F495796

General Info

Members Datasets Scaffolds Average Seq Length
1821 691 3642 145

Family's Representative Sequence

Representative Sequence 3300005456|Ga0070678_101940904|Ga0070678_1019409041
Length 161
Sequence MLPNSLIIQLKKKKMAKKVFKMVKLQVKGGAANPSPPVGPALGSAGVNIMEFCKQFNGRTQDKPGQVLPVVITVYEDKSFEFVIKTPPAAIQLMDAAKIKGGSGEPNRNKVGSVSWDQVKKIAEDKMVDLNCFTLDSALSMVAGTARSMGLRVTGTKPANA

Samples

Sample ID Description Type Environment
1 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
11 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
12 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
13 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
14 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
15 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
16 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
17 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
18 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
19 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
20 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
21 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
22 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
23 3300003405 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM Metagenome Rhizosphere
24 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
25 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
26 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
27 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
28 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
29 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
30 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
31 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
32 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
33 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
34 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
35 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
36 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
37 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
38 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
39 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
40 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
41 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
42 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
43 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
44 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
45 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
46 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
47 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
48 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
49 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
50 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
51 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
52 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
53 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
54 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
55 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
56 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
57 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
58 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
59 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
60 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
61 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
62 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
63 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
64 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
65 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
66 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
67 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
68 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
69 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
70 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
71 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
72 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
73 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
74 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
75 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
76 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
77 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
78 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
79 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
80 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
81 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
82 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
83 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
84 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
85 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
86 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
87 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
88 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
89 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
90 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
91 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
92 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
93 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
94 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
95 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
96 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
97 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
98 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
99 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
100 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
101 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
102 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
103 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
104 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
105 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
106 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
107 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
108 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
109 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
110 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
111 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
112 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
113 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
114 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
115 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
116 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
117 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
118 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
119 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
120 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
121 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
122 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
123 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
124 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
125 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
126 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
127 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
128 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
129 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
130 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
131 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
132 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
133 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
134 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
135 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
136 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
137 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
138 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
139 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
140 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
141 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
142 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
143 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
144 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
145 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
146 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
147 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
148 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
149 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
150 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
151 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
152 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
153 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
154 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
155 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
156 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
157 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
158 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
159 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
160 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
161 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
162 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
163 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
164 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
165 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
166 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
167 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
169 3300023309 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctcc.R1 Metatranscriptome Rhizosphere
170 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
171 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
173 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
174 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
176 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
177 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
179 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
180 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
183 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
184 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
186 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
187 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
188 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
189 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
254 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
255 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
256 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
257 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
258 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
259 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
260 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
264 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
265 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
266 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
267 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
268 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
269 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
270 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
271 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
272 3300031011 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
273 3300031043 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
274 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
275 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
276 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
277 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
278 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
279 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
280 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
281 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
282 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
283 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
284 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
285 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
286 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
287 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
288 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
289 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
290 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
291 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
292 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
293 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
294 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
295 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
296 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
297 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
298 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
299 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
300 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
301 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
302 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
303 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
304 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
305 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
306 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
307 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
308 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
309 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
310 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
311 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
312 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
313 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
314 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
315 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
316 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
317 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
318 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
319 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
320 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
321 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
322 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
323 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
324 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
325 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
326 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
327 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
328 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
329 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
330 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
331 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
332 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
333 3300041442 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaT Metatranscriptome Rhizoplane
334 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
335 3300041444 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT Metatranscriptome Rhizoplane
336 3300041445 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaT Metatranscriptome Rhizoplane
337 3300041446 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT Metatranscriptome Rhizoplane
338 3300041450 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaT Metatranscriptome Rhizoplane
339 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
340 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
341 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
342 3300041454 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaT Metatranscriptome Rhizoplane
343 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
344 3300041457 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaT Metatranscriptome Rhizoplane
345 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
346 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
347 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
348 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
349 3300041464 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaT Metatranscriptome Rhizoplane
350 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
351 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
352 3300041493 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaT Metatranscriptome Unclassified
353 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
354 3300041497 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT Metatranscriptome Unclassified
355 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
356 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
357 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
358 3300041506 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT Metatranscriptome Unclassified
359 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
360 3300041508 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaT Metatranscriptome Unclassified
361 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
362 3300041510 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT Metatranscriptome Unclassified
363 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
364 3300041907 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT_extra_run Metatranscriptome Unclassified
365 3300041908 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaT_extra_run Metatranscriptome Unclassified
366 3300041916 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run Metatranscriptome Unclassified
367 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
368 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
369 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
370 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
371 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
372 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
373 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
374 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
375 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
376 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
377 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
378 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
379 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
380 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
381 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
382 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
383 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
384 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
385 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
386 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
387 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
388 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
389 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
390 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
391 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
392 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
393 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
394 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
395 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
396 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
397 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
398 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
399 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
400 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
401 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
402 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
403 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
404 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
405 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
406 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
407 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
408 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
409 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
410 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
411 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
412 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
413 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
414 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
415 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
416 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
417 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
418 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
419 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
420 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
421 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
422 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
423 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
424 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
425 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
426 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
427 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
428 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
429 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
430 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
431 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
432 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
433 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
434 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
435 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
436 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
437 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
438 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
439 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
440 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
441 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
442 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
443 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
444 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
445 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
446 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
447 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
448 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
449 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
450 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
451 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
452 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
453 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
454 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
455 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
456 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
457 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
458 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
459 3300049133 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
460 3300049134 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
461 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
462 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
463 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
464 3300049163 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
465 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
466 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
467 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
468 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
469 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
470 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
471 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
472 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
473 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
474 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
475 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
476 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
477 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
478 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
479 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
480 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
481 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
482 3300049543 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
483 3300049544 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
484 3300049545 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
485 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
486 3300049547 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
487 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
488 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
489 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
490 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
491 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
492 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
493 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
494 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
495 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
496 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
497 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
498 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
499 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
500 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
501 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
502 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
503 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
504 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
505 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
506 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
507 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
508 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
509 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
510 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
511 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
512 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
513 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
514 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
515 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
516 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
517 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
518 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
519 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
520 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
521 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
522 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
523 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
524 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
525 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
526 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
527 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
528 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
529 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
530 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
531 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
532 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
533 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
534 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
535 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
536 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
537 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
538 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
539 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
540 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
541 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
542 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
543 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
544 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
545 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
546 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
547 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
548 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
549 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
550 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
551 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
552 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
553 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
554 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
555 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
556 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
557 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
558 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
559 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
560 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
561 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
562 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
563 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
564 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
565 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
566 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
567 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
568 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
569 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
570 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
571 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
572 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
573 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
574 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
575 3300060243 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 1R_CW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
576 3300060244 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 2R_CW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
577 3300060246 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 22R_SD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
578 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
579 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
580 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
581 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
582 2523533629 Kaistella palustris DSM 21579 Isolate Rhizosphere
583 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
584 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
585 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
586 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
587 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
588 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
589 2585428061 Chryseobacterium sp. CF356 Isolate Rhizosphere
590 2585428095 Chryseobacterium sp. YR005 Isolate Rhizosphere
591 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
592 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
593 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
594 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
595 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
596 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
597 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
598 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
599 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
600 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
601 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
602 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
603 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
604 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
605 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
606 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
607 2738541273 Elizabethkingia sp. YR214 Isolate Unclassified
608 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
609 2738541283 Pedobacter sp. OK701 Isolate Unclassified
610 2738541284 Pedobacter sp. YR016 Isolate Unclassified
611 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
612 2738541302 Pedobacter sp. CF074 Isolate Unclassified
613 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
614 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
615 2738543023 Pedobacter sp. OK628 Isolate Unclassified
616 2739367651 Pedobacter sp. OK291 Isolate Unclassified
617 2739367656 Pedobacter sp. CF523 Isolate Unclassified
618 2739367663 Pedobacter sp. YR510 Isolate Unclassified
619 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
620 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
621 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
622 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
623 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
624 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
625 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
626 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
627 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
628 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
629 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
630 2818991437 Pedobacter terrae 518 Isolate Unclassified
631 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
632 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
633 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
634 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
635 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
636 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
637 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
638 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
639 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
640 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
641 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
642 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
643 2881247448 Flavobacterium beibuense RSKm HC5 Isolate Rhizosphere
644 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
645 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
646 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
647 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
648 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
649 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
650 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
651 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
652 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
653 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
654 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
655 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
656 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
657 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
658 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
659 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
660 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
661 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
662 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
663 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
664 2919509842 Flavobacterium arsenatis 3773 Isolate Unclassified
665 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
666 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
667 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
668 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
669 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
670 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
671 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
672 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
673 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
674 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
675 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
676 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
677 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
678 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
679 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
680 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
681 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
682 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
683 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
684 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere
685 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
686 8036736890 Flavobacterium dauae TCH3-2 Isolate Rhizosphere
687 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
688 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
689 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere
690 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere
691 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 71.44
Metatranscriptomes 22.3
Isolates 6.26

Biome Distribution

Category Percentage (%)
Aerial Root 0.11
Bulb 0
Endosphere 4.45
Nodule 0.16
Rhizoplane 3.57
Rhizosphere 82.92
Stem 0
Stem Tuber 0
Unclassified 0.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070678_101940904 3300005456 Bacteria 556
2 MRS2a_Contig_9405 2124908027 Bacteria 1869
3 SwRhRL2b_contig_2240772 2162886007 Bacteria 1434
4 SwRhRL2b_contig_2684773 2162886007 Bacteria 2886
5 SwRhRL2b_contig_534079 2162886007 Bacteria 3423
6 SwRhRL2b_contig_908903 2162886007 Bacteria 1008
7 JGI24741J21665_1000115 3300001915 Bacteria 21692
8 JGI24741J21665_1061020 3300001915 Bacteria 556
9 JGI24740J21852_10015326 3300001979 Bacteria 2803
10 JGI24740J21852_10053646 3300001979 Bacteria 1142
11 JGI24739J22299_10047850 3300001989 Bacteria 1393
12 JGI24739J22299_10166146 3300001989 Bacteria 650
13 JGI24737J22298_10000614 3300001990 Bacteria 12575
14 JGI24737J22298_10001905 3300001990 Bacteria 7459
15 JGI24737J22298_10003582 3300001990 Bacteria 5476
16 JGI24737J22298_10148067 3300001990 Bacteria 693
17 JGI24743J22301_10020627 3300001991 Bacteria 1255
18 JGI24735J21928_10000009 3300002067 Bacteria 247425
19 JGI24735J21928_10021163 3300002067 Bacteria 1988
20 JGI24735J21928_10042167 3300002067 Bacteria 1329
21 JGI24744J21845_10008899 3300002077 Bacteria 2063
22 JGI24034J26672_10101796 3300002239 Bacteria 542
23 JGI25162J39368_1000120 3300002737 Bacteria 86031
24 JGI25162J39368_1001524 3300002737 Bacteria 11972
25 JGI25157J39369_1002820 3300002741 Bacteria 3946
26 JGI25157J39369_1004397 3300002741 Bacteria 2564
27 JGI25157J39369_1031034 3300002741 Bacteria 609
28 JGI25164J39214_1000824 3300002772 Bacteria 10827
29 JGI25150J39212_1000001 3300002774 Bacteria 1318726
30 Ga0006759J45824_1125488 3300003163 Unclassified 727
31 JGI25151J46595_10000001 3300003187 Bacteria 887211
32 JGI25165J46597_1000923 3300003214 Bacteria 20349
33 JGI25153J46596_10000001 3300003215 Bacteria 748985
34 rootH2_10012942 3300003320 Bacteria 1545
35 rootH2_10298437 3300003320 Bacteria 1012
36 rootL2_10051773 3300003322 Bacteria 3799
37 rootL2_10150346 3300003322 Bacteria 2920
38 rootL2_10285627 3300003322 Bacteria 3159
39 rootH1_10107846 3300003323 Bacteria 1569
40 rootH1_10125727 3300003323 Bacteria 1872
41 JGI26132J50249_101713 3300003405 Bacteria 750
42 Ga0007409J51694_1078244 3300003575 Bacteria 1684
43 Ga0006562J51391_1002124 3300003578 Bacteria 4457
44 Ga0055536_1013448 3300003781 Bacteria 2951
45 Ga0055534_1012830 3300003784 Bacteria 1639
46 Ga0055531_10002043 3300003794 Bacteria 13930
47 Ga0058859_11302483 3300004798 Bacteria 673
48 Ga0058863_11953297 3300004799 Bacteria 801
49 Ga0058863_11963325 3300004799 Bacteria 880
50 Ga0058861_10088285 3300004800 Bacteria 3413
51 Ga0058861_12069072 3300004800 Bacteria 746
52 Ga0058860_10018004 3300004801 Bacteria 5911
53 Ga0058860_11803557 3300004801 Bacteria 768
54 Ga0058860_11880010 3300004801 Bacteria 1056
55 Ga0058862_10247728 3300004803 Bacteria 8738
56 Ga0058862_12706272 3300004803 Bacteria 798
57 Ga0058862_12779971 3300004803 Bacteria 1326
58 Ga0065165_1002853 3300005262 Bacteria 13414
59 Ga0065717_1002063 3300005276 Bacteria 3205
60 Ga0065714_10005413 3300005288 Bacteria 4818
61 Ga0065714_10007805 3300005288 Bacteria 3491
62 Ga0065714_10011283 3300005288 Bacteria 2115
63 Ga0065714_10020754 3300005288 Bacteria 1772
64 Ga0065714_10083664 3300005288 Bacteria 2221
65 Ga0065714_10089556 3300005288 Bacteria 1975
66 Ga0065714_10089647 3300005288 Bacteria 1971
67 Ga0065714_10118833 3300005288 Bacteria 1374
68 Ga0065714_10216369 3300005288 Bacteria 852
69 Ga0065714_10217047 3300005288 Bacteria 826
70 Ga0065714_10288794 3300005288 Bacteria 711
71 Ga0065714_10382470 3300005288 Bacteria 605
72 Ga0065704_10000757 3300005289 Bacteria 16510
73 Ga0065704_10013526 3300005289 Bacteria 1496
74 Ga0065704_10072003 3300005289 Bacteria 9408
75 Ga0065704_10085384 3300005289 Bacteria 3228
76 Ga0065704_10093408 3300005289 Bacteria 2596
77 Ga0065704_10231864 3300005289 Bacteria 1040
78 Ga0065712_10224894 3300005290 Bacteria 1028
79 Ga0065712_10768292 3300005290 Bacteria 523
80 Ga0065715_10015955 3300005293 Bacteria 1697
81 Ga0065715_10109002 3300005293 Bacteria 2690
82 Ga0065715_10118594 3300005293 Bacteria 2312
83 Ga0065715_10142356 3300005293 Bacteria 1834
84 Ga0065715_10938245 3300005293 Bacteria 563
85 Ga0065707_10108988 3300005295 Bacteria 2486
86 Ga0070658_10000014 3300005327 Bacteria 244978
87 Ga0070658_10474022 3300005327 Bacteria 1080
88 Ga0070676_10000852 3300005328 Bacteria 15089
89 Ga0070676_10004106 3300005328 Bacteria 7650
90 Ga0070683_100003409 3300005329 Bacteria 12889
91 Ga0070683_100091959 3300005329 Bacteria 2849
92 Ga0070670_100128832 3300005331 Bacteria 2184
93 Ga0070670_100472812 3300005331 Bacteria 1112
94 Ga0068869_100006678 3300005334 Bacteria 7327
95 Ga0070666_10176639 3300005335 Bacteria 1497
96 Ga0070680_100002006 3300005336 Bacteria 14996
97 Ga0070680_100062159 3300005336 Bacteria 3057
98 Ga0070680_100302481 3300005336 Bacteria 1357
99 Ga0070680_100681878 3300005336 Bacteria 884
100 Ga0070682_100000087 3300005337 Bacteria 83686
101 Ga0070682_100171019 3300005337 Bacteria 1510
102 Ga0070682_100173333 3300005337 Bacteria 1501
103 Ga0070682_100322988 3300005337 Bacteria 1141
104 Ga0070682_100676261 3300005337 Bacteria 825
105 Ga0068868_100866915 3300005338 Bacteria 819
106 Ga0070660_100028188 3300005339 Bacteria 4199
107 Ga0070660_100082225 3300005339 Bacteria 2529
108 Ga0070660_100100250 3300005339 Bacteria 2294
109 Ga0070660_100197618 3300005339 Bacteria 1631
110 Ga0070689_100055251 3300005340 Bacteria 3076
111 Ga0070689_100074007 3300005340 Bacteria 2665
112 Ga0070689_100451148 3300005340 Bacteria 1094
113 Ga0070689_100581681 3300005340 Bacteria 968
114 Ga0070687_100309619 3300005343 Bacteria 1005
115 Ga0070661_100060578 3300005344 Bacteria 2777
116 Ga0070661_100073348 3300005344 Bacteria 2520
117 Ga0070661_100590876 3300005344 Bacteria 897
118 Ga0070692_10028172 3300005345 Bacteria 2791
119 Ga0070692_10145738 3300005345 Bacteria 1344
120 Ga0070668_100017094 3300005347 Bacteria 5428
121 Ga0070668_100204111 3300005347 Bacteria 1623
122 Ga0070669_100005808 3300005353 Bacteria 8898
123 Ga0070669_100051832 3300005353 Bacteria 3000
124 Ga0070669_100093042 3300005353 Bacteria 2263
125 Ga0070675_100029347 3300005354 Bacteria 4435
126 Ga0070675_100053172 3300005354 Bacteria 3330
127 Ga0070675_100171639 3300005354 Bacteria 1870
128 Ga0070675_100967478 3300005354 Bacteria 781
129 Ga0070671_100003462 3300005355 Bacteria 12327
130 Ga0070671_100005487 3300005355 Bacteria 10117
131 Ga0070674_100086265 3300005356 Bacteria 2254
132 Ga0070673_100015276 3300005364 Bacteria 5387
133 Ga0070673_100049506 3300005364 Bacteria 3281
134 Ga0070673_100068302 3300005364 Bacteria 2845
135 Ga0070673_100070036 3300005364 Bacteria 2813
136 Ga0070688_100019652 3300005365 Bacteria 3916
137 Ga0070659_100000402 3300005366 Bacteria 32771
138 Ga0070659_100016784 3300005366 Bacteria 5501
139 Ga0070659_100023709 3300005366 Bacteria 4699
140 Ga0070659_100061430 3300005366 Bacteria 2969
141 Ga0070659_100898031 3300005366 Bacteria 774
142 Ga0070659_101468645 3300005366 Bacteria 607
143 Ga0070667_100024096 3300005367 Bacteria 5054
144 Ga0070667_100302485 3300005367 Bacteria 1440
145 Ga0070714_100173670 3300005435 Bacteria 1957
146 Ga0070714_102037064 3300005435 Bacteria 560
147 Ga0070713_100273715 3300005436 Bacteria 1547
148 Ga0070701_10031401 3300005438 Bacteria 2635
149 Ga0070711_100021768 3300005439 Bacteria 4149
150 Ga0070705_100095390 3300005440 Bacteria 1865
151 Ga0070700_100009943 3300005441 Bacteria 5235
152 Ga0070694_100103391 3300005444 Bacteria 2018
153 Ga0070694_100238117 3300005444 Bacteria 1372
154 Ga0070694_100957891 3300005444 Bacteria 709
155 Ga0070663_100035412 3300005455 Bacteria 3464
156 Ga0070663_100311088 3300005455 Bacteria 1264
157 Ga0070663_100637672 3300005455 Bacteria 900
158 Ga0070678_100001822 3300005456 Bacteria 11482
159 Ga0070662_100014975 3300005457 Bacteria 5187
160 Ga0070662_100059100 3300005457 Bacteria 2792
161 Ga0070662_100323843 3300005457 Bacteria 1257
162 Ga0070662_100328983 3300005457 Bacteria 1248
163 Ga0070662_100472900 3300005457 Bacteria 1043
164 Ga0070681_10003472 3300005458 Bacteria 14770
165 Ga0070681_10008372 3300005458 Bacteria 10130
166 Ga0070681_11508704 3300005458 Bacteria 597
167 Ga0068867_100001197 3300005459 Bacteria 17799
168 Ga0068867_100225030 3300005459 Bacteria 1514
169 Ga0070685_10023543 3300005466 Bacteria 3372
170 Ga0070685_10054316 3300005466 Bacteria 2323
171 Ga0070685_10102990 3300005466 Bacteria 1746
172 Ga0070706_100032249 3300005467 Bacteria 4832
173 Ga0070706_101901071 3300005467 Bacteria 540
174 Ga0070698_100011319 3300005471 Bacteria 9473
175 Ga0070699_100060134 3300005518 Bacteria 3292
176 Ga0070679_100014038 3300005530 Bacteria 7681
177 Ga0070679_100017069 3300005530 Bacteria 7017
178 Ga0070679_100087502 3300005530 Bacteria 3102
179 Ga0070679_100122160 3300005530 Bacteria 2589
180 Ga0070679_100358998 3300005530 Bacteria 1404
181 Ga0070684_100054640 3300005535 Bacteria 3480
182 Ga0070684_100108229 3300005535 Bacteria 2490
183 Ga0070684_100129440 3300005535 Bacteria 2276
184 Ga0070684_100637665 3300005535 Bacteria 991
185 Ga0070697_100412354 3300005536 Bacteria 1173
186 Ga0068853_100080677 3300005539 Bacteria 2847
187 Ga0068853_100090995 3300005539 Bacteria 2682
188 Ga0068853_100334591 3300005539 Bacteria 1406
189 Ga0070672_100026322 3300005543 Bacteria 4326
190 Ga0070672_100292590 3300005543 Bacteria 1379
191 Ga0070693_100050514 3300005547 Bacteria 2377
192 Ga0070693_100268601 3300005547 Bacteria 1138
193 Ga0070693_100675544 3300005547 Bacteria 754
194 Ga0070665_100000032 3300005548 Bacteria 333352
195 Ga0070665_100202373 3300005548 Bacteria 1986
196 Ga0070665_101146757 3300005548 Bacteria 788
197 Ga0068855_100000026 3300005563 Bacteria 175140
198 Ga0068855_100042965 3300005563 Bacteria 5355
199 Ga0068855_100079811 3300005563 Bacteria 3794
200 Ga0068855_100088358 3300005563 Bacteria 3580
201 Ga0068855_100153698 3300005563 Bacteria 2615
202 Ga0068855_100337587 3300005563 Bacteria 1662
203 Ga0068855_100579060 3300005563 Bacteria 1212
204 Ga0068855_100681485 3300005563 Bacteria 1101
205 Ga0068855_101056822 3300005563 Bacteria 851
206 Ga0070664_100071441 3300005564 Bacteria 2974
207 Ga0068857_100140153 3300005577 Bacteria 2185
208 Ga0068857_100669386 3300005577 Bacteria 985
209 Ga0068857_101362068 3300005577 Bacteria 690
210 Ga0068854_100049164 3300005578 Bacteria 3011
211 Ga0068854_101222578 3300005578 Bacteria 674
212 Ga0068854_102016889 3300005578 Bacteria 532
213 Ga0068856_100000014 3300005614 Bacteria 163480
214 Ga0068856_100003360 3300005614 Bacteria 16215
215 Ga0068856_100039856 3300005614 Bacteria 4612
216 Ga0068856_100123168 3300005614 Bacteria 2595
217 Ga0068856_100173722 3300005614 Bacteria 2167
218 Ga0068856_100526112 3300005614 Bacteria 1204
219 Ga0068856_100614725 3300005614 Bacteria 1108
220 Ga0070702_101058628 3300005615 Bacteria 646
221 Ga0068852_100001456 3300005616 Bacteria 15984
222 Ga0068852_100021426 3300005616 Bacteria 5160
223 Ga0068852_100751085 3300005616 Bacteria 988
224 Ga0068859_100079340 3300005617 Bacteria 3322
225 Ga0068859_100107960 3300005617 Bacteria 2844
226 Ga0068859_100180854 3300005617 Bacteria 2191
227 Ga0068859_101109496 3300005617 Bacteria 870
228 Ga0068859_101349300 3300005617 Bacteria 786
229 Ga0068864_100263279 3300005618 Bacteria 1604
230 Ga0068864_100343112 3300005618 Bacteria 1408
231 Ga0068864_100579521 3300005618 Bacteria 1087
232 Ga0068866_10034749 3300005718 Bacteria 2458
233 Ga0068861_100000562 3300005719 Bacteria 22006
234 Ga0068861_100000975 3300005719 Bacteria 17448
235 Ga0068861_101149382 3300005719 Bacteria 748
236 Ga0068861_101227399 3300005719 Bacteria 726
237 Ga0068851_10000357 3300005834 Bacteria 20609
238 Ga0068851_10203485 3300005834 Bacteria 1106
239 Ga0068851_10641888 3300005834 Bacteria 649
240 Ga0068863_100000969 3300005841 Bacteria 28867
241 Ga0068863_100051547 3300005841 Bacteria 3900
242 Ga0068863_100326755 3300005841 Bacteria 1491
243 Ga0068863_100635317 3300005841 Bacteria 1058
244 Ga0068863_100906656 3300005841 Bacteria 882
245 Ga0068863_102736433 3300005841 Bacteria 502
246 Ga0068858_100031724 3300005842 Bacteria 4910
247 Ga0068858_100071033 3300005842 Bacteria 3228
248 Ga0068858_100072941 3300005842 Bacteria 3186
249 Ga0068858_100256656 3300005842 Bacteria 1661
250 Ga0068860_100004188 3300005843 Bacteria 14782
251 Ga0068860_100131686 3300005843 Bacteria 2400
252 Ga0068860_100229215 3300005843 Bacteria 1805
253 Ga0068860_102491524 3300005843 Bacteria 537
254 Ga0068862_100013561 3300005844 Bacteria 6752
255 Ga0068862_101367029 3300005844 Bacteria 711
256 Ga0070717_11705124 3300006028 Bacteria 570
257 Ga0070716_100351276 3300006173 Bacteria 1044
258 Ga0070716_100800406 3300006173 Bacteria 730
259 Ga0070712_100083391 3300006175 Bacteria 2321
260 Ga0070712_100135523 3300006175 Bacteria 1872
261 Ga0075369_10436126 3300006186 Bacteria 620
262 Ga0075366_10000812 3300006195 Bacteria 14982
263 Ga0075366_10140973 3300006195 Bacteria 1457
264 Ga0075366_10566369 3300006195 Bacteria 704
265 Ga0097621_100000057 3300006237 Bacteria 58430
266 Ga0097621_100020011 3300006237 Bacteria 5152
267 Ga0097621_101030470 3300006237 Bacteria 771
268 Ga0075370_10119059 3300006353 Bacteria 1536
269 Ga0075370_10528481 3300006353 Bacteria 713
270 Ga0075370_10530814 3300006353 Bacteria 711
271 Ga0068871_100000094 3300006358 Bacteria 52461
272 Ga0068871_100013592 3300006358 Bacteria 6044
273 Ga0068871_100849862 3300006358 Bacteria 844
274 Ga0075428_100003457 3300006844 Bacteria 17282
275 Ga0075428_100032084 3300006844 Bacteria 5804
276 Ga0075428_100144106 3300006844 Bacteria 2589
277 Ga0075428_100698736 3300006844 Bacteria 1080
278 Ga0075430_100001414 3300006846 Bacteria 19526
279 Ga0075430_100030156 3300006846 Bacteria 4605
280 Ga0075430_100094296 3300006846 Bacteria 2502
281 Ga0075430_100096433 3300006846 Bacteria 2471
282 Ga0075431_100002689 3300006847 Bacteria 17232
283 Ga0075431_100088689 3300006847 Bacteria 3192
284 Ga0075431_100287042 3300006847 Bacteria 1665
285 Ga0075431_100880819 3300006847 Bacteria 865
286 Ga0075431_101086602 3300006847 Bacteria 765
287 Ga0075433_10155235 3300006852 Bacteria 2036
288 Ga0075434_100192776 3300006871 Bacteria 2058
289 Ga0075434_100413611 3300006871 Bacteria 1370
290 Ga0075429_100002173 3300006880 Bacteria 16374
291 Ga0075429_100009872 3300006880 Bacteria 8276
292 Ga0075429_100917206 3300006880 Bacteria 766
293 Ga0075429_101098667 3300006880 Bacteria 694
294 Ga0075429_101334970 3300006880 Bacteria 625
295 Ga0068865_100000200 3300006881 Bacteria 33423
296 Ga0068865_100026446 3300006881 Bacteria 3826
297 Ga0097620_100079345 3300006931 Bacteria 3322
298 Ga0097620_100107978 3300006931 Bacteria 2844
299 Ga0097620_100180865 3300006931 Bacteria 2191
300 Ga0097620_101109567 3300006931 Bacteria 870
301 Ga0097620_101349199 3300006931 Bacteria 786
302 Ga0075435_100115545 3300007076 Bacteria 2235
303 Ga0105251_10012672 3300009011 Bacteria 4758
304 Ga0105251_10149065 3300009011 Bacteria 1057
305 Ga0105244_10000001 3300009036 Bacteria 1034899
306 Ga0105244_10013287 3300009036 Bacteria 4822
307 Ga0105244_10020501 3300009036 Bacteria 3671
308 Ga0105244_10219993 3300009036 Bacteria 891
309 Ga0105250_10025692 3300009092 Bacteria 2373
310 Ga0105250_10119615 3300009092 Bacteria 1082
311 Ga0105240_10015703 3300009093 Bacteria 10276
312 Ga0105240_10067718 3300009093 Bacteria 4425
313 Ga0105240_10129348 3300009093 Bacteria 3030
314 Ga0105240_10140553 3300009093 Bacteria 2887
315 Ga0105240_10221121 3300009093 Bacteria 2206
316 Ga0105240_10260499 3300009093 Bacteria 2001
317 Ga0105240_10276735 3300009093 Bacteria 1930
318 Ga0105240_10429871 3300009093 Bacteria 1482
319 Ga0105240_10654945 3300009093 Bacteria 1151
320 Ga0105240_10877236 3300009093 Bacteria 967
321 Ga0111539_10158570 3300009094 Bacteria 2647
322 Ga0111539_10159065 3300009094 Bacteria 2642
323 Ga0111539_10365710 3300009094 Bacteria 1679
324 Ga0111539_10776634 3300009094 Bacteria 1115
325 Ga0111539_11773332 3300009094 Bacteria 716
326 Ga0111539_11837627 3300009094 Bacteria 702
327 Ga0105247_10085212 3300009101 Bacteria 1998
328 Ga0105247_10127594 3300009101 Bacteria 1655
329 Ga0114129_10004634 3300009147 Bacteria 19404
330 Ga0114129_10030165 3300009147 Bacteria 7680
331 Ga0114129_10303183 3300009147 Bacteria 2128
332 Ga0105243_10000018 3300009148 Bacteria 227618
333 Ga0105243_10368164 3300009148 Bacteria 1325
334 Ga0105243_10880714 3300009148 Bacteria 889
335 Ga0105241_10019243 3300009174 Bacteria 5034
336 Ga0105241_10127780 3300009174 Bacteria 2054
337 Ga0105241_10152542 3300009174 Bacteria 1891
338 Ga0105241_10218230 3300009174 Bacteria 1601
339 Ga0105241_11532111 3300009174 Bacteria 643
340 Ga0105241_12131542 3300009174 Bacteria 555
341 Ga0105242_10040711 3300009176 Bacteria 3745
342 Ga0105242_10158277 3300009176 Bacteria 1980
343 Ga0105242_10259463 3300009176 Bacteria 1569
344 Ga0105242_12059936 3300009176 Bacteria 614
345 Ga0105248_10001106 3300009177 Bacteria 29895
346 Ga0105248_10052133 3300009177 Bacteria 4591
347 Ga0105248_10977514 3300009177 Bacteria 956
348 Ga0105248_11746004 3300009177 Bacteria 705
349 Ga0105248_12115238 3300009177 Bacteria 640
350 Ga0105237_10001287 3300009545 Bacteria 33378
351 Ga0105237_10001321 3300009545 Bacteria 32889
352 Ga0105237_10012788 3300009545 Bacteria 8828
353 Ga0105237_10060769 3300009545 Bacteria 3779
354 Ga0105237_10075128 3300009545 Bacteria 3371
355 Ga0105237_10131048 3300009545 Bacteria 2502
356 Ga0105237_10224782 3300009545 Bacteria 1878
357 Ga0105237_10307141 3300009545 Bacteria 1589
358 Ga0105237_10511742 3300009545 Bacteria 1207
359 Ga0105237_10549691 3300009545 Bacteria 1161
360 Ga0105237_10556101 3300009545 Bacteria 1154
361 Ga0105237_10568819 3300009545 Bacteria 1140
362 Ga0105237_11485236 3300009545 Bacteria 684
363 Ga0105237_12054660 3300009545 Bacteria 580
364 Ga0105238_10003742 3300009551 Bacteria 15125
365 Ga0105238_10097306 3300009551 Bacteria 2929
366 Ga0105238_10128234 3300009551 Bacteria 2515
367 Ga0105238_10645026 3300009551 Bacteria 1069
368 Ga0105238_10719173 3300009551 Bacteria 1011
369 Ga0105249_10006060 3300009553 Bacteria 10478
370 Ga0105249_10008223 3300009553 Bacteria 9087
371 Ga0105249_10479239 3300009553 Bacteria 1287
372 Ga0105239_10000001 3300010375 Bacteria 617353
373 Ga0105239_10001363 3300010375 Bacteria 32814
374 Ga0105239_10005053 3300010375 Bacteria 15586
375 Ga0105239_10023806 3300010375 Bacteria 6743
376 Ga0105239_10192411 3300010375 Bacteria 2283
377 Ga0105239_10622805 3300010375 Bacteria 1231
378 Ga0105239_10844655 3300010375 Bacteria 1050
379 Ga0105239_11040978 3300010375 Bacteria 941
380 Ga0105239_11124118 3300010375 Bacteria 905
381 Ga0105239_12832608 3300010375 Bacteria 566
382 Ga0105239_13253544 3300010375 Bacteria 529
383 Ga0105246_10112043 3300011119 Bacteria 2006
384 Ga0105246_10234751 3300011119 Bacteria 1446
385 Ga0105246_10828799 3300011119 Bacteria 823
386 Ga0157325_1008804 3300012485 Bacteria 708
387 Ga0157321_1017992 3300012487 Bacteria 621
388 Ga0157329_1013074 3300012491 Bacteria 688
389 Ga0157319_1019331 3300012497 Bacteria 647
390 Ga0157327_1003754 3300012512 Bacteria 1139
391 Ga0157373_10000054 3300013100 Bacteria 103861
392 Ga0157373_10000448 3300013100 Bacteria 32580
393 Ga0157373_10016881 3300013100 Bacteria 5323
394 Ga0157373_10018002 3300013100 Bacteria 5145
395 Ga0157373_10061203 3300013100 Bacteria 2666
396 Ga0157373_10068921 3300013100 Bacteria 2501
397 Ga0157373_10171486 3300013100 Bacteria 1527
398 Ga0157373_10172455 3300013100 Bacteria 1522
399 Ga0157373_10225466 3300013100 Bacteria 1323
400 Ga0157373_10476989 3300013100 Bacteria 900
401 Ga0157373_10668179 3300013100 Bacteria 760
402 Ga0157373_11440186 3300013100 Bacteria 525
403 Ga0157371_10000052 3300013102 Bacteria 179522
404 Ga0157371_10002095 3300013102 Bacteria 19477
405 Ga0157371_10009982 3300013102 Bacteria 7432
406 Ga0157371_10012727 3300013102 Bacteria 6414
407 Ga0157371_10132755 3300013102 Bacteria 1772
408 Ga0157371_10182884 3300013102 Bacteria 1499
409 Ga0157371_10237127 3300013102 Bacteria 1312
410 Ga0157371_10242405 3300013102 Bacteria 1297
411 Ga0157371_10487143 3300013102 Bacteria 910
412 Ga0157371_11012007 3300013102 Bacteria 634
413 Ga0157370_10014970 3300013104 Bacteria 7909
414 Ga0157370_10043162 3300013104 Bacteria 4341
415 Ga0157370_10044584 3300013104 Bacteria 4261
416 Ga0157370_10114453 3300013104 Bacteria 2520
417 Ga0157370_10163773 3300013104 Bacteria 2069
418 Ga0157370_10176265 3300013104 Bacteria 1987
419 Ga0157370_10320873 3300013104 Bacteria 1429
420 Ga0157370_10470573 3300013104 Bacteria 1155
421 Ga0157370_10658017 3300013104 Bacteria 957
422 Ga0157370_10670684 3300013104 Bacteria 947
423 Ga0157370_10857595 3300013104 Bacteria 825
424 Ga0157370_11041377 3300013104 Bacteria 740
425 Ga0157370_12059448 3300013104 Bacteria 511
426 Ga0157369_10000355 3300013105 Bacteria 60997
427 Ga0157369_10058386 3300013105 Bacteria 4162
428 Ga0157369_10064414 3300013105 Bacteria 3948
429 Ga0157369_10241115 3300013105 Bacteria 1888
430 Ga0157369_10307020 3300013105 Bacteria 1650
431 Ga0157369_10437331 3300013105 Bacteria 1355
432 Ga0157369_11430714 3300013105 Bacteria 704
433 Ga0157374_10092042 3300013296 Bacteria 2892
434 Ga0157374_10150180 3300013296 Bacteria 2265
435 Ga0157374_10240694 3300013296 Bacteria 1779
436 Ga0157374_11247236 3300013296 Bacteria 765
437 Ga0157374_12052736 3300013296 Bacteria 598
438 Ga0157378_10022748 3300013297 Bacteria 5516
439 Ga0157378_10041902 3300013297 Bacteria 4062
440 Ga0157378_10160320 3300013297 Bacteria 2103
441 Ga0157378_11438049 3300013297 Bacteria 733
442 Ga0163162_10000052 3300013306 Bacteria 112651
443 Ga0163162_10004579 3300013306 Bacteria 13316
444 Ga0163162_10006136 3300013306 Bacteria 11634
445 Ga0163162_10038959 3300013306 Bacteria 4746
446 Ga0163162_10090809 3300013306 Bacteria 3136
447 Ga0163162_10224456 3300013306 Bacteria 2008
448 Ga0163162_10878452 3300013306 Bacteria 1011
449 Ga0163162_12000926 3300013306 Bacteria 664
450 Ga0157372_10000254 3300013307 Bacteria 59194
451 Ga0157372_10001280 3300013307 Bacteria 27216
452 Ga0157372_10042429 3300013307 Bacteria 5032
453 Ga0157372_10122899 3300013307 Bacteria 2983
454 Ga0157372_10151310 3300013307 Bacteria 2679
455 Ga0157372_10153165 3300013307 Bacteria 2662
456 Ga0157372_10265687 3300013307 Bacteria 1993
457 Ga0157372_10372742 3300013307 Bacteria 1663
458 Ga0157372_10481125 3300013307 Bacteria 1447
459 Ga0157372_10914657 3300013307 Bacteria 1018
460 Ga0157372_10946815 3300013307 Bacteria 998
461 Ga0157372_11204962 3300013307 Bacteria 875
462 Ga0157372_11267669 3300013307 Bacteria 851
463 Ga0157375_10008115 3300013308 Bacteria 9188
464 Ga0157375_10013846 3300013308 Bacteria 7190
465 Ga0157375_10044048 3300013308 Bacteria 4331
466 Ga0157375_10106910 3300013308 Bacteria 2891
467 Ga0157375_10169512 3300013308 Bacteria 2330
468 Ga0157375_10469799 3300013308 Bacteria 1423
469 Ga0163163_10060719 3300014325 Bacteria 3744
470 Ga0163163_10280146 3300014325 Bacteria 1719
471 Ga0157380_10000015 3300014326 Bacteria 129842
472 Ga0157380_10046242 3300014326 Bacteria 3417
473 Ga0157380_10339685 3300014326 Bacteria 1400
474 Ga0157380_10585040 3300014326 Bacteria 1101
475 Ga0157380_12000718 3300014326 Bacteria 641
476 Ga0157380_12570396 3300014326 Bacteria 575
477 Ga0182008_10000030 3300014497 Bacteria 169168
478 Ga0182008_10000062 3300014497 Bacteria 90671
479 Ga0182008_10006054 3300014497 Bacteria 6805
480 Ga0182008_10021142 3300014497 Bacteria 3345
481 Ga0182008_10090076 3300014497 Bacteria 1512
482 Ga0157379_10000562 3300014968 Bacteria 29935
483 Ga0157379_10009212 3300014968 Bacteria 8597
484 Ga0157379_10268826 3300014968 Bacteria 1550
485 Ga0157376_10074456 3300014969 Bacteria 2894
486 Ga0157376_10279806 3300014969 Bacteria 1571
487 Ga0157376_10525825 3300014969 Bacteria 1167
488 Ga0157376_10575405 3300014969 Bacteria 1118
489 Ga0182006_1000003 3300015261 Bacteria 826681
490 Ga0182006_1002415 3300015261 Bacteria 10209
491 Ga0182006_1070067 3300015261 Bacteria 1302
492 Ga0182007_10000003 3300015262 Bacteria 548244
493 Ga0182007_10049861 3300015262 Bacteria 1382
494 Ga0182005_1000076 3300015265 Bacteria 79167
495 Ga0163161_10000009 3300017792 Bacteria 287918
496 Ga0163161_10000641 3300017792 Bacteria 27918
497 Ga0163161_10000862 3300017792 Bacteria 23670
498 Ga0163161_10025292 3300017792 Bacteria 4201
499 Ga0163161_10030399 3300017792 Bacteria 3844
500 Ga0163161_10035920 3300017792 Bacteria 3548
501 Ga0163161_10037844 3300017792 Bacteria 3458
502 Ga0163161_10041013 3300017792 Bacteria 3325
503 Ga0163161_10054458 3300017792 Bacteria 2903
504 Ga0163161_10075458 3300017792 Bacteria 2474
505 Ga0163161_10099208 3300017792 Bacteria 2165
506 Ga0163161_10481887 3300017792 Bacteria 1007
507 Ga0163161_11056009 3300017792 Bacteria 696
508 Ga0197907_10502577 3300020069 Bacteria 1836
509 Ga0197907_10706642 3300020069 Bacteria 2159
510 Ga0197907_10819694 3300020069 Bacteria 4207
511 Ga0197907_11339442 3300020069 Bacteria 821
512 Ga0206356_10266805 3300020070 Bacteria 1129
513 Ga0206356_10319799 3300020070 Bacteria 2513
514 Ga0206356_10781816 3300020070 Bacteria 700
515 Ga0206356_11054826 3300020070 Bacteria 3985
516 Ga0206356_11795532 3300020070 Bacteria 2420
517 Ga0206356_11849337 3300020070 Bacteria 1449
518 Ga0206349_1678553 3300020075 Bacteria 686
519 Ga0206349_1906000 3300020075 Bacteria 629
520 Ga0206355_1389572 3300020076 Bacteria 514
521 Ga0206355_1710056 3300020076 Bacteria 1509
522 Ga0206351_10106046 3300020077 Bacteria 13123
523 Ga0206351_10453586 3300020077 Bacteria 1408
524 Ga0206351_10462283 3300020077 Bacteria 11313
525 Ga0206351_10586730 3300020077 Bacteria 2505
526 Ga0206351_10776079 3300020077 Bacteria 649
527 Ga0206352_10195467 3300020078 Bacteria 639
528 Ga0206352_10639884 3300020078 Bacteria 976
529 Ga0206352_11093239 3300020078 Bacteria 539
530 Ga0206352_11147567 3300020078 Bacteria 665
531 Ga0206352_11257836 3300020078 Bacteria 1298
532 Ga0206350_10111961 3300020080 Bacteria 11279
533 Ga0206350_10297200 3300020080 Bacteria 8943
534 Ga0206350_10464794 3300020080 Bacteria 555
535 Ga0206350_10530843 3300020080 Bacteria 669
536 Ga0206350_10647756 3300020080 Bacteria 730
537 Ga0206354_10771971 3300020081 Bacteria 2472
538 Ga0206354_10796355 3300020081 Bacteria 3126
539 Ga0206354_11204833 3300020081 Bacteria 1496
540 Ga0206354_11237852 3300020081 Bacteria 921
541 Ga0206353_10800764 3300020082 Bacteria 2247
542 Ga0206353_11117576 3300020082 Bacteria 3238
543 Ga0206353_11125333 3300020082 Bacteria 3606
544 Ga0206353_11264094 3300020082 Bacteria 628
545 Ga0206353_11831860 3300020082 Bacteria 639
546 Ga0206353_12062741 3300020082 Bacteria 1520
547 Ga0154015_1153066 3300020610 Bacteria 6861
548 Ga0154015_1236635 3300020610 Bacteria 10577
549 Ga0154015_1602182 3300020610 Bacteria 1296
550 Ga0224712_10005983 3300022467 Bacteria 3435
551 Ga0224712_10267272 3300022467 Bacteria 793
552 Ga0256744_137381 3300023309 Bacteria 554
553 Ga0209436_101300 3300025208 Bacteria 8890
554 Ga0209563_107118 3300025230 Bacteria 1861
555 Ga0207427_100236 3300025231 Bacteria 45297
556 Ga0207427_122187 3300025231 Bacteria 565
557 Ga0209437_100034 3300025233 Bacteria 494007
558 Ga0209437_100143 3300025233 Bacteria 164970
559 Ga0209258_118342 3300025242 Bacteria 756
560 Ga0207425_1000002 3300025245 Bacteria 1362590
561 Ga0209026_1000463 3300025250 Bacteria 31275
562 Ga0209026_1002304 3300025250 Bacteria 7279
563 Ga0209026_1004428 3300025250 Bacteria 4158
564 Ga0209148_1017590 3300025254 Bacteria 1211
565 Ga0209129_1000002 3300025258 Bacteria 1359086
566 Ga0209129_1013234 3300025258 Bacteria 1829
567 Ga0209233_1000038 3300025261 Bacteria 548972
568 Ga0209233_1019928 3300025261 Bacteria 1771
569 Ga0207666_1014994 3300025271 Bacteria 1100
570 Ga0209455_1001279 3300025272 Bacteria 11764
571 Ga0207673_1028041 3300025290 Bacteria 775
572 Ga0209675_1000059 3300025291 Bacteria 184781
573 Ga0209676_1000294 3300025292 Bacteria 101100
574 Ga0209025_1000004 3300025294 Bacteria 1361782
575 Ga0209758_1000006 3300025297 Bacteria 1359562
576 Ga0207426_1003126 3300025302 Bacteria 9435
577 Ga0209257_1000023 3300025304 Bacteria 753019
578 Ga0207697_10147388 3300025315 Bacteria 1023
579 Ga0207656_10000220 3300025321 Bacteria 20616
580 Ga0207656_10030400 3300025321 Bacteria 2231
581 Ga0207656_10082248 3300025321 Bacteria 1449
582 Ga0207696_1087382 3300025711 Bacteria 856
583 Ga0207696_1134549 3300025711 Bacteria 663
584 Ga0207655_1000018 3300025728 Bacteria 537129
585 Ga0207655_1000093 3300025728 Bacteria 196813
586 Ga0207655_1059925 3300025728 Bacteria 1478
587 Ga0207713_1055674 3300025735 Bacteria 1542
588 Ga0207642_10582530 3300025899 Bacteria 694
589 Ga0207710_10107597 3300025900 Bacteria 1321
590 Ga0207688_10060048 3300025901 Bacteria 2141
591 Ga0207680_10130973 3300025903 Bacteria 1653
592 Ga0207680_10162725 3300025903 Bacteria 1498
593 Ga0207647_10003884 3300025904 Bacteria 11172
594 Ga0207647_10007050 3300025904 Bacteria 8148
595 Ga0207647_10063060 3300025904 Bacteria 2255
596 Ga0207647_10086388 3300025904 Bacteria 1875
597 Ga0207645_10000909 3300025907 Bacteria 24558
598 Ga0207645_10002281 3300025907 Bacteria 15210
599 Ga0207643_10973824 3300025908 Bacteria 549
600 Ga0207705_10000043 3300025909 Bacteria 181491
601 Ga0207705_10377593 3300025909 Bacteria 1095
602 Ga0207705_10469959 3300025909 Bacteria 976
603 Ga0207705_10559224 3300025909 Bacteria 889
604 Ga0207684_10006660 3300025910 Bacteria 10497
605 Ga0207654_10005184 3300025911 Bacteria 6575
606 Ga0207654_10518295 3300025911 Bacteria 844
607 Ga0207654_11252249 3300025911 Bacteria 541
608 Ga0207707_10005257 3300025912 Bacteria 11339
609 Ga0207707_10055872 3300025912 Bacteria 3434
610 Ga0207707_10213426 3300025912 Bacteria 1681
611 Ga0207707_10904110 3300025912 Bacteria 730
612 Ga0207695_10000053 3300025913 Bacteria 396740
613 Ga0207695_10020568 3300025913 Bacteria 7555
614 Ga0207695_10029659 3300025913 Bacteria 6038
615 Ga0207695_10034034 3300025913 Bacteria 5548
616 Ga0207695_10044139 3300025913 Bacteria 4744
617 Ga0207695_10088255 3300025913 Bacteria 3122
618 Ga0207695_10088720 3300025913 Bacteria 3112
619 Ga0207695_10196503 3300025913 Bacteria 1933
620 Ga0207695_10287337 3300025913 Bacteria 1537
621 Ga0207695_10530382 3300025913 Bacteria 1059
622 Ga0207695_10807302 3300025913 Bacteria 818
623 Ga0207671_10002869 3300025914 Bacteria 17871
624 Ga0207671_10003103 3300025914 Bacteria 16910
625 Ga0207671_10007516 3300025914 Bacteria 9448
626 Ga0207671_10012211 3300025914 Bacteria 6926
627 Ga0207671_10032530 3300025914 Bacteria 3882
628 Ga0207671_10037359 3300025914 Bacteria 3602
629 Ga0207671_10069032 3300025914 Bacteria 2635
630 Ga0207671_10961347 3300025914 Bacteria 674
631 Ga0207693_10049593 3300025915 Bacteria 3297
632 Ga0207693_10081649 3300025915 Bacteria 2531
633 Ga0207660_10083829 3300025917 Bacteria 2348
634 Ga0207660_10092024 3300025917 Bacteria 2250
635 Ga0207662_10000695 3300025918 Bacteria 15329
636 Ga0207657_10020514 3300025919 Bacteria 6243
637 Ga0207657_10091410 3300025919 Bacteria 2538
638 Ga0207657_10220731 3300025919 Bacteria 1519
639 Ga0207657_10245093 3300025919 Bacteria 1430
640 Ga0207649_10018776 3300025920 Bacteria 3940
641 Ga0207649_10028375 3300025920 Bacteria 3294
642 Ga0207649_10056686 3300025920 Bacteria 2448
643 Ga0207652_10004160 3300025921 Bacteria 11800
644 Ga0207652_10022531 3300025921 Bacteria 5212
645 Ga0207652_10026145 3300025921 Bacteria 4858
646 Ga0207652_10257275 3300025921 Bacteria 1575
647 Ga0207652_11854710 3300025921 Bacteria 508
648 Ga0207681_10000921 3300025923 Bacteria 19202
649 Ga0207681_10031056 3300025923 Bacteria 3486
650 Ga0207694_10022814 3300025924 Bacteria 4747
651 Ga0207694_10083340 3300025924 Bacteria 2514
652 Ga0207694_10464667 3300025924 Bacteria 1057
653 Ga0207694_10686066 3300025924 Bacteria 864
654 Ga0207694_10779327 3300025924 Bacteria 808
655 Ga0207650_10095058 3300025925 Bacteria 2284
656 Ga0207650_10320790 3300025925 Bacteria 1269
657 Ga0207659_10000169 3300025926 Bacteria 39159
658 Ga0207659_10000843 3300025926 Bacteria 18152
659 Ga0207659_10070326 3300025926 Bacteria 2552
660 Ga0207659_10435990 3300025926 Bacteria 1101
661 Ga0207687_10105232 3300025927 Bacteria 2084
662 Ga0207700_11601388 3300025928 Bacteria 576
663 Ga0207664_10833667 3300025929 Bacteria 829
664 Ga0207644_10001196 3300025931 Bacteria 16709
665 Ga0207644_10010204 3300025931 Bacteria 6189
666 Ga0207644_10296214 3300025931 Bacteria 1302
667 Ga0207644_10677170 3300025931 Bacteria 859
668 Ga0207690_10000365 3300025932 Bacteria 30004
669 Ga0207690_10063455 3300025932 Bacteria 2519
670 Ga0207690_11265899 3300025932 Bacteria 616
671 Ga0207706_10000057 3300025933 Bacteria 112805
672 Ga0207706_10002035 3300025933 Bacteria 19832
673 Ga0207706_10169742 3300025933 Bacteria 1917
674 Ga0207706_10266418 3300025933 Bacteria 1495
675 Ga0207686_10007982 3300025934 Bacteria 5706
676 Ga0207686_10125683 3300025934 Bacteria 1752
677 Ga0207686_10450592 3300025934 Bacteria 990
678 Ga0207686_11301119 3300025934 Bacteria 597
679 Ga0207709_10000021 3300025935 Bacteria 386722
680 Ga0207709_10000628 3300025935 Bacteria 28907
681 Ga0207670_10007709 3300025936 Bacteria 6033
682 Ga0207670_10082497 3300025936 Bacteria 2253
683 Ga0207670_10454751 3300025936 Bacteria 1033
684 Ga0207669_10099554 3300025937 Bacteria 1917
685 Ga0207704_10000052 3300025938 Bacteria 80866
686 Ga0207704_10003676 3300025938 Bacteria 6974
687 Ga0207665_10045738 3300025939 Bacteria 2931
688 Ga0207665_10116996 3300025939 Bacteria 1879
689 Ga0207665_10165633 3300025939 Bacteria 1593
690 Ga0207691_10031365 3300025940 Bacteria 4961
691 Ga0207691_10896985 3300025940 Bacteria 742
692 Ga0207711_10002561 3300025941 Bacteria 16200
693 Ga0207689_10004653 3300025942 Bacteria 12412
694 Ga0207689_10080823 3300025942 Bacteria 2672
695 Ga0207661_10007883 3300025944 Bacteria 7589
696 Ga0207661_10007950 3300025944 Bacteria 7561
697 Ga0207661_10090386 3300025944 Bacteria 2549
698 Ga0207661_10252019 3300025944 Bacteria 1569
699 Ga0207679_10002943 3300025945 Bacteria 10549
700 Ga0207679_10003915 3300025945 Bacteria 9241
701 Ga0207679_10188504 3300025945 Bacteria 1712
702 Ga0207667_10000022 3300025949 Bacteria 369570
703 Ga0207667_10001325 3300025949 Bacteria 31070
704 Ga0207667_10012833 3300025949 Bacteria 9627
705 Ga0207667_10073046 3300025949 Bacteria 3565
706 Ga0207667_10152790 3300025949 Bacteria 2376
707 Ga0207667_10419233 3300025949 Bacteria 1362
708 Ga0207667_10800527 3300025949 Bacteria 939
709 Ga0207651_10027165 3300025960 Bacteria 3590
710 Ga0207651_10039011 3300025960 Bacteria 3127
711 Ga0207712_10009138 3300025961 Bacteria 6272
712 Ga0207712_10030186 3300025961 Bacteria 3642
713 Ga0207712_10578305 3300025961 Bacteria 969
714 Ga0207668_10046737 3300025972 Bacteria 2959
715 Ga0207668_10051640 3300025972 Bacteria 2840
716 Ga0207640_10033694 3300025981 Bacteria 3189
717 Ga0207640_10984577 3300025981 Bacteria 741
718 Ga0207640_11093045 3300025981 Bacteria 705
719 Ga0207640_11596769 3300025981 Bacteria 587
720 Ga0207640_11660664 3300025981 Bacteria 576
721 Ga0207658_10030281 3300025986 Bacteria 3830
722 Ga0207658_10048536 3300025986 Bacteria 3113
723 Ga0207658_10323473 3300025986 Bacteria 1336
724 Ga0207677_10076079 3300026023 Bacteria 2388
725 Ga0207703_10005252 3300026035 Bacteria 10445
726 Ga0207703_10008320 3300026035 Bacteria 8196
727 Ga0207703_10031399 3300026035 Bacteria 4200
728 Ga0207703_11067542 3300026035 Bacteria 775
729 Ga0207703_11630091 3300026035 Bacteria 621
730 Ga0207639_10030610 3300026041 Bacteria 3948
731 Ga0207639_10157453 3300026041 Bacteria 1910
732 Ga0207639_10287311 3300026041 Bacteria 1449
733 Ga0207639_10610595 3300026041 Bacteria 1006
734 Ga0207678_10310685 3300026067 Bacteria 1355
735 Ga0207708_10004898 3300026075 Bacteria 9870
736 Ga0207708_10296528 3300026075 Bacteria 1314
737 Ga0207708_10663202 3300026075 Bacteria 889
738 Ga0207702_10000036 3300026078 Bacteria 154106
739 Ga0207702_10034672 3300026078 Bacteria 4220
740 Ga0207702_10052280 3300026078 Bacteria 3456
741 Ga0207702_10089289 3300026078 Bacteria 2695
742 Ga0207702_10144049 3300026078 Bacteria 2160
743 Ga0207702_10982685 3300026078 Bacteria 837
744 Ga0207641_10000293 3300026088 Bacteria 62674
745 Ga0207641_10011831 3300026088 Bacteria 7160
746 Ga0207641_10593628 3300026088 Bacteria 1084
747 Ga0207648_10002788 3300026089 Bacteria 18537
748 Ga0207676_10060399 3300026095 Bacteria 2998
749 Ga0207676_10238990 3300026095 Bacteria 1628
750 Ga0207676_10258511 3300026095 Bacteria 1571
751 Ga0207674_10127668 3300026116 Bacteria 2508
752 Ga0207674_10521044 3300026116 Bacteria 1148
753 Ga0207675_100003884 3300026118 Bacteria 14525
754 Ga0207675_100066788 3300026118 Bacteria 3361
755 Ga0207683_10010796 3300026121 Bacteria 7788
756 Ga0207683_11373484 3300026121 Bacteria 653
757 Ga0207683_11831365 3300026121 Bacteria 556
758 Ga0207683_12069707 3300026121 Bacteria 517
759 Ga0207698_10003054 3300026142 Bacteria 10034
760 Ga0207698_10005473 3300026142 Bacteria 7852
761 Ga0207698_10031644 3300026142 Bacteria 3822
762 Ga0207698_10401696 3300026142 Bacteria 1310
763 Ga0207698_10567760 3300026142 Bacteria 1114
764 Ga0207698_11049840 3300026142 Bacteria 826
765 Ga0209281_1000158 3300027111 Bacteria 162280
766 Ga0209969_1021884 3300027360 Bacteria 955
767 Ga0209969_1027942 3300027360 Bacteria 856
768 Ga0209489_116311 3300027361 Bacteria 4031
769 Ga0209995_1002344 3300027471 Bacteria 2991
770 Ga0209968_1001388 3300027526 Bacteria 3666
771 Ga0209974_10022486 3300027876 Bacteria 2089
772 Ga0207428_10570692 3300027907 Bacteria 817
773 Ga0268266_10000030 3300028379 Bacteria 417120
774 Ga0268265_10004276 3300028380 Bacteria 9964
775 Ga0268265_10122397 3300028380 Bacteria 2146
776 Ga0268265_11064869 3300028380 Bacteria 801
777 Ga0268264_10028955 3300028381 Bacteria 4534
778 Ga0268264_10116808 3300028381 Bacteria 2346
779 Ga0268264_10687715 3300028381 Bacteria 1015
780 Ga0265318_10153980 3300028577 Bacteria 843
781 Ga0265323_10000038 3300028653 Bacteria 70544
782 Ga0265323_10015327 3300028653 Unclassified 3018
783 Ga0307517_10006168 3300028786 Bacteria 17856
784 Ga0307517_10262260 3300028786 Bacteria 1002
785 Ga0307515_10000009 3300028794 Bacteria 653206
786 Ga0307515_10049612 3300028794 Bacteria 6307
787 Ga0307515_10244807 3300028794 Bacteria 1556
788 Ga0307515_10486209 3300028794 Bacteria 846
789 Ga0307515_10689333 3300028794 Bacteria 637
790 Ga0265338_10000920 3300028800 Bacteria 49610
791 Ga0265338_10049114 3300028800 Bacteria 3829
792 Ga0316177_1136623 3300030731 Bacteria 824
793 Ga0316181_1034012 3300030744 Bacteria 902
794 Ga0316181_1133526 3300030744 Bacteria 837
795 Ga0316181_1201818 3300030744 Bacteria 1920
796 Ga0316181_1282363 3300030744 Bacteria 2852
797 Ga0316182_1171482 3300030745 Bacteria 4017
798 Ga0265766_1009546 3300030863 Bacteria 681
799 Ga0265774_104937 3300031011 Bacteria 573
800 Ga0265779_112346 3300031043 Bacteria 540
801 Ga0265327_10017918 3300031251 Bacteria 4417
802 Ga0265327_10054874 3300031251 Bacteria 2061
803 Ga0265327_10059485 3300031251 Bacteria 1957
804 Ga0265316_10000481 3300031344 Bacteria 45334
805 Ga0265316_10002116 3300031344 Bacteria 20863
806 Ga0265316_10541036 3300031344 Bacteria 830
807 Ga0307513_10494596 3300031456 Bacteria 941
808 Ga0307513_10840906 3300031456 Bacteria 624
809 Ga0307509_10007266 3300031507 Bacteria 14552
810 Ga0307509_10101371 3300031507 Bacteria 2914
811 Ga0307509_10372105 3300031507 Bacteria 1145
812 Ga0307408_100002257 3300031548 Bacteria 13743
813 Ga0307408_100037589 3300031548 Bacteria 3411
814 Ga0307408_100070397 3300031548 Bacteria 2582
815 Ga0307408_102048102 3300031548 Bacteria 551
816 Ga0307508_10389351 3300031616 Bacteria 985
817 Ga0307514_10113935 3300031649 Bacteria 1907
818 Ga0307514_10407243 3300031649 Bacteria 691
819 Ga0265342_10203717 3300031712 Unclassified 1073
820 Ga0265342_10311692 3300031712 Bacteria 827
821 Ga0316576_10012743 3300031727 Bacteria 5562
822 Ga0316576_10027864 3300031727 Bacteria 3975
823 Ga0316576_10050475 3300031727 Bacteria 3026
824 Ga0316576_10080691 3300031727 Bacteria 2413
825 Ga0316576_10176552 3300031727 Bacteria 1611
826 Ga0316576_10259036 3300031727 Bacteria 1305
827 Ga0316576_10269349 3300031727 Bacteria 1277
828 Ga0316576_10969568 3300031727 Bacteria 607
829 Ga0316578_10520202 3300031728 Bacteria 700
830 Ga0307516_10131017 3300031730 Bacteria 2287
831 Ga0307405_10000001 3300031731 Bacteria 1731270
832 Ga0307405_10000003 3300031731 Bacteria 569064
833 Ga0307405_10001399 3300031731 Bacteria 10145
834 Ga0307405_10036088 3300031731 Bacteria 2959
835 Ga0307405_10051289 3300031731 Bacteria 2559
836 Ga0307405_10387160 3300031731 Bacteria 1090
837 Ga0307405_11196301 3300031731 Bacteria 657
838 Ga0316577_10579840 3300031733 Bacteria 638
839 Ga0307413_10000568 3300031824 Bacteria 12415
840 Ga0307413_10816658 3300031824 Bacteria 785
841 Ga0307410_10020508 3300031852 Bacteria 4044
842 Ga0307410_10556354 3300031852 Bacteria 951
843 Ga0307406_10002275 3300031901 Bacteria 10446
844 Ga0307406_10083679 3300031901 Bacteria 2128
845 Ga0307406_10116079 3300031901 Bacteria 1851
846 Ga0307406_10306128 3300031901 Bacteria 1223
847 Ga0307407_10000030 3300031903 Bacteria 97416
848 Ga0307407_10030089 3300031903 Bacteria 2925
849 Ga0307412_10000065 3300031911 Bacteria 122279
850 Ga0307412_10000072 3300031911 Bacteria 105576
851 Ga0307412_10000385 3300031911 Bacteria 27410
852 Ga0307412_10000925 3300031911 Bacteria 16779
853 Ga0307412_10002592 3300031911 Bacteria 10043
854 Ga0307412_10007236 3300031911 Bacteria 6294
855 Ga0307412_10120538 3300031911 Bacteria 1888
856 Ga0307412_10529903 3300031911 Bacteria 986
857 Ga0307412_10806344 3300031911 Bacteria 815
858 Ga0307412_10826948 3300031911 Bacteria 806
859 Ga0307412_11062801 3300031911 Bacteria 718
860 Ga0307409_101921563 3300031995 Bacteria 621
861 Ga0307416_100000013 3300032002 Bacteria 283585
862 Ga0307416_100000014 3300032002 Bacteria 249053
863 Ga0307416_100007927 3300032002 Bacteria 6802
864 Ga0307416_100090547 3300032002 Bacteria 2623
865 Ga0307416_100330333 3300032002 Bacteria 1532
866 Ga0307416_100506789 3300032002 Bacteria 1272
867 Ga0307416_100828746 3300032002 Bacteria 1022
868 Ga0307416_102443421 3300032002 Bacteria 622
869 Ga0307414_10000140 3300032004 Bacteria 49611
870 Ga0307414_10007780 3300032004 Bacteria 6041
871 Ga0307414_10010548 3300032004 Bacteria 5369
872 Ga0307414_10043088 3300032004 Bacteria 3071
873 Ga0307414_10073019 3300032004 Bacteria 2480
874 Ga0307414_10079883 3300032004 Bacteria 2389
875 Ga0307414_10100000 3300032004 Bacteria 2180
876 Ga0307414_10100320 3300032004 Bacteria 2177
877 Ga0307414_10120028 3300032004 Bacteria 2019
878 Ga0307414_10131990 3300032004 Bacteria 1940
879 Ga0307414_10141810 3300032004 Bacteria 1882
880 Ga0307414_10191977 3300032004 Bacteria 1653
881 Ga0307414_10279941 3300032004 Bacteria 1401
882 Ga0307414_10281196 3300032004 Bacteria 1398
883 Ga0307414_10318639 3300032004 Bacteria 1322
884 Ga0307414_10528899 3300032004 Bacteria 1048
885 Ga0307414_10662742 3300032004 Bacteria 942
886 Ga0307414_10767053 3300032004 Bacteria 877
887 Ga0307414_10790271 3300032004 Bacteria 865
888 Ga0307414_11422815 3300032004 Bacteria 644
889 Ga0307411_10000010 3300032005 Bacteria 238134
890 Ga0307411_10037802 3300032005 Bacteria 3039
891 Ga0307411_10116047 3300032005 Bacteria 1927
892 Ga0307415_100149326 3300032126 Bacteria 1796
893 Ga0307415_101670334 3300032126 Bacteria 613
894 Ga0307415_101849028 3300032126 Bacteria 585
895 Ga0316585_10044695 3300032137 Bacteria 1416
896 Ga0316585_10076681 3300032137 Bacteria 1088
897 Ga0316580_10058497 3300032139 Bacteria 1184
898 Ga0316580_10119047 3300032139 Bacteria 809
899 Ga0316593_10001317 3300032168 Bacteria 5411
900 Ga0316593_10001424 3300032168 Bacteria 5268
901 Ga0316593_10005401 3300032168 Bacteria 3366
902 Ga0316593_10007056 3300032168 Bacteria 3067
903 Ga0316593_10010871 3300032168 Bacteria 2627
904 Ga0316593_10019016 3300032168 Bacteria 2118
905 Ga0316593_10022431 3300032168 Bacteria 1983
906 Ga0316593_10023475 3300032168 Bacteria 1946
907 Ga0316593_10047964 3300032168 Bacteria 1437
908 Ga0316593_10053466 3300032168 Bacteria 1368
909 Ga0316593_10061455 3300032168 Bacteria 1285
910 Ga0316593_10139556 3300032168 Bacteria 878
911 Ga0316593_10239907 3300032168 Bacteria 676
912 Ga0316593_10337803 3300032168 Bacteria 575
913 Ga0307507_10000032 3300033179 Bacteria 194155
914 Ga0307510_10005905 3300033180 Bacteria 14606
915 Ga0307510_10022058 3300033180 Bacteria 7402
916 Ga0316592_1000944 3300033524 Bacteria 4451
917 Ga0316592_1001500 3300033524 Bacteria 3781
918 Ga0316592_1001667 3300033524 Bacteria 3663
919 Ga0316592_1003832 3300033524 Bacteria 2756
920 Ga0316592_1005390 3300033524 Bacteria 2427
921 Ga0316592_1010904 3300033524 Bacteria 1838
922 Ga0316592_1011737 3300033524 Bacteria 1787
923 Ga0316592_1017679 3300033524 Bacteria 1498
924 Ga0316592_1021309 3300033524 Bacteria 1380
925 Ga0316592_1024241 3300033524 Bacteria 1305
926 Ga0316592_1032646 3300033524 Bacteria 1136
927 Ga0316592_1055538 3300033524 Bacteria 886
928 Ga0316592_1075461 3300033524 Bacteria 764
929 Ga0316592_1088032 3300033524 Bacteria 709
930 Ga0316592_1113262 3300033524 Bacteria 628
931 Ga0316592_1129750 3300033524 Bacteria 588
932 Ga0316592_1133454 3300033524 Bacteria 580
933 Ga0316586_1000972 3300033527 Bacteria 3063
934 Ga0316586_1002316 3300033527 Bacteria 2357
935 Ga0316586_1007006 3300033527 Bacteria 1634
936 Ga0316586_1047132 3300033527 Bacteria 766
937 Ga0316586_1104026 3300033527 Bacteria 544
938 Ga0316588_1001715 3300033528 Bacteria 3675
939 Ga0316588_1016176 3300033528 Bacteria 1650
940 Ga0316588_1021501 3300033528 Bacteria 1468
941 Ga0316588_1025332 3300033528 Bacteria 1370
942 Ga0316588_1035028 3300033528 Bacteria 1188
943 Ga0316588_1114550 3300033528 Bacteria 680
944 Ga0316588_1129337 3300033528 Bacteria 642
945 Ga0316588_1129532 3300033528 Bacteria 641
946 Ga0316596_1000933 3300033541 Bacteria 5561
947 Ga0316596_1001316 3300033541 Bacteria 4945
948 Ga0316596_1003631 3300033541 Bacteria 3400
949 Ga0316596_1004659 3300033541 Bacteria 3093
950 Ga0316596_1005709 3300033541 Bacteria 2857
951 Ga0316596_1009273 3300033541 Bacteria 2359
952 Ga0316596_1009752 3300033541 Bacteria 2308
953 Ga0316596_1015300 3300033541 Bacteria 1910
954 Ga0316596_1017392 3300033541 Bacteria 1808
955 Ga0316596_1021017 3300033541 Bacteria 1662
956 Ga0316596_1028750 3300033541 Bacteria 1437
957 Ga0316596_1032378 3300033541 Bacteria 1360
958 Ga0316596_1037825 3300033541 Bacteria 1263
959 Ga0316596_1041213 3300033541 Bacteria 1213
960 Ga0316596_1089556 3300033541 Bacteria 829
961 Ga0316596_1090694 3300033541 Bacteria 824
962 Ga0316596_1133003 3300033541 Bacteria 679
963 Ga0316596_1148215 3300033541 Bacteria 644
964 Ga0316596_1242811 3300033541 Bacteria 507
965 Ga0373959_0160283 3300034820 Bacteria 574
966 Ga0373944_0087759 3300035089 Bacteria 1036
967 Ga0373951_0061742 3300035091 Bacteria 940
968 Ga0373954_0408307 3300035118 Bacteria 672
969 Ga0373960_0013130 3300035121 Bacteria 2072
970 Ga0373942_0108523 3300035207 Bacteria 856
971 Ga0316574_0079726 3300035398 Bacteria 2077
972 Ga0316574_0168258 3300035398 Bacteria 1411
973 Ga0316574_0244732 3300035398 Bacteria 1146
974 Ga0373935_0645599 3300035692 Bacteria 776
975 Ga0373927_0246332 3300035695 Bacteria 1175
976 Ga0373937_0394787 3300036401 Bacteria 1312
977 Ga0265778_001249 3300036457 Bacteria 2277
978 Ga0316582_0005208 3300036647 Bacteria 6663
979 Ga0316582_0012374 3300036647 Bacteria 4759
980 Ga0316582_0456969 3300036647 Bacteria 880
981 Ga0316582_0763131 3300036647 Bacteria 663
982 Ga0316584_0001736 3300036712 Bacteria 13379
983 Ga0316584_0004533 3300036712 Bacteria 9200
984 Ga0316584_0018160 3300036712 Bacteria 5071
985 Ga0316584_0126509 3300036712 Bacteria 1908
986 Ga0316584_0817308 3300036712 Bacteria 632
987 Ga0373925_1404430 3300037068 Bacteria 572
988 Ga0395899_0000002 3300037312 Bacteria 1324310
989 Ga0395899_0000061 3300037312 Bacteria 212002
990 Ga0395899_0012421 3300037312 Bacteria 6524
991 Ga0395899_0046276 3300037312 Bacteria 3241
992 Ga0395899_0490756 3300037312 Bacteria 798
993 Ga0395900_0000143 3300037418 Bacteria 120234
994 Ga0395900_0000284 3300037418 Bacteria 75852
995 Ga0395900_0125611 3300037418 Bacteria 2631
996 Ga0395900_0258745 3300037418 Bacteria 1739
997 Ga0395898_0049674 3300037466 Bacteria 4109
998 Ga0395898_0059816 3300037466 Bacteria 3705
999 Ga0395905_0000045 3300037471 Bacteria 241370
1000 Ga0395905_0001507 3300037471 Bacteria 27862
1001 Ga0395905_0003630 3300037471 Bacteria 16393
1002 Ga0395905_0164245 3300037471 Bacteria 2086
1003 Ga0395905_1684294 3300037471 Bacteria 539
1004 Ga0395901_0000976 3300038443 Bacteria 31051
1005 Ga0395901_0003957 3300038443 Bacteria 14901
1006 Ga0395901_0056763 3300038443 Bacteria 4073
1007 Ga0395901_0237197 3300038443 Bacteria 1903
1008 Ga0395901_0276349 3300038443 Bacteria 1746
1009 Ga0400483_029390 3300039062 Bacteria 48364
1010 Ga0400483_050403 3300039062 Bacteria 1329
1011 Ga0400483_124011 3300039062 Bacteria 2626
1012 Ga0400483_195876 3300039062 Bacteria 1274
1013 Ga0400483_226961 3300039062 Bacteria 47833
1014 Ga0400489_00166 3300039093 Bacteria 1648
1015 Ga0436365_0622767 3300039437 Bacteria 2913
1016 Ga0436365_1899993 3300039437 Bacteria 762
1017 Ga0436361_0285047 3300039447 Bacteria 6372
1018 Ga0436361_1065956 3300039447 Bacteria 1310
1019 Ga0439447_000448 3300041407 Bacteria 15364
1020 Ga0439453_0030344 3300041408 Bacteria 1022
1021 Ga0439465_0000059 3300041413 Bacteria 23849
1022 Ga0451787_190884 3300041441 Bacteria 1502
1023 Ga0451787_260319 3300041441 Bacteria 591
1024 Ga0451787_275413 3300041441 Bacteria 532
1025 Ga0451788_06079 3300041442 Bacteria 624
1026 Ga0451788_08994 3300041442 Bacteria 702
1027 Ga0451789_0910149 3300041443 Bacteria 1042
1028 Ga0451789_1121600 3300041443 Bacteria 910
1029 Ga0451790_02189 3300041444 Bacteria 1789
1030 Ga0451790_02818 3300041444 Bacteria 1385
1031 Ga0451790_07784 3300041444 Bacteria 681
1032 Ga0451790_08466 3300041444 Bacteria 881
1033 Ga0451790_08648 3300041444 Bacteria 576
1034 Ga0451790_27903 3300041444 Bacteria 612
1035 Ga0451790_29633 3300041444 Bacteria 681
1036 Ga0451792_04669 3300041445 Bacteria 607
1037 Ga0451792_14905 3300041445 Bacteria 1301
1038 Ga0451794_07486 3300041446 Bacteria 660
1039 Ga0451794_12521 3300041446 Bacteria 671
1040 Ga0451794_28924 3300041446 Bacteria 1122
1041 Ga0451794_30763 3300041446 Bacteria 582
1042 Ga0451794_36379 3300041446 Bacteria 500
1043 Ga0451794_38207 3300041446 Bacteria 697
1044 Ga0451794_41130 3300041446 Bacteria 936
1045 Ga0451794_46656 3300041446 Bacteria 1016
1046 Ga0451796_14267 3300041450 Bacteria 772
1047 Ga0451791_0638065 3300041451 Bacteria 1041
1048 Ga0451791_1422218 3300041451 Bacteria 1921
1049 Ga0451793_1805624 3300041452 Bacteria 756
1050 Ga0451797_0299663 3300041453 Bacteria 681
1051 Ga0451797_0547988 3300041453 Bacteria 844
1052 Ga0451797_0843647 3300041453 Bacteria 800
1053 Ga0451799_34312 3300041454 Bacteria 597
1054 Ga0451795_0287747 3300041456 Bacteria 809
1055 Ga0451795_0330379 3300041456 Bacteria 651
1056 Ga0451795_0366728 3300041456 Bacteria 1568
1057 Ga0451795_0531346 3300041456 Bacteria 3201
1058 Ga0451795_0712291 3300041456 Bacteria 802
1059 Ga0451795_0944706 3300041456 Bacteria 1101
1060 Ga0451795_1233880 3300041456 Bacteria 3095
1061 Ga0451795_1279062 3300041456 Bacteria 675
1062 Ga0451795_1367261 3300041456 Bacteria 1198
1063 Ga0451795_1448660 3300041456 Bacteria 689
1064 Ga0451795_1631148 3300041456 Bacteria 1279
1065 Ga0451803_12559 3300041457 Bacteria 649
1066 Ga0451802_0278220 3300041460 Bacteria 834
1067 Ga0451802_2099772 3300041460 Bacteria 1028
1068 Ga0451805_071652 3300041461 Bacteria 976
1069 Ga0451805_080062 3300041461 Bacteria 606
1070 Ga0451805_090433 3300041461 Bacteria 1204
1071 Ga0451805_090728 3300041461 Bacteria 770
1072 Ga0451806_626055 3300041462 Bacteria 646
1073 Ga0451804_0537731 3300041463 Bacteria 577
1074 Ga0451808_04048 3300041464 Bacteria 582
1075 Ga0451807_0716238 3300041486 Bacteria 869
1076 Ga0451807_2059496 3300041486 Bacteria 1623
1077 Ga0451807_2675568 3300041486 Bacteria 1064
1078 Ga0451833_1205465 3300041491 Bacteria 1011
1079 Ga0451836_08780 3300041493 Bacteria 530
1080 Ga0451837_0040229 3300041494 Bacteria 2161
1081 Ga0451837_0608429 3300041494 Bacteria 878
1082 Ga0451837_0813853 3300041494 Bacteria 787
1083 Ga0451837_1109650 3300041494 Bacteria 1096
1084 Ga0451840_01673 3300041497 Bacteria 564
1085 Ga0451841_1223165 3300041498 Bacteria 693
1086 Ga0451846_27502 3300041502 Bacteria 559
1087 Ga0451847_0250895 3300041503 Bacteria 817
1088 Ga0451847_0611722 3300041503 Bacteria 518
1089 Ga0451850_54086 3300041506 Bacteria 701
1090 Ga0451851_0814099 3300041507 Bacteria 857
1091 Ga0451851_0960257 3300041507 Bacteria 518
1092 Ga0451852_06555 3300041508 Bacteria 702
1093 Ga0451852_36362 3300041508 Bacteria 939
1094 Ga0451852_44034 3300041508 Bacteria 2681
1095 Ga0451843_0050032 3300041509 Bacteria 768
1096 Ga0451843_0575012 3300041509 Bacteria 748
1097 Ga0451843_1460174 3300041509 Bacteria 537
1098 Ga0451854_21462 3300041510 Bacteria 1378
1099 Ga0451855_0044321 3300041511 Bacteria 1755
1100 Ga0451855_0129181 3300041511 Bacteria 4451
1101 Ga0451855_0274826 3300041511 Bacteria 601
1102 Ga0451855_0368377 3300041511 Bacteria 993
1103 Ga0451855_0517858 3300041511 Bacteria 1525
1104 Ga0451855_0696871 3300041511 Bacteria 675
1105 Ga0451855_0991025 3300041511 Bacteria 530
1106 Ga0451855_1020551 3300041511 Bacteria 662
1107 Ga0452268_13769 3300041907 Bacteria 554
1108 Ga0452268_16729 3300041907 Bacteria 864
1109 Ga0452268_21896 3300041907 Bacteria 511
1110 Ga0452268_35472 3300041907 Bacteria 900
1111 Ga0452269_1053 3300041908 Bacteria 553
1112 Ga0452271_05642 3300041916 Bacteria 561
1113 Ga0452271_28809 3300041916 Bacteria 679
1114 Ga0439433_0021808 3300041999 Bacteria 1434
1115 Ga0439445_0000513 3300042004 Bacteria 7833
1116 Ga0439445_0100589 3300042004 Bacteria 820
1117 Ga0439448_0007567 3300042005 Bacteria 3153
1118 Ga0439448_0029702 3300042005 Bacteria 1731
1119 Ga0439450_019604 3300042008 Bacteria 1435
1120 Ga0439455_0009871 3300042012 Bacteria 2084
1121 Ga0439455_0056405 3300042012 Bacteria 1035
1122 Ga0439457_009023 3300042014 Bacteria 2332
1123 Ga0439462_0082276 3300042015 Bacteria 880
1124 Ga0450890_012146 3300042127 Bacteria 1116
1125 Ga0439446_0026548 3300042156 Bacteria 1660
1126 Ga0439460_0249123 3300042461 Bacteria 614
1127 Ga0450893_0004983 3300042532 Bacteria 2121
1128 Ga0451577_0000854 3300042876 Bacteria 45411
1129 Ga0451577_0001297 3300042876 Bacteria 34391
1130 Ga0451577_0003726 3300042876 Bacteria 16640
1131 Ga0451577_0011827 3300042876 Bacteria 8233
1132 Ga0451577_0022661 3300042876 Bacteria 5734
1133 Ga0451577_0025338 3300042876 Bacteria 5383
1134 Ga0451577_0031270 3300042876 Bacteria 4804
1135 Ga0451577_0057422 3300042876 Bacteria 3470
1136 Ga0451577_0075809 3300042876 Bacteria 2999
1137 Ga0451577_0079353 3300042876 Bacteria 2926
1138 Ga0451577_0182065 3300042876 Bacteria 1894
1139 Ga0451577_0246633 3300042876 Bacteria 1616
1140 Ga0451577_0264702 3300042876 Bacteria 1557
1141 Ga0451577_0273441 3300042876 Bacteria 1530
1142 Ga0451577_0274429 3300042876 Unclassified 1527
1143 Ga0451577_0435209 3300042876 Bacteria 1191
1144 Ga0451577_0485948 3300042876 Bacteria 1121
1145 Ga0451577_0580449 3300042876 Bacteria 1018
1146 Ga0451577_1266591 3300042876 Bacteria 656
1147 Ga0451577_1678341 3300042876 Bacteria 559
1148 Ga0453683_0014479 3300044673 Bacteria 5118
1149 Ga0453683_0032774 3300044673 Bacteria 3276
1150 Ga0453683_0033895 3300044673 Bacteria 3220
1151 Ga0453683_0038384 3300044673 Bacteria 3010
1152 Ga0453683_0042488 3300044673 Bacteria 2854
1153 Ga0453683_0056977 3300044673 Bacteria 2445
1154 Ga0453683_0089489 3300044673 Bacteria 1929
1155 Ga0453683_0206789 3300044673 Bacteria 1246
1156 Ga0453683_0222554 3300044673 Bacteria 1200
1157 Ga0453683_0499328 3300044673 Bacteria 789
1158 Ga0453683_0624968 3300044673 Bacteria 703
1159 Ga0453683_0821136 3300044673 Bacteria 613
1160 Ga0466964_0042874 3300044706 Bacteria 1834
1161 Ga0453684_0000011 3300044712 Bacteria 1108399
1162 Ga0453684_0000194 3300044712 Bacteria 265783
1163 Ga0453684_0000197 3300044712 Bacteria 264445
1164 Ga0453684_0000779 3300044712 Bacteria 109902
1165 Ga0453684_0001358 3300044712 Bacteria 71434
1166 Ga0453684_0001456 3300044712 Bacteria 67220
1167 Ga0453684_0001891 3300044712 Bacteria 54349
1168 Ga0453684_0002943 3300044712 Bacteria 39941
1169 Ga0453684_0004073 3300044712 Bacteria 31745
1170 Ga0453684_0006165 3300044712 Bacteria 23060
1171 Ga0453684_0009847 3300044712 Bacteria 16550
1172 Ga0453684_0024439 3300044712 Bacteria 8830
1173 Ga0453684_0037423 3300044712 Bacteria 6661
1174 Ga0453684_0046511 3300044712 Bacteria 5770
1175 Ga0453684_0057481 3300044712 Bacteria 5034
1176 Ga0453684_0058092 3300044712 Bacteria 5000
1177 Ga0453684_0060601 3300044712 Bacteria 4864
1178 Ga0453684_0064802 3300044712 Bacteria 4664
1179 Ga0453684_0127015 3300044712 Bacteria 3067
1180 Ga0453684_0140381 3300044712 Bacteria 2886
1181 Ga0453684_0180136 3300044712 Bacteria 2481
1182 Ga0453684_0253166 3300044712 Bacteria 2021
1183 Ga0453684_0308865 3300044712 Bacteria 1795
1184 Ga0453684_0375729 3300044712 Bacteria 1597
1185 Ga0453684_0425574 3300044712 Bacteria 1482
1186 Ga0453684_0467645 3300044712 Bacteria 1401
1187 Ga0453684_0614489 3300044712 Bacteria 1190
1188 Ga0453684_0817984 3300044712 Bacteria 1003
1189 Ga0453684_0919404 3300044712 Bacteria 936
1190 Ga0453684_1055676 3300044712 Unclassified 861
1191 Ga0453684_1456891 3300044712 Bacteria 708
1192 Ga0453684_1461441 3300044712 Bacteria 707
1193 Ga0453684_1778979 3300044712 Unclassified 627
1194 Ga0453684_1998358 3300044712 Bacteria 584
1195 Ga0466959_0260439 3300045049 Bacteria 1194
1196 Ga0451576_0000003 3300045051 Bacteria 1550573
1197 Ga0451576_0004347 3300045051 Bacteria 18488
1198 Ga0451576_0006577 3300045051 Bacteria 14217
1199 Ga0451576_0007377 3300045051 Bacteria 13170
1200 Ga0451576_0010553 3300045051 Bacteria 10581
1201 Ga0451576_0013829 3300045051 Bacteria 9016
1202 Ga0451576_0022593 3300045051 Bacteria 6819
1203 Ga0451576_0044632 3300045051 Bacteria 4672
1204 Ga0451576_0062300 3300045051 Bacteria 3888
1205 Ga0451576_0100168 3300045051 Bacteria 3013
1206 Ga0451576_0161739 3300045051 Bacteria 2337
1207 Ga0451576_0189408 3300045051 Bacteria 2148
1208 Ga0451576_0225019 3300045051 Bacteria 1959
1209 Ga0451576_0226040 3300045051 Bacteria 1954
1210 Ga0451576_1001280 3300045051 Bacteria 876
1211 Ga0451576_1153877 3300045051 Bacteria 810
1212 Ga0451576_1732574 3300045051 Bacteria 647
1213 Ga0451576_1827137 3300045051 Bacteria 628
1214 Ga0451576_1846626 3300045051 Bacteria 624
1215 Ga0451576_1976816 3300045051 Bacteria 601
1216 Ga0451576_2139450 3300045051 Bacteria 575
1217 Ga0466967_0039117 3300045976 Bacteria 4074
1218 Ga0466967_0084399 3300045976 Bacteria 2874
1219 Ga0495627_000067 3300046453 Bacteria 130165
1220 Ga0495627_002663 3300046453 Bacteria 8378
1221 Ga0495590_0042540 3300046457 Bacteria 1584
1222 Ga0495629_0121662 3300046459 Bacteria 1818
1223 Ga0495629_0126330 3300046459 Bacteria 1781
1224 Ga0495638_0098466 3300046460 Bacteria 1752
1225 Ga0495638_0122692 3300046460 Bacteria 1534
1226 Ga0495638_0136173 3300046460 Bacteria 1438
1227 Ga0495638_0231104 3300046460 Bacteria 1029
1228 Ga0495641_0314106 3300046461 Bacteria 707
1229 Ga0495651_0032684 3300046462 Bacteria 4057
1230 Ga0495651_0230749 3300046462 Bacteria 1275
1231 Ga0495650_0000594 3300046471 Bacteria 49931
1232 Ga0495580_0118598 3300046472 Bacteria 1837
1233 Ga0495605_0239097 3300046474 Bacteria 780
1234 Ga0495664_0000007 3300046477 Bacteria 386710
1235 Ga0495585_0003458 3300046492 Bacteria 10667
1236 Ga0495585_0004171 3300046492 Bacteria 9440
1237 Ga0495585_0258813 3300046492 Bacteria 866
1238 Ga0495596_0022478 3300046500 Bacteria 2567
1239 Ga0495607_0034827 3300046501 Bacteria 3052
1240 Ga0495607_0100116 3300046501 Bacteria 1554
1241 Ga0495607_0254487 3300046501 Bacteria 844
1242 Ga0495607_0328816 3300046501 Bacteria 711
1243 Ga0495607_0360535 3300046501 Bacteria 669
1244 Ga0495583_0028887 3300046506 Bacteria 2720
1245 Ga0495606_0027164 3300046507 Bacteria 4064
1246 Ga0495606_0030744 3300046507 Bacteria 3745
1247 Ga0495606_0037734 3300046507 Bacteria 3278
1248 Ga0495606_0057780 3300046507 Bacteria 2497
1249 Ga0495606_0085902 3300046507 Bacteria 1945
1250 Ga0495606_0089225 3300046507 Bacteria 1900
1251 Ga0495606_0477622 3300046507 Bacteria 633
1252 Ga0495608_0174230 3300046511 Bacteria 1363
1253 Ga0495608_0570398 3300046511 Bacteria 681
1254 Ga0495610_0000006 3300046512 Bacteria 856822
1255 Ga0495610_0001861 3300046512 Bacteria 18285
1256 Ga0495610_0007560 3300046512 Bacteria 7198
1257 Ga0495610_0052876 3300046512 Bacteria 1970
1258 Ga0495610_0224928 3300046512 Bacteria 756
1259 Ga0495616_0006133 3300046513 Bacteria 7319
1260 Ga0495616_0010134 3300046513 Bacteria 5469
1261 Ga0495616_0010222 3300046513 Bacteria 5443
1262 Ga0495618_0126846 3300046514 Bacteria 1634
1263 Ga0495628_0282519 3300046516 Bacteria 1232
1264 Ga0495631_0025389 3300046518 Bacteria 2728
1265 Ga0495631_0122889 3300046518 Bacteria 1116
1266 Ga0495632_0009820 3300046519 Bacteria 5727
1267 Ga0495632_0158702 3300046519 Bacteria 1043
1268 Ga0495637_0021088 3300046520 Bacteria 2990
1269 Ga0495637_0099456 3300046520 Bacteria 1138
1270 Ga0495643_0000948 3300046522 Bacteria 30016
1271 Ga0495643_0007748 3300046522 Bacteria 6876
1272 Ga0495643_0266685 3300046522 Bacteria 793
1273 Ga0495643_0318438 3300046522 Bacteria 704
1274 Ga0495648_0004657 3300046524 Bacteria 11632
1275 Ga0495663_0000043 3300046525 Bacteria 63128
1276 Ga0495663_0010896 3300046525 Bacteria 2529
1277 Ga0495663_0026521 3300046525 Bacteria 1697
1278 Ga0495652_0185809 3300046529 Bacteria 1590
1279 Ga0495654_0000017 3300046530 Bacteria 295999
1280 Ga0495654_0011017 3300046530 Bacteria 4910
1281 Ga0495654_0071533 3300046530 Bacteria 1643
1282 Ga0495609_0000780 3300046538 Bacteria 23818
1283 Ga0495609_0005251 3300046538 Bacteria 6875
1284 Ga0495621_0111333 3300046539 Bacteria 1050
1285 Ga0495645_0326213 3300046543 Bacteria 995
1286 Ga0495622_0026339 3300046557 Bacteria 2716
1287 Ga0495633_0000021 3300046558 Bacteria 227171
1288 Ga0495633_0000680 3300046558 Bacteria 31336
1289 Ga0495633_0096896 3300046558 Bacteria 1370
1290 Ga0495668_0000673 3300046616 Bacteria 41193
1291 Ga0495668_0110755 3300046616 Bacteria 1502
1292 Ga0495625_0000021 3300046660 Bacteria 282133
1293 Ga0495625_0004265 3300046660 Bacteria 13612
1294 Ga0495625_0033407 3300046660 Bacteria 3805
1295 Ga0495625_0047911 3300046660 Bacteria 3080
1296 Ga0495625_0110420 3300046660 Bacteria 1880
1297 Ga0495625_0159974 3300046660 Bacteria 1509
1298 Ga0495625_0287222 3300046660 Bacteria 1056
1299 Ga0495661_0000739 3300046665 Bacteria 31861
1300 Ga0495661_0008232 3300046665 Bacteria 7223
1301 Ga0495588_0182890 3300046674 Bacteria 1108
1302 Ga0495657_0455975 3300046675 Bacteria 748
1303 Ga0495658_0141088 3300046683 Bacteria 1473
1304 Ga0495670_0119049 3300046691 Bacteria 1371
1305 Ga0495671_0072492 3300046692 Bacteria 1691
1306 Ga0495671_0136005 3300046692 Bacteria 1198
1307 Ga0495649_0000009 3300046694 Bacteria 451725
1308 Ga0495649_0023066 3300046694 Bacteria 3477
1309 Ga0495660_0005455 3300046810 Bacteria 7616
1310 Ga0495660_0050714 3300046810 Bacteria 2260
1311 Ga0495660_0079118 3300046810 Bacteria 1727
1312 Ga0495581_0660112 3300047315 Bacteria 604
1313 Ga0495680_0539006 3300047322 Bacteria 788
1314 Ga0495683_0291568 3300047323 Bacteria 703
1315 Ga0495687_001340 3300047443 Bacteria 22938
1316 Ga0495687_020359 3300047443 Bacteria 3233
1317 Ga0495673_0016437 3300047469 Bacteria 3783
1318 Ga0495681_0230989 3300047470 Bacteria 738
1319 Ga0495686_0021467 3300047472 Bacteria 4287
1320 Ga0495686_0060699 3300047472 Bacteria 2350
1321 Ga0495686_0129726 3300047472 Bacteria 1496
1322 Ga0495686_0131215 3300047472 Bacteria 1485
1323 Ga0495686_0384665 3300047472 Bacteria 756
1324 Ga0495615_0042524 3300048090 Bacteria 1140
1325 Ga0496102_0238774 3300048905 Bacteria 1714
1326 Ga0496105_0435175 3300048908 Bacteria 1037
1327 Ga0496108_0460348 3300048911 Bacteria 1111
1328 Ga0496110_0612555 3300048913 Bacteria 987
1329 Ga0496113_0085785 3300048916 Bacteria 2419
1330 Ga0496113_0695514 3300048916 Bacteria 812
1331 Ga0496114_0599002 3300048917 Bacteria 972
1332 Ga0496115_0002997 3300048918 Bacteria 12131
1333 Ga0496116_0000156 3300048919 Bacteria 140734
1334 Ga0496116_0000199 3300048919 Bacteria 116470
1335 Ga0496116_0005208 3300048919 Bacteria 12179
1336 Ga0496117_0000076 3300048920 Bacteria 232366
1337 Ga0496117_0015077 3300048920 Bacteria 6618
1338 Ga0496118_0001659 3300048921 Bacteria 32694
1339 Ga0496118_0070500 3300048921 Bacteria 2523
1340 Ga0496119_0000021 3300048922 Bacteria 277056
1341 Ga0496121_0000030 3300048924 Bacteria 412079
1342 Ga0496121_0075674 3300048924 Bacteria 2688
1343 Ga0496121_0394902 3300048924 Bacteria 908
1344 Ga0496122_0000625 3300048925 Bacteria 72309
1345 Ga0496122_0011897 3300048925 Bacteria 8742
1346 Ga0496122_0013994 3300048925 Bacteria 7794
1347 Ga0496122_0026712 3300048925 Bacteria 4965
1348 Ga0496122_0032264 3300048925 Bacteria 4335
1349 Ga0496122_0244208 3300048925 Bacteria 1009
1350 Ga0496123_0003734 3300048926 Bacteria 16722
1351 Ga0496123_0015161 3300048926 Bacteria 6341
1352 Ga0496123_0015827 3300048926 Bacteria 6161
1353 Ga0496123_0064856 3300048926 Bacteria 2325
1354 Ga0496124_0002475 3300048927 Bacteria 24121
1355 Ga0496124_0040283 3300048927 Bacteria 4043
1356 Ga0496125_0000062 3300048928 Bacteria 259277
1357 Ga0496125_0000452 3300048928 Bacteria 74236
1358 Ga0496125_0045300 3300048928 Bacteria 3704
1359 Ga0496125_0065617 3300048928 Bacteria 2874
1360 Ga0496125_0100691 3300048928 Bacteria 2129
1361 Ga0496125_0156945 3300048928 Bacteria 1553
1362 Ga0496125_0443612 3300048928 Bacteria 746
1363 Ga0496126_0001324 3300048929 Bacteria 39392
1364 Ga0496126_0026501 3300048929 Bacteria 5557
1365 Ga0496126_0031118 3300048929 Bacteria 5047
1366 Ga0496126_0390404 3300048929 Bacteria 1131
1367 Ga0501306_000090 3300049127 Bacteria 4994
1368 Ga0501306_003219 3300049127 Bacteria 1743
1369 Ga0501306_003286 3300049127 Bacteria 1731
1370 Ga0501306_007803 3300049127 Bacteria 1290
1371 Ga0501306_036287 3300049127 Bacteria 751
1372 Ga0501306_037179 3300049127 Bacteria 744
1373 Ga0501306_056119 3300049127 Bacteria 641
1374 Ga0501308_001515 3300049128 Bacteria 1877
1375 Ga0501308_004388 3300049128 Bacteria 1358
1376 Ga0501308_008086 3300049128 Bacteria 1117
1377 Ga0501308_046871 3300049128 Bacteria 623
1378 Ga0501309_001209 3300049129 Bacteria 2455
1379 Ga0501309_006960 3300049129 Bacteria 1391
1380 Ga0501309_076406 3300049129 Bacteria 557
1381 Ga0501310_000037 3300049130 Bacteria 13386
1382 Ga0501310_000916 3300049130 Bacteria 2624
1383 Ga0501310_007733 3300049130 Bacteria 1153
1384 Ga0501310_012147 3300049130 Bacteria 984
1385 Ga0501310_017354 3300049130 Bacteria 870
1386 Ga0501341_00790 3300049131 Bacteria 1438
1387 Ga0501341_01701 3300049131 Bacteria 1128
1388 Ga0501341_04030 3300049131 Bacteria 847
1389 Ga0501341_09538 3300049131 Bacteria 630
1390 Ga0501343_002150 3300049132 Bacteria 1393
1391 Ga0501343_005438 3300049132 Bacteria 977
1392 Ga0501343_014719 3300049132 Bacteria 662
1393 Ga0501343_020106 3300049132 Bacteria 587
1394 Ga0501344_04193 3300049133 Bacteria 786
1395 Ga0501345_01540 3300049134 Bacteria 892
1396 Ga0501304_007086 3300049160 Bacteria 918
1397 Ga0501304_007801 3300049160 Bacteria 891
1398 Ga0501304_008375 3300049160 Bacteria 870
1399 Ga0501304_018661 3300049160 Bacteria 672
1400 Ga0501304_026738 3300049160 Bacteria 596
1401 Ga0501305_000794 3300049161 Bacteria 2794
1402 Ga0501305_001549 3300049161 Bacteria 2277
1403 Ga0501305_001909 3300049161 Bacteria 2150
1404 Ga0501305_002800 3300049161 Bacteria 1920
1405 Ga0501305_033759 3300049161 Bacteria 809
1406 Ga0501305_035163 3300049161 Bacteria 797
1407 Ga0501305_048762 3300049161 Bacteria 706
1408 Ga0501305_052529 3300049161 Bacteria 687
1409 Ga0501305_066695 3300049161 Bacteria 627
1410 Ga0501307_000560 3300049162 Bacteria 2636
1411 Ga0501307_000602 3300049162 Bacteria 2573
1412 Ga0501307_008962 3300049162 Bacteria 1135
1413 Ga0501307_013824 3300049162 Bacteria 979
1414 Ga0501307_027966 3300049162 Bacteria 769
1415 Ga0501307_029260 3300049162 Bacteria 757
1416 Ga0501307_057024 3300049162 Bacteria 599
1417 Ga0501307_061293 3300049162 Bacteria 584
1418 Ga0501342_01634 3300049163 Bacteria 724
1419 Ga0501342_03433 3300049163 Bacteria 560
1420 Ga0501342_03506 3300049163 Bacteria 556
1421 Ga0495678_033405 3300049459 Bacteria 2124
1422 Ga0495682_0041703 3300049460 Bacteria 1682
1423 Ga0501311_009489 3300049527 Bacteria 1163
1424 Ga0501311_012558 3300049527 Bacteria 1058
1425 Ga0501311_013964 3300049527 Bacteria 1020
1426 Ga0501311_015846 3300049527 Bacteria 977
1427 Ga0501311_050040 3300049527 Bacteria 653
1428 Ga0501312_000226 3300049528 Bacteria 4004
1429 Ga0501312_000486 3300049528 Bacteria 3226
1430 Ga0501312_007844 3300049528 Bacteria 1371
1431 Ga0501312_013626 3300049528 Bacteria 1133
1432 Ga0501312_025871 3300049528 Bacteria 897
1433 Ga0501312_041004 3300049528 Bacteria 757
1434 Ga0501312_048843 3300049528 Bacteria 709
1435 Ga0501312_055713 3300049528 Bacteria 676
1436 Ga0501312_060610 3300049528 Bacteria 655
1437 Ga0501313_000829 3300049529 Bacteria 2374
1438 Ga0501313_001041 3300049529 Bacteria 2239
1439 Ga0501313_023195 3300049529 Bacteria 777
1440 Ga0501313_029125 3300049529 Bacteria 710
1441 Ga0501313_035218 3300049529 Bacteria 660
1442 Ga0501313_042735 3300049529 Bacteria 613
1443 Ga0501314_000485 3300049530 Bacteria 2490
1444 Ga0501314_001176 3300049530 Bacteria 1845
1445 Ga0501314_003861 3300049530 Bacteria 1223
1446 Ga0501314_005415 3300049530 Bacteria 1086
1447 Ga0501314_012624 3300049530 Bacteria 812
1448 Ga0501314_023345 3300049530 Bacteria 655
1449 Ga0501314_039590 3300049530 Bacteria 546
1450 Ga0501315_000064 3300049531 Bacteria 4778
1451 Ga0501315_000629 3300049531 Bacteria 2561
1452 Ga0501315_001579 3300049531 Bacteria 1985
1453 Ga0501315_011574 3300049531 Bacteria 1079
1454 Ga0501315_047206 3300049531 Bacteria 668
1455 Ga0501315_080912 3300049531 Bacteria 552
1456 Ga0501315_093331 3300049531 Bacteria 524
1457 Ga0501316_000650 3300049532 Bacteria 2551
1458 Ga0501316_004246 3300049532 Bacteria 1430
1459 Ga0501316_024839 3300049532 Bacteria 776
1460 Ga0501316_036380 3300049532 Bacteria 674
1461 Ga0501316_057394 3300049532 Bacteria 570
1462 Ga0501317_001389 3300049533 Bacteria 2081
1463 Ga0501317_020207 3300049533 Bacteria 896
1464 Ga0501317_030347 3300049533 Bacteria 781
1465 Ga0501317_034208 3300049533 Bacteria 751
1466 Ga0501317_062792 3300049533 Bacteria 613
1467 Ga0501317_109971 3300049533 Bacteria 505
1468 Ga0501318_013246 3300049534 Bacteria 956
1469 Ga0501318_018041 3300049534 Bacteria 868
1470 Ga0501318_033966 3300049534 Bacteria 705
1471 Ga0501319_000006 3300049535 Bacteria 8644
1472 Ga0501319_000068 3300049535 Bacteria 3484
1473 Ga0501319_000383 3300049535 Bacteria 2045
1474 Ga0501319_000428 3300049535 Bacteria 1988
1475 Ga0501319_007320 3300049535 Bacteria 832
1476 Ga0501319_008963 3300049535 Bacteria 778
1477 Ga0501319_010268 3300049535 Bacteria 744
1478 Ga0501319_012847 3300049535 Bacteria 690
1479 Ga0501319_017561 3300049535 Bacteria 622
1480 Ga0501320_000264 3300049536 Bacteria 2816
1481 Ga0501320_000540 3300049536 Bacteria 2271
1482 Ga0501320_003081 3300049536 Bacteria 1387
1483 Ga0501320_004332 3300049536 Bacteria 1248
1484 Ga0501320_015745 3300049536 Bacteria 830
1485 Ga0501320_023241 3300049536 Bacteria 732
1486 Ga0501320_023596 3300049536 Bacteria 728
1487 Ga0501320_027211 3300049536 Bacteria 694
1488 Ga0501321_013675 3300049537 Bacteria 935
1489 Ga0501321_018418 3300049537 Bacteria 848
1490 Ga0501321_021060 3300049537 Bacteria 811
1491 Ga0501321_027635 3300049537 Bacteria 742
1492 Ga0501321_031517 3300049537 Bacteria 711
1493 Ga0501321_033178 3300049537 Bacteria 699
1494 Ga0501321_089192 3300049537 Bacteria 501
1495 Ga0501323_000717 3300049539 Bacteria 2607
1496 Ga0501323_001002 3300049539 Bacteria 2347
1497 Ga0501323_001783 3300049539 Bacteria 1983
1498 Ga0501323_002460 3300049539 Bacteria 1796
1499 Ga0501323_005626 3300049539 Bacteria 1378
1500 Ga0501323_011315 3300049539 Bacteria 1075
1501 Ga0501323_015120 3300049539 Bacteria 971
1502 Ga0501323_022411 3300049539 Bacteria 841
1503 Ga0501323_027020 3300049539 Bacteria 788
1504 Ga0501323_060436 3300049539 Bacteria 591
1505 Ga0501324_002531 3300049540 Bacteria 1330
1506 Ga0501324_003092 3300049540 Bacteria 1254
1507 Ga0501324_022717 3300049540 Bacteria 650
1508 Ga0501324_026087 3300049540 Bacteria 619
1509 Ga0501324_047264 3300049540 Bacteria 503
1510 Ga0501325_011584 3300049541 Bacteria 818
1511 Ga0501325_019734 3300049541 Bacteria 701
1512 Ga0501325_034807 3300049541 Bacteria 592
1513 Ga0501325_043087 3300049541 Bacteria 555
1514 Ga0501326_09759 3300049542 Bacteria 570
1515 Ga0501326_11467 3300049542 Bacteria 540
1516 Ga0501327_09345 3300049543 Bacteria 634
1517 Ga0501328_03265 3300049544 Bacteria 746
1518 Ga0501328_03694 3300049544 Bacteria 719
1519 Ga0501328_07964 3300049544 Bacteria 570
1520 Ga0501329_00132 3300049545 Bacteria 1975
1521 Ga0501329_03571 3300049545 Bacteria 796
1522 Ga0501329_04205 3300049545 Bacteria 762
1523 Ga0501330_004977 3300049546 Bacteria 836
1524 Ga0501330_008315 3300049546 Bacteria 710
1525 Ga0501331_01194 3300049547 Bacteria 1228
1526 Ga0501331_02908 3300049547 Bacteria 904
1527 Ga0501331_05306 3300049547 Bacteria 733
1528 Ga0501332_05328 3300049548 Bacteria 786
1529 Ga0501334_00025 3300049550 Bacteria 4715
1530 Ga0501334_00211 3300049550 Bacteria 2345
1531 Ga0501334_02889 3300049550 Bacteria 1042
1532 Ga0501334_05362 3300049550 Bacteria 845
1533 Ga0501335_000748 3300049551 Bacteria 2239
1534 Ga0501335_000798 3300049551 Bacteria 2199
1535 Ga0501335_005233 3300049551 Bacteria 1154
1536 Ga0501335_010801 3300049551 Bacteria 886
1537 Ga0501335_011976 3300049551 Bacteria 852
1538 Ga0501335_014245 3300049551 Bacteria 801
1539 Ga0501336_000444 3300049552 Bacteria 2044
1540 Ga0501336_001556 3300049552 Bacteria 1384
1541 Ga0501337_004420 3300049553 Bacteria 919
1542 Ga0501337_015152 3300049553 Bacteria 594
1543 Ga0501340_002106 3300049556 Bacteria 1132
1544 Ga0501340_003356 3300049556 Bacteria 967
1545 Ga0501032_0000353 3300049569 Bacteria 38266
1546 Ga0501034_0000001 3300049571 Bacteria 2184493
1547 Ga0501034_0112090 3300049571 Bacteria 2718
1548 Ga0501036_0141855 3300049572 Bacteria 2027
1549 Ga0501039_0000169 3300049575 Bacteria 45709
1550 Ga0501047_0150432 3300049581 Bacteria 2204
1551 Ga0501223_002278 3300049663 Bacteria 4288
1552 Ga0501238_015660 3300049671 Bacteria 1047
1553 Ga0501238_030760 3300049671 Bacteria 776
1554 Ga0501240_000074 3300049673 Bacteria 6037
1555 Ga0501243_052474 3300049675 Bacteria 739
1556 Ga0501243_057375 3300049675 Bacteria 715
1557 Ga0501243_095078 3300049675 Bacteria 595
1558 Ga0501249_000797 3300049679 Bacteria 7031
1559 Ga0501249_005929 3300049679 Bacteria 2505
1560 Ga0501249_086232 3300049679 Bacteria 741
1561 Ga0501251_001354 3300049681 Bacteria 2281
1562 Ga0501252_057595 3300049682 Bacteria 600
1563 Ga0501257_204875 3300049686 Bacteria 569
1564 Ga0501260_004986 3300049689 Bacteria 1238
1565 Ga0501219_025063 3300049703 Bacteria 538
1566 Ga0501225_0026515 3300049705 Bacteria 1593
1567 Ga0501241_000017 3300049758 Bacteria 96324
1568 Ga0501241_001570 3300049758 Bacteria 4587
1569 Ga0501241_007664 3300049758 Bacteria 1978
1570 Ga0501266_000009 3300049763 Bacteria 233584
1571 Ga0501269_001154 3300049766 Bacteria 3643
1572 Ga0501280_034090 3300049776 Bacteria 804
1573 Ga0501035_0114203 3300049822 Bacteria 2365
1574 Ga0501035_0668587 3300049822 Bacteria 840
1575 Ga0501035_1405445 3300049822 Bacteria 535
1576 nmdc:mga0k408_173043_c1 3300050493 Bacteria 1287
1577 nmdc:mga0k408_234301_c1 3300050493 Bacteria 1096
1578 nmdc:mga0k408_350_c1 3300050493 Bacteria 25267
1579 nmdc:mga0k408_38765_c1 3300050493 Bacteria 2736
1580 nmdc:mga0k408_4120_c1 3300050493 Bacteria 7721
1581 nmdc:mga07m45_164171_c1 3300050496 Bacteria 1290
1582 nmdc:mga07m45_248103_c1 3300050496 Bacteria 1036
1583 nmdc:mga07m45_361836_c1 3300050496 Bacteria 843
1584 nmdc:mga07m45_446713_c1 3300050496 Bacteria 750
1585 nmdc:mga07m45_97058_c1 3300050496 Bacteria 1691
1586 nmdc:mga05p37_19612_c1 3300050507 Bacteria 8178
1587 nmdc:mga05p37_3446_c1 3300050507 Bacteria 18465
1588 nmdc:mga05p37_377892_c1 3300050507 Bacteria 1661
1589 nmdc:mga05p37_38531_c1 3300050507 Bacteria 5863
1590 nmdc:mga05p37_82274_c1 3300050507 Bacteria 3967
1591 nmdc:mga09592_102110_c1 3300050508 Bacteria 2457
1592 nmdc:mga09592_15413_c1 3300050508 Bacteria 6245
1593 nmdc:mga09592_5366_c1 3300050508 Bacteria 10420
1594 nmdc:mga09592_986624_c1 3300050508 Bacteria 705
1595 nmdc:mga0qj67_24513_c1 3300050509 Bacteria 4651
1596 nmdc:mga0qj67_56075_c1 3300050509 Bacteria 3123
1597 nmdc:mga0qj67_591893_c1 3300050509 Bacteria 888
1598 nmdc:mga0qj67_88044_c1 3300050509 Bacteria 2493
1599 nmdc:mga06r32_235827_c1 3300050510 Bacteria 1817
1600 nmdc:mga06r32_29589_c1 3300050510 Bacteria 5135
1601 nmdc:mga06r32_600_c1 3300050510 Bacteria 18075
1602 nmdc:mga06r32_914153_c1 3300050510 Bacteria 833
1603 nmdc:mga08y16_145790_c1 3300050511 Bacteria 2461
1604 nmdc:mga08y16_300768_c1 3300050511 Bacteria 1654
1605 nmdc:mga08y16_330478_c1 3300050511 Bacteria 1568
1606 nmdc:mga08y16_793049_c1 3300050511 Bacteria 940
1607 nmdc:mga0n895_10875_c1 3300050512 Bacteria 8079
1608 nmdc:mga0n895_14066_c1 3300050512 Bacteria 7253
1609 nmdc:mga0rr50_59956_c1 3300050513 Bacteria 2860
1610 nmdc:mga0a205_128227_c1 3300050515 Bacteria 2437
1611 nmdc:mga0a205_36134_c1 3300050515 Bacteria 4746
1612 nmdc:mga0a205_58582_c1 3300050515 Bacteria 3720
1613 nmdc:mga0sz30_159519_c1 3300050516 Bacteria 999
1614 nmdc:mga0sz30_264560_c1 3300050516 Bacteria 766
1615 Ga0500635_0001097 3300053080 Bacteria 6481
1616 Ga0500635_0080487 3300053080 Bacteria 1170
1617 Ga0500578_0018628 3300053086 Bacteria 4460
1618 Ga0500578_0293623 3300053086 Bacteria 966
1619 Ga0500644_0096053 3300053088 Bacteria 1118
1620 Ga0500644_0501588 3300053088 Bacteria 534
1621 Ga0500646_0003988 3300053090 Bacteria 3755
1622 Ga0500646_0022173 3300053090 Bacteria 1697
1623 Ga0500651_0000124 3300053093 Bacteria 47212
1624 Ga0500641_0000029 3300053096 Bacteria 103994
1625 Ga0500641_0003322 3300053096 Bacteria 5693
1626 Ga0500641_0049673 3300053096 Bacteria 1721
1627 Ga0500650_0273731 3300053098 Bacteria 752
1628 Ga0500594_0020923 3300053118 Bacteria 1636
1629 Ga0500608_006222 3300053122 Bacteria 4839
1630 Ga0500608_018016 3300053122 Bacteria 3216
1631 Ga0500614_008477 3300053123 Bacteria 2180
1632 Ga0500618_000080 3300053125 Bacteria 78455
1633 Ga0500618_028226 3300053125 Bacteria 1330
1634 Ga0500652_086699 3300053131 Bacteria 1306
1635 Ga0500658_0000006 3300053134 Bacteria 290380
1636 Ga0500559_0018627 3300053136 Bacteria 2933
1637 Ga0500561_0045175 3300053137 Bacteria 1180
1638 Ga0500573_0033087 3300053140 Bacteria 2984
1639 Ga0500573_0257649 3300053140 Bacteria 895
1640 Ga0500616_0130805 3300053153 Bacteria 1186
1641 Ga0500622_0001219 3300053156 Bacteria 21136
1642 Ga0500622_0084917 3300053156 Bacteria 1580
1643 Ga0500622_0290167 3300053156 Bacteria 701
1644 Ga0500624_000925 3300053157 Bacteria 6183
1645 Ga0500584_010431 3300053726 Bacteria 4160
1646 Ga0587093_006264 3300059478 Bacteria 1290
1647 Ga0587093_014210 3300059478 Bacteria 990
1648 Ga0587093_015105 3300059478 Bacteria 971
1649 Ga0587066_037503 3300059490 Bacteria 897
1650 Ga0587066_047208 3300059490 Bacteria 834
1651 Ga0587066_167584 3300059490 Bacteria 557
1652 Ga0587070_064167 3300059491 Bacteria 767
1653 Ga0587073_0035653 3300059492 Bacteria 1056
1654 Ga0587073_0254163 3300059492 Bacteria 552
1655 Ga0587077_000327 3300059493 Bacteria 3754
1656 Ga0587077_005446 3300059493 Bacteria 1742
1657 Ga0587077_029444 3300059493 Bacteria 1035
1658 Ga0587077_067958 3300059493 Bacteria 789
1659 Ga0587077_147256 3300059493 Bacteria 612
1660 Ga0587080_025713 3300059503 Bacteria 996
1661 Ga0587080_034069 3300059503 Bacteria 901
1662 Ga0587080_069869 3300059503 Bacteria 701
1663 Ga0587080_117459 3300059503 Bacteria 586
1664 Ga0587083_0012424 3300059505 Bacteria 1429
1665 Ga0587083_0013735 3300059505 Bacteria 1383
1666 Ga0587083_0036396 3300059505 Bacteria 1008
1667 Ga0587085_004592 3300059506 Bacteria 1577
1668 Ga0587086_027045 3300059507 Bacteria 821
1669 Ga0587089_082686 3300059509 Bacteria 561
1670 Ga0587090_000102 3300059510 Bacteria 5197
1671 Ga0587090_018824 3300059510 Bacteria 1059
1672 Ga0587091_009311 3300059511 Bacteria 1476
1673 Ga0587091_025972 3300059511 Bacteria 1063
1674 Ga0587091_085083 3300059511 Bacteria 717
1675 Ga0587092_041284 3300059512 Bacteria 804
1676 Ga0587092_073173 3300059512 Bacteria 664
1677 Ga0587094_050899 3300059513 Bacteria 701
1678 Ga0587106_004580 3300059605 Bacteria 1529
1679 Ga0587125_001886 3300059607 Bacteria 1604
1680 Ga0587101_032508 3300059623 Bacteria 822
1681 Ga0587101_037944 3300059623 Bacteria 782
1682 Ga0587101_059563 3300059623 Bacteria 678
1683 Ga0587109_024961 3300059624 Bacteria 1095
1684 Ga0587117_000256 3300059627 Bacteria 3264
1685 Ga0587117_107560 3300059627 Bacteria 539
1686 Ga0587128_003957 3300059630 Bacteria 1688
1687 Ga0587062_001988 3300059639 Bacteria 1883
1688 Ga0587067_061713 3300059640 Bacteria 787
1689 Ga0587068_017603 3300059641 Bacteria 1143
1690 Ga0587068_029487 3300059641 Bacteria 944
1691 Ga0587068_066075 3300059641 Bacteria 705
1692 Ga0587069_041391 3300059642 Bacteria 787
1693 Ga0587076_000772 3300059645 Bacteria 2886
1694 Ga0587076_001127 3300059645 Bacteria 2613
1695 Ga0587076_020634 3300059645 Bacteria 1083
1696 Ga0587076_027105 3300059645 Bacteria 990
1697 Ga0587076_105265 3300059645 Bacteria 635
1698 Ga0587076_161974 3300059645 Bacteria 551
1699 Ga0587100_006833 3300059648 Bacteria 888
1700 Ga0587105_012794 3300059651 Bacteria 662
1701 Ga0587107_012382 3300059652 Bacteria 1062
1702 Ga0587107_013944 3300059652 Bacteria 1027
1703 Ga0587108_001109 3300059653 Bacteria 1582
1704 Ga0587124_001026 3300059660 Bacteria 1727
1705 Ga0587060_017818 3300060243 Bacteria 659
1706 Ga0587061_00281 3300060244 Bacteria 1648
1707 Ga0587081_01723 3300060246 Bacteria 1278
1708 2511234222 2511231000 Bacteria 4488346
1709 2513234198 2513020052 Bacteria 5120511
1710 2520881101 2519899754 Bacteria 5336938
1711 2522552600 2522125168 Bacteria 7376607
1712 2524005425 2523533629 Bacteria 2982326
1713 2585142333 2582581278 Bacteria 5296881
1714 2585159825 2582581281 Bacteria 4487904
1715 2585164021 2582581282 Bacteria 4495830
1716 2586210453 2585427687 Bacteria 5544917
1717 2587680916 2585428045 Bacteria 5203023
1718 2587747638 2585428060 Bacteria 5304711
1719 2587751529 2585428061 Bacteria 3939663
1720 2587867303 2585428095 Bacteria 3789702
1721 2587945030 2585428115 Bacteria 4420269
1722 2588210629 2585428182 Bacteria 5007281
1723 2588214126 2585428183 Bacteria 5166119
1724 2588221607 2585428184 Bacteria 4978681
1725 2588223430 2585428185 Bacteria 4969476
1726 2588232642 2585428187 Bacteria 4629388
1727 2588443666 2588253712 Bacteria 5403181
1728 2590601901 2588254255 Bacteria 5014294
1729 2590613363 2588254257 Bacteria 5436094
1730 2599479163 2599185184 Bacteria 6430550
1731 2644011031 2643221600 Bacteria 5530138
1732 2644373886 2643221667 Bacteria 5627472
1733 2644643521 2643221716 Bacteria 4986332
1734 2644683942 2643221725 Bacteria 5087956
1735 2722726630 2721755487 Bacteria 6357185
1736 2729200419 2728369107 Bacteria 5082720
1737 2738699648 2738541273 Bacteria 4048577
1738 2738736999 2738541279 Bacteria 6149495
1739 2738755464 2738541283 Bacteria 7222293
1740 2738763474 2738541284 Bacteria 5199923
1741 2738769539 2738541285 Bacteria 6150075
1742 2738851932 2738541302 Bacteria 5944758
1743 2739218581 2738543007 Bacteria 6149845
1744 2739253397 2738543014 Bacteria 4048139
1745 2739303599 2738543023 Bacteria 6767879
1746 2739590822 2739367651 Bacteria 6359826
1747 2739617017 2739367656 Bacteria 5152243
1748 2739647323 2739367663 Bacteria 5040914
1749 2739999427 2739367857 Bacteria 5433684
1750 2740004244 2739367858 Bacteria 5432813
1751 2740059400 2739367874 Bacteria 4872888
1752 2753673463 2751185877 Bacteria 4921427
1753 2765574568 2765235839 Bacteria 5314748
1754 2772604697 2772190705 Bacteria 4666226
1755 2775671675 2775506739 Bacteria 3855222
1756 2776615088 2775506987 Bacteria 5373360
1757 2802652169 2802428842 Bacteria 4926114
1758 2816874785 2816332188 Bacteria 5133218
1759 2817415027 2816332280 Bacteria 5109718
1760 2819546477 2818991437 Bacteria 5805520
1761 2819573418 2818991442 Bacteria 8318214
1762 2821136838 2821136567 Bacteria 8080116
1763 2833642870 2833640130 Bacteria 4858325
1764 2842085314 2842083920 Bacteria 4857652
1765 2842725173 2842722452 Bacteria 6263924
1766 2842912448 2842909656 Bacteria 6185908
1767 2849286038 2849281842 Bacteria 6065644
1768 2852629338 2852627209 Bacteria 5896285
1769 2857617507 2857613821 Bacteria 4917088
1770 2857621262 2857618242 Bacteria 5635925
1771 2857629754 2857627736 Bacteria 5625397
1772 2871722311 2871720351 Bacteria 4862476
1773 2881250019 2881247448 Bacteria 3717788
1774 2881359952 2881359912 Bacteria 4935907
1775 2889294872 2889290771 Bacteria 5530962
1776 2890738049 2890737413 Bacteria 4269751
1777 2896321221 2896317667 Bacteria 4606601
1778 2896345744 2896344016 Bacteria 3811746
1779 2898713532 2898713307 Bacteria 4110805
1780 2902052509 2902048731 Bacteria 4976191
1781 2903896138 2903895155 Bacteria 5258610
1782 2904421811 2904419702 Bacteria 5166287
1783 2904446637 2904445276 Bacteria 5310396
1784 2904468417 2904467357 Bacteria 8057758
1785 2904559878 2904555929 Bacteria 5218588
1786 2904785860 2904780799 Bacteria 5840761
1787 2906001493 2905999023 Bacteria 4591259
1788 2919099496 2919097161 Bacteria 3860339
1789 2919182478 2919177583 Bacteria 5641607
1790 2919190323 2919186247 Bacteria 6244071
1791 2919195749 2919191525 Bacteria 5765973
1792 2919402438 2919399522 Bacteria 5164947
1793 2919438212 2919437846 Bacteria 6199444
1794 2919510864 2919509842 Bacteria 4104664
1795 2919687966 2919683626 Bacteria 5534354
1796 2928082522 2928078545 Bacteria 6534839
1797 2928148890 2928147474 Bacteria 6512076
1798 2929152201 2929150217 Bacteria 5462483
1799 2932086312 2932082852 Bacteria 6563563
1800 2939668604 2939664404 Bacteria 6364494
1801 2945925749 2945924605 Bacteria 4296724
1802 2946002100 2945997725 Bacteria 6404843
1803 2946023016 2946019816 Bacteria 4621265
1804 2954018998 2954016120 Bacteria 6446024
1805 2958460101 2958458903 Bacteria 5301041
1806 2958514759 2958512119 Bacteria 4528530
1807 2965323019 2965320100 Bacteria 3975600
1808 2977233776 2977232053 Bacteria 5485925
1809 2977244650 2977243572 Bacteria 4374394
1810 2977268898 2977268062 Bacteria 5243061
1811 2984573517 2984572630 Bacteria 4186940
1812 2984606956 2984606641 Bacteria 4186971
1813 2993376059 2993372514 Bacteria 4214139
1814 2993482904 2993480792 Bacteria 4022225
1815 3003235167 3003233435 Bacteria 4458031
1816 8036739390 8036736890 Bacteria 2944828
1817 8054309581 8054307821 Bacteria 5212224
1818 8055419150 8055419101 Bacteria 5289643
1819 8055590023 8055588893 Bacteria 3619545
1820 8055592429 8055592153 Bacteria 5961247
1821 8056442548 8056440228 Bacteria 4946504
1822 Ga0070678_101940904
1823 MRS2a_Contig_9405
1824 SwRhRL2b_contig_2240772
1825 SwRhRL2b_contig_2684773
1826 SwRhRL2b_contig_534079
1827 SwRhRL2b_contig_908903
1828 JGI24741J21665_1000115
1829 JGI24741J21665_1061020
1830 JGI24740J21852_10015326
1831 JGI24740J21852_10053646
1832 JGI24739J22299_10047850
1833 JGI24739J22299_10166146
1834 JGI24737J22298_10000614
1835 JGI24737J22298_10001905
1836 JGI24737J22298_10003582
1837 JGI24737J22298_10148067
1838 JGI24743J22301_10020627
1839 JGI24735J21928_10000009
1840 JGI24735J21928_10021163
1841 JGI24735J21928_10042167
1842 JGI24744J21845_10008899
1843 JGI24034J26672_10101796
1844 JGI25162J39368_1000120
1845 JGI25162J39368_1001524
1846 JGI25157J39369_1002820
1847 JGI25157J39369_1004397
1848 JGI25157J39369_1031034
1849 JGI25164J39214_1000824
1850 JGI25150J39212_1000001
1851 Ga0006759J45824_1125488
1852 JGI25151J46595_10000001
1853 JGI25165J46597_1000923
1854 JGI25153J46596_10000001
1855 rootH2_10012942
1856 rootH2_10298437
1857 rootL2_10051773
1858 rootL2_10150346
1859 rootL2_10285627
1860 rootH1_10107846
1861 rootH1_10125727
1862 JGI26132J50249_101713
1863 Ga0007409J51694_1078244
1864 Ga0006562J51391_1002124
1865 Ga0055536_1013448
1866 Ga0055534_1012830
1867 Ga0055531_10002043
1868 Ga0058859_11302483
1869 Ga0058863_11953297
1870 Ga0058863_11963325
1871 Ga0058861_10088285
1872 Ga0058861_12069072
1873 Ga0058860_10018004
1874 Ga0058860_11803557
1875 Ga0058860_11880010
1876 Ga0058862_10247728
1877 Ga0058862_12706272
1878 Ga0058862_12779971
1879 Ga0065165_1002853
1880 Ga0065717_1002063
1881 Ga0065714_10005413
1882 Ga0065714_10007805
1883 Ga0065714_10011283
1884 Ga0065714_10020754
1885 Ga0065714_10083664
1886 Ga0065714_10089556
1887 Ga0065714_10089647
1888 Ga0065714_10118833
1889 Ga0065714_10216369
1890 Ga0065714_10217047
1891 Ga0065714_10288794
1892 Ga0065714_10382470
1893 Ga0065704_10000757
1894 Ga0065704_10013526
1895 Ga0065704_10072003
1896 Ga0065704_10085384
1897 Ga0065704_10093408
1898 Ga0065704_10231864
1899 Ga0065712_10224894
1900 Ga0065712_10768292
1901 Ga0065715_10015955
1902 Ga0065715_10109002
1903 Ga0065715_10118594
1904 Ga0065715_10142356
1905 Ga0065715_10938245
1906 Ga0065707_10108988
1907 Ga0070658_10000014
1908 Ga0070658_10474022
1909 Ga0070676_10000852
1910 Ga0070676_10004106
1911 Ga0070683_100003409
1912 Ga0070683_100091959
1913 Ga0070670_100128832
1914 Ga0070670_100472812
1915 Ga0068869_100006678
1916 Ga0070666_10176639
1917 Ga0070680_100002006
1918 Ga0070680_100062159
1919 Ga0070680_100302481
1920 Ga0070680_100681878
1921 Ga0070682_100000087
1922 Ga0070682_100171019
1923 Ga0070682_100173333
1924 Ga0070682_100322988
1925 Ga0070682_100676261
1926 Ga0068868_100866915
1927 Ga0070660_100028188
1928 Ga0070660_100082225
1929 Ga0070660_100100250
1930 Ga0070660_100197618
1931 Ga0070689_100055251
1932 Ga0070689_100074007
1933 Ga0070689_100451148
1934 Ga0070689_100581681
1935 Ga0070687_100309619
1936 Ga0070661_100060578
1937 Ga0070661_100073348
1938 Ga0070661_100590876
1939 Ga0070692_10028172
1940 Ga0070692_10145738
1941 Ga0070668_100017094
1942 Ga0070668_100204111
1943 Ga0070669_100005808
1944 Ga0070669_100051832
1945 Ga0070669_100093042
1946 Ga0070675_100029347
1947 Ga0070675_100053172
1948 Ga0070675_100171639
1949 Ga0070675_100967478
1950 Ga0070671_100003462
1951 Ga0070671_100005487
1952 Ga0070674_100086265
1953 Ga0070673_100015276
1954 Ga0070673_100049506
1955 Ga0070673_100068302
1956 Ga0070673_100070036
1957 Ga0070688_100019652
1958 Ga0070659_100000402
1959 Ga0070659_100016784
1960 Ga0070659_100023709
1961 Ga0070659_100061430
1962 Ga0070659_100898031
1963 Ga0070659_101468645
1964 Ga0070667_100024096
1965 Ga0070667_100302485
1966 Ga0070714_100173670
1967 Ga0070714_102037064
1968 Ga0070713_100273715
1969 Ga0070701_10031401
1970 Ga0070711_100021768
1971 Ga0070705_100095390
1972 Ga0070700_100009943
1973 Ga0070694_100103391
1974 Ga0070694_100238117
1975 Ga0070694_100957891
1976 Ga0070663_100035412
1977 Ga0070663_100311088
1978 Ga0070663_100637672
1979 Ga0070678_100001822
1980 Ga0070662_100014975
1981 Ga0070662_100059100
1982 Ga0070662_100323843
1983 Ga0070662_100328983
1984 Ga0070662_100472900
1985 Ga0070681_10003472
1986 Ga0070681_10008372
1987 Ga0070681_11508704
1988 Ga0068867_100001197
1989 Ga0068867_100225030
1990 Ga0070685_10023543
1991 Ga0070685_10054316
1992 Ga0070685_10102990
1993 Ga0070706_100032249
1994 Ga0070706_101901071
1995 Ga0070698_100011319
1996 Ga0070699_100060134
1997 Ga0070679_100014038
1998 Ga0070679_100017069
1999 Ga0070679_100087502
2000 Ga0070679_100122160
2001 Ga0070679_100358998
2002 Ga0070684_100054640
2003 Ga0070684_100108229
2004 Ga0070684_100129440
2005 Ga0070684_100637665
2006 Ga0070697_100412354
2007 Ga0068853_100080677
2008 Ga0068853_100090995
2009 Ga0068853_100334591
2010 Ga0070672_100026322
2011 Ga0070672_100292590
2012 Ga0070693_100050514
2013 Ga0070693_100268601
2014 Ga0070693_100675544
2015 Ga0070665_100000032
2016 Ga0070665_100202373
2017 Ga0070665_101146757
2018 Ga0068855_100000026
2019 Ga0068855_100042965
2020 Ga0068855_100079811
2021 Ga0068855_100088358
2022 Ga0068855_100153698
2023 Ga0068855_100337587
2024 Ga0068855_100579060
2025 Ga0068855_100681485
2026 Ga0068855_101056822
2027 Ga0070664_100071441
2028 Ga0068857_100140153
2029 Ga0068857_100669386
2030 Ga0068857_101362068
2031 Ga0068854_100049164
2032 Ga0068854_101222578
2033 Ga0068854_102016889
2034 Ga0068856_100000014
2035 Ga0068856_100003360
2036 Ga0068856_100039856
2037 Ga0068856_100123168
2038 Ga0068856_100173722
2039 Ga0068856_100526112
2040 Ga0068856_100614725
2041 Ga0070702_101058628
2042 Ga0068852_100001456
2043 Ga0068852_100021426
2044 Ga0068852_100751085
2045 Ga0068859_100079340
2046 Ga0068859_100107960
2047 Ga0068859_100180854
2048 Ga0068859_101109496
2049 Ga0068859_101349300
2050 Ga0068864_100263279
2051 Ga0068864_100343112
2052 Ga0068864_100579521
2053 Ga0068866_10034749
2054 Ga0068861_100000562
2055 Ga0068861_100000975
2056 Ga0068861_101149382
2057 Ga0068861_101227399
2058 Ga0068851_10000357
2059 Ga0068851_10203485
2060 Ga0068851_10641888
2061 Ga0068863_100000969
2062 Ga0068863_100051547
2063 Ga0068863_100326755
2064 Ga0068863_100635317
2065 Ga0068863_100906656
2066 Ga0068863_102736433
2067 Ga0068858_100031724
2068 Ga0068858_100071033
2069 Ga0068858_100072941
2070 Ga0068858_100256656
2071 Ga0068860_100004188
2072 Ga0068860_100131686
2073 Ga0068860_100229215
2074 Ga0068860_102491524
2075 Ga0068862_100013561
2076 Ga0068862_101367029
2077 Ga0070717_11705124
2078 Ga0070716_100351276
2079 Ga0070716_100800406
2080 Ga0070712_100083391
2081 Ga0070712_100135523
2082 Ga0075369_10436126
2083 Ga0075366_10000812
2084 Ga0075366_10140973
2085 Ga0075366_10566369
2086 Ga0097621_100000057
2087 Ga0097621_100020011
2088 Ga0097621_101030470
2089 Ga0075370_10119059
2090 Ga0075370_10528481
2091 Ga0075370_10530814
2092 Ga0068871_100000094
2093 Ga0068871_100013592
2094 Ga0068871_100849862
2095 Ga0075428_100003457
2096 Ga0075428_100032084
2097 Ga0075428_100144106
2098 Ga0075428_100698736
2099 Ga0075430_100001414
2100 Ga0075430_100030156
2101 Ga0075430_100094296
2102 Ga0075430_100096433
2103 Ga0075431_100002689
2104 Ga0075431_100088689
2105 Ga0075431_100287042
2106 Ga0075431_100880819
2107 Ga0075431_101086602
2108 Ga0075433_10155235
2109 Ga0075434_100192776
2110 Ga0075434_100413611
2111 Ga0075429_100002173
2112 Ga0075429_100009872
2113 Ga0075429_100917206
2114 Ga0075429_101098667
2115 Ga0075429_101334970
2116 Ga0068865_100000200
2117 Ga0068865_100026446
2118 Ga0097620_100079345
2119 Ga0097620_100107978
2120 Ga0097620_100180865
2121 Ga0097620_101109567
2122 Ga0097620_101349199
2123 Ga0075435_100115545
2124 Ga0105251_10012672
2125 Ga0105251_10149065
2126 Ga0105244_10000001
2127 Ga0105244_10013287
2128 Ga0105244_10020501
2129 Ga0105244_10219993
2130 Ga0105250_10025692
2131 Ga0105250_10119615
2132 Ga0105240_10015703
2133 Ga0105240_10067718
2134 Ga0105240_10129348
2135 Ga0105240_10140553
2136 Ga0105240_10221121
2137 Ga0105240_10260499
2138 Ga0105240_10276735
2139 Ga0105240_10429871
2140 Ga0105240_10654945
2141 Ga0105240_10877236
2142 Ga0111539_10158570
2143 Ga0111539_10159065
2144 Ga0111539_10365710
2145 Ga0111539_10776634
2146 Ga0111539_11773332
2147 Ga0111539_11837627
2148 Ga0105247_10085212
2149 Ga0105247_10127594
2150 Ga0114129_10004634
2151 Ga0114129_10030165
2152 Ga0114129_10303183
2153 Ga0105243_10000018
2154 Ga0105243_10368164
2155 Ga0105243_10880714
2156 Ga0105241_10019243
2157 Ga0105241_10127780
2158 Ga0105241_10152542
2159 Ga0105241_10218230
2160 Ga0105241_11532111
2161 Ga0105241_12131542
2162 Ga0105242_10040711
2163 Ga0105242_10158277
2164 Ga0105242_10259463
2165 Ga0105242_12059936
2166 Ga0105248_10001106
2167 Ga0105248_10052133
2168 Ga0105248_10977514
2169 Ga0105248_11746004
2170 Ga0105248_12115238
2171 Ga0105237_10001287
2172 Ga0105237_10001321
2173 Ga0105237_10012788
2174 Ga0105237_10060769
2175 Ga0105237_10075128
2176 Ga0105237_10131048
2177 Ga0105237_10224782
2178 Ga0105237_10307141
2179 Ga0105237_10511742
2180 Ga0105237_10549691
2181 Ga0105237_10556101
2182 Ga0105237_10568819
2183 Ga0105237_11485236
2184 Ga0105237_12054660
2185 Ga0105238_10003742
2186 Ga0105238_10097306
2187 Ga0105238_10128234
2188 Ga0105238_10645026
2189 Ga0105238_10719173
2190 Ga0105249_10006060
2191 Ga0105249_10008223
2192 Ga0105249_10479239
2193 Ga0105239_10000001
2194 Ga0105239_10001363
2195 Ga0105239_10005053
2196 Ga0105239_10023806
2197 Ga0105239_10192411
2198 Ga0105239_10622805
2199 Ga0105239_10844655
2200 Ga0105239_11040978
2201 Ga0105239_11124118
2202 Ga0105239_12832608
2203 Ga0105239_13253544
2204 Ga0105246_10112043
2205 Ga0105246_10234751
2206 Ga0105246_10828799
2207 Ga0157325_1008804
2208 Ga0157321_1017992
2209 Ga0157329_1013074
2210 Ga0157319_1019331
2211 Ga0157327_1003754
2212 Ga0157373_10000054
2213 Ga0157373_10000448
2214 Ga0157373_10016881
2215 Ga0157373_10018002
2216 Ga0157373_10061203
2217 Ga0157373_10068921
2218 Ga0157373_10171486
2219 Ga0157373_10172455
2220 Ga0157373_10225466
2221 Ga0157373_10476989
2222 Ga0157373_10668179
2223 Ga0157373_11440186
2224 Ga0157371_10000052
2225 Ga0157371_10002095
2226 Ga0157371_10009982
2227 Ga0157371_10012727
2228 Ga0157371_10132755
2229 Ga0157371_10182884
2230 Ga0157371_10237127
2231 Ga0157371_10242405
2232 Ga0157371_10487143
2233 Ga0157371_11012007
2234 Ga0157370_10014970
2235 Ga0157370_10043162
2236 Ga0157370_10044584
2237 Ga0157370_10114453
2238 Ga0157370_10163773
2239 Ga0157370_10176265
2240 Ga0157370_10320873
2241 Ga0157370_10470573
2242 Ga0157370_10658017
2243 Ga0157370_10670684
2244 Ga0157370_10857595
2245 Ga0157370_11041377
2246 Ga0157370_12059448
2247 Ga0157369_10000355
2248 Ga0157369_10058386
2249 Ga0157369_10064414
2250 Ga0157369_10241115
2251 Ga0157369_10307020
2252 Ga0157369_10437331
2253 Ga0157369_11430714
2254 Ga0157374_10092042
2255 Ga0157374_10150180
2256 Ga0157374_10240694
2257 Ga0157374_11247236
2258 Ga0157374_12052736
2259 Ga0157378_10022748
2260 Ga0157378_10041902
2261 Ga0157378_10160320
2262 Ga0157378_11438049
2263 Ga0163162_10000052
2264 Ga0163162_10004579
2265 Ga0163162_10006136
2266 Ga0163162_10038959
2267 Ga0163162_10090809
2268 Ga0163162_10224456
2269 Ga0163162_10878452
2270 Ga0163162_12000926
2271 Ga0157372_10000254
2272 Ga0157372_10001280
2273 Ga0157372_10042429
2274 Ga0157372_10122899
2275 Ga0157372_10151310
2276 Ga0157372_10153165
2277 Ga0157372_10265687
2278 Ga0157372_10372742
2279 Ga0157372_10481125
2280 Ga0157372_10914657
2281 Ga0157372_10946815
2282 Ga0157372_11204962
2283 Ga0157372_11267669
2284 Ga0157375_10008115
2285 Ga0157375_10013846
2286 Ga0157375_10044048
2287 Ga0157375_10106910
2288 Ga0157375_10169512
2289 Ga0157375_10469799
2290 Ga0163163_10060719
2291 Ga0163163_10280146
2292 Ga0157380_10000015
2293 Ga0157380_10046242
2294 Ga0157380_10339685
2295 Ga0157380_10585040
2296 Ga0157380_12000718
2297 Ga0157380_12570396
2298 Ga0182008_10000030
2299 Ga0182008_10000062
2300 Ga0182008_10006054
2301 Ga0182008_10021142
2302 Ga0182008_10090076
2303 Ga0157379_10000562
2304 Ga0157379_10009212
2305 Ga0157379_10268826
2306 Ga0157376_10074456
2307 Ga0157376_10279806
2308 Ga0157376_10525825
2309 Ga0157376_10575405
2310 Ga0182006_1000003
2311 Ga0182006_1002415
2312 Ga0182006_1070067
2313 Ga0182007_10000003
2314 Ga0182007_10049861
2315 Ga0182005_1000076
2316 Ga0163161_10000009
2317 Ga0163161_10000641
2318 Ga0163161_10000862
2319 Ga0163161_10025292
2320 Ga0163161_10030399
2321 Ga0163161_10035920
2322 Ga0163161_10037844
2323 Ga0163161_10041013
2324 Ga0163161_10054458
2325 Ga0163161_10075458
2326 Ga0163161_10099208
2327 Ga0163161_10481887
2328 Ga0163161_11056009
2329 Ga0197907_10502577
2330 Ga0197907_10706642
2331 Ga0197907_10819694
2332 Ga0197907_11339442
2333 Ga0206356_10266805
2334 Ga0206356_10319799
2335 Ga0206356_10781816
2336 Ga0206356_11054826
2337 Ga0206356_11795532
2338 Ga0206356_11849337
2339 Ga0206349_1678553
2340 Ga0206349_1906000
2341 Ga0206355_1389572
2342 Ga0206355_1710056
2343 Ga0206351_10106046
2344 Ga0206351_10453586
2345 Ga0206351_10462283
2346 Ga0206351_10586730
2347 Ga0206351_10776079
2348 Ga0206352_10195467
2349 Ga0206352_10639884
2350 Ga0206352_11093239
2351 Ga0206352_11147567
2352 Ga0206352_11257836
2353 Ga0206350_10111961
2354 Ga0206350_10297200
2355 Ga0206350_10464794
2356 Ga0206350_10530843
2357 Ga0206350_10647756
2358 Ga0206354_10771971
2359 Ga0206354_10796355
2360 Ga0206354_11204833
2361 Ga0206354_11237852
2362 Ga0206353_10800764
2363 Ga0206353_11117576
2364 Ga0206353_11125333
2365 Ga0206353_11264094
2366 Ga0206353_11831860
2367 Ga0206353_12062741
2368 Ga0154015_1153066
2369 Ga0154015_1236635
2370 Ga0154015_1602182
2371 Ga0224712_10005983
2372 Ga0224712_10267272
2373 Ga0256744_137381
2374 Ga0209436_101300
2375 Ga0209563_107118
2376 Ga0207427_100236
2377 Ga0207427_122187
2378 Ga0209437_100034
2379 Ga0209437_100143
2380 Ga0209258_118342
2381 Ga0207425_1000002
2382 Ga0209026_1000463
2383 Ga0209026_1002304
2384 Ga0209026_1004428
2385 Ga0209148_1017590
2386 Ga0209129_1000002
2387 Ga0209129_1013234
2388 Ga0209233_1000038
2389 Ga0209233_1019928
2390 Ga0207666_1014994
2391 Ga0209455_1001279
2392 Ga0207673_1028041
2393 Ga0209675_1000059
2394 Ga0209676_1000294
2395 Ga0209025_1000004
2396 Ga0209758_1000006
2397 Ga0207426_1003126
2398 Ga0209257_1000023
2399 Ga0207697_10147388
2400 Ga0207656_10000220
2401 Ga0207656_10030400
2402 Ga0207656_10082248
2403 Ga0207696_1087382
2404 Ga0207696_1134549
2405 Ga0207655_1000018
2406 Ga0207655_1000093
2407 Ga0207655_1059925
2408 Ga0207713_1055674
2409 Ga0207642_10582530
2410 Ga0207710_10107597
2411 Ga0207688_10060048
2412 Ga0207680_10130973
2413 Ga0207680_10162725
2414 Ga0207647_10003884
2415 Ga0207647_10007050
2416 Ga0207647_10063060
2417 Ga0207647_10086388
2418 Ga0207645_10000909
2419 Ga0207645_10002281
2420 Ga0207643_10973824
2421 Ga0207705_10000043
2422 Ga0207705_10377593
2423 Ga0207705_10469959
2424 Ga0207705_10559224
2425 Ga0207684_10006660
2426 Ga0207654_10005184
2427 Ga0207654_10518295
2428 Ga0207654_11252249
2429 Ga0207707_10005257
2430 Ga0207707_10055872
2431 Ga0207707_10213426
2432 Ga0207707_10904110
2433 Ga0207695_10000053
2434 Ga0207695_10020568
2435 Ga0207695_10029659
2436 Ga0207695_10034034
2437 Ga0207695_10044139
2438 Ga0207695_10088255
2439 Ga0207695_10088720
2440 Ga0207695_10196503
2441 Ga0207695_10287337
2442 Ga0207695_10530382
2443 Ga0207695_10807302
2444 Ga0207671_10002869
2445 Ga0207671_10003103
2446 Ga0207671_10007516
2447 Ga0207671_10012211
2448 Ga0207671_10032530
2449 Ga0207671_10037359
2450 Ga0207671_10069032
2451 Ga0207671_10961347
2452 Ga0207693_10049593
2453 Ga0207693_10081649
2454 Ga0207660_10083829
2455 Ga0207660_10092024
2456 Ga0207662_10000695
2457 Ga0207657_10020514
2458 Ga0207657_10091410
2459 Ga0207657_10220731
2460 Ga0207657_10245093
2461 Ga0207649_10018776
2462 Ga0207649_10028375
2463 Ga0207649_10056686
2464 Ga0207652_10004160
2465 Ga0207652_10022531
2466 Ga0207652_10026145
2467 Ga0207652_10257275
2468 Ga0207652_11854710
2469 Ga0207681_10000921
2470 Ga0207681_10031056
2471 Ga0207694_10022814
2472 Ga0207694_10083340
2473 Ga0207694_10464667
2474 Ga0207694_10686066
2475 Ga0207694_10779327
2476 Ga0207650_10095058
2477 Ga0207650_10320790
2478 Ga0207659_10000169
2479 Ga0207659_10000843
2480 Ga0207659_10070326
2481 Ga0207659_10435990
2482 Ga0207687_10105232
2483 Ga0207700_11601388
2484 Ga0207664_10833667
2485 Ga0207644_10001196
2486 Ga0207644_10010204
2487 Ga0207644_10296214
2488 Ga0207644_10677170
2489 Ga0207690_10000365
2490 Ga0207690_10063455
2491 Ga0207690_11265899
2492 Ga0207706_10000057
2493 Ga0207706_10002035
2494 Ga0207706_10169742
2495 Ga0207706_10266418
2496 Ga0207686_10007982
2497 Ga0207686_10125683
2498 Ga0207686_10450592
2499 Ga0207686_11301119
2500 Ga0207709_10000021
2501 Ga0207709_10000628
2502 Ga0207670_10007709
2503 Ga0207670_10082497
2504 Ga0207670_10454751
2505 Ga0207669_10099554
2506 Ga0207704_10000052
2507 Ga0207704_10003676
2508 Ga0207665_10045738
2509 Ga0207665_10116996
2510 Ga0207665_10165633
2511 Ga0207691_10031365
2512 Ga0207691_10896985
2513 Ga0207711_10002561
2514 Ga0207689_10004653
2515 Ga0207689_10080823
2516 Ga0207661_10007883
2517 Ga0207661_10007950
2518 Ga0207661_10090386
2519 Ga0207661_10252019
2520 Ga0207679_10002943
2521 Ga0207679_10003915
2522 Ga0207679_10188504
2523 Ga0207667_10000022
2524 Ga0207667_10001325
2525 Ga0207667_10012833
2526 Ga0207667_10073046
2527 Ga0207667_10152790
2528 Ga0207667_10419233
2529 Ga0207667_10800527
2530 Ga0207651_10027165
2531 Ga0207651_10039011
2532 Ga0207712_10009138
2533 Ga0207712_10030186
2534 Ga0207712_10578305
2535 Ga0207668_10046737
2536 Ga0207668_10051640
2537 Ga0207640_10033694
2538 Ga0207640_10984577
2539 Ga0207640_11093045
2540 Ga0207640_11596769
2541 Ga0207640_11660664
2542 Ga0207658_10030281
2543 Ga0207658_10048536
2544 Ga0207658_10323473
2545 Ga0207677_10076079
2546 Ga0207703_10005252
2547 Ga0207703_10008320
2548 Ga0207703_10031399
2549 Ga0207703_11067542
2550 Ga0207703_11630091
2551 Ga0207639_10030610
2552 Ga0207639_10157453
2553 Ga0207639_10287311
2554 Ga0207639_10610595
2555 Ga0207678_10310685
2556 Ga0207708_10004898
2557 Ga0207708_10296528
2558 Ga0207708_10663202
2559 Ga0207702_10000036
2560 Ga0207702_10034672
2561 Ga0207702_10052280
2562 Ga0207702_10089289
2563 Ga0207702_10144049
2564 Ga0207702_10982685
2565 Ga0207641_10000293
2566 Ga0207641_10011831
2567 Ga0207641_10593628
2568 Ga0207648_10002788
2569 Ga0207676_10060399
2570 Ga0207676_10238990
2571 Ga0207676_10258511
2572 Ga0207674_10127668
2573 Ga0207674_10521044
2574 Ga0207675_100003884
2575 Ga0207675_100066788
2576 Ga0207683_10010796
2577 Ga0207683_11373484
2578 Ga0207683_11831365
2579 Ga0207683_12069707
2580 Ga0207698_10003054
2581 Ga0207698_10005473
2582 Ga0207698_10031644
2583 Ga0207698_10401696
2584 Ga0207698_10567760
2585 Ga0207698_11049840
2586 Ga0209281_1000158
2587 Ga0209969_1021884
2588 Ga0209969_1027942
2589 Ga0209489_116311
2590 Ga0209995_1002344
2591 Ga0209968_1001388
2592 Ga0209974_10022486
2593 Ga0207428_10570692
2594 Ga0268266_10000030
2595 Ga0268265_10004276
2596 Ga0268265_10122397
2597 Ga0268265_11064869
2598 Ga0268264_10028955
2599 Ga0268264_10116808
2600 Ga0268264_10687715
2601 Ga0265318_10153980
2602 Ga0265323_10000038
2603 Ga0265323_10015327
2604 Ga0307517_10006168
2605 Ga0307517_10262260
2606 Ga0307515_10000009
2607 Ga0307515_10049612
2608 Ga0307515_10244807
2609 Ga0307515_10486209
2610 Ga0307515_10689333
2611 Ga0265338_10000920
2612 Ga0265338_10049114
2613 Ga0316177_1136623
2614 Ga0316181_1034012
2615 Ga0316181_1133526
2616 Ga0316181_1201818
2617 Ga0316181_1282363
2618 Ga0316182_1171482
2619 Ga0265766_1009546
2620 Ga0265774_104937
2621 Ga0265779_112346
2622 Ga0265327_10017918
2623 Ga0265327_10054874
2624 Ga0265327_10059485
2625 Ga0265316_10000481
2626 Ga0265316_10002116
2627 Ga0265316_10541036
2628 Ga0307513_10494596
2629 Ga0307513_10840906
2630 Ga0307509_10007266
2631 Ga0307509_10101371
2632 Ga0307509_10372105
2633 Ga0307408_100002257
2634 Ga0307408_100037589
2635 Ga0307408_100070397
2636 Ga0307408_102048102
2637 Ga0307508_10389351
2638 Ga0307514_10113935
2639 Ga0307514_10407243
2640 Ga0265342_10203717
2641 Ga0265342_10311692
2642 Ga0316576_10012743
2643 Ga0316576_10027864
2644 Ga0316576_10050475
2645 Ga0316576_10080691
2646 Ga0316576_10176552
2647 Ga0316576_10259036
2648 Ga0316576_10269349
2649 Ga0316576_10969568
2650 Ga0316578_10520202
2651 Ga0307516_10131017
2652 Ga0307405_10000001
2653 Ga0307405_10000003
2654 Ga0307405_10001399
2655 Ga0307405_10036088
2656 Ga0307405_10051289
2657 Ga0307405_10387160
2658 Ga0307405_11196301
2659 Ga0316577_10579840
2660 Ga0307413_10000568
2661 Ga0307413_10816658
2662 Ga0307410_10020508
2663 Ga0307410_10556354
2664 Ga0307406_10002275
2665 Ga0307406_10083679
2666 Ga0307406_10116079
2667 Ga0307406_10306128
2668 Ga0307407_10000030
2669 Ga0307407_10030089
2670 Ga0307412_10000065
2671 Ga0307412_10000072
2672 Ga0307412_10000385
2673 Ga0307412_10000925
2674 Ga0307412_10002592
2675 Ga0307412_10007236
2676 Ga0307412_10120538
2677 Ga0307412_10529903
2678 Ga0307412_10806344
2679 Ga0307412_10826948
2680 Ga0307412_11062801
2681 Ga0307409_101921563
2682 Ga0307416_100000013
2683 Ga0307416_100000014
2684 Ga0307416_100007927
2685 Ga0307416_100090547
2686 Ga0307416_100330333
2687 Ga0307416_100506789
2688 Ga0307416_100828746
2689 Ga0307416_102443421
2690 Ga0307414_10000140
2691 Ga0307414_10007780
2692 Ga0307414_10010548
2693 Ga0307414_10043088
2694 Ga0307414_10073019
2695 Ga0307414_10079883
2696 Ga0307414_10100000
2697 Ga0307414_10100320
2698 Ga0307414_10120028
2699 Ga0307414_10131990
2700 Ga0307414_10141810
2701 Ga0307414_10191977
2702 Ga0307414_10279941
2703 Ga0307414_10281196
2704 Ga0307414_10318639
2705 Ga0307414_10528899
2706 Ga0307414_10662742
2707 Ga0307414_10767053
2708 Ga0307414_10790271
2709 Ga0307414_11422815
2710 Ga0307411_10000010
2711 Ga0307411_10037802
2712 Ga0307411_10116047
2713 Ga0307415_100149326
2714 Ga0307415_101670334
2715 Ga0307415_101849028
2716 Ga0316585_10044695
2717 Ga0316585_10076681
2718 Ga0316580_10058497
2719 Ga0316580_10119047
2720 Ga0316593_10001317
2721 Ga0316593_10001424
2722 Ga0316593_10005401
2723 Ga0316593_10007056
2724 Ga0316593_10010871
2725 Ga0316593_10019016
2726 Ga0316593_10022431
2727 Ga0316593_10023475
2728 Ga0316593_10047964
2729 Ga0316593_10053466
2730 Ga0316593_10061455
2731 Ga0316593_10139556
2732 Ga0316593_10239907
2733 Ga0316593_10337803
2734 Ga0307507_10000032
2735 Ga0307510_10005905
2736 Ga0307510_10022058
2737 Ga0316592_1000944
2738 Ga0316592_1001500
2739 Ga0316592_1001667
2740 Ga0316592_1003832
2741 Ga0316592_1005390
2742 Ga0316592_1010904
2743 Ga0316592_1011737
2744 Ga0316592_1017679
2745 Ga0316592_1021309
2746 Ga0316592_1024241
2747 Ga0316592_1032646
2748 Ga0316592_1055538
2749 Ga0316592_1075461
2750 Ga0316592_1088032
2751 Ga0316592_1113262
2752 Ga0316592_1129750
2753 Ga0316592_1133454
2754 Ga0316586_1000972
2755 Ga0316586_1002316
2756 Ga0316586_1007006
2757 Ga0316586_1047132
2758 Ga0316586_1104026
2759 Ga0316588_1001715
2760 Ga0316588_1016176
2761 Ga0316588_1021501
2762 Ga0316588_1025332
2763 Ga0316588_1035028
2764 Ga0316588_1114550
2765 Ga0316588_1129337
2766 Ga0316588_1129532
2767 Ga0316596_1000933
2768 Ga0316596_1001316
2769 Ga0316596_1003631
2770 Ga0316596_1004659
2771 Ga0316596_1005709
2772 Ga0316596_1009273
2773 Ga0316596_1009752
2774 Ga0316596_1015300
2775 Ga0316596_1017392
2776 Ga0316596_1021017
2777 Ga0316596_1028750
2778 Ga0316596_1032378
2779 Ga0316596_1037825
2780 Ga0316596_1041213
2781 Ga0316596_1089556
2782 Ga0316596_1090694
2783 Ga0316596_1133003
2784 Ga0316596_1148215
2785 Ga0316596_1242811
2786 Ga0373959_0160283
2787 Ga0373944_0087759
2788 Ga0373951_0061742
2789 Ga0373954_0408307
2790 Ga0373960_0013130
2791 Ga0373942_0108523
2792 Ga0316574_0079726
2793 Ga0316574_0168258
2794 Ga0316574_0244732
2795 Ga0373935_0645599
2796 Ga0373927_0246332
2797 Ga0373937_0394787
2798 Ga0265778_001249
2799 Ga0316582_0005208
2800 Ga0316582_0012374
2801 Ga0316582_0456969
2802 Ga0316582_0763131
2803 Ga0316584_0001736
2804 Ga0316584_0004533
2805 Ga0316584_0018160
2806 Ga0316584_0126509
2807 Ga0316584_0817308
2808 Ga0373925_1404430
2809 Ga0395899_0000002
2810 Ga0395899_0000061
2811 Ga0395899_0012421
2812 Ga0395899_0046276
2813 Ga0395899_0490756
2814 Ga0395900_0000143
2815 Ga0395900_0000284
2816 Ga0395900_0125611
2817 Ga0395900_0258745
2818 Ga0395898_0049674
2819 Ga0395898_0059816
2820 Ga0395905_0000045
2821 Ga0395905_0001507
2822 Ga0395905_0003630
2823 Ga0395905_0164245
2824 Ga0395905_1684294
2825 Ga0395901_0000976
2826 Ga0395901_0003957
2827 Ga0395901_0056763
2828 Ga0395901_0237197
2829 Ga0395901_0276349
2830 Ga0400483_029390
2831 Ga0400483_050403
2832 Ga0400483_124011
2833 Ga0400483_195876
2834 Ga0400483_226961
2835 Ga0400489_00166
2836 Ga0436365_0622767
2837 Ga0436365_1899993
2838 Ga0436361_0285047
2839 Ga0436361_1065956
2840 Ga0439447_000448
2841 Ga0439453_0030344
2842 Ga0439465_0000059
2843 Ga0451787_190884
2844 Ga0451787_260319
2845 Ga0451787_275413
2846 Ga0451788_06079
2847 Ga0451788_08994
2848 Ga0451789_0910149
2849 Ga0451789_1121600
2850 Ga0451790_02189
2851 Ga0451790_02818
2852 Ga0451790_07784
2853 Ga0451790_08466
2854 Ga0451790_08648
2855 Ga0451790_27903
2856 Ga0451790_29633
2857 Ga0451792_04669
2858 Ga0451792_14905
2859 Ga0451794_07486
2860 Ga0451794_12521
2861 Ga0451794_28924
2862 Ga0451794_30763
2863 Ga0451794_36379
2864 Ga0451794_38207
2865 Ga0451794_41130
2866 Ga0451794_46656
2867 Ga0451796_14267
2868 Ga0451791_0638065
2869 Ga0451791_1422218
2870 Ga0451793_1805624
2871 Ga0451797_0299663
2872 Ga0451797_0547988
2873 Ga0451797_0843647
2874 Ga0451799_34312
2875 Ga0451795_0287747
2876 Ga0451795_0330379
2877 Ga0451795_0366728
2878 Ga0451795_0531346
2879 Ga0451795_0712291
2880 Ga0451795_0944706
2881 Ga0451795_1233880
2882 Ga0451795_1279062
2883 Ga0451795_1367261
2884 Ga0451795_1448660
2885 Ga0451795_1631148
2886 Ga0451803_12559
2887 Ga0451802_0278220
2888 Ga0451802_2099772
2889 Ga0451805_071652
2890 Ga0451805_080062
2891 Ga0451805_090433
2892 Ga0451805_090728
2893 Ga0451806_626055
2894 Ga0451804_0537731
2895 Ga0451808_04048
2896 Ga0451807_0716238
2897 Ga0451807_2059496
2898 Ga0451807_2675568
2899 Ga0451833_1205465
2900 Ga0451836_08780
2901 Ga0451837_0040229
2902 Ga0451837_0608429
2903 Ga0451837_0813853
2904 Ga0451837_1109650
2905 Ga0451840_01673
2906 Ga0451841_1223165
2907 Ga0451846_27502
2908 Ga0451847_0250895
2909 Ga0451847_0611722
2910 Ga0451850_54086
2911 Ga0451851_0814099
2912 Ga0451851_0960257
2913 Ga0451852_06555
2914 Ga0451852_36362
2915 Ga0451852_44034
2916 Ga0451843_0050032
2917 Ga0451843_0575012
2918 Ga0451843_1460174
2919 Ga0451854_21462
2920 Ga0451855_0044321
2921 Ga0451855_0129181
2922 Ga0451855_0274826
2923 Ga0451855_0368377
2924 Ga0451855_0517858
2925 Ga0451855_0696871
2926 Ga0451855_0991025
2927 Ga0451855_1020551
2928 Ga0452268_13769
2929 Ga0452268_16729
2930 Ga0452268_21896
2931 Ga0452268_35472
2932 Ga0452269_1053
2933 Ga0452271_05642
2934 Ga0452271_28809
2935 Ga0439433_0021808
2936 Ga0439445_0000513
2937 Ga0439445_0100589
2938 Ga0439448_0007567
2939 Ga0439448_0029702
2940 Ga0439450_019604
2941 Ga0439455_0009871
2942 Ga0439455_0056405
2943 Ga0439457_009023
2944 Ga0439462_0082276
2945 Ga0450890_012146
2946 Ga0439446_0026548
2947 Ga0439460_0249123
2948 Ga0450893_0004983
2949 Ga0451577_0000854
2950 Ga0451577_0001297
2951 Ga0451577_0003726
2952 Ga0451577_0011827
2953 Ga0451577_0022661
2954 Ga0451577_0025338
2955 Ga0451577_0031270
2956 Ga0451577_0057422
2957 Ga0451577_0075809
2958 Ga0451577_0079353
2959 Ga0451577_0182065
2960 Ga0451577_0246633
2961 Ga0451577_0264702
2962 Ga0451577_0273441
2963 Ga0451577_0274429
2964 Ga0451577_0435209
2965 Ga0451577_0485948
2966 Ga0451577_0580449
2967 Ga0451577_1266591
2968 Ga0451577_1678341
2969 Ga0453683_0014479
2970 Ga0453683_0032774
2971 Ga0453683_0033895
2972 Ga0453683_0038384
2973 Ga0453683_0042488
2974 Ga0453683_0056977
2975 Ga0453683_0089489
2976 Ga0453683_0206789
2977 Ga0453683_0222554
2978 Ga0453683_0499328
2979 Ga0453683_0624968
2980 Ga0453683_0821136
2981 Ga0466964_0042874
2982 Ga0453684_0000011
2983 Ga0453684_0000194
2984 Ga0453684_0000197
2985 Ga0453684_0000779
2986 Ga0453684_0001358
2987 Ga0453684_0001456
2988 Ga0453684_0001891
2989 Ga0453684_0002943
2990 Ga0453684_0004073
2991 Ga0453684_0006165
2992 Ga0453684_0009847
2993 Ga0453684_0024439
2994 Ga0453684_0037423
2995 Ga0453684_0046511
2996 Ga0453684_0057481
2997 Ga0453684_0058092
2998 Ga0453684_0060601
2999 Ga0453684_0064802
3000 Ga0453684_0127015
3001 Ga0453684_0140381
3002 Ga0453684_0180136
3003 Ga0453684_0253166
3004 Ga0453684_0308865
3005 Ga0453684_0375729
3006 Ga0453684_0425574
3007 Ga0453684_0467645
3008 Ga0453684_0614489
3009 Ga0453684_0817984
3010 Ga0453684_0919404
3011 Ga0453684_1055676
3012 Ga0453684_1456891
3013 Ga0453684_1461441
3014 Ga0453684_1778979
3015 Ga0453684_1998358
3016 Ga0466959_0260439
3017 Ga0451576_0000003
3018 Ga0451576_0004347
3019 Ga0451576_0006577
3020 Ga0451576_0007377
3021 Ga0451576_0010553
3022 Ga0451576_0013829
3023 Ga0451576_0022593
3024 Ga0451576_0044632
3025 Ga0451576_0062300
3026 Ga0451576_0100168
3027 Ga0451576_0161739
3028 Ga0451576_0189408
3029 Ga0451576_0225019
3030 Ga0451576_0226040
3031 Ga0451576_1001280
3032 Ga0451576_1153877
3033 Ga0451576_1732574
3034 Ga0451576_1827137
3035 Ga0451576_1846626
3036 Ga0451576_1976816
3037 Ga0451576_2139450
3038 Ga0466967_0039117
3039 Ga0466967_0084399
3040 Ga0495627_000067
3041 Ga0495627_002663
3042 Ga0495590_0042540
3043 Ga0495629_0121662
3044 Ga0495629_0126330
3045 Ga0495638_0098466
3046 Ga0495638_0122692
3047 Ga0495638_0136173
3048 Ga0495638_0231104
3049 Ga0495641_0314106
3050 Ga0495651_0032684
3051 Ga0495651_0230749
3052 Ga0495650_0000594
3053 Ga0495580_0118598
3054 Ga0495605_0239097
3055 Ga0495664_0000007
3056 Ga0495585_0003458
3057 Ga0495585_0004171
3058 Ga0495585_0258813
3059 Ga0495596_0022478
3060 Ga0495607_0034827
3061 Ga0495607_0100116
3062 Ga0495607_0254487
3063 Ga0495607_0328816
3064 Ga0495607_0360535
3065 Ga0495583_0028887
3066 Ga0495606_0027164
3067 Ga0495606_0030744
3068 Ga0495606_0037734
3069 Ga0495606_0057780
3070 Ga0495606_0085902
3071 Ga0495606_0089225
3072 Ga0495606_0477622
3073 Ga0495608_0174230
3074 Ga0495608_0570398
3075 Ga0495610_0000006
3076 Ga0495610_0001861
3077 Ga0495610_0007560
3078 Ga0495610_0052876
3079 Ga0495610_0224928
3080 Ga0495616_0006133
3081 Ga0495616_0010134
3082 Ga0495616_0010222
3083 Ga0495618_0126846
3084 Ga0495628_0282519
3085 Ga0495631_0025389
3086 Ga0495631_0122889
3087 Ga0495632_0009820
3088 Ga0495632_0158702
3089 Ga0495637_0021088
3090 Ga0495637_0099456
3091 Ga0495643_0000948
3092 Ga0495643_0007748
3093 Ga0495643_0266685
3094 Ga0495643_0318438
3095 Ga0495648_0004657
3096 Ga0495663_0000043
3097 Ga0495663_0010896
3098 Ga0495663_0026521
3099 Ga0495652_0185809
3100 Ga0495654_0000017
3101 Ga0495654_0011017
3102 Ga0495654_0071533
3103 Ga0495609_0000780
3104 Ga0495609_0005251
3105 Ga0495621_0111333
3106 Ga0495645_0326213
3107 Ga0495622_0026339
3108 Ga0495633_0000021
3109 Ga0495633_0000680
3110 Ga0495633_0096896
3111 Ga0495668_0000673
3112 Ga0495668_0110755
3113 Ga0495625_0000021
3114 Ga0495625_0004265
3115 Ga0495625_0033407
3116 Ga0495625_0047911
3117 Ga0495625_0110420
3118 Ga0495625_0159974
3119 Ga0495625_0287222
3120 Ga0495661_0000739
3121 Ga0495661_0008232
3122 Ga0495588_0182890
3123 Ga0495657_0455975
3124 Ga0495658_0141088
3125 Ga0495670_0119049
3126 Ga0495671_0072492
3127 Ga0495671_0136005
3128 Ga0495649_0000009
3129 Ga0495649_0023066
3130 Ga0495660_0005455
3131 Ga0495660_0050714
3132 Ga0495660_0079118
3133 Ga0495581_0660112
3134 Ga0495680_0539006
3135 Ga0495683_0291568
3136 Ga0495687_001340
3137 Ga0495687_020359
3138 Ga0495673_0016437
3139 Ga0495681_0230989
3140 Ga0495686_0021467
3141 Ga0495686_0060699
3142 Ga0495686_0129726
3143 Ga0495686_0131215
3144 Ga0495686_0384665
3145 Ga0495615_0042524
3146 Ga0496102_0238774
3147 Ga0496105_0435175
3148 Ga0496108_0460348
3149 Ga0496110_0612555
3150 Ga0496113_0085785
3151 Ga0496113_0695514
3152 Ga0496114_0599002
3153 Ga0496115_0002997
3154 Ga0496116_0000156
3155 Ga0496116_0000199
3156 Ga0496116_0005208
3157 Ga0496117_0000076
3158 Ga0496117_0015077
3159 Ga0496118_0001659
3160 Ga0496118_0070500
3161 Ga0496119_0000021
3162 Ga0496121_0000030
3163 Ga0496121_0075674
3164 Ga0496121_0394902
3165 Ga0496122_0000625
3166 Ga0496122_0011897
3167 Ga0496122_0013994
3168 Ga0496122_0026712
3169 Ga0496122_0032264
3170 Ga0496122_0244208
3171 Ga0496123_0003734
3172 Ga0496123_0015161
3173 Ga0496123_0015827
3174 Ga0496123_0064856
3175 Ga0496124_0002475
3176 Ga0496124_0040283
3177 Ga0496125_0000062
3178 Ga0496125_0000452
3179 Ga0496125_0045300
3180 Ga0496125_0065617
3181 Ga0496125_0100691
3182 Ga0496125_0156945
3183 Ga0496125_0443612
3184 Ga0496126_0001324
3185 Ga0496126_0026501
3186 Ga0496126_0031118
3187 Ga0496126_0390404
3188 Ga0501306_000090
3189 Ga0501306_003219
3190 Ga0501306_003286
3191 Ga0501306_007803
3192 Ga0501306_036287
3193 Ga0501306_037179
3194 Ga0501306_056119
3195 Ga0501308_001515
3196 Ga0501308_004388
3197 Ga0501308_008086
3198 Ga0501308_046871
3199 Ga0501309_001209
3200 Ga0501309_006960
3201 Ga0501309_076406
3202 Ga0501310_000037
3203 Ga0501310_000916
3204 Ga0501310_007733
3205 Ga0501310_012147
3206 Ga0501310_017354
3207 Ga0501341_00790
3208 Ga0501341_01701
3209 Ga0501341_04030
3210 Ga0501341_09538
3211 Ga0501343_002150
3212 Ga0501343_005438
3213 Ga0501343_014719
3214 Ga0501343_020106
3215 Ga0501344_04193
3216 Ga0501345_01540
3217 Ga0501304_007086
3218 Ga0501304_007801
3219 Ga0501304_008375
3220 Ga0501304_018661
3221 Ga0501304_026738
3222 Ga0501305_000794
3223 Ga0501305_001549
3224 Ga0501305_001909
3225 Ga0501305_002800
3226 Ga0501305_033759
3227 Ga0501305_035163
3228 Ga0501305_048762
3229 Ga0501305_052529
3230 Ga0501305_066695
3231 Ga0501307_000560
3232 Ga0501307_000602
3233 Ga0501307_008962
3234 Ga0501307_013824
3235 Ga0501307_027966
3236 Ga0501307_029260
3237 Ga0501307_057024
3238 Ga0501307_061293
3239 Ga0501342_01634
3240 Ga0501342_03433
3241 Ga0501342_03506
3242 Ga0495678_033405
3243 Ga0495682_0041703
3244 Ga0501311_009489
3245 Ga0501311_012558
3246 Ga0501311_013964
3247 Ga0501311_015846
3248 Ga0501311_050040
3249 Ga0501312_000226
3250 Ga0501312_000486
3251 Ga0501312_007844
3252 Ga0501312_013626
3253 Ga0501312_025871
3254 Ga0501312_041004
3255 Ga0501312_048843
3256 Ga0501312_055713
3257 Ga0501312_060610
3258 Ga0501313_000829
3259 Ga0501313_001041
3260 Ga0501313_023195
3261 Ga0501313_029125
3262 Ga0501313_035218
3263 Ga0501313_042735
3264 Ga0501314_000485
3265 Ga0501314_001176
3266 Ga0501314_003861
3267 Ga0501314_005415
3268 Ga0501314_012624
3269 Ga0501314_023345
3270 Ga0501314_039590
3271 Ga0501315_000064
3272 Ga0501315_000629
3273 Ga0501315_001579
3274 Ga0501315_011574
3275 Ga0501315_047206
3276 Ga0501315_080912
3277 Ga0501315_093331
3278 Ga0501316_000650
3279 Ga0501316_004246
3280 Ga0501316_024839
3281 Ga0501316_036380
3282 Ga0501316_057394
3283 Ga0501317_001389
3284 Ga0501317_020207
3285 Ga0501317_030347
3286 Ga0501317_034208
3287 Ga0501317_062792
3288 Ga0501317_109971
3289 Ga0501318_013246
3290 Ga0501318_018041
3291 Ga0501318_033966
3292 Ga0501319_000006
3293 Ga0501319_000068
3294 Ga0501319_000383
3295 Ga0501319_000428
3296 Ga0501319_007320
3297 Ga0501319_008963
3298 Ga0501319_010268
3299 Ga0501319_012847
3300 Ga0501319_017561
3301 Ga0501320_000264
3302 Ga0501320_000540
3303 Ga0501320_003081
3304 Ga0501320_004332
3305 Ga0501320_015745
3306 Ga0501320_023241
3307 Ga0501320_023596
3308 Ga0501320_027211
3309 Ga0501321_013675
3310 Ga0501321_018418
3311 Ga0501321_021060
3312 Ga0501321_027635
3313 Ga0501321_031517
3314 Ga0501321_033178
3315 Ga0501321_089192
3316 Ga0501323_000717
3317 Ga0501323_001002
3318 Ga0501323_001783
3319 Ga0501323_002460
3320 Ga0501323_005626
3321 Ga0501323_011315
3322 Ga0501323_015120
3323 Ga0501323_022411
3324 Ga0501323_027020
3325 Ga0501323_060436
3326 Ga0501324_002531
3327 Ga0501324_003092
3328 Ga0501324_022717
3329 Ga0501324_026087
3330 Ga0501324_047264
3331 Ga0501325_011584
3332 Ga0501325_019734
3333 Ga0501325_034807
3334 Ga0501325_043087
3335 Ga0501326_09759
3336 Ga0501326_11467
3337 Ga0501327_09345
3338 Ga0501328_03265
3339 Ga0501328_03694
3340 Ga0501328_07964
3341 Ga0501329_00132
3342 Ga0501329_03571
3343 Ga0501329_04205
3344 Ga0501330_004977
3345 Ga0501330_008315
3346 Ga0501331_01194
3347 Ga0501331_02908
3348 Ga0501331_05306
3349 Ga0501332_05328
3350 Ga0501334_00025
3351 Ga0501334_00211
3352 Ga0501334_02889
3353 Ga0501334_05362
3354 Ga0501335_000748
3355 Ga0501335_000798
3356 Ga0501335_005233
3357 Ga0501335_010801
3358 Ga0501335_011976
3359 Ga0501335_014245
3360 Ga0501336_000444
3361 Ga0501336_001556
3362 Ga0501337_004420
3363 Ga0501337_015152
3364 Ga0501340_002106
3365 Ga0501340_003356
3366 Ga0501032_0000353
3367 Ga0501034_0000001
3368 Ga0501034_0112090
3369 Ga0501036_0141855
3370 Ga0501039_0000169
3371 Ga0501047_0150432
3372 Ga0501223_002278
3373 Ga0501238_015660
3374 Ga0501238_030760
3375 Ga0501240_000074
3376 Ga0501243_052474
3377 Ga0501243_057375
3378 Ga0501243_095078
3379 Ga0501249_000797
3380 Ga0501249_005929
3381 Ga0501249_086232
3382 Ga0501251_001354
3383 Ga0501252_057595
3384 Ga0501257_204875
3385 Ga0501260_004986
3386 Ga0501219_025063
3387 Ga0501225_0026515
3388 Ga0501241_000017
3389 Ga0501241_001570
3390 Ga0501241_007664
3391 Ga0501266_000009
3392 Ga0501269_001154
3393 Ga0501280_034090
3394 Ga0501035_0114203
3395 Ga0501035_0668587
3396 Ga0501035_1405445
3397 nmdc:mga0k408_173043_c1
3398 nmdc:mga0k408_234301_c1
3399 nmdc:mga0k408_350_c1
3400 nmdc:mga0k408_38765_c1
3401 nmdc:mga0k408_4120_c1
3402 nmdc:mga07m45_164171_c1
3403 nmdc:mga07m45_248103_c1
3404 nmdc:mga07m45_361836_c1
3405 nmdc:mga07m45_446713_c1
3406 nmdc:mga07m45_97058_c1
3407 nmdc:mga05p37_19612_c1
3408 nmdc:mga05p37_3446_c1
3409 nmdc:mga05p37_377892_c1
3410 nmdc:mga05p37_38531_c1
3411 nmdc:mga05p37_82274_c1
3412 nmdc:mga09592_102110_c1
3413 nmdc:mga09592_15413_c1
3414 nmdc:mga09592_5366_c1
3415 nmdc:mga09592_986624_c1
3416 nmdc:mga0qj67_24513_c1
3417 nmdc:mga0qj67_56075_c1
3418 nmdc:mga0qj67_591893_c1
3419 nmdc:mga0qj67_88044_c1
3420 nmdc:mga06r32_235827_c1
3421 nmdc:mga06r32_29589_c1
3422 nmdc:mga06r32_600_c1
3423 nmdc:mga06r32_914153_c1
3424 nmdc:mga08y16_145790_c1
3425 nmdc:mga08y16_300768_c1
3426 nmdc:mga08y16_330478_c1
3427 nmdc:mga08y16_793049_c1
3428 nmdc:mga0n895_10875_c1
3429 nmdc:mga0n895_14066_c1
3430 nmdc:mga0rr50_59956_c1
3431 nmdc:mga0a205_128227_c1
3432 nmdc:mga0a205_36134_c1
3433 nmdc:mga0a205_58582_c1
3434 nmdc:mga0sz30_159519_c1
3435 nmdc:mga0sz30_264560_c1
3436 Ga0500635_0001097
3437 Ga0500635_0080487
3438 Ga0500578_0018628
3439 Ga0500578_0293623
3440 Ga0500644_0096053
3441 Ga0500644_0501588
3442 Ga0500646_0003988
3443 Ga0500646_0022173
3444 Ga0500651_0000124
3445 Ga0500641_0000029
3446 Ga0500641_0003322
3447 Ga0500641_0049673
3448 Ga0500650_0273731
3449 Ga0500594_0020923
3450 Ga0500608_006222
3451 Ga0500608_018016
3452 Ga0500614_008477
3453 Ga0500618_000080
3454 Ga0500618_028226
3455 Ga0500652_086699
3456 Ga0500658_0000006
3457 Ga0500559_0018627
3458 Ga0500561_0045175
3459 Ga0500573_0033087
3460 Ga0500573_0257649
3461 Ga0500616_0130805
3462 Ga0500622_0001219
3463 Ga0500622_0084917
3464 Ga0500622_0290167
3465 Ga0500624_000925
3466 Ga0500584_010431
3467 Ga0587093_006264
3468 Ga0587093_014210
3469 Ga0587093_015105
3470 Ga0587066_037503
3471 Ga0587066_047208
3472 Ga0587066_167584
3473 Ga0587070_064167
3474 Ga0587073_0035653
3475 Ga0587073_0254163
3476 Ga0587077_000327
3477 Ga0587077_005446
3478 Ga0587077_029444
3479 Ga0587077_067958
3480 Ga0587077_147256
3481 Ga0587080_025713
3482 Ga0587080_034069
3483 Ga0587080_069869
3484 Ga0587080_117459
3485 Ga0587083_0012424
3486 Ga0587083_0013735
3487 Ga0587083_0036396
3488 Ga0587085_004592
3489 Ga0587086_027045
3490 Ga0587089_082686
3491 Ga0587090_000102
3492 Ga0587090_018824
3493 Ga0587091_009311
3494 Ga0587091_025972
3495 Ga0587091_085083
3496 Ga0587092_041284
3497 Ga0587092_073173
3498 Ga0587094_050899
3499 Ga0587106_004580
3500 Ga0587125_001886
3501 Ga0587101_032508
3502 Ga0587101_037944
3503 Ga0587101_059563
3504 Ga0587109_024961
3505 Ga0587117_000256
3506 Ga0587117_107560
3507 Ga0587128_003957
3508 Ga0587062_001988
3509 Ga0587067_061713
3510 Ga0587068_017603
3511 Ga0587068_029487
3512 Ga0587068_066075
3513 Ga0587069_041391
3514 Ga0587076_000772
3515 Ga0587076_001127
3516 Ga0587076_020634
3517 Ga0587076_027105
3518 Ga0587076_105265
3519 Ga0587076_161974
3520 Ga0587100_006833
3521 Ga0587105_012794
3522 Ga0587107_012382
3523 Ga0587107_013944
3524 Ga0587108_001109
3525 Ga0587124_001026
3526 Ga0587060_017818
3527 Ga0587061_00281
3528 Ga0587081_01723
3529 2511234222
3530 2513234198
3531 2520881101
3532 2522552600
3533 2524005425
3534 2585142333
3535 2585159825
3536 2585164021
3537 2586210453
3538 2587680916
3539 2587747638
3540 2587751529
3541 2587867303
3542 2587945030
3543 2588210629
3544 2588214126
3545 2588221607
3546 2588223430
3547 2588232642
3548 2588443666
3549 2590601901
3550 2590613363
3551 2599479163
3552 2644011031
3553 2644373886
3554 2644643521
3555 2644683942
3556 2722726630
3557 2729200419
3558 2738699648
3559 2738736999
3560 2738755464
3561 2738763474
3562 2738769539
3563 2738851932
3564 2739218581
3565 2739253397
3566 2739303599
3567 2739590822
3568 2739617017
3569 2739647323
3570 2739999427
3571 2740004244
3572 2740059400
3573 2753673463
3574 2765574568
3575 2772604697
3576 2775671675
3577 2776615088
3578 2802652169
3579 2816874785
3580 2817415027
3581 2819546477
3582 2819573418
3583 2821136838
3584 2833642870
3585 2842085314
3586 2842725173
3587 2842912448
3588 2849286038
3589 2852629338
3590 2857617507
3591 2857621262
3592 2857629754
3593 2871722311
3594 2881250019
3595 2881359952
3596 2889294872
3597 2890738049
3598 2896321221
3599 2896345744
3600 2898713532
3601 2902052509
3602 2903896138
3603 2904421811
3604 2904446637
3605 2904468417
3606 2904559878
3607 2904785860
3608 2906001493
3609 2919099496
3610 2919182478
3611 2919190323
3612 2919195749
3613 2919402438
3614 2919438212
3615 2919510864
3616 2919687966
3617 2928082522
3618 2928148890
3619 2929152201
3620 2932086312
3621 2939668604
3622 2945925749
3623 2946002100
3624 2946023016
3625 2954018998
3626 2958460101
3627 2958514759
3628 2965323019
3629 2977233776
3630 2977244650
3631 2977268898
3632 2984573517
3633 2984606956
3634 2993376059
3635 2993482904
3636 3003235167
3637 8036739390
3638 8054309581
3639 8055419150
3640 8055590023
3641 8055592429
3642 8056442548

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00298

Ribosomal_L11

Ribosomal protein L11, RNA binding domain

85

153

0.99

PF03946

Ribosomal_L11_N

Ribosomal protein L11, N-terminal domain

23

80

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1hc8-assembly2.cif.gz_B crystal structure of a conserved ribosomal protein-rna complex 0.9928 71 140
1mms-assembly2.cif.gz_B crystal structure of the ribosomal protein l11-rna complex 0.9861 71 140
1y39-assembly2.cif.gz_B co-evolution of protein and rna structures within a highly conserved ribosomal domain 0.9859 71 141
1hc8-assembly2.cif.gz_B crystal structure of a conserved ribosomal protein-rna complex 0.979 71 140
5gae-assembly1.cif.gz_J rnc in complex with a translocating secyeg 0.975 71 140
ID Description Score Start End Superfamily
af_I1J9L7_135_215_1.10.10.250 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Ribosomal protein L11/L12, C-terminal domain 0.9954 72 139 1.10.10.250
af_A0A0R4J4M9_4_71_3.30.1550.10 Alpha Beta;2-Layer Sandwich;Ribosomal protein L11, N-terminal domain;Ribosomal protein L11/L12, N-terminal domain 0.9893 3 68 3.30.1550.10
1hc8A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Ribosomal protein L11/L12, C-terminal domain 0.9662 67 140 1.10.10.250
3egvB00 Alpha Beta;2-Layer Sandwich;Ribosomal protein L11, N-terminal domain;Ribosomal protein L11/L12, N-terminal domain 0.9649 3 77 3.30.1550.10
1vq4I00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Ribosomal protein L11/L12, C-terminal domain 0.9643 73 140 1.10.10.250
ID Description Score Start End GO Terms
AF-A0A645A187-F1-model_v4 50S ribosomal protein L11 0.9953 78 141 GO:0003735
GO:0006412
GO:0022625
GO:0070180
AF-A0A2D7JF69-F1-model_v4 50S ribosomal protein L11 0.9936 1 71 GO:0003735
GO:0006412
GO:0022625
GO:0070180
AF-A0A357HFS0-F1-model_v4 50S ribosomal protein L11 0.9936 66 140 GO:0003735
GO:0006412
GO:0022625
GO:0070180
AF-A0A7J4E0X6-F1-model_v4 deleted 0.9935 1 69
AF-A0A4Q0I9F9-F1-model_v4 50S ribosomal protein L11 0.9935 67 140 GO:0003735
GO:0006412
GO:0022625
GO:0070180

Map