1585 | nmdc:mga07m45_97058_c1 | 3300050496 | Bacteria | 1691 |
| 1586 | nmdc:mga05p37_19612_c1 | 3300050507 | Bacteria | 8178 |
| 1587 | nmdc:mga05p37_3446_c1 | 3300050507 | Bacteria | 18465 |
| 1588 | nmdc:mga05p37_377892_c1 | 3300050507 | Bacteria | 1661 |
| 1589 | nmdc:mga05p37_38531_c1 | 3300050507 | Bacteria | 5863 |
| 1590 | nmdc:mga05p37_82274_c1 | 3300050507 | Bacteria | 3967 |
| 1591 | nmdc:mga09592_102110_c1 | 3300050508 | Bacteria | 2457 |
| 1592 | nmdc:mga09592_15413_c1 | 3300050508 | Bacteria | 6245 |
| 1593 | nmdc:mga09592_5366_c1 | 3300050508 | Bacteria | 10420 |
| 1594 | nmdc:mga09592_986624_c1 | 3300050508 | Bacteria | 705 |
| 1595 | nmdc:mga0qj67_24513_c1 | 3300050509 | Bacteria | 4651 |
| 1596 | nmdc:mga0qj67_56075_c1 | 3300050509 | Bacteria | 3123 |
| 1597 | nmdc:mga0qj67_591893_c1 | 3300050509 | Bacteria | 888 |
| 1598 | nmdc:mga0qj67_88044_c1 | 3300050509 | Bacteria | 2493 |
| 1599 | nmdc:mga06r32_235827_c1 | 3300050510 | Bacteria | 1817 |
| 1600 | nmdc:mga06r32_29589_c1 | 3300050510 | Bacteria | 5135 |
| 1601 | nmdc:mga06r32_600_c1 | 3300050510 | Bacteria | 18075 |
| 1602 | nmdc:mga06r32_914153_c1 | 3300050510 | Bacteria | 833 |
| 1603 | nmdc:mga08y16_145790_c1 | 3300050511 | Bacteria | 2461 |
| 1604 | nmdc:mga08y16_300768_c1 | 3300050511 | Bacteria | 1654 |
| 1605 | nmdc:mga08y16_330478_c1 | 3300050511 | Bacteria | 1568 |
| 1606 | nmdc:mga08y16_793049_c1 | 3300050511 | Bacteria | 940 |
| 1607 | nmdc:mga0n895_10875_c1 | 3300050512 | Bacteria | 8079 |
| 1608 | nmdc:mga0n895_14066_c1 | 3300050512 | Bacteria | 7253 |
| 1609 | nmdc:mga0rr50_59956_c1 | 3300050513 | Bacteria | 2860 |
| 1610 | nmdc:mga0a205_128227_c1 | 3300050515 | Bacteria | 2437 |
| 1611 | nmdc:mga0a205_36134_c1 | 3300050515 | Bacteria | 4746 |
| 1612 | nmdc:mga0a205_58582_c1 | 3300050515 | Bacteria | 3720 |
| 1613 | nmdc:mga0sz30_159519_c1 | 3300050516 | Bacteria | 999 |
| 1614 | nmdc:mga0sz30_264560_c1 | 3300050516 | Bacteria | 766 |
| 1615 | Ga0500635_0001097 | 3300053080 | Bacteria | 6481 |
| 1616 | Ga0500635_0080487 | 3300053080 | Bacteria | 1170 |
| 1617 | Ga0500578_0018628 | 3300053086 | Bacteria | 4460 |
| 1618 | Ga0500578_0293623 | 3300053086 | Bacteria | 966 |
| 1619 | Ga0500644_0096053 | 3300053088 | Bacteria | 1118 |
| 1620 | Ga0500644_0501588 | 3300053088 | Bacteria | 534 |
| 1621 | Ga0500646_0003988 | 3300053090 | Bacteria | 3755 |
| 1622 | Ga0500646_0022173 | 3300053090 | Bacteria | 1697 |
| 1623 | Ga0500651_0000124 | 3300053093 | Bacteria | 47212 |
| 1624 | Ga0500641_0000029 | 3300053096 | Bacteria | 103994 |
| 1625 | Ga0500641_0003322 | 3300053096 | Bacteria | 5693 |
| 1626 | Ga0500641_0049673 | 3300053096 | Bacteria | 1721 |
| 1627 | Ga0500650_0273731 | 3300053098 | Bacteria | 752 |
| 1628 | Ga0500594_0020923 | 3300053118 | Bacteria | 1636 |
| 1629 | Ga0500608_006222 | 3300053122 | Bacteria | 4839 |
| 1630 | Ga0500608_018016 | 3300053122 | Bacteria | 3216 |
| 1631 | Ga0500614_008477 | 3300053123 | Bacteria | 2180 |
| 1632 | Ga0500618_000080 | 3300053125 | Bacteria | 78455 |
| 1633 | Ga0500618_028226 | 3300053125 | Bacteria | 1330 |
| 1634 | Ga0500652_086699 | 3300053131 | Bacteria | 1306 |
| 1635 | Ga0500658_0000006 | 3300053134 | Bacteria | 290380 |
| 1636 | Ga0500559_0018627 | 3300053136 | Bacteria | 2933 |
| 1637 | Ga0500561_0045175 | 3300053137 | Bacteria | 1180 |
| 1638 | Ga0500573_0033087 | 3300053140 | Bacteria | 2984 |
| 1639 | Ga0500573_0257649 | 3300053140 | Bacteria | 895 |
| 1640 | Ga0500616_0130805 | 3300053153 | Bacteria | 1186 |
| 1641 | Ga0500622_0001219 | 3300053156 | Bacteria | 21136 |
| 1642 | Ga0500622_0084917 | 3300053156 | Bacteria | 1580 |
| 1643 | Ga0500622_0290167 | 3300053156 | Bacteria | 701 |
| 1644 | Ga0500624_000925 | 3300053157 | Bacteria | 6183 |
| 1645 | Ga0500584_010431 | 3300053726 | Bacteria | 4160 |
| 1646 | Ga0587093_006264 | 3300059478 | Bacteria | 1290 |
| 1647 | Ga0587093_014210 | 3300059478 | Bacteria | 990 |
| 1648 | Ga0587093_015105 | 3300059478 | Bacteria | 971 |
| 1649 | Ga0587066_037503 | 3300059490 | Bacteria | 897 |
| 1650 | Ga0587066_047208 | 3300059490 | Bacteria | 834 |
| 1651 | Ga0587066_167584 | 3300059490 | Bacteria | 557 |
| 1652 | Ga0587070_064167 | 3300059491 | Bacteria | 767 |
| 1653 | Ga0587073_0035653 | 3300059492 | Bacteria | 1056 |
| 1654 | Ga0587073_0254163 | 3300059492 | Bacteria | 552 |
| 1655 | Ga0587077_000327 | 3300059493 | Bacteria | 3754 |
| 1656 | Ga0587077_005446 | 3300059493 | Bacteria | 1742 |
| 1657 | Ga0587077_029444 | 3300059493 | Bacteria | 1035 |
| 1658 | Ga0587077_067958 | 3300059493 | Bacteria | 789 |
| 1659 | Ga0587077_147256 | 3300059493 | Bacteria | 612 |
| 1660 | Ga0587080_025713 | 3300059503 | Bacteria | 996 |
| 1661 | Ga0587080_034069 | 3300059503 | Bacteria | 901 |
| 1662 | Ga0587080_069869 | 3300059503 | Bacteria | 701 |
| 1663 | Ga0587080_117459 | 3300059503 | Bacteria | 586 |
| 1664 | Ga0587083_0012424 | 3300059505 | Bacteria | 1429 |
| 1665 | Ga0587083_0013735 | 3300059505 | Bacteria | 1383 |
| 1666 | Ga0587083_0036396 | 3300059505 | Bacteria | 1008 |
| 1667 | Ga0587085_004592 | 3300059506 | Bacteria | 1577 |
| 1668 | Ga0587086_027045 | 3300059507 | Bacteria | 821 |
| 1669 | Ga0587089_082686 | 3300059509 | Bacteria | 561 |
| 1670 | Ga0587090_000102 | 3300059510 | Bacteria | 5197 |
| 1671 | Ga0587090_018824 | 3300059510 | Bacteria | 1059 |
| 1672 | Ga0587091_009311 | 3300059511 | Bacteria | 1476 |
| 1673 | Ga0587091_025972 | 3300059511 | Bacteria | 1063 |
| 1674 | Ga0587091_085083 | 3300059511 | Bacteria | 717 |
| 1675 | Ga0587092_041284 | 3300059512 | Bacteria | 804 |
| 1676 | Ga0587092_073173 | 3300059512 | Bacteria | 664 |
| 1677 | Ga0587094_050899 | 3300059513 | Bacteria | 701 |
| 1678 | Ga0587106_004580 | 3300059605 | Bacteria | 1529 |
| 1679 | Ga0587125_001886 | 3300059607 | Bacteria | 1604 |
| 1680 | Ga0587101_032508 | 3300059623 | Bacteria | 822 |
| 1681 | Ga0587101_037944 | 3300059623 | Bacteria | 782 |
| 1682 | Ga0587101_059563 | 3300059623 | Bacteria | 678 |
| 1683 | Ga0587109_024961 | 3300059624 | Bacteria | 1095 |
| 1684 | Ga0587117_000256 | 3300059627 | Bacteria | 3264 |
| 1685 | Ga0587117_107560 | 3300059627 | Bacteria | 539 |
| 1686 | Ga0587128_003957 | 3300059630 | Bacteria | 1688 |
| 1687 | Ga0587062_001988 | 3300059639 | Bacteria | 1883 |
| 1688 | Ga0587067_061713 | 3300059640 | Bacteria | 787 |
| 1689 | Ga0587068_017603 | 3300059641 | Bacteria | 1143 |
| 1690 | Ga0587068_029487 | 3300059641 | Bacteria | 944 |
| 1691 | Ga0587068_066075 | 3300059641 | Bacteria | 705 |
| 1692 | Ga0587069_041391 | 3300059642 | Bacteria | 787 |
| 1693 | Ga0587076_000772 | 3300059645 | Bacteria | 2886 |
| 1694 | Ga0587076_001127 | 3300059645 | Bacteria | 2613 |
| 1695 | Ga0587076_020634 | 3300059645 | Bacteria | 1083 |
| 1696 | Ga0587076_027105 | 3300059645 | Bacteria | 990 |
| 1697 | Ga0587076_105265 | 3300059645 | Bacteria | 635 |
| 1698 | Ga0587076_161974 | 3300059645 | Bacteria | 551 |
| 1699 | Ga0587100_006833 | 3300059648 | Bacteria | 888 |
| 1700 | Ga0587105_012794 | 3300059651 | Bacteria | 662 |
| 1701 | Ga0587107_012382 | 3300059652 | Bacteria | 1062 |
| 1702 | Ga0587107_013944 | 3300059652 | Bacteria | 1027 |
| 1703 | Ga0587108_001109 | 3300059653 | Bacteria | 1582 |
| 1704 | Ga0587124_001026 | 3300059660 | Bacteria | 1727 |
| 1705 | Ga0587060_017818 | 3300060243 | Bacteria | 659 |
| 1706 | Ga0587061_00281 | 3300060244 | Bacteria | 1648 |
| 1707 | Ga0587081_01723 | 3300060246 | Bacteria | 1278 |
| 1708 | 2511234222 | 2511231000 | Bacteria | 4488346 |
| 1709 | 2513234198 | 2513020052 | Bacteria | 5120511 |
| 1710 | 2520881101 | 2519899754 | Bacteria | 5336938 |
| 1711 | 2522552600 | 2522125168 | Bacteria | 7376607 |
| 1712 | 2524005425 | 2523533629 | Bacteria | 2982326 |
| 1713 | 2585142333 | 2582581278 | Bacteria | 5296881 |
| 1714 | 2585159825 | 2582581281 | Bacteria | 4487904 |
| 1715 | 2585164021 | 2582581282 | Bacteria | 4495830 |
| 1716 | 2586210453 | 2585427687 | Bacteria | 5544917 |
| 1717 | 2587680916 | 2585428045 | Bacteria | 5203023 |
| 1718 | 2587747638 | 2585428060 | Bacteria | 5304711 |
| 1719 | 2587751529 | 2585428061 | Bacteria | 3939663 |
| 1720 | 2587867303 | 2585428095 | Bacteria | 3789702 |
| 1721 | 2587945030 | 2585428115 | Bacteria | 4420269 |
| 1722 | 2588210629 | 2585428182 | Bacteria | 5007281 |
| 1723 | 2588214126 | 2585428183 | Bacteria | 5166119 |
| 1724 | 2588221607 | 2585428184 | Bacteria | 4978681 |
| 1725 | 2588223430 | 2585428185 | Bacteria | 4969476 |
| 1726 | 2588232642 | 2585428187 | Bacteria | 4629388 |
| 1727 | 2588443666 | 2588253712 | Bacteria | 5403181 |
| 1728 | 2590601901 | 2588254255 | Bacteria | 5014294 |
| 1729 | 2590613363 | 2588254257 | Bacteria | 5436094 |
| 1730 | 2599479163 | 2599185184 | Bacteria | 6430550 |
| 1731 | 2644011031 | 2643221600 | Bacteria | 5530138 |
| 1732 | 2644373886 | 2643221667 | Bacteria | 5627472 |
| 1733 | 2644643521 | 2643221716 | Bacteria | 4986332 |
| 1734 | 2644683942 | 2643221725 | Bacteria | 5087956 |
| 1735 | 2722726630 | 2721755487 | Bacteria | 6357185 |
| 1736 | 2729200419 | 2728369107 | Bacteria | 5082720 |
| 1737 | 2738699648 | 2738541273 | Bacteria | 4048577 |
| 1738 | 2738736999 | 2738541279 | Bacteria | 6149495 |
| 1739 | 2738755464 | 2738541283 | Bacteria | 7222293 |
| 1740 | 2738763474 | 2738541284 | Bacteria | 5199923 |
| 1741 | 2738769539 | 2738541285 | Bacteria | 6150075 |
| 1742 | 2738851932 | 2738541302 | Bacteria | 5944758 |
| 1743 | 2739218581 | 2738543007 | Bacteria | 6149845 |
| 1744 | 2739253397 | 2738543014 | Bacteria | 4048139 |
| 1745 | 2739303599 | 2738543023 | Bacteria | 6767879 |
| 1746 | 2739590822 | 2739367651 | Bacteria | 6359826 |
| 1747 | 2739617017 | 2739367656 | Bacteria | 5152243 |
| 1748 | 2739647323 | 2739367663 | Bacteria | 5040914 |
| 1749 | 2739999427 | 2739367857 | Bacteria | 5433684 |
| 1750 | 2740004244 | 2739367858 | Bacteria | 5432813 |
| 1751 | 2740059400 | 2739367874 | Bacteria | 4872888 |
| 1752 | 2753673463 | 2751185877 | Bacteria | 4921427 |
| 1753 | 2765574568 | 2765235839 | Bacteria | 5314748 |
| 1754 | 2772604697 | 2772190705 | Bacteria | 4666226 |
| 1755 | 2775671675 | 2775506739 | Bacteria | 3855222 |
| 1756 | 2776615088 | 2775506987 | Bacteria | 5373360 |
| 1757 | 2802652169 | 2802428842 | Bacteria | 4926114 |
| 1758 | 2816874785 | 2816332188 | Bacteria | 5133218 |
| 1759 | 2817415027 | 2816332280 | Bacteria | 5109718 |
| 1760 | 2819546477 | 2818991437 | Bacteria | 5805520 |
| 1761 | 2819573418 | 2818991442 | Bacteria | 8318214 |
| 1762 | 2821136838 | 2821136567 | Bacteria | 8080116 |
| 1763 | 2833642870 | 2833640130 | Bacteria | 4858325 |
| 1764 | 2842085314 | 2842083920 | Bacteria | 4857652 |
| 1765 | 2842725173 | 2842722452 | Bacteria | 6263924 |
| 1766 | 2842912448 | 2842909656 | Bacteria | 6185908 |
| 1767 | 2849286038 | 2849281842 | Bacteria | 6065644 |
| 1768 | 2852629338 | 2852627209 | Bacteria | 5896285 |
| 1769 | 2857617507 | 2857613821 | Bacteria | 4917088 |
| 1770 | 2857621262 | 2857618242 | Bacteria | 5635925 |
| 1771 | 2857629754 | 2857627736 | Bacteria | 5625397 |
| 1772 | 2871722311 | 2871720351 | Bacteria | 4862476 |
| 1773 | 2881250019 | 2881247448 | Bacteria | 3717788 |
| 1774 | 2881359952 | 2881359912 | Bacteria | 4935907 |
| 1775 | 2889294872 | 2889290771 | Bacteria | 5530962 |
| 1776 | 2890738049 | 2890737413 | Bacteria | 4269751 |
| 1777 | 2896321221 | 2896317667 | Bacteria | 4606601 |
| 1778 | 2896345744 | 2896344016 | Bacteria | 3811746 |
| 1779 | 2898713532 | 2898713307 | Bacteria | 4110805 |
| 1780 | 2902052509 | 2902048731 | Bacteria | 4976191 |
| 1781 | 2903896138 | 2903895155 | Bacteria | 5258610 |
| 1782 | 2904421811 | 2904419702 | Bacteria | 5166287 |
| 1783 | 2904446637 | 2904445276 | Bacteria | 5310396 |
| 1784 | 2904468417 | 2904467357 | Bacteria | 8057758 |
| 1785 | 2904559878 | 2904555929 | Bacteria | 5218588 |
| 1786 | 2904785860 | 2904780799 | Bacteria | 5840761 |
| 1787 | 2906001493 | 2905999023 | Bacteria | 4591259 |
| 1788 | 2919099496 | 2919097161 | Bacteria | 3860339 |
| 1789 | 2919182478 | 2919177583 | Bacteria | 5641607 |
| 1790 | 2919190323 | 2919186247 | Bacteria | 6244071 |
| 1791 | 2919195749 | 2919191525 | Bacteria | 5765973 |
| 1792 | 2919402438 | 2919399522 | Bacteria | 5164947 |
| 1793 | 2919438212 | 2919437846 | Bacteria | 6199444 |
| 1794 | 2919510864 | 2919509842 | Bacteria | 4104664 |
| 1795 | 2919687966 | 2919683626 | Bacteria | 5534354 |
| 1796 | 2928082522 | 2928078545 | Bacteria | 6534839 |
| 1797 | 2928148890 | 2928147474 | Bacteria | 6512076 |
| 1798 | 2929152201 | 2929150217 | Bacteria | 5462483 |
| 1799 | 2932086312 | 2932082852 | Bacteria | 6563563 |
| 1800 | 2939668604 | 2939664404 | Bacteria | 6364494 |
| 1801 | 2945925749 | 2945924605 | Bacteria | 4296724 |
| 1802 | 2946002100 | 2945997725 | Bacteria | 6404843 |
| 1803 | 2946023016 | 2946019816 | Bacteria | 4621265 |
| 1804 | 2954018998 | 2954016120 | Bacteria | 6446024 |
| 1805 | 2958460101 | 2958458903 | Bacteria | 5301041 |
| 1806 | 2958514759 | 2958512119 | Bacteria | 4528530 |
| 1807 | 2965323019 | 2965320100 | Bacteria | 3975600 |
| 1808 | 2977233776 | 2977232053 | Bacteria | 5485925 |
| 1809 | 2977244650 | 2977243572 | Bacteria | 4374394 |
| 1810 | 2977268898 | 2977268062 | Bacteria | 5243061 |
| 1811 | 2984573517 | 2984572630 | Bacteria | 4186940 |
| 1812 | 2984606956 | 2984606641 | Bacteria | 4186971 |
| 1813 | 2993376059 | 2993372514 | Bacteria | 4214139 |
| 1814 | 2993482904 | 2993480792 | Bacteria | 4022225 |
| 1815 | 3003235167 | 3003233435 | Bacteria | 4458031 |
| 1816 | 8036739390 | 8036736890 | Bacteria | 2944828 |
| 1817 | 8054309581 | 8054307821 | Bacteria | 5212224 |
| 1818 | 8055419150 | 8055419101 | Bacteria | 5289643 |
| 1819 | 8055590023 | 8055588893 | Bacteria | 3619545 |
| 1820 | 8055592429 | 8055592153 | Bacteria | 5961247 |
| 1821 | 8056442548 | 8056440228 | Bacteria | 4946504 |
| 1822 | Ga0070678_101940904 | |||
| 1823 | MRS2a_Contig_9405 | |||
| 1824 | SwRhRL2b_contig_2240772 | |||
| 1825 | SwRhRL2b_contig_2684773 | |||
| 1826 | SwRhRL2b_contig_534079 | |||
| 1827 | SwRhRL2b_contig_908903 | |||
| 1828 | JGI24741J21665_1000115 | |||
| 1829 | JGI24741J21665_1061020 | |||
| 1830 | JGI24740J21852_10015326 | |||
| 1831 | JGI24740J21852_10053646 | |||
| 1832 | JGI24739J22299_10047850 | |||
| 1833 | JGI24739J22299_10166146 | |||
| 1834 | JGI24737J22298_10000614 | |||
| 1835 | JGI24737J22298_10001905 | |||
| 1836 | JGI24737J22298_10003582 | |||
| 1837 | JGI24737J22298_10148067 | |||
| 1838 | JGI24743J22301_10020627 | |||
| 1839 | JGI24735J21928_10000009 | |||
| 1840 | JGI24735J21928_10021163 | |||
| 1841 | JGI24735J21928_10042167 | |||
| 1842 | JGI24744J21845_10008899 | |||
| 1843 | JGI24034J26672_10101796 | |||
| 1844 | JGI25162J39368_1000120 | |||
| 1845 | JGI25162J39368_1001524 | |||
| 1846 | JGI25157J39369_1002820 | |||
| 1847 | JGI25157J39369_1004397 | |||
| 1848 | JGI25157J39369_1031034 | |||
| 1849 | JGI25164J39214_1000824 | |||
| 1850 | JGI25150J39212_1000001 | |||
| 1851 | Ga0006759J45824_1125488 | |||
| 1852 | JGI25151J46595_10000001 | |||
| 1853 | JGI25165J46597_1000923 | |||
| 1854 | JGI25153J46596_10000001 | |||
| 1855 | rootH2_10012942 | |||
| 1856 | rootH2_10298437 | |||
| 1857 | rootL2_10051773 | |||
| 1858 | rootL2_10150346 | |||
| 1859 | rootL2_10285627 | |||
| 1860 | rootH1_10107846 | |||
| 1861 | rootH1_10125727 | |||
| 1862 | JGI26132J50249_101713 | |||
| 1863 | Ga0007409J51694_1078244 | |||
| 1864 | Ga0006562J51391_1002124 | |||
| 1865 | Ga0055536_1013448 | |||
| 1866 | Ga0055534_1012830 | |||
| 1867 | Ga0055531_10002043 | |||
| 1868 | Ga0058859_11302483 | |||
| 1869 | Ga0058863_11953297 | |||
| 1870 | Ga0058863_11963325 | |||
| 1871 | Ga0058861_10088285 | |||
| 1872 | Ga0058861_12069072 | |||
| 1873 | Ga0058860_10018004 | |||
| 1874 | Ga0058860_11803557 | |||
| 1875 | Ga0058860_11880010 | |||
| 1876 | Ga0058862_10247728 | |||
| 1877 | Ga0058862_12706272 | |||
| 1878 | Ga0058862_12779971 | |||
| 1879 | Ga0065165_1002853 | |||
| 1880 | Ga0065717_1002063 | |||
| 1881 | Ga0065714_10005413 | |||
| 1882 | Ga0065714_10007805 | |||
| 1883 | Ga0065714_10011283 | |||
| 1884 | Ga0065714_10020754 | |||
| 1885 | Ga0065714_10083664 | |||
| 1886 | Ga0065714_10089556 | |||
| 1887 | Ga0065714_10089647 | |||
| 1888 | Ga0065714_10118833 | |||
| 1889 | Ga0065714_10216369 | |||
| 1890 | Ga0065714_10217047 | |||
| 1891 | Ga0065714_10288794 | |||
| 1892 | Ga0065714_10382470 | |||
| 1893 | Ga0065704_10000757 | |||
| 1894 | Ga0065704_10013526 | |||
| 1895 | Ga0065704_10072003 | |||
| 1896 | Ga0065704_10085384 | |||
| 1897 | Ga0065704_10093408 | |||
| 1898 | Ga0065704_10231864 | |||
| 1899 | Ga0065712_10224894 | |||
| 1900 | Ga0065712_10768292 | |||
| 1901 | Ga0065715_10015955 | |||
| 1902 | Ga0065715_10109002 | |||
| 1903 | Ga0065715_10118594 | |||
| 1904 | Ga0065715_10142356 | |||
| 1905 | Ga0065715_10938245 | |||
| 1906 | Ga0065707_10108988 | |||
| 1907 | Ga0070658_10000014 | |||
| 1908 | Ga0070658_10474022 | |||
| 1909 | Ga0070676_10000852 | |||
| 1910 | Ga0070676_10004106 | |||
| 1911 | Ga0070683_100003409 | |||
| 1912 | Ga0070683_100091959 | |||
| 1913 | Ga0070670_100128832 | |||
| 1914 | Ga0070670_100472812 | |||
| 1915 | Ga0068869_100006678 | |||
| 1916 | Ga0070666_10176639 | |||
| 1917 | Ga0070680_100002006 | |||
| 1918 | Ga0070680_100062159 | |||
| 1919 | Ga0070680_100302481 | |||
| 1920 | Ga0070680_100681878 | |||
| 1921 | Ga0070682_100000087 | |||
| 1922 | Ga0070682_100171019 | |||
| 1923 | Ga0070682_100173333 | |||
| 1924 | Ga0070682_100322988 | |||
| 1925 | Ga0070682_100676261 | |||
| 1926 | Ga0068868_100866915 | |||
| 1927 | Ga0070660_100028188 | |||
| 1928 | Ga0070660_100082225 | |||
| 1929 | Ga0070660_100100250 | |||
| 1930 | Ga0070660_100197618 | |||
| 1931 | Ga0070689_100055251 | |||
| 1932 | Ga0070689_100074007 | |||
| 1933 | Ga0070689_100451148 | |||
| 1934 | Ga0070689_100581681 | |||
| 1935 | Ga0070687_100309619 | |||
| 1936 | Ga0070661_100060578 | |||
| 1937 | Ga0070661_100073348 | |||
| 1938 | Ga0070661_100590876 | |||
| 1939 | Ga0070692_10028172 | |||
| 1940 | Ga0070692_10145738 | |||
| 1941 | Ga0070668_100017094 | |||
| 1942 | Ga0070668_100204111 | |||
| 1943 | Ga0070669_100005808 | |||
| 1944 | Ga0070669_100051832 | |||
| 1945 | Ga0070669_100093042 | |||
| 1946 | Ga0070675_100029347 | |||
| 1947 | Ga0070675_100053172 | |||
| 1948 | Ga0070675_100171639 | |||
| 1949 | Ga0070675_100967478 | |||
| 1950 | Ga0070671_100003462 | |||
| 1951 | Ga0070671_100005487 | |||
| 1952 | Ga0070674_100086265 | |||
| 1953 | Ga0070673_100015276 | |||
| 1954 | Ga0070673_100049506 | |||
| 1955 | Ga0070673_100068302 | |||
| 1956 | Ga0070673_100070036 | |||
| 1957 | Ga0070688_100019652 | |||
| 1958 | Ga0070659_100000402 | |||
| 1959 | Ga0070659_100016784 | |||
| 1960 | Ga0070659_100023709 | |||
| 1961 | Ga0070659_100061430 | |||
| 1962 | Ga0070659_100898031 | |||
| 1963 | Ga0070659_101468645 | |||
| 1964 | Ga0070667_100024096 | |||
| 1965 | Ga0070667_100302485 | |||
| 1966 | Ga0070714_100173670 | |||
| 1967 | Ga0070714_102037064 | |||
| 1968 | Ga0070713_100273715 | |||
| 1969 | Ga0070701_10031401 | |||
| 1970 | Ga0070711_100021768 | |||
| 1971 | Ga0070705_100095390 | |||
| 1972 | Ga0070700_100009943 | |||
| 1973 | Ga0070694_100103391 | |||
| 1974 | Ga0070694_100238117 | |||
| 1975 | Ga0070694_100957891 | |||
| 1976 | Ga0070663_100035412 | |||
| 1977 | Ga0070663_100311088 | |||
| 1978 | Ga0070663_100637672 | |||
| 1979 | Ga0070678_100001822 | |||
| 1980 | Ga0070662_100014975 | |||
| 1981 | Ga0070662_100059100 | |||
| 1982 | Ga0070662_100323843 | |||
| 1983 | Ga0070662_100328983 | |||
| 1984 | Ga0070662_100472900 | |||
| 1985 | Ga0070681_10003472 | |||
| 1986 | Ga0070681_10008372 | |||
| 1987 | Ga0070681_11508704 | |||
| 1988 | Ga0068867_100001197 | |||
| 1989 | Ga0068867_100225030 | |||
| 1990 | Ga0070685_10023543 | |||
| 1991 | Ga0070685_10054316 | |||
| 1992 | Ga0070685_10102990 | |||
| 1993 | Ga0070706_100032249 | |||
| 1994 | Ga0070706_101901071 | |||
| 1995 | Ga0070698_100011319 | |||
| 1996 | Ga0070699_100060134 | |||
| 1997 | Ga0070679_100014038 | |||
| 1998 | Ga0070679_100017069 | |||
| 1999 | Ga0070679_100087502 | |||
| 2000 | Ga0070679_100122160 | |||
| 2001 | Ga0070679_100358998 | |||
| 2002 | Ga0070684_100054640 | |||
| 2003 | Ga0070684_100108229 | |||
| 2004 | Ga0070684_100129440 | |||
| 2005 | Ga0070684_100637665 | |||
| 2006 | Ga0070697_100412354 | |||
| 2007 | Ga0068853_100080677 | |||
| 2008 | Ga0068853_100090995 | |||
| 2009 | Ga0068853_100334591 | |||
| 2010 | Ga0070672_100026322 | |||
| 2011 | Ga0070672_100292590 | |||
| 2012 | Ga0070693_100050514 | |||
| 2013 | Ga0070693_100268601 | |||
| 2014 | Ga0070693_100675544 | |||
| 2015 | Ga0070665_100000032 | |||
| 2016 | Ga0070665_100202373 | |||
| 2017 | Ga0070665_101146757 | |||
| 2018 | Ga0068855_100000026 | |||
| 2019 | Ga0068855_100042965 | |||
| 2020 | Ga0068855_100079811 | |||
| 2021 | Ga0068855_100088358 | |||
| 2022 | Ga0068855_100153698 | |||
| 2023 | Ga0068855_100337587 | |||
| 2024 | Ga0068855_100579060 | |||
| 2025 | Ga0068855_100681485 | |||
| 2026 | Ga0068855_101056822 | |||
| 2027 | Ga0070664_100071441 | |||
| 2028 | Ga0068857_100140153 | |||
| 2029 | Ga0068857_100669386 | |||
| 2030 | Ga0068857_101362068 | |||
| 2031 | Ga0068854_100049164 | |||
| 2032 | Ga0068854_101222578 | |||
| 2033 | Ga0068854_102016889 | |||
| 2034 | Ga0068856_100000014 | |||
| 2035 | Ga0068856_100003360 | |||
| 2036 | Ga0068856_100039856 | |||
| 2037 | Ga0068856_100123168 | |||
| 2038 | Ga0068856_100173722 | |||
| 2039 | Ga0068856_100526112 | |||
| 2040 | Ga0068856_100614725 | |||
| 2041 | Ga0070702_101058628 | |||
| 2042 | Ga0068852_100001456 | |||
| 2043 | Ga0068852_100021426 | |||
| 2044 | Ga0068852_100751085 | |||
| 2045 | Ga0068859_100079340 | |||
| 2046 | Ga0068859_100107960 | |||
| 2047 | Ga0068859_100180854 | |||
| 2048 | Ga0068859_101109496 | |||
| 2049 | Ga0068859_101349300 | |||
| 2050 | Ga0068864_100263279 | |||
| 2051 | Ga0068864_100343112 | |||
| 2052 | Ga0068864_100579521 | |||
| 2053 | Ga0068866_10034749 | |||
| 2054 | Ga0068861_100000562 | |||
| 2055 | Ga0068861_100000975 | |||
| 2056 | Ga0068861_101149382 | |||
| 2057 | Ga0068861_101227399 | |||
| 2058 | Ga0068851_10000357 | |||
| 2059 | Ga0068851_10203485 | |||
| 2060 | Ga0068851_10641888 | |||
| 2061 | Ga0068863_100000969 | |||
| 2062 | Ga0068863_100051547 | |||
| 2063 | Ga0068863_100326755 | |||
| 2064 | Ga0068863_100635317 | |||
| 2065 | Ga0068863_100906656 | |||
| 2066 | Ga0068863_102736433 | |||
| 2067 | Ga0068858_100031724 | |||
| 2068 | Ga0068858_100071033 | |||
| 2069 | Ga0068858_100072941 | |||
| 2070 | Ga0068858_100256656 | |||
| 2071 | Ga0068860_100004188 | |||
| 2072 | Ga0068860_100131686 | |||
| 2073 | Ga0068860_100229215 | |||
| 2074 | Ga0068860_102491524 | |||
| 2075 | Ga0068862_100013561 | |||
| 2076 | Ga0068862_101367029 | |||
| 2077 | Ga0070717_11705124 | |||
| 2078 | Ga0070716_100351276 | |||
| 2079 | Ga0070716_100800406 | |||
| 2080 | Ga0070712_100083391 | |||
| 2081 | Ga0070712_100135523 | |||
| 2082 | Ga0075369_10436126 | |||
| 2083 | Ga0075366_10000812 | |||
| 2084 | Ga0075366_10140973 | |||
| 2085 | Ga0075366_10566369 | |||
| 2086 | Ga0097621_100000057 | |||
| 2087 | Ga0097621_100020011 | |||
| 2088 | Ga0097621_101030470 | |||
| 2089 | Ga0075370_10119059 | |||
| 2090 | Ga0075370_10528481 | |||
| 2091 | Ga0075370_10530814 | |||
| 2092 | Ga0068871_100000094 | |||
| 2093 | Ga0068871_100013592 | |||
| 2094 | Ga0068871_100849862 | |||
| 2095 | Ga0075428_100003457 | |||
| 2096 | Ga0075428_100032084 | |||
| 2097 | Ga0075428_100144106 | |||
| 2098 | Ga0075428_100698736 | |||
| 2099 | Ga0075430_100001414 | |||
| 2100 | Ga0075430_100030156 | |||
| 2101 | Ga0075430_100094296 | |||
| 2102 | Ga0075430_100096433 | |||
| 2103 | Ga0075431_100002689 | |||
| 2104 | Ga0075431_100088689 | |||
| 2105 | Ga0075431_100287042 | |||
| 2106 | Ga0075431_100880819 | |||
| 2107 | Ga0075431_101086602 | |||
| 2108 | Ga0075433_10155235 | |||
| 2109 | Ga0075434_100192776 | |||
| 2110 | Ga0075434_100413611 | |||
| 2111 | Ga0075429_100002173 | |||
| 2112 | Ga0075429_100009872 | |||
| 2113 | Ga0075429_100917206 | |||
| 2114 | Ga0075429_101098667 | |||
| 2115 | Ga0075429_101334970 | |||
| 2116 | Ga0068865_100000200 | |||
| 2117 | Ga0068865_100026446 | |||
| 2118 | Ga0097620_100079345 | |||
| 2119 | Ga0097620_100107978 | |||
| 2120 | Ga0097620_100180865 | |||
| 2121 | Ga0097620_101109567 | |||
| 2122 | Ga0097620_101349199 | |||
| 2123 | Ga0075435_100115545 | |||
| 2124 | Ga0105251_10012672 | |||
| 2125 | Ga0105251_10149065 | |||
| 2126 | Ga0105244_10000001 | |||
| 2127 | Ga0105244_10013287 | |||
| 2128 | Ga0105244_10020501 | |||
| 2129 | Ga0105244_10219993 | |||
| 2130 | Ga0105250_10025692 | |||
| 2131 | Ga0105250_10119615 | |||
| 2132 | Ga0105240_10015703 | |||
| 2133 | Ga0105240_10067718 | |||
| 2134 | Ga0105240_10129348 | |||
| 2135 | Ga0105240_10140553 | |||
| 2136 | Ga0105240_10221121 | |||
| 2137 | Ga0105240_10260499 | |||
| 2138 | Ga0105240_10276735 | |||
| 2139 | Ga0105240_10429871 | |||
| 2140 | Ga0105240_10654945 | |||
| 2141 | Ga0105240_10877236 | |||
| 2142 | Ga0111539_10158570 | |||
| 2143 | Ga0111539_10159065 | |||
| 2144 | Ga0111539_10365710 | |||
| 2145 | Ga0111539_10776634 | |||
| 2146 | Ga0111539_11773332 | |||
| 2147 | Ga0111539_11837627 | |||
| 2148 | Ga0105247_10085212 | |||
| 2149 | Ga0105247_10127594 | |||
| 2150 | Ga0114129_10004634 | |||
| 2151 | Ga0114129_10030165 | |||
| 2152 | Ga0114129_10303183 | |||
| 2153 | Ga0105243_10000018 | |||
| 2154 | Ga0105243_10368164 | |||
| 2155 | Ga0105243_10880714 | |||
| 2156 | Ga0105241_10019243 | |||
| 2157 | Ga0105241_10127780 | |||
| 2158 | Ga0105241_10152542 | |||
| 2159 | Ga0105241_10218230 | |||
| 2160 | Ga0105241_11532111 | |||
| 2161 | Ga0105241_12131542 | |||
| 2162 | Ga0105242_10040711 | |||
| 2163 | Ga0105242_10158277 | |||
| 2164 | Ga0105242_10259463 | |||
| 2165 | Ga0105242_12059936 | |||
| 2166 | Ga0105248_10001106 | |||
| 2167 | Ga0105248_10052133 | |||
| 2168 | Ga0105248_10977514 | |||
| 2169 | Ga0105248_11746004 | |||
| 2170 | Ga0105248_12115238 | |||
| 2171 | Ga0105237_10001287 | |||
| 2172 | Ga0105237_10001321 | |||
| 2173 | Ga0105237_10012788 | |||
| 2174 | Ga0105237_10060769 | |||
| 2175 | Ga0105237_10075128 | |||
| 2176 | Ga0105237_10131048 | |||
| 2177 | Ga0105237_10224782 | |||
| 2178 | Ga0105237_10307141 | |||
| 2179 | Ga0105237_10511742 | |||
| 2180 | Ga0105237_10549691 | |||
| 2181 | Ga0105237_10556101 | |||
| 2182 | Ga0105237_10568819 | |||
| 2183 | Ga0105237_11485236 | |||
| 2184 | Ga0105237_12054660 | |||
| 2185 | Ga0105238_10003742 | |||
| 2186 | Ga0105238_10097306 | |||
| 2187 | Ga0105238_10128234 | |||
| 2188 | Ga0105238_10645026 | |||
| 2189 | Ga0105238_10719173 | |||
| 2190 | Ga0105249_10006060 | |||
| 2191 | Ga0105249_10008223 | |||
| 2192 | Ga0105249_10479239 | |||
| 2193 | Ga0105239_10000001 | |||
| 2194 | Ga0105239_10001363 | |||
| 2195 | Ga0105239_10005053 | |||
| 2196 | Ga0105239_10023806 | |||
| 2197 | Ga0105239_10192411 | |||
| 2198 | Ga0105239_10622805 | |||
| 2199 | Ga0105239_10844655 | |||
| 2200 | Ga0105239_11040978 | |||
| 2201 | Ga0105239_11124118 | |||
| 2202 | Ga0105239_12832608 | |||
| 2203 | Ga0105239_13253544 | |||
| 2204 | Ga0105246_10112043 | |||
| 2205 | Ga0105246_10234751 | |||
| 2206 | Ga0105246_10828799 | |||
| 2207 | Ga0157325_1008804 | |||
| 2208 | Ga0157321_1017992 | |||
| 2209 | Ga0157329_1013074 | |||
| 2210 | Ga0157319_1019331 | |||
| 2211 | Ga0157327_1003754 | |||
| 2212 | Ga0157373_10000054 | |||
| 2213 | Ga0157373_10000448 | |||
| 2214 | Ga0157373_10016881 | |||
| 2215 | Ga0157373_10018002 | |||
| 2216 | Ga0157373_10061203 | |||
| 2217 | Ga0157373_10068921 | |||
| 2218 | Ga0157373_10171486 | |||
| 2219 | Ga0157373_10172455 | |||
| 2220 | Ga0157373_10225466 | |||
| 2221 | Ga0157373_10476989 | |||
| 2222 | Ga0157373_10668179 | |||
| 2223 | Ga0157373_11440186 | |||
| 2224 | Ga0157371_10000052 | |||
| 2225 | Ga0157371_10002095 | |||
| 2226 | Ga0157371_10009982 | |||
| 2227 | Ga0157371_10012727 | |||
| 2228 | Ga0157371_10132755 | |||
| 2229 | Ga0157371_10182884 | |||
| 2230 | Ga0157371_10237127 | |||
| 2231 | Ga0157371_10242405 | |||
| 2232 | Ga0157371_10487143 | |||
| 2233 | Ga0157371_11012007 | |||
| 2234 | Ga0157370_10014970 | |||
| 2235 | Ga0157370_10043162 | |||
| 2236 | Ga0157370_10044584 | |||
| 2237 | Ga0157370_10114453 | |||
| 2238 | Ga0157370_10163773 | |||
| 2239 | Ga0157370_10176265 | |||
| 2240 | Ga0157370_10320873 | |||
| 2241 | Ga0157370_10470573 | |||
| 2242 | Ga0157370_10658017 | |||
| 2243 | Ga0157370_10670684 | |||
| 2244 | Ga0157370_10857595 | |||
| 2245 | Ga0157370_11041377 | |||
| 2246 | Ga0157370_12059448 | |||
| 2247 | Ga0157369_10000355 | |||
| 2248 | Ga0157369_10058386 | |||
| 2249 | Ga0157369_10064414 | |||
| 2250 | Ga0157369_10241115 | |||
| 2251 | Ga0157369_10307020 | |||
| 2252 | Ga0157369_10437331 | |||
| 2253 | Ga0157369_11430714 | |||
| 2254 | Ga0157374_10092042 | |||
| 2255 | Ga0157374_10150180 | |||
| 2256 | Ga0157374_10240694 | |||
| 2257 | Ga0157374_11247236 | |||
| 2258 | Ga0157374_12052736 | |||
| 2259 | Ga0157378_10022748 | |||
| 2260 | Ga0157378_10041902 | |||
| 2261 | Ga0157378_10160320 | |||
| 2262 | Ga0157378_11438049 | |||
| 2263 | Ga0163162_10000052 | |||
| 2264 | Ga0163162_10004579 | |||
| 2265 | Ga0163162_10006136 | |||
| 2266 | Ga0163162_10038959 | |||
| 2267 | Ga0163162_10090809 | |||
| 2268 | Ga0163162_10224456 | |||
| 2269 | Ga0163162_10878452 | |||
| 2270 | Ga0163162_12000926 | |||
| 2271 | Ga0157372_10000254 | |||
| 2272 | Ga0157372_10001280 | |||
| 2273 | Ga0157372_10042429 | |||
| 2274 | Ga0157372_10122899 | |||
| 2275 | Ga0157372_10151310 | |||
| 2276 | Ga0157372_10153165 | |||
| 2277 | Ga0157372_10265687 | |||
| 2278 | Ga0157372_10372742 | |||
| 2279 | Ga0157372_10481125 | |||
| 2280 | Ga0157372_10914657 | |||
| 2281 | Ga0157372_10946815 | |||
| 2282 | Ga0157372_11204962 | |||
| 2283 | Ga0157372_11267669 | |||
| 2284 | Ga0157375_10008115 | |||
| 2285 | Ga0157375_10013846 | |||
| 2286 | Ga0157375_10044048 | |||
| 2287 | Ga0157375_10106910 | |||
| 2288 | Ga0157375_10169512 | |||
| 2289 | Ga0157375_10469799 | |||
| 2290 | Ga0163163_10060719 | |||
| 2291 | Ga0163163_10280146 | |||
| 2292 | Ga0157380_10000015 | |||
| 2293 | Ga0157380_10046242 | |||
| 2294 | Ga0157380_10339685 | |||
| 2295 | Ga0157380_10585040 | |||
| 2296 | Ga0157380_12000718 | |||
| 2297 | Ga0157380_12570396 | |||
| 2298 | Ga0182008_10000030 | |||
| 2299 | Ga0182008_10000062 | |||
| 2300 | Ga0182008_10006054 | |||
| 2301 | Ga0182008_10021142 | |||
| 2302 | Ga0182008_10090076 | |||
| 2303 | Ga0157379_10000562 | |||
| 2304 | Ga0157379_10009212 | |||
| 2305 | Ga0157379_10268826 | |||
| 2306 | Ga0157376_10074456 | |||
| 2307 | Ga0157376_10279806 | |||
| 2308 | Ga0157376_10525825 | |||
| 2309 | Ga0157376_10575405 | |||
| 2310 | Ga0182006_1000003 | |||
| 2311 | Ga0182006_1002415 | |||
| 2312 | Ga0182006_1070067 | |||
| 2313 | Ga0182007_10000003 | |||
| 2314 | Ga0182007_10049861 | |||
| 2315 | Ga0182005_1000076 | |||
| 2316 | Ga0163161_10000009 | |||
| 2317 | Ga0163161_10000641 | |||
| 2318 | Ga0163161_10000862 | |||
| 2319 | Ga0163161_10025292 | |||
| 2320 | Ga0163161_10030399 | |||
| 2321 | Ga0163161_10035920 | |||
| 2322 | Ga0163161_10037844 | |||
| 2323 | Ga0163161_10041013 | |||
| 2324 | Ga0163161_10054458 | |||
| 2325 | Ga0163161_10075458 | |||
| 2326 | Ga0163161_10099208 | |||
| 2327 | Ga0163161_10481887 | |||
| 2328 | Ga0163161_11056009 | |||
| 2329 | Ga0197907_10502577 | |||
| 2330 | Ga0197907_10706642 | |||
| 2331 | Ga0197907_10819694 | |||
| 2332 | Ga0197907_11339442 | |||
| 2333 | Ga0206356_10266805 | |||
| 2334 | Ga0206356_10319799 | |||
| 2335 | Ga0206356_10781816 | |||
| 2336 | Ga0206356_11054826 | |||
| 2337 | Ga0206356_11795532 | |||
| 2338 | Ga0206356_11849337 | |||
| 2339 | Ga0206349_1678553 | |||
| 2340 | Ga0206349_1906000 | |||
| 2341 | Ga0206355_1389572 | |||
| 2342 | Ga0206355_1710056 | |||
| 2343 | Ga0206351_10106046 | |||
| 2344 | Ga0206351_10453586 | |||
| 2345 | Ga0206351_10462283 | |||
| 2346 | Ga0206351_10586730 | |||
| 2347 | Ga0206351_10776079 | |||
| 2348 | Ga0206352_10195467 | |||
| 2349 | Ga0206352_10639884 | |||
| 2350 | Ga0206352_11093239 | |||
| 2351 | Ga0206352_11147567 | |||
| 2352 | Ga0206352_11257836 | |||
| 2353 | Ga0206350_10111961 | |||
| 2354 | Ga0206350_10297200 | |||
| 2355 | Ga0206350_10464794 | |||
| 2356 | Ga0206350_10530843 | |||
| 2357 | Ga0206350_10647756 | |||
| 2358 | Ga0206354_10771971 | |||
| 2359 | Ga0206354_10796355 | |||
| 2360 | Ga0206354_11204833 | |||
| 2361 | Ga0206354_11237852 | |||
| 2362 | Ga0206353_10800764 | |||
| 2363 | Ga0206353_11117576 | |||
| 2364 | Ga0206353_11125333 | |||
| 2365 | Ga0206353_11264094 | |||
| 2366 | Ga0206353_11831860 | |||
| 2367 | Ga0206353_12062741 | |||
| 2368 | Ga0154015_1153066 | |||
| 2369 | Ga0154015_1236635 | |||
| 2370 | Ga0154015_1602182 | |||
| 2371 | Ga0224712_10005983 | |||
| 2372 | Ga0224712_10267272 | |||
| 2373 | Ga0256744_137381 | |||
| 2374 | Ga0209436_101300 | |||
| 2375 | Ga0209563_107118 | |||
| 2376 | Ga0207427_100236 | |||
| 2377 | Ga0207427_122187 | |||
| 2378 | Ga0209437_100034 | |||
| 2379 | Ga0209437_100143 | |||
| 2380 | Ga0209258_118342 | |||
| 2381 | Ga0207425_1000002 | |||
| 2382 | Ga0209026_1000463 | |||
| 2383 | Ga0209026_1002304 | |||
| 2384 | Ga0209026_1004428 | |||
| 2385 | Ga0209148_1017590 | |||
| 2386 | Ga0209129_1000002 | |||
| 2387 | Ga0209129_1013234 | |||
| 2388 | Ga0209233_1000038 | |||
| 2389 | Ga0209233_1019928 | |||
| 2390 | Ga0207666_1014994 | |||
| 2391 | Ga0209455_1001279 | |||
| 2392 | Ga0207673_1028041 | |||
| 2393 | Ga0209675_1000059 | |||
| 2394 | Ga0209676_1000294 | |||
| 2395 | Ga0209025_1000004 | |||
| 2396 | Ga0209758_1000006 | |||
| 2397 | Ga0207426_1003126 | |||
| 2398 | Ga0209257_1000023 | |||
| 2399 | Ga0207697_10147388 | |||
| 2400 | Ga0207656_10000220 | |||
| 2401 | Ga0207656_10030400 | |||
| 2402 | Ga0207656_10082248 | |||
| 2403 | Ga0207696_1087382 | |||
| 2404 | Ga0207696_1134549 | |||
| 2405 | Ga0207655_1000018 | |||
| 2406 | Ga0207655_1000093 | |||
| 2407 | Ga0207655_1059925 | |||
| 2408 | Ga0207713_1055674 | |||
| 2409 | Ga0207642_10582530 | |||
| 2410 | Ga0207710_10107597 | |||
| 2411 | Ga0207688_10060048 | |||
| 2412 | Ga0207680_10130973 | |||
| 2413 | Ga0207680_10162725 | |||
| 2414 | Ga0207647_10003884 | |||
| 2415 | Ga0207647_10007050 | |||
| 2416 | Ga0207647_10063060 | |||
| 2417 | Ga0207647_10086388 | |||
| 2418 | Ga0207645_10000909 | |||
| 2419 | Ga0207645_10002281 | |||
| 2420 | Ga0207643_10973824 | |||
| 2421 | Ga0207705_10000043 | |||
| 2422 | Ga0207705_10377593 | |||
| 2423 | Ga0207705_10469959 | |||
| 2424 | Ga0207705_10559224 | |||
| 2425 | Ga0207684_10006660 | |||
| 2426 | Ga0207654_10005184 | |||
| 2427 | Ga0207654_10518295 | |||
| 2428 | Ga0207654_11252249 | |||
| 2429 | Ga0207707_10005257 | |||
| 2430 | Ga0207707_10055872 | |||
| 2431 | Ga0207707_10213426 | |||
| 2432 | Ga0207707_10904110 | |||
| 2433 | Ga0207695_10000053 | |||
| 2434 | Ga0207695_10020568 | |||
| 2435 | Ga0207695_10029659 | |||
| 2436 | Ga0207695_10034034 | |||
| 2437 | Ga0207695_10044139 | |||
| 2438 | Ga0207695_10088255 | |||
| 2439 | Ga0207695_10088720 | |||
| 2440 | Ga0207695_10196503 | |||
| 2441 | Ga0207695_10287337 | |||
| 2442 | Ga0207695_10530382 | |||
| 2443 | Ga0207695_10807302 | |||
| 2444 | Ga0207671_10002869 | |||
| 2445 | Ga0207671_10003103 | |||
| 2446 | Ga0207671_10007516 | |||
| 2447 | Ga0207671_10012211 | |||
| 2448 | Ga0207671_10032530 | |||
| 2449 | Ga0207671_10037359 | |||
| 2450 | Ga0207671_10069032 | |||
| 2451 | Ga0207671_10961347 | |||
| 2452 | Ga0207693_10049593 | |||
| 2453 | Ga0207693_10081649 | |||
| 2454 | Ga0207660_10083829 | |||
| 2455 | Ga0207660_10092024 | |||
| 2456 | Ga0207662_10000695 | |||
| 2457 | Ga0207657_10020514 | |||
| 2458 | Ga0207657_10091410 | |||
| 2459 | Ga0207657_10220731 | |||
| 2460 | Ga0207657_10245093 | |||
| 2461 | Ga0207649_10018776 | |||
| 2462 | Ga0207649_10028375 | |||
| 2463 | Ga0207649_10056686 | |||
| 2464 | Ga0207652_10004160 | |||
| 2465 | Ga0207652_10022531 | |||
| 2466 | Ga0207652_10026145 | |||
| 2467 | Ga0207652_10257275 | |||
| 2468 | Ga0207652_11854710 | |||
| 2469 | Ga0207681_10000921 | |||
| 2470 | Ga0207681_10031056 | |||
| 2471 | Ga0207694_10022814 | |||
| 2472 | Ga0207694_10083340 | |||
| 2473 | Ga0207694_10464667 | |||
| 2474 | Ga0207694_10686066 | |||
| 2475 | Ga0207694_10779327 | |||
| 2476 | Ga0207650_10095058 | |||
| 2477 | Ga0207650_10320790 | |||
| 2478 | Ga0207659_10000169 | |||
| 2479 | Ga0207659_10000843 | |||
| 2480 | Ga0207659_10070326 | |||
| 2481 | Ga0207659_10435990 | |||
| 2482 | Ga0207687_10105232 | |||
| 2483 | Ga0207700_11601388 | |||
| 2484 | Ga0207664_10833667 | |||
| 2485 | Ga0207644_10001196 | |||
| 2486 | Ga0207644_10010204 | |||
| 2487 | Ga0207644_10296214 | |||
| 2488 | Ga0207644_10677170 | |||
| 2489 | Ga0207690_10000365 | |||
| 2490 | Ga0207690_10063455 | |||
| 2491 | Ga0207690_11265899 | |||
| 2492 | Ga0207706_10000057 | |||
| 2493 | Ga0207706_10002035 | |||
| 2494 | Ga0207706_10169742 | |||
| 2495 | Ga0207706_10266418 | |||
| 2496 | Ga0207686_10007982 | |||
| 2497 | Ga0207686_10125683 | |||
| 2498 | Ga0207686_10450592 | |||
| 2499 | Ga0207686_11301119 | |||
| 2500 | Ga0207709_10000021 | |||
| 2501 | Ga0207709_10000628 | |||
| 2502 | Ga0207670_10007709 | |||
| 2503 | Ga0207670_10082497 | |||
| 2504 | Ga0207670_10454751 | |||
| 2505 | Ga0207669_10099554 | |||
| 2506 | Ga0207704_10000052 | |||
| 2507 | Ga0207704_10003676 | |||
| 2508 | Ga0207665_10045738 | |||
| 2509 | Ga0207665_10116996 | |||
| 2510 | Ga0207665_10165633 | |||
| 2511 | Ga0207691_10031365 | |||
| 2512 | Ga0207691_10896985 | |||
| 2513 | Ga0207711_10002561 | |||
| 2514 | Ga0207689_10004653 | |||
| 2515 | Ga0207689_10080823 | |||
| 2516 | Ga0207661_10007883 | |||
| 2517 | Ga0207661_10007950 | |||
| 2518 | Ga0207661_10090386 | |||
| 2519 | Ga0207661_10252019 | |||
| 2520 | Ga0207679_10002943 | |||
| 2521 | Ga0207679_10003915 | |||
| 2522 | Ga0207679_10188504 | |||
| 2523 | Ga0207667_10000022 | |||
| 2524 | Ga0207667_10001325 | |||
| 2525 | Ga0207667_10012833 | |||
| 2526 | Ga0207667_10073046 | |||
| 2527 | Ga0207667_10152790 | |||
| 2528 | Ga0207667_10419233 | |||
| 2529 | Ga0207667_10800527 | |||
| 2530 | Ga0207651_10027165 | |||
| 2531 | Ga0207651_10039011 | |||
| 2532 | Ga0207712_10009138 | |||
| 2533 | Ga0207712_10030186 | |||
| 2534 | Ga0207712_10578305 | |||
| 2535 | Ga0207668_10046737 | |||
| 2536 | Ga0207668_10051640 | |||
| 2537 | Ga0207640_10033694 | |||
| 2538 | Ga0207640_10984577 | |||
| 2539 | Ga0207640_11093045 | |||
| 2540 | Ga0207640_11596769 | |||
| 2541 | Ga0207640_11660664 | |||
| 2542 | Ga0207658_10030281 | |||
| 2543 | Ga0207658_10048536 | |||
| 2544 | Ga0207658_10323473 | |||
| 2545 | Ga0207677_10076079 | |||
| 2546 | Ga0207703_10005252 | |||
| 2547 | Ga0207703_10008320 | |||
| 2548 | Ga0207703_10031399 | |||
| 2549 | Ga0207703_11067542 | |||
| 2550 | Ga0207703_11630091 | |||
| 2551 | Ga0207639_10030610 | |||
| 2552 | Ga0207639_10157453 | |||
| 2553 | Ga0207639_10287311 | |||
| 2554 | Ga0207639_10610595 | |||
| 2555 | Ga0207678_10310685 | |||
| 2556 | Ga0207708_10004898 | |||
| 2557 | Ga0207708_10296528 | |||
| 2558 | Ga0207708_10663202 | |||
| 2559 | Ga0207702_10000036 | |||
| 2560 | Ga0207702_10034672 | |||
| 2561 | Ga0207702_10052280 | |||
| 2562 | Ga0207702_10089289 | |||
| 2563 | Ga0207702_10144049 | |||
| 2564 | Ga0207702_10982685 | |||
| 2565 | Ga0207641_10000293 | |||
| 2566 | Ga0207641_10011831 | |||
| 2567 | Ga0207641_10593628 | |||
| 2568 | Ga0207648_10002788 | |||
| 2569 | Ga0207676_10060399 | |||
| 2570 | Ga0207676_10238990 | |||
| 2571 | Ga0207676_10258511 | |||
| 2572 | Ga0207674_10127668 | |||
| 2573 | Ga0207674_10521044 | |||
| 2574 | Ga0207675_100003884 | |||
| 2575 | Ga0207675_100066788 | |||
| 2576 | Ga0207683_10010796 | |||
| 2577 | Ga0207683_11373484 | |||
| 2578 | Ga0207683_11831365 | |||
| 2579 | Ga0207683_12069707 | |||
| 2580 | Ga0207698_10003054 | |||
| 2581 | Ga0207698_10005473 | |||
| 2582 | Ga0207698_10031644 | |||
| 2583 | Ga0207698_10401696 | |||
| 2584 | Ga0207698_10567760 | |||
| 2585 | Ga0207698_11049840 | |||
| 2586 | Ga0209281_1000158 | |||
| 2587 | Ga0209969_1021884 | |||
| 2588 | Ga0209969_1027942 | |||
| 2589 | Ga0209489_116311 | |||
| 2590 | Ga0209995_1002344 | |||
| 2591 | Ga0209968_1001388 | |||
| 2592 | Ga0209974_10022486 | |||
| 2593 | Ga0207428_10570692 | |||
| 2594 | Ga0268266_10000030 | |||
| 2595 | Ga0268265_10004276 | |||
| 2596 | Ga0268265_10122397 | |||
| 2597 | Ga0268265_11064869 | |||
| 2598 | Ga0268264_10028955 | |||
| 2599 | Ga0268264_10116808 | |||
| 2600 | Ga0268264_10687715 | |||
| 2601 | Ga0265318_10153980 | |||
| 2602 | Ga0265323_10000038 | |||
| 2603 | Ga0265323_10015327 | |||
| 2604 | Ga0307517_10006168 | |||
| 2605 | Ga0307517_10262260 | |||
| 2606 | Ga0307515_10000009 | |||
| 2607 | Ga0307515_10049612 | |||
| 2608 | Ga0307515_10244807 | |||
| 2609 | Ga0307515_10486209 | |||
| 2610 | Ga0307515_10689333 | |||
| 2611 | Ga0265338_10000920 | |||
| 2612 | Ga0265338_10049114 | |||
| 2613 | Ga0316177_1136623 | |||
| 2614 | Ga0316181_1034012 | |||
| 2615 | Ga0316181_1133526 | |||
| 2616 | Ga0316181_1201818 | |||
| 2617 | Ga0316181_1282363 | |||
| 2618 | Ga0316182_1171482 | |||
| 2619 | Ga0265766_1009546 | |||
| 2620 | Ga0265774_104937 | |||
| 2621 | Ga0265779_112346 | |||
| 2622 | Ga0265327_10017918 | |||
| 2623 | Ga0265327_10054874 | |||
| 2624 | Ga0265327_10059485 | |||
| 2625 | Ga0265316_10000481 | |||
| 2626 | Ga0265316_10002116 | |||
| 2627 | Ga0265316_10541036 | |||
| 2628 | Ga0307513_10494596 | |||
| 2629 | Ga0307513_10840906 | |||
| 2630 | Ga0307509_10007266 | |||
| 2631 | Ga0307509_10101371 | |||
| 2632 | Ga0307509_10372105 | |||
| 2633 | Ga0307408_100002257 | |||
| 2634 | Ga0307408_100037589 | |||
| 2635 | Ga0307408_100070397 | |||
| 2636 | Ga0307408_102048102 | |||
| 2637 | Ga0307508_10389351 | |||
| 2638 | Ga0307514_10113935 | |||
| 2639 | Ga0307514_10407243 | |||
| 2640 | Ga0265342_10203717 | |||
| 2641 | Ga0265342_10311692 | |||
| 2642 | Ga0316576_10012743 | |||
| 2643 | Ga0316576_10027864 | |||
| 2644 | Ga0316576_10050475 | |||
| 2645 | Ga0316576_10080691 | |||
| 2646 | Ga0316576_10176552 | |||
| 2647 | Ga0316576_10259036 | |||
| 2648 | Ga0316576_10269349 | |||
| 2649 | Ga0316576_10969568 | |||
| 2650 | Ga0316578_10520202 | |||
| 2651 | Ga0307516_10131017 | |||
| 2652 | Ga0307405_10000001 | |||
| 2653 | Ga0307405_10000003 | |||
| 2654 | Ga0307405_10001399 | |||
| 2655 | Ga0307405_10036088 | |||
| 2656 | Ga0307405_10051289 | |||
| 2657 | Ga0307405_10387160 | |||
| 2658 | Ga0307405_11196301 | |||
| 2659 | Ga0316577_10579840 | |||
| 2660 | Ga0307413_10000568 | |||
| 2661 | Ga0307413_10816658 | |||
| 2662 | Ga0307410_10020508 | |||
| 2663 | Ga0307410_10556354 | |||
| 2664 | Ga0307406_10002275 | |||
| 2665 | Ga0307406_10083679 | |||
| 2666 | Ga0307406_10116079 | |||
| 2667 | Ga0307406_10306128 | |||
| 2668 | Ga0307407_10000030 | |||
| 2669 | Ga0307407_10030089 | |||
| 2670 | Ga0307412_10000065 | |||
| 2671 | Ga0307412_10000072 | |||
| 2672 | Ga0307412_10000385 | |||
| 2673 | Ga0307412_10000925 | |||
| 2674 | Ga0307412_10002592 | |||
| 2675 | Ga0307412_10007236 | |||
| 2676 | Ga0307412_10120538 | |||
| 2677 | Ga0307412_10529903 | |||
| 2678 | Ga0307412_10806344 | |||
| 2679 | Ga0307412_10826948 | |||
| 2680 | Ga0307412_11062801 | |||
| 2681 | Ga0307409_101921563 | |||
| 2682 | Ga0307416_100000013 | |||
| 2683 | Ga0307416_100000014 | |||
| 2684 | Ga0307416_100007927 | |||
| 2685 | Ga0307416_100090547 | |||
| 2686 | Ga0307416_100330333 | |||
| 2687 | Ga0307416_100506789 | |||
| 2688 | Ga0307416_100828746 | |||
| 2689 | Ga0307416_102443421 | |||
| 2690 | Ga0307414_10000140 | |||
| 2691 | Ga0307414_10007780 | |||
| 2692 | Ga0307414_10010548 | |||
| 2693 | Ga0307414_10043088 | |||
| 2694 | Ga0307414_10073019 | |||
| 2695 | Ga0307414_10079883 | |||
| 2696 | Ga0307414_10100000 | |||
| 2697 | Ga0307414_10100320 | |||
| 2698 | Ga0307414_10120028 | |||
| 2699 | Ga0307414_10131990 | |||
| 2700 | Ga0307414_10141810 | |||
| 2701 | Ga0307414_10191977 | |||
| 2702 | Ga0307414_10279941 | |||
| 2703 | Ga0307414_10281196 | |||
| 2704 | Ga0307414_10318639 | |||
| 2705 | Ga0307414_10528899 | |||
| 2706 | Ga0307414_10662742 | |||
| 2707 | Ga0307414_10767053 | |||
| 2708 | Ga0307414_10790271 | |||
| 2709 | Ga0307414_11422815 | |||
| 2710 | Ga0307411_10000010 | |||
| 2711 | Ga0307411_10037802 | |||
| 2712 | Ga0307411_10116047 | |||
| 2713 | Ga0307415_100149326 | |||
| 2714 | Ga0307415_101670334 | |||
| 2715 | Ga0307415_101849028 | |||
| 2716 | Ga0316585_10044695 | |||
| 2717 | Ga0316585_10076681 | |||
| 2718 | Ga0316580_10058497 | |||
| 2719 | Ga0316580_10119047 | |||
| 2720 | Ga0316593_10001317 | |||
| 2721 | Ga0316593_10001424 | |||
| 2722 | Ga0316593_10005401 | |||
| 2723 | Ga0316593_10007056 | |||
| 2724 | Ga0316593_10010871 | |||
| 2725 | Ga0316593_10019016 | |||
| 2726 | Ga0316593_10022431 | |||
| 2727 | Ga0316593_10023475 | |||
| 2728 | Ga0316593_10047964 | |||
| 2729 | Ga0316593_10053466 | |||
| 2730 | Ga0316593_10061455 | |||
| 2731 | Ga0316593_10139556 | |||
| 2732 | Ga0316593_10239907 | |||
| 2733 | Ga0316593_10337803 | |||
| 2734 | Ga0307507_10000032 | |||
| 2735 | Ga0307510_10005905 | |||
| 2736 | Ga0307510_10022058 | |||
| 2737 | Ga0316592_1000944 | |||
| 2738 | Ga0316592_1001500 | |||
| 2739 | Ga0316592_1001667 | |||
| 2740 | Ga0316592_1003832 | |||
| 2741 | Ga0316592_1005390 | |||
| 2742 | Ga0316592_1010904 | |||
| 2743 | Ga0316592_1011737 | |||
| 2744 | Ga0316592_1017679 | |||
| 2745 | Ga0316592_1021309 | |||
| 2746 | Ga0316592_1024241 | |||
| 2747 | Ga0316592_1032646 | |||
| 2748 | Ga0316592_1055538 | |||
| 2749 | Ga0316592_1075461 | |||
| 2750 | Ga0316592_1088032 | |||
| 2751 | Ga0316592_1113262 | |||
| 2752 | Ga0316592_1129750 | |||
| 2753 | Ga0316592_1133454 | |||
| 2754 | Ga0316586_1000972 | |||
| 2755 | Ga0316586_1002316 | |||
| 2756 | Ga0316586_1007006 | |||
| 2757 | Ga0316586_1047132 | |||
| 2758 | Ga0316586_1104026 | |||
| 2759 | Ga0316588_1001715 | |||
| 2760 | Ga0316588_1016176 | |||
| 2761 | Ga0316588_1021501 | |||
| 2762 | Ga0316588_1025332 | |||
| 2763 | Ga0316588_1035028 | |||
| 2764 | Ga0316588_1114550 | |||
| 2765 | Ga0316588_1129337 | |||
| 2766 | Ga0316588_1129532 | |||
| 2767 | Ga0316596_1000933 | |||
| 2768 | Ga0316596_1001316 | |||
| 2769 | Ga0316596_1003631 | |||
| 2770 | Ga0316596_1004659 | |||
| 2771 | Ga0316596_1005709 | |||
| 2772 | Ga0316596_1009273 | |||
| 2773 | Ga0316596_1009752 | |||
| 2774 | Ga0316596_1015300 | |||
| 2775 | Ga0316596_1017392 | |||
| 2776 | Ga0316596_1021017 | |||
| 2777 | Ga0316596_1028750 | |||
| 2778 | Ga0316596_1032378 | |||
| 2779 | Ga0316596_1037825 | |||
| 2780 | Ga0316596_1041213 | |||
| 2781 | Ga0316596_1089556 | |||
| 2782 | Ga0316596_1090694 | |||
| 2783 | Ga0316596_1133003 | |||
| 2784 | Ga0316596_1148215 | |||
| 2785 | Ga0316596_1242811 | |||
| 2786 | Ga0373959_0160283 | |||
| 2787 | Ga0373944_0087759 | |||
| 2788 | Ga0373951_0061742 | |||
| 2789 | Ga0373954_0408307 | |||
| 2790 | Ga0373960_0013130 | |||
| 2791 | Ga0373942_0108523 | |||
| 2792 | Ga0316574_0079726 | |||
| 2793 | Ga0316574_0168258 | |||
| 2794 | Ga0316574_0244732 | |||
| 2795 | Ga0373935_0645599 | |||
| 2796 | Ga0373927_0246332 | |||
| 2797 | Ga0373937_0394787 | |||
| 2798 | Ga0265778_001249 | |||
| 2799 | Ga0316582_0005208 | |||
| 2800 | Ga0316582_0012374 | |||
| 2801 | Ga0316582_0456969 | |||
| 2802 | Ga0316582_0763131 | |||
| 2803 | Ga0316584_0001736 | |||
| 2804 | Ga0316584_0004533 | |||
| 2805 | Ga0316584_0018160 | |||
| 2806 | Ga0316584_0126509 | |||
| 2807 | Ga0316584_0817308 | |||
| 2808 | Ga0373925_1404430 | |||
| 2809 | Ga0395899_0000002 | |||
| 2810 | Ga0395899_0000061 | |||
| 2811 | Ga0395899_0012421 | |||
| 2812 | Ga0395899_0046276 | |||
| 2813 | Ga0395899_0490756 | |||
| 2814 | Ga0395900_0000143 | |||
| 2815 | Ga0395900_0000284 | |||
| 2816 | Ga0395900_0125611 | |||
| 2817 | Ga0395900_0258745 | |||
| 2818 | Ga0395898_0049674 | |||
| 2819 | Ga0395898_0059816 | |||
| 2820 | Ga0395905_0000045 | |||
| 2821 | Ga0395905_0001507 | |||
| 2822 | Ga0395905_0003630 | |||
| 2823 | Ga0395905_0164245 | |||
| 2824 | Ga0395905_1684294 | |||
| 2825 | Ga0395901_0000976 | |||
| 2826 | Ga0395901_0003957 | |||
| 2827 | Ga0395901_0056763 | |||
| 2828 | Ga0395901_0237197 | |||
| 2829 | Ga0395901_0276349 | |||
| 2830 | Ga0400483_029390 | |||
| 2831 | Ga0400483_050403 | |||
| 2832 | Ga0400483_124011 | |||
| 2833 | Ga0400483_195876 | |||
| 2834 | Ga0400483_226961 | |||
| 2835 | Ga0400489_00166 | |||
| 2836 | Ga0436365_0622767 | |||
| 2837 | Ga0436365_1899993 | |||
| 2838 | Ga0436361_0285047 | |||
| 2839 | Ga0436361_1065956 | |||
| 2840 | Ga0439447_000448 | |||
| 2841 | Ga0439453_0030344 | |||
| 2842 | Ga0439465_0000059 | |||
| 2843 | Ga0451787_190884 | |||
| 2844 | Ga0451787_260319 | |||
| 2845 | Ga0451787_275413 | |||
| 2846 | Ga0451788_06079 | |||
| 2847 | Ga0451788_08994 | |||
| 2848 | Ga0451789_0910149 | |||
| 2849 | Ga0451789_1121600 | |||
| 2850 | Ga0451790_02189 | |||
| 2851 | Ga0451790_02818 | |||
| 2852 | Ga0451790_07784 | |||
| 2853 | Ga0451790_08466 | |||
| 2854 | Ga0451790_08648 | |||
| 2855 | Ga0451790_27903 | |||
| 2856 | Ga0451790_29633 | |||
| 2857 | Ga0451792_04669 | |||
| 2858 | Ga0451792_14905 | |||
| 2859 | Ga0451794_07486 | |||
| 2860 | Ga0451794_12521 | |||
| 2861 | Ga0451794_28924 | |||
| 2862 | Ga0451794_30763 | |||
| 2863 | Ga0451794_36379 | |||
| 2864 | Ga0451794_38207 | |||
| 2865 | Ga0451794_41130 | |||
| 2866 | Ga0451794_46656 | |||
| 2867 | Ga0451796_14267 | |||
| 2868 | Ga0451791_0638065 | |||
| 2869 | Ga0451791_1422218 | |||
| 2870 | Ga0451793_1805624 | |||
| 2871 | Ga0451797_0299663 | |||
| 2872 | Ga0451797_0547988 | |||
| 2873 | Ga0451797_0843647 | |||
| 2874 | Ga0451799_34312 | |||
| 2875 | Ga0451795_0287747 | |||
| 2876 | Ga0451795_0330379 | |||
| 2877 | Ga0451795_0366728 | |||
| 2878 | Ga0451795_0531346 | |||
| 2879 | Ga0451795_0712291 | |||
| 2880 | Ga0451795_0944706 | |||
| 2881 | Ga0451795_1233880 | |||
| 2882 | Ga0451795_1279062 | |||
| 2883 | Ga0451795_1367261 | |||
| 2884 | Ga0451795_1448660 | |||
| 2885 | Ga0451795_1631148 | |||
| 2886 | Ga0451803_12559 | |||
| 2887 | Ga0451802_0278220 | |||
| 2888 | Ga0451802_2099772 | |||
| 2889 | Ga0451805_071652 | |||
| 2890 | Ga0451805_080062 | |||
| 2891 | Ga0451805_090433 | |||
| 2892 | Ga0451805_090728 | |||
| 2893 | Ga0451806_626055 | |||
| 2894 | Ga0451804_0537731 | |||
| 2895 | Ga0451808_04048 | |||
| 2896 | Ga0451807_0716238 | |||
| 2897 | Ga0451807_2059496 | |||
| 2898 | Ga0451807_2675568 | |||
| 2899 | Ga0451833_1205465 | |||
| 2900 | Ga0451836_08780 | |||
| 2901 | Ga0451837_0040229 | |||
| 2902 | Ga0451837_0608429 | |||
| 2903 | Ga0451837_0813853 | |||
| 2904 | Ga0451837_1109650 | |||
| 2905 | Ga0451840_01673 | |||
| 2906 | Ga0451841_1223165 | |||
| 2907 | Ga0451846_27502 | |||
| 2908 | Ga0451847_0250895 | |||
| 2909 | Ga0451847_0611722 | |||
| 2910 | Ga0451850_54086 | |||
| 2911 | Ga0451851_0814099 | |||
| 2912 | Ga0451851_0960257 | |||
| 2913 | Ga0451852_06555 | |||
| 2914 | Ga0451852_36362 | |||
| 2915 | Ga0451852_44034 | |||
| 2916 | Ga0451843_0050032 | |||
| 2917 | Ga0451843_0575012 | |||
| 2918 | Ga0451843_1460174 | |||
| 2919 | Ga0451854_21462 | |||
| 2920 | Ga0451855_0044321 | |||
| 2921 | Ga0451855_0129181 | |||
| 2922 | Ga0451855_0274826 | |||
| 2923 | Ga0451855_0368377 | |||
| 2924 | Ga0451855_0517858 | |||
| 2925 | Ga0451855_0696871 | |||
| 2926 | Ga0451855_0991025 | |||
| 2927 | Ga0451855_1020551 | |||
| 2928 | Ga0452268_13769 | |||
| 2929 | Ga0452268_16729 | |||
| 2930 | Ga0452268_21896 | |||
| 2931 | Ga0452268_35472 | |||
| 2932 | Ga0452269_1053 | |||
| 2933 | Ga0452271_05642 | |||
| 2934 | Ga0452271_28809 | |||
| 2935 | Ga0439433_0021808 | |||
| 2936 | Ga0439445_0000513 | |||
| 2937 | Ga0439445_0100589 | |||
| 2938 | Ga0439448_0007567 | |||
| 2939 | Ga0439448_0029702 | |||
| 2940 | Ga0439450_019604 | |||
| 2941 | Ga0439455_0009871 | |||
| 2942 | Ga0439455_0056405 | |||
| 2943 | Ga0439457_009023 | |||
| 2944 | Ga0439462_0082276 | |||
| 2945 | Ga0450890_012146 | |||
| 2946 | Ga0439446_0026548 | |||
| 2947 | Ga0439460_0249123 | |||
| 2948 | Ga0450893_0004983 | |||
| 2949 | Ga0451577_0000854 | |||
| 2950 | Ga0451577_0001297 | |||
| 2951 | Ga0451577_0003726 | |||
| 2952 | Ga0451577_0011827 | |||
| 2953 | Ga0451577_0022661 | |||
| 2954 | Ga0451577_0025338 | |||
| 2955 | Ga0451577_0031270 | |||
| 2956 | Ga0451577_0057422 | |||
| 2957 | Ga0451577_0075809 | |||
| 2958 | Ga0451577_0079353 | |||
| 2959 | Ga0451577_0182065 | |||
| 2960 | Ga0451577_0246633 | |||
| 2961 | Ga0451577_0264702 | |||
| 2962 | Ga0451577_0273441 | |||
| 2963 | Ga0451577_0274429 | |||
| 2964 | Ga0451577_0435209 | |||
| 2965 | Ga0451577_0485948 | |||
| 2966 | Ga0451577_0580449 | |||
| 2967 | Ga0451577_1266591 | |||
| 2968 | Ga0451577_1678341 | |||
| 2969 | Ga0453683_0014479 | |||
| 2970 | Ga0453683_0032774 | |||
| 2971 | Ga0453683_0033895 | |||
| 2972 | Ga0453683_0038384 | |||
| 2973 | Ga0453683_0042488 | |||
| 2974 | Ga0453683_0056977 | |||
| 2975 | Ga0453683_0089489 | |||
| 2976 | Ga0453683_0206789 | |||
| 2977 | Ga0453683_0222554 | |||
| 2978 | Ga0453683_0499328 | |||
| 2979 | Ga0453683_0624968 | |||
| 2980 | Ga0453683_0821136 | |||
| 2981 | Ga0466964_0042874 | |||
| 2982 | Ga0453684_0000011 | |||
| 2983 | Ga0453684_0000194 | |||
| 2984 | Ga0453684_0000197 | |||
| 2985 | Ga0453684_0000779 | |||
| 2986 | Ga0453684_0001358 | |||
| 2987 | Ga0453684_0001456 | |||
| 2988 | Ga0453684_0001891 | |||
| 2989 | Ga0453684_0002943 | |||
| 2990 | Ga0453684_0004073 | |||
| 2991 | Ga0453684_0006165 | |||
| 2992 | Ga0453684_0009847 | |||
| 2993 | Ga0453684_0024439 | |||
| 2994 | Ga0453684_0037423 | |||
| 2995 | Ga0453684_0046511 | |||
| 2996 | Ga0453684_0057481 | |||
| 2997 | Ga0453684_0058092 | |||
| 2998 | Ga0453684_0060601 | |||
| 2999 | Ga0453684_0064802 | |||
| 3000 | Ga0453684_0127015 | |||
| 3001 | Ga0453684_0140381 | |||
| 3002 | Ga0453684_0180136 | |||
| 3003 | Ga0453684_0253166 | |||
| 3004 | Ga0453684_0308865 | |||
| 3005 | Ga0453684_0375729 | |||
| 3006 | Ga0453684_0425574 | |||
| 3007 | Ga0453684_0467645 | |||
| 3008 | Ga0453684_0614489 | |||
| 3009 | Ga0453684_0817984 | |||
| 3010 | Ga0453684_0919404 | |||
| 3011 | Ga0453684_1055676 | |||
| 3012 | Ga0453684_1456891 | |||
| 3013 | Ga0453684_1461441 | |||
| 3014 | Ga0453684_1778979 | |||
| 3015 | Ga0453684_1998358 | |||
| 3016 | Ga0466959_0260439 | |||
| 3017 | Ga0451576_0000003 | |||
| 3018 | Ga0451576_0004347 | |||
| 3019 | Ga0451576_0006577 | |||
| 3020 | Ga0451576_0007377 | |||
| 3021 | Ga0451576_0010553 | |||
| 3022 | Ga0451576_0013829 | |||
| 3023 | Ga0451576_0022593 | |||
| 3024 | Ga0451576_0044632 | |||
| 3025 | Ga0451576_0062300 | |||
| 3026 | Ga0451576_0100168 | |||
| 3027 | Ga0451576_0161739 | |||
| 3028 | Ga0451576_0189408 | |||
| 3029 | Ga0451576_0225019 | |||
| 3030 | Ga0451576_0226040 | |||
| 3031 | Ga0451576_1001280 | |||
| 3032 | Ga0451576_1153877 | |||
| 3033 | Ga0451576_1732574 | |||
| 3034 | Ga0451576_1827137 | |||
| 3035 | Ga0451576_1846626 | |||
| 3036 | Ga0451576_1976816 | |||
| 3037 | Ga0451576_2139450 | |||
| 3038 | Ga0466967_0039117 | |||
| 3039 | Ga0466967_0084399 | |||
| 3040 | Ga0495627_000067 | |||
| 3041 | Ga0495627_002663 | |||
| 3042 | Ga0495590_0042540 | |||
| 3043 | Ga0495629_0121662 | |||
| 3044 | Ga0495629_0126330 | |||
| 3045 | Ga0495638_0098466 | |||
| 3046 | Ga0495638_0122692 | |||
| 3047 | Ga0495638_0136173 | |||
| 3048 | Ga0495638_0231104 | |||
| 3049 | Ga0495641_0314106 | |||
| 3050 | Ga0495651_0032684 | |||
| 3051 | Ga0495651_0230749 | |||
| 3052 | Ga0495650_0000594 | |||
| 3053 | Ga0495580_0118598 | |||
| 3054 | Ga0495605_0239097 | |||
| 3055 | Ga0495664_0000007 | |||
| 3056 | Ga0495585_0003458 | |||
| 3057 | Ga0495585_0004171 | |||
| 3058 | Ga0495585_0258813 | |||
| 3059 | Ga0495596_0022478 | |||
| 3060 | Ga0495607_0034827 | |||
| 3061 | Ga0495607_0100116 | |||
| 3062 | Ga0495607_0254487 | |||
| 3063 | Ga0495607_0328816 | |||
| 3064 | Ga0495607_0360535 | |||
| 3065 | Ga0495583_0028887 | |||
| 3066 | Ga0495606_0027164 | |||
| 3067 | Ga0495606_0030744 | |||
| 3068 | Ga0495606_0037734 | |||
| 3069 | Ga0495606_0057780 | |||
| 3070 | Ga0495606_0085902 | |||
| 3071 | Ga0495606_0089225 | |||
| 3072 | Ga0495606_0477622 | |||
| 3073 | Ga0495608_0174230 | |||
| 3074 | Ga0495608_0570398 | |||
| 3075 | Ga0495610_0000006 | |||
| 3076 | Ga0495610_0001861 | |||
| 3077 | Ga0495610_0007560 | |||
| 3078 | Ga0495610_0052876 | |||
| 3079 | Ga0495610_0224928 | |||
| 3080 | Ga0495616_0006133 | |||
| 3081 | Ga0495616_0010134 | |||
| 3082 | Ga0495616_0010222 | |||
| 3083 | Ga0495618_0126846 | |||
| 3084 | Ga0495628_0282519 | |||
| 3085 | Ga0495631_0025389 | |||
| 3086 | Ga0495631_0122889 | |||
| 3087 | Ga0495632_0009820 | |||
| 3088 | Ga0495632_0158702 | |||
| 3089 | Ga0495637_0021088 | |||
| 3090 | Ga0495637_0099456 | |||
| 3091 | Ga0495643_0000948 | |||
| 3092 | Ga0495643_0007748 | |||
| 3093 | Ga0495643_0266685 | |||
| 3094 | Ga0495643_0318438 | |||
| 3095 | Ga0495648_0004657 | |||
| 3096 | Ga0495663_0000043 | |||
| 3097 | Ga0495663_0010896 | |||
| 3098 | Ga0495663_0026521 | |||
| 3099 | Ga0495652_0185809 | |||
| 3100 | Ga0495654_0000017 | |||
| 3101 | Ga0495654_0011017 | |||
| 3102 | Ga0495654_0071533 | |||
| 3103 | Ga0495609_0000780 | |||
| 3104 | Ga0495609_0005251 | |||
| 3105 | Ga0495621_0111333 | |||
| 3106 | Ga0495645_0326213 | |||
| 3107 | Ga0495622_0026339 | |||
| 3108 | Ga0495633_0000021 | |||
| 3109 | Ga0495633_0000680 | |||
| 3110 | Ga0495633_0096896 | |||
| 3111 | Ga0495668_0000673 | |||
| 3112 | Ga0495668_0110755 | |||
| 3113 | Ga0495625_0000021 | |||
| 3114 | Ga0495625_0004265 | |||
| 3115 | Ga0495625_0033407 | |||
| 3116 | Ga0495625_0047911 | |||
| 3117 | Ga0495625_0110420 | |||
| 3118 | Ga0495625_0159974 | |||
| 3119 | Ga0495625_0287222 | |||
| 3120 | Ga0495661_0000739 | |||
| 3121 | Ga0495661_0008232 | |||
| 3122 | Ga0495588_0182890 | |||
| 3123 | Ga0495657_0455975 | |||
| 3124 | Ga0495658_0141088 | |||
| 3125 | Ga0495670_0119049 | |||
| 3126 | Ga0495671_0072492 | |||
| 3127 | Ga0495671_0136005 | |||
| 3128 | Ga0495649_0000009 | |||
| 3129 | Ga0495649_0023066 | |||
| 3130 | Ga0495660_0005455 | |||
| 3131 | Ga0495660_0050714 | |||
| 3132 | Ga0495660_0079118 | |||
| 3133 | Ga0495581_0660112 | |||
| 3134 | Ga0495680_0539006 | |||
| 3135 | Ga0495683_0291568 | |||
| 3136 | Ga0495687_001340 | |||
| 3137 | Ga0495687_020359 | |||
| 3138 | Ga0495673_0016437 | |||
| 3139 | Ga0495681_0230989 | |||
| 3140 | Ga0495686_0021467 | |||
| 3141 | Ga0495686_0060699 | |||
| 3142 | Ga0495686_0129726 | |||
| 3143 | Ga0495686_0131215 | |||
| 3144 | Ga0495686_0384665 | |||
| 3145 | Ga0495615_0042524 | |||
| 3146 | Ga0496102_0238774 | |||
| 3147 | Ga0496105_0435175 | |||
| 3148 | Ga0496108_0460348 | |||
| 3149 | Ga0496110_0612555 | |||
| 3150 | Ga0496113_0085785 | |||
| 3151 | Ga0496113_0695514 | |||
| 3152 | Ga0496114_0599002 | |||
| 3153 | Ga0496115_0002997 | |||
| 3154 | Ga0496116_0000156 | |||
| 3155 | Ga0496116_0000199 | |||
| 3156 | Ga0496116_0005208 | |||
| 3157 | Ga0496117_0000076 | |||
| 3158 | Ga0496117_0015077 | |||
| 3159 | Ga0496118_0001659 | |||
| 3160 | Ga0496118_0070500 | |||
| 3161 | Ga0496119_0000021 | |||
| 3162 | Ga0496121_0000030 | |||
| 3163 | Ga0496121_0075674 | |||
| 3164 | Ga0496121_0394902 | |||
| 3165 | Ga0496122_0000625 | |||
| 3166 | Ga0496122_0011897 | |||
| 3167 | Ga0496122_0013994 | |||
| 3168 | Ga0496122_0026712 | |||
| 3169 | Ga0496122_0032264 | |||
| 3170 | Ga0496122_0244208 | |||
| 3171 | Ga0496123_0003734 | |||
| 3172 | Ga0496123_0015161 | |||
| 3173 | Ga0496123_0015827 | |||
| 3174 | Ga0496123_0064856 | |||
| 3175 | Ga0496124_0002475 | |||
| 3176 | Ga0496124_0040283 | |||
| 3177 | Ga0496125_0000062 | |||
| 3178 | Ga0496125_0000452 | |||
| 3179 | Ga0496125_0045300 | |||
| 3180 | Ga0496125_0065617 | |||
| 3181 | Ga0496125_0100691 | |||
| 3182 | Ga0496125_0156945 | |||
| 3183 | Ga0496125_0443612 | |||
| 3184 | Ga0496126_0001324 | |||
| 3185 | Ga0496126_0026501 | |||
| 3186 | Ga0496126_0031118 | |||
| 3187 | Ga0496126_0390404 | |||
| 3188 | Ga0501306_000090 | |||
| 3189 | Ga0501306_003219 | |||
| 3190 | Ga0501306_003286 | |||
| 3191 | Ga0501306_007803 | |||
| 3192 | Ga0501306_036287 | |||
| 3193 | Ga0501306_037179 | |||
| 3194 | Ga0501306_056119 | |||
| 3195 | Ga0501308_001515 | |||
| 3196 | Ga0501308_004388 | |||
| 3197 | Ga0501308_008086 | |||
| 3198 | Ga0501308_046871 | |||
| 3199 | Ga0501309_001209 | |||
| 3200 | Ga0501309_006960 | |||
| 3201 | Ga0501309_076406 | |||
| 3202 | Ga0501310_000037 | |||
| 3203 | Ga0501310_000916 | |||
| 3204 | Ga0501310_007733 | |||
| 3205 | Ga0501310_012147 | |||
| 3206 | Ga0501310_017354 | |||
| 3207 | Ga0501341_00790 | |||
| 3208 | Ga0501341_01701 | |||
| 3209 | Ga0501341_04030 | |||
| 3210 | Ga0501341_09538 | |||
| 3211 | Ga0501343_002150 | |||
| 3212 | Ga0501343_005438 | |||
| 3213 | Ga0501343_014719 | |||
| 3214 | Ga0501343_020106 | |||
| 3215 | Ga0501344_04193 | |||
| 3216 | Ga0501345_01540 | |||
| 3217 | Ga0501304_007086 | |||
| 3218 | Ga0501304_007801 | |||
| 3219 | Ga0501304_008375 | |||
| 3220 | Ga0501304_018661 | |||
| 3221 | Ga0501304_026738 | |||
| 3222 | Ga0501305_000794 | |||
| 3223 | Ga0501305_001549 | |||
| 3224 | Ga0501305_001909 | |||
| 3225 | Ga0501305_002800 | |||
| 3226 | Ga0501305_033759 | |||
| 3227 | Ga0501305_035163 | |||
| 3228 | Ga0501305_048762 | |||
| 3229 | Ga0501305_052529 | |||
| 3230 | Ga0501305_066695 | |||
| 3231 | Ga0501307_000560 | |||
| 3232 | Ga0501307_000602 | |||
| 3233 | Ga0501307_008962 | |||
| 3234 | Ga0501307_013824 | |||
| 3235 | Ga0501307_027966 | |||
| 3236 | Ga0501307_029260 | |||
| 3237 | Ga0501307_057024 | |||
| 3238 | Ga0501307_061293 | |||
| 3239 | Ga0501342_01634 | |||
| 3240 | Ga0501342_03433 | |||
| 3241 | Ga0501342_03506 | |||
| 3242 | Ga0495678_033405 | |||
| 3243 | Ga0495682_0041703 | |||
| 3244 | Ga0501311_009489 | |||
| 3245 | Ga0501311_012558 | |||
| 3246 | Ga0501311_013964 | |||
| 3247 | Ga0501311_015846 | |||
| 3248 | Ga0501311_050040 | |||
| 3249 | Ga0501312_000226 | |||
| 3250 | Ga0501312_000486 | |||
| 3251 | Ga0501312_007844 | |||
| 3252 | Ga0501312_013626 | |||
| 3253 | Ga0501312_025871 | |||
| 3254 | Ga0501312_041004 | |||
| 3255 | Ga0501312_048843 | |||
| 3256 | Ga0501312_055713 | |||
| 3257 | Ga0501312_060610 | |||
| 3258 | Ga0501313_000829 | |||
| 3259 | Ga0501313_001041 | |||
| 3260 | Ga0501313_023195 | |||
| 3261 | Ga0501313_029125 | |||
| 3262 | Ga0501313_035218 | |||
| 3263 | Ga0501313_042735 | |||
| 3264 | Ga0501314_000485 | |||
| 3265 | Ga0501314_001176 | |||
| 3266 | Ga0501314_003861 | |||
| 3267 | Ga0501314_005415 | |||
| 3268 | Ga0501314_012624 | |||
| 3269 | Ga0501314_023345 | |||
| 3270 | Ga0501314_039590 | |||
| 3271 | Ga0501315_000064 | |||
| 3272 | Ga0501315_000629 | |||
| 3273 | Ga0501315_001579 | |||
| 3274 | Ga0501315_011574 | |||
| 3275 | Ga0501315_047206 | |||
| 3276 | Ga0501315_080912 | |||
| 3277 | Ga0501315_093331 | |||
| 3278 | Ga0501316_000650 | |||
| 3279 | Ga0501316_004246 | |||
| 3280 | Ga0501316_024839 | |||
| 3281 | Ga0501316_036380 | |||
| 3282 | Ga0501316_057394 | |||
| 3283 | Ga0501317_001389 | |||
| 3284 | Ga0501317_020207 | |||
| 3285 | Ga0501317_030347 | |||
| 3286 | Ga0501317_034208 | |||
| 3287 | Ga0501317_062792 | |||
| 3288 | Ga0501317_109971 | |||
| 3289 | Ga0501318_013246 | |||
| 3290 | Ga0501318_018041 | |||
| 3291 | Ga0501318_033966 | |||
| 3292 | Ga0501319_000006 | |||
| 3293 | Ga0501319_000068 | |||
| 3294 | Ga0501319_000383 | |||
| 3295 | Ga0501319_000428 | |||
| 3296 | Ga0501319_007320 | |||
| 3297 | Ga0501319_008963 | |||
| 3298 | Ga0501319_010268 | |||
| 3299 | Ga0501319_012847 | |||
| 3300 | Ga0501319_017561 | |||
| 3301 | Ga0501320_000264 | |||
| 3302 | Ga0501320_000540 | |||
| 3303 | Ga0501320_003081 | |||
| 3304 | Ga0501320_004332 | |||
| 3305 | Ga0501320_015745 | |||
| 3306 | Ga0501320_023241 | |||
| 3307 | Ga0501320_023596 | |||
| 3308 | Ga0501320_027211 | |||
| 3309 | Ga0501321_013675 | |||
| 3310 | Ga0501321_018418 | |||
| 3311 | Ga0501321_021060 | |||
| 3312 | Ga0501321_027635 | |||
| 3313 | Ga0501321_031517 | |||
| 3314 | Ga0501321_033178 | |||
| 3315 | Ga0501321_089192 | |||
| 3316 | Ga0501323_000717 | |||
| 3317 | Ga0501323_001002 | |||
| 3318 | Ga0501323_001783 | |||
| 3319 | Ga0501323_002460 | |||
| 3320 | Ga0501323_005626 | |||
| 3321 | Ga0501323_011315 | |||
| 3322 | Ga0501323_015120 | |||
| 3323 | Ga0501323_022411 | |||
| 3324 | Ga0501323_027020 | |||
| 3325 | Ga0501323_060436 | |||
| 3326 | Ga0501324_002531 | |||
| 3327 | Ga0501324_003092 | |||
| 3328 | Ga0501324_022717 | |||
| 3329 | Ga0501324_026087 | |||
| 3330 | Ga0501324_047264 | |||
| 3331 | Ga0501325_011584 | |||
| 3332 | Ga0501325_019734 | |||
| 3333 | Ga0501325_034807 | |||
| 3334 | Ga0501325_043087 | |||
| 3335 | Ga0501326_09759 | |||
| 3336 | Ga0501326_11467 | |||
| 3337 | Ga0501327_09345 | |||
| 3338 | Ga0501328_03265 | |||
| 3339 | Ga0501328_03694 | |||
| 3340 | Ga0501328_07964 | |||
| 3341 | Ga0501329_00132 | |||
| 3342 | Ga0501329_03571 | |||
| 3343 | Ga0501329_04205 | |||
| 3344 | Ga0501330_004977 | |||
| 3345 | Ga0501330_008315 | |||
| 3346 | Ga0501331_01194 | |||
| 3347 | Ga0501331_02908 | |||
| 3348 | Ga0501331_05306 | |||
| 3349 | Ga0501332_05328 | |||
| 3350 | Ga0501334_00025 | |||
| 3351 | Ga0501334_00211 | |||
| 3352 | Ga0501334_02889 | |||
| 3353 | Ga0501334_05362 | |||
| 3354 | Ga0501335_000748 | |||
| 3355 | Ga0501335_000798 | |||
| 3356 | Ga0501335_005233 | |||
| 3357 | Ga0501335_010801 | |||
| 3358 | Ga0501335_011976 | |||
| 3359 | Ga0501335_014245 | |||
| 3360 | Ga0501336_000444 | |||
| 3361 | Ga0501336_001556 | |||
| 3362 | Ga0501337_004420 | |||
| 3363 | Ga0501337_015152 | |||
| 3364 | Ga0501340_002106 | |||
| 3365 | Ga0501340_003356 | |||
| 3366 | Ga0501032_0000353 | |||
| 3367 | Ga0501034_0000001 | |||
| 3368 | Ga0501034_0112090 | |||
| 3369 | Ga0501036_0141855 | |||
| 3370 | Ga0501039_0000169 | |||
| 3371 | Ga0501047_0150432 | |||
| 3372 | Ga0501223_002278 | |||
| 3373 | Ga0501238_015660 | |||
| 3374 | Ga0501238_030760 | |||
| 3375 | Ga0501240_000074 | |||
| 3376 | Ga0501243_052474 | |||
| 3377 | Ga0501243_057375 | |||
| 3378 | Ga0501243_095078 | |||
| 3379 | Ga0501249_000797 | |||
| 3380 | Ga0501249_005929 | |||
| 3381 | Ga0501249_086232 | |||
| 3382 | Ga0501251_001354 | |||
| 3383 | Ga0501252_057595 | |||
| 3384 | Ga0501257_204875 | |||
| 3385 | Ga0501260_004986 | |||
| 3386 | Ga0501219_025063 | |||
| 3387 | Ga0501225_0026515 | |||
| 3388 | Ga0501241_000017 | |||
| 3389 | Ga0501241_001570 | |||
| 3390 | Ga0501241_007664 | |||
| 3391 | Ga0501266_000009 | |||
| 3392 | Ga0501269_001154 | |||
| 3393 | Ga0501280_034090 | |||
| 3394 | Ga0501035_0114203 | |||
| 3395 | Ga0501035_0668587 | |||
| 3396 | Ga0501035_1405445 | |||
| 3397 | nmdc:mga0k408_173043_c1 | |||
| 3398 | nmdc:mga0k408_234301_c1 | |||
| 3399 | nmdc:mga0k408_350_c1 | |||
| 3400 | nmdc:mga0k408_38765_c1 | |||
| 3401 | nmdc:mga0k408_4120_c1 | |||
| 3402 | nmdc:mga07m45_164171_c1 | |||
| 3403 | nmdc:mga07m45_248103_c1 | |||
| 3404 | nmdc:mga07m45_361836_c1 | |||
| 3405 | nmdc:mga07m45_446713_c1 | |||
| 3406 | nmdc:mga07m45_97058_c1 | |||
| 3407 | nmdc:mga05p37_19612_c1 | |||
| 3408 | nmdc:mga05p37_3446_c1 | |||
| 3409 | nmdc:mga05p37_377892_c1 | |||
| 3410 | nmdc:mga05p37_38531_c1 | |||
| 3411 | nmdc:mga05p37_82274_c1 | |||
| 3412 | nmdc:mga09592_102110_c1 | |||
| 3413 | nmdc:mga09592_15413_c1 | |||
| 3414 | nmdc:mga09592_5366_c1 | |||
| 3415 | nmdc:mga09592_986624_c1 | |||
| 3416 | nmdc:mga0qj67_24513_c1 | |||
| 3417 | nmdc:mga0qj67_56075_c1 | |||
| 3418 | nmdc:mga0qj67_591893_c1 | |||
| 3419 | nmdc:mga0qj67_88044_c1 | |||
| 3420 | nmdc:mga06r32_235827_c1 | |||
| 3421 | nmdc:mga06r32_29589_c1 | |||
| 3422 | nmdc:mga06r32_600_c1 | |||
| 3423 | nmdc:mga06r32_914153_c1 | |||
| 3424 | nmdc:mga08y16_145790_c1 | |||
| 3425 | nmdc:mga08y16_300768_c1 | |||
| 3426 | nmdc:mga08y16_330478_c1 | |||
| 3427 | nmdc:mga08y16_793049_c1 | |||
| 3428 | nmdc:mga0n895_10875_c1 | |||
| 3429 | nmdc:mga0n895_14066_c1 | |||
| 3430 | nmdc:mga0rr50_59956_c1 | |||
| 3431 | nmdc:mga0a205_128227_c1 | |||
| 3432 | nmdc:mga0a205_36134_c1 | |||
| 3433 | nmdc:mga0a205_58582_c1 | |||
| 3434 | nmdc:mga0sz30_159519_c1 | |||
| 3435 | nmdc:mga0sz30_264560_c1 | |||
| 3436 | Ga0500635_0001097 | |||
| 3437 | Ga0500635_0080487 | |||
| 3438 | Ga0500578_0018628 | |||
| 3439 | Ga0500578_0293623 | |||
| 3440 | Ga0500644_0096053 | |||
| 3441 | Ga0500644_0501588 | |||
| 3442 | Ga0500646_0003988 | |||
| 3443 | Ga0500646_0022173 | |||
| 3444 | Ga0500651_0000124 | |||
| 3445 | Ga0500641_0000029 | |||
| 3446 | Ga0500641_0003322 | |||
| 3447 | Ga0500641_0049673 | |||
| 3448 | Ga0500650_0273731 | |||
| 3449 | Ga0500594_0020923 | |||
| 3450 | Ga0500608_006222 | |||
| 3451 | Ga0500608_018016 | |||
| 3452 | Ga0500614_008477 | |||
| 3453 | Ga0500618_000080 | |||
| 3454 | Ga0500618_028226 | |||
| 3455 | Ga0500652_086699 | |||
| 3456 | Ga0500658_0000006 | |||
| 3457 | Ga0500559_0018627 | |||
| 3458 | Ga0500561_0045175 | |||
| 3459 | Ga0500573_0033087 | |||
| 3460 | Ga0500573_0257649 | |||
| 3461 | Ga0500616_0130805 | |||
| 3462 | Ga0500622_0001219 | |||
| 3463 | Ga0500622_0084917 | |||
| 3464 | Ga0500622_0290167 | |||
| 3465 | Ga0500624_000925 | |||
| 3466 | Ga0500584_010431 | |||
| 3467 | Ga0587093_006264 | |||
| 3468 | Ga0587093_014210 | |||
| 3469 | Ga0587093_015105 | |||
| 3470 | Ga0587066_037503 | |||
| 3471 | Ga0587066_047208 | |||
| 3472 | Ga0587066_167584 | |||
| 3473 | Ga0587070_064167 | |||
| 3474 | Ga0587073_0035653 | |||
| 3475 | Ga0587073_0254163 | |||
| 3476 | Ga0587077_000327 | |||
| 3477 | Ga0587077_005446 | |||
| 3478 | Ga0587077_029444 | |||
| 3479 | Ga0587077_067958 | |||
| 3480 | Ga0587077_147256 | |||
| 3481 | Ga0587080_025713 | |||
| 3482 | Ga0587080_034069 | |||
| 3483 | Ga0587080_069869 | |||
| 3484 | Ga0587080_117459 | |||
| 3485 | Ga0587083_0012424 | |||
| 3486 | Ga0587083_0013735 | |||
| 3487 | Ga0587083_0036396 | |||
| 3488 | Ga0587085_004592 | |||
| 3489 | Ga0587086_027045 | |||
| 3490 | Ga0587089_082686 | |||
| 3491 | Ga0587090_000102 | |||
| 3492 | Ga0587090_018824 | |||
| 3493 | Ga0587091_009311 | |||
| 3494 | Ga0587091_025972 | |||
| 3495 | Ga0587091_085083 | |||
| 3496 | Ga0587092_041284 | |||
| 3497 | Ga0587092_073173 | |||
| 3498 | Ga0587094_050899 | |||
| 3499 | Ga0587106_004580 | |||
| 3500 | Ga0587125_001886 | |||
| 3501 | Ga0587101_032508 | |||
| 3502 | Ga0587101_037944 | |||
| 3503 | Ga0587101_059563 | |||
| 3504 | Ga0587109_024961 | |||
| 3505 | Ga0587117_000256 | |||
| 3506 | Ga0587117_107560 | |||
| 3507 | Ga0587128_003957 | |||
| 3508 | Ga0587062_001988 | |||
| 3509 | Ga0587067_061713 | |||
| 3510 | Ga0587068_017603 | |||
| 3511 | Ga0587068_029487 | |||
| 3512 | Ga0587068_066075 | |||
| 3513 | Ga0587069_041391 | |||
| 3514 | Ga0587076_000772 | |||
| 3515 | Ga0587076_001127 | |||
| 3516 | Ga0587076_020634 | |||
| 3517 | Ga0587076_027105 | |||
| 3518 | Ga0587076_105265 | |||
| 3519 | Ga0587076_161974 | |||
| 3520 | Ga0587100_006833 | |||
| 3521 | Ga0587105_012794 | |||
| 3522 | Ga0587107_012382 | |||
| 3523 | Ga0587107_013944 | |||
| 3524 | Ga0587108_001109 | |||
| 3525 | Ga0587124_001026 | |||
| 3526 | Ga0587060_017818 | |||
| 3527 | Ga0587061_00281 | |||
| 3528 | Ga0587081_01723 | |||
| 3529 | 2511234222 | |||
| 3530 | 2513234198 | |||
| 3531 | 2520881101 | |||
| 3532 | 2522552600 | |||
| 3533 | 2524005425 | |||
| 3534 | 2585142333 | |||
| 3535 | 2585159825 | |||
| 3536 | 2585164021 | |||
| 3537 | 2586210453 | |||
| 3538 | 2587680916 | |||
| 3539 | 2587747638 | |||
| 3540 | 2587751529 | |||
| 3541 | 2587867303 | |||
| 3542 | 2587945030 | |||
| 3543 | 2588210629 | |||
| 3544 | 2588214126 | |||
| 3545 | 2588221607 | |||
| 3546 | 2588223430 | |||
| 3547 | 2588232642 | |||
| 3548 | 2588443666 | |||
| 3549 | 2590601901 | |||
| 3550 | 2590613363 | |||
| 3551 | 2599479163 | |||
| 3552 | 2644011031 | |||
| 3553 | 2644373886 | |||
| 3554 | 2644643521 | |||
| 3555 | 2644683942 | |||
| 3556 | 2722726630 | |||
| 3557 | 2729200419 | |||
| 3558 | 2738699648 | |||
| 3559 | 2738736999 | |||
| 3560 | 2738755464 | |||
| 3561 | 2738763474 | |||
| 3562 | 2738769539 | |||
| 3563 | 2738851932 | |||
| 3564 | 2739218581 | |||
| 3565 | 2739253397 | |||
| 3566 | 2739303599 | |||
| 3567 | 2739590822 | |||
| 3568 | 2739617017 | |||
| 3569 | 2739647323 | |||
| 3570 | 2739999427 | |||
| 3571 | 2740004244 | |||
| 3572 | 2740059400 | |||
| 3573 | 2753673463 | |||
| 3574 | 2765574568 | |||
| 3575 | 2772604697 | |||
| 3576 | 2775671675 | |||
| 3577 | 2776615088 | |||
| 3578 | 2802652169 | |||
| 3579 | 2816874785 | |||
| 3580 | 2817415027 | |||
| 3581 | 2819546477 | |||
| 3582 | 2819573418 | |||
| 3583 | 2821136838 | |||
| 3584 | 2833642870 | |||
| 3585 | 2842085314 | |||
| 3586 | 2842725173 | |||
| 3587 | 2842912448 | |||
| 3588 | 2849286038 | |||
| 3589 | 2852629338 | |||
| 3590 | 2857617507 | |||
| 3591 | 2857621262 | |||
| 3592 | 2857629754 | |||
| 3593 | 2871722311 | |||
| 3594 | 2881250019 | |||
| 3595 | 2881359952 | |||
| 3596 | 2889294872 | |||
| 3597 | 2890738049 | |||
| 3598 | 2896321221 | |||
| 3599 | 2896345744 | |||
| 3600 | 2898713532 | |||
| 3601 | 2902052509 | |||
| 3602 | 2903896138 | |||
| 3603 | 2904421811 | |||
| 3604 | 2904446637 | |||
| 3605 | 2904468417 | |||
| 3606 | 2904559878 | |||
| 3607 | 2904785860 | |||
| 3608 | 2906001493 | |||
| 3609 | 2919099496 | |||
| 3610 | 2919182478 | |||
| 3611 | 2919190323 | |||
| 3612 | 2919195749 | |||
| 3613 | 2919402438 | |||
| 3614 | 2919438212 | |||
| 3615 | 2919510864 | |||
| 3616 | 2919687966 | |||
| 3617 | 2928082522 | |||
| 3618 | 2928148890 | |||
| 3619 | 2929152201 | |||
| 3620 | 2932086312 | |||
| 3621 | 2939668604 | |||
| 3622 | 2945925749 | |||
| 3623 | 2946002100 | |||
| 3624 | 2946023016 | |||
| 3625 | 2954018998 | |||
| 3626 | 2958460101 | |||
| 3627 | 2958514759 | |||
| 3628 | 2965323019 | |||
| 3629 | 2977233776 | |||
| 3630 | 2977244650 | |||
| 3631 | 2977268898 | |||
| 3632 | 2984573517 | |||
| 3633 | 2984606956 | |||
| 3634 | 2993376059 | |||
| 3635 | 2993482904 | |||
| 3636 | 3003235167 | |||
| 3637 | 8036739390 | |||
| 3638 | 8054309581 | |||
| 3639 | 8055419150 | |||
| 3640 | 8055590023 | |||
| 3641 | 8055592429 | |||
| 3642 | 8056442548 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1hc8-assembly2.cif.gz_B | crystal structure of a conserved ribosomal protein-rna complex | 0.9928 | 71 | 140 |
| 1mms-assembly2.cif.gz_B | crystal structure of the ribosomal protein l11-rna complex | 0.9861 | 71 | 140 |
| 1y39-assembly2.cif.gz_B | co-evolution of protein and rna structures within a highly conserved ribosomal domain | 0.9859 | 71 | 141 |
| 1hc8-assembly2.cif.gz_B | crystal structure of a conserved ribosomal protein-rna complex | 0.979 | 71 | 140 |
| 5gae-assembly1.cif.gz_J | rnc in complex with a translocating secyeg | 0.975 | 71 | 140 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I1J9L7_135_215_1.10.10.250 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Ribosomal protein L11/L12, C-terminal domain | 0.9954 | 72 | 139 | 1.10.10.250 |
| af_A0A0R4J4M9_4_71_3.30.1550.10 | Alpha Beta;2-Layer Sandwich;Ribosomal protein L11, N-terminal domain;Ribosomal protein L11/L12, N-terminal domain | 0.9893 | 3 | 68 | 3.30.1550.10 |
| 1hc8A00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Ribosomal protein L11/L12, C-terminal domain | 0.9662 | 67 | 140 | 1.10.10.250 |
| 3egvB00 | Alpha Beta;2-Layer Sandwich;Ribosomal protein L11, N-terminal domain;Ribosomal protein L11/L12, N-terminal domain | 0.9649 | 3 | 77 | 3.30.1550.10 |
| 1vq4I00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Ribosomal protein L11/L12, C-terminal domain | 0.9643 | 73 | 140 | 1.10.10.250 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A645A187-F1-model_v4 | 50S ribosomal protein L11 | 0.9953 | 78 | 141 |
GO:0003735
GO:0006412 GO:0022625 GO:0070180 |
| AF-A0A2D7JF69-F1-model_v4 | 50S ribosomal protein L11 | 0.9936 | 1 | 71 |
GO:0003735
GO:0006412 GO:0022625 GO:0070180 |
| AF-A0A357HFS0-F1-model_v4 | 50S ribosomal protein L11 | 0.9936 | 66 | 140 |
GO:0003735
GO:0006412 GO:0022625 GO:0070180 |
| AF-A0A7J4E0X6-F1-model_v4 | deleted | 0.9935 | 1 | 69 |
|
| AF-A0A4Q0I9F9-F1-model_v4 | 50S ribosomal protein L11 | 0.9935 | 67 | 140 |
GO:0003735
GO:0006412 GO:0022625 GO:0070180 |