F495685

General Info

Members Datasets Scaffolds Average Seq Length
1783 637 1744 124

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100001187|Ga0070706_10000118715
Length 128
Sequence MARIAGVDIPREKRVEIALTYIYGIGLTTSQKVLTATRIDPDTRVKNLTEEETARLREYIDRNPDIQVEGDLRRIVDLNIKRLMEINCYRGIRHRRNLPVHGQRTRTNARTRRGAKKTVAGKKKATKK

Samples

Sample ID Description Type Environment
1 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
2 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
3 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
4 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
5 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
6 2643221714 Streptomyces sp. Root264 Isolate Unclassified
7 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
8 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
9 2808606448 Streptomyces sp. 193411 Isolate Unclassified
10 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
11 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
12 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
13 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
14 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
15 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
16 2867428634 Streptomyces sp. RP5T Isolate Unclassified
17 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
18 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
19 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
20 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
21 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
22 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
23 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
24 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
25 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
26 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
27 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
28 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
29 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
30 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
31 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
32 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
33 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
34 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
35 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
36 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
37 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
38 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
39 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
40 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
41 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
42 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
43 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
44 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
45 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
46 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
47 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
48 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
49 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
50 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
51 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
53 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
54 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
55 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
56 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
57 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
58 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
59 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
60 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
61 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
62 3300004785 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
63 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
64 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
65 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
66 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
67 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
68 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
69 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
70 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
71 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
72 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
73 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
74 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
75 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
76 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
77 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
78 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
79 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
80 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
81 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
82 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
83 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
84 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
85 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
86 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
87 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
88 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
89 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
90 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
91 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
92 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
93 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
94 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
95 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
96 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
97 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
98 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
99 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
100 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
101 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
102 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
103 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
104 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
105 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
106 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
107 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
108 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
109 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
110 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
111 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
112 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
113 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
114 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
115 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
116 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
117 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
118 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
119 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
120 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
121 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
122 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
123 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
124 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
125 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
126 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
127 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
128 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
129 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
130 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
131 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
132 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
133 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
134 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
135 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
136 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
137 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
138 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
139 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
140 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
141 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
142 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
143 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
144 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
145 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
146 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
147 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
148 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
149 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
150 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
151 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
152 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
153 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
154 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
155 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
156 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
157 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
158 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
159 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
160 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
161 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
162 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
163 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
164 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
165 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
166 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
167 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
168 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
169 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
170 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
171 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
172 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
173 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
174 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
175 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
176 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
177 3300013044 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300013045 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300013052 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300013059 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300013062 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
183 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
184 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
185 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
186 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
187 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
188 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
189 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
190 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
191 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
192 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
193 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
194 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
195 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
196 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
197 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
198 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
199 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
200 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
201 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
202 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
203 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
204 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
205 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
206 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
208 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
209 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
210 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
211 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
212 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
213 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
214 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
215 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
216 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
217 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
218 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
219 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
220 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
274 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
275 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
276 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
279 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
280 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
281 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
282 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
283 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
284 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
286 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
287 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
288 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
289 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
290 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
291 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
292 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
293 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
294 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
295 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
296 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
297 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
298 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
299 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
300 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
301 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
303 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
304 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
305 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
306 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
307 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
308 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
309 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
310 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
311 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
312 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
313 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
314 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
315 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
316 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
317 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
318 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
319 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
320 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
321 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
322 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
323 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
324 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
325 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
326 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
327 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
328 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
329 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
330 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
331 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
332 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
333 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
334 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
335 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
336 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
337 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
338 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
339 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
340 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
341 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
342 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
343 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
344 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
345 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
346 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
347 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
348 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
349 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
350 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
351 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
352 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
353 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
354 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
355 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
356 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
357 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
358 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
359 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
360 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
361 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
362 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
363 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
364 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
365 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
366 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
367 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
368 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
369 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
370 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
371 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
372 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
373 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
374 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
375 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
376 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
377 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
378 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
379 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
380 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
382 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
383 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
384 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
385 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
386 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
387 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
388 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
389 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
390 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
391 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
392 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
393 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
394 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
395 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
396 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
397 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
398 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
399 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
400 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
401 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
402 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
403 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
404 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
405 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
406 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
407 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
408 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
409 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
410 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
411 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
412 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
413 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
414 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
415 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
416 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
417 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
418 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
419 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
420 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
421 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
422 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
423 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
424 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
425 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
426 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
427 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
428 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
429 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
430 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
431 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
432 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
433 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
434 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
435 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
436 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
437 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
438 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
439 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
440 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
441 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
442 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
443 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
444 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
445 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
446 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
447 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
448 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
449 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
450 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
451 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
452 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
453 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
454 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
455 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
456 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
457 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
458 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
459 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
460 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
461 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
462 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
463 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
464 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
465 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
466 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
467 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
468 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
469 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
470 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
471 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
472 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
473 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
474 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
475 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
476 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
477 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
478 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
479 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
480 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
481 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
482 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
483 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
484 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
485 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
486 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
487 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
488 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
489 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
490 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
491 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
492 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
493 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
494 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
495 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
496 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
497 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
498 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
499 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
500 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
501 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
502 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
503 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
504 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
505 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
506 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
507 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
508 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
509 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
510 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
511 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
512 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
513 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
514 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
515 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
516 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
517 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
518 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
519 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
520 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
521 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
522 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
523 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
524 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
525 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
526 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
527 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
528 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
529 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
530 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
531 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
532 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
533 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
534 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
535 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
536 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
537 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
538 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
539 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
540 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
541 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
542 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
543 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
544 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
545 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
546 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
547 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
548 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
549 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
550 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
551 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
552 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
553 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
554 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
555 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
556 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
557 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
558 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
559 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
560 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
561 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
562 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
563 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
564 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
565 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
566 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
567 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
568 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
569 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
570 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
571 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
572 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
573 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
574 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
575 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
576 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
577 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
578 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
579 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
580 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
581 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
582 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
583 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
584 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
585 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
586 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
587 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
588 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
589 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
590 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
591 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
592 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
593 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
594 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
595 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
596 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
597 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
598 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
599 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
600 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
601 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
602 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
603 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
604 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
605 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
606 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
607 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
608 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
609 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
610 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
611 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
612 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
613 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
614 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
615 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
616 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
617 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
618 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
619 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
620 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
621 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
622 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
623 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
624 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
625 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
626 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
627 3300059659 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
628 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
629 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
630 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
631 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
632 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
633 8002784119 Frankia sp. AgB1.9 Isolate Nodule
634 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
635 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
636 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
637 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.03
Metatranscriptomes 11.78
Isolates 2.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.85
Nodule 0.06
Rhizoplane 7.12
Rhizosphere 88.5
Stem 0
Stem Tuber 0
Unclassified 2.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1010606 3300001977 Bacteria 1362
2 JGI24747J21853_1004561 3300001978 Bacteria 1249
3 JGI24740J21852_10074867 3300001979 Bacteria 898
4 JGI24739J22299_10014218 3300001989 Bacteria 2896
5 JGI24739J22299_10031467 3300001989 Bacteria 1834
6 JGI24737J22298_10014055 3300001990 Bacteria 2600
7 JGI24737J22298_10255683 3300001990 Bacteria 518
8 JGI24750J21931_1025217 3300002070 Bacteria 852
9 JGI24745J21846_1002378 3300002073 Bacteria 1921
10 JGI24738J21930_10026481 3300002075 Bacteria 1190
11 JGI24744J21845_10009983 3300002077 Bacteria 1947
12 JGI24034J26672_10019434 3300002239 Bacteria 1060
13 JGI24742J22300_10008900 3300002244 Bacteria 1655
14 JGI24751J29686_10064209 3300002459 Bacteria 756
15 JGI25162J39368_1003458 3300002737 Bacteria 4543
16 JGI25164J39214_1000679 3300002772 Bacteria 13579
17 Ga0006778J45830_1037313 3300003162 Bacteria 794
18 Ga0006759J45824_1035239 3300003163 Bacteria 815
19 JGI25406J46586_10006196 3300003203 Bacteria 5524
20 JGI25406J46586_10008605 3300003203 Bacteria 4610
21 JGI25165J46597_1000061 3300003214 Bacteria 208362
22 Ga0007416J51690_1057683 3300003577 Bacteria 1204
23 Ga0007429J51699_1088480 3300003579 Bacteria 742
24 Ga0007429J51699_1088481 3300003579 Bacteria 776
25 Ga0032354_1022066 3300003693 Bacteria 1153
26 Ga0055539_1000808 3300003752 Bacteria 7414
27 Ga0055533_1000001 3300003756 Bacteria 1863437
28 Ga0055527_1000017 3300003760 Bacteria 242362
29 Ga0055542_1000044 3300003762 Bacteria 206982
30 Ga0055529_1000279 3300003763 Bacteria 60946
31 Ga0055529_1039149 3300003763 Bacteria 575
32 Ga0055541_1009606 3300003841 Bacteria 1486
33 Ga0058858_1434606 3300004785 Bacteria 717
34 Ga0058859_10032894 3300004798 Bacteria 546
35 Ga0058863_10079837 3300004799 Bacteria 692
36 Ga0058863_10092482 3300004799 Bacteria 1125
37 Ga0058863_11902506 3300004799 Bacteria 1252
38 Ga0058863_11911031 3300004799 Bacteria 689
39 Ga0058861_10002618 3300004800 Bacteria 723
40 Ga0058861_10039056 3300004800 Bacteria 1500
41 Ga0058861_10046230 3300004800 Bacteria 559
42 Ga0058861_10088000 3300004800 Bacteria 1031
43 Ga0058861_11840072 3300004800 Bacteria 735
44 Ga0058861_12025964 3300004800 Bacteria 832
45 Ga0058860_10225518 3300004801 Bacteria 1295
46 Ga0058860_12169112 3300004801 Bacteria 1029
47 Ga0058860_12198917 3300004801 Bacteria 692
48 Ga0058862_10139641 3300004803 Bacteria 1053
49 Ga0058862_10153948 3300004803 Bacteria 600
50 Ga0058862_10202782 3300004803 Bacteria 1521
51 Ga0058862_10277273 3300004803 Bacteria 545
52 Ga0058862_12205953 3300004803 Bacteria 985
53 Ga0058862_12730137 3300004803 Bacteria 1272
54 Ga0065714_10021838 3300005288 Bacteria 1673
55 Ga0070658_10028535 3300005327 Bacteria 4481
56 Ga0070658_10028947 3300005327 Bacteria 4448
57 Ga0070658_10258464 3300005327 Bacteria 1479
58 Ga0070658_10271826 3300005327 Bacteria 1441
59 Ga0070658_11038680 3300005327 Bacteria 713
60 Ga0070676_10224730 3300005328 Bacteria 1242
61 Ga0070676_10414025 3300005328 Bacteria 940
62 Ga0070683_100029975 3300005329 Bacteria 4933
63 Ga0070683_100274263 3300005329 Bacteria 1604
64 Ga0070683_100285358 3300005329 Bacteria 1570
65 Ga0070683_100306297 3300005329 Bacteria 1511
66 Ga0070683_100332725 3300005329 Bacteria 1446
67 Ga0070683_100346506 3300005329 Bacteria 1415
68 Ga0070683_100481930 3300005329 Bacteria 1184
69 Ga0070690_100194908 3300005330 Bacteria 1407
70 Ga0070690_100396542 3300005330 Bacteria 1012
71 Ga0070690_100523026 3300005330 Bacteria 891
72 Ga0070690_100645872 3300005330 Bacteria 808
73 Ga0070690_100835503 3300005330 Bacteria 716
74 Ga0070670_100568059 3300005331 Bacteria 1013
75 Ga0070670_101091103 3300005331 Bacteria 728
76 Ga0070677_10336382 3300005333 Bacteria 778
77 Ga0068869_100012691 3300005334 Bacteria 5573
78 Ga0068869_100062239 3300005334 Bacteria 2739
79 Ga0068869_100168006 3300005334 Bacteria 1712
80 Ga0068869_100509726 3300005334 Bacteria 1006
81 Ga0068869_101838502 3300005334 Bacteria 542
82 Ga0070680_100000015 3300005336 Bacteria 93646
83 Ga0070680_100033020 3300005336 Bacteria 4168
84 Ga0070680_100093789 3300005336 Bacteria 2487
85 Ga0070680_100153032 3300005336 Bacteria 1937
86 Ga0070680_100356170 3300005336 Bacteria 1244
87 Ga0070680_100432224 3300005336 Bacteria 1124
88 Ga0070680_100834179 3300005336 Bacteria 795
89 Ga0070682_100011705 3300005337 Bacteria 5016
90 Ga0070682_100203653 3300005337 Bacteria 1398
91 Ga0070682_100236792 3300005337 Bacteria 1308
92 Ga0070682_100246860 3300005337 Bacteria 1285
93 Ga0068868_100005144 3300005338 Bacteria 9183
94 Ga0068868_100122450 3300005338 Bacteria 2122
95 Ga0068868_100382455 3300005338 Bacteria 1211
96 Ga0068868_100459711 3300005338 Bacteria 1108
97 Ga0070660_100059135 3300005339 Bacteria 2972
98 Ga0070660_100128075 3300005339 Bacteria 2030
99 Ga0070660_100134654 3300005339 Bacteria 1979
100 Ga0070660_100329375 3300005339 Bacteria 1255
101 Ga0070689_100029463 3300005340 Bacteria 4155
102 Ga0070689_100158604 3300005340 Bacteria 1828
103 Ga0070689_100818584 3300005340 Bacteria 820
104 Ga0070691_10003867 3300005341 Bacteria 6767
105 Ga0070691_10024314 3300005341 Bacteria 2816
106 Ga0070691_10043635 3300005341 Bacteria 2125
107 Ga0070691_10206936 3300005341 Bacteria 1033
108 Ga0070687_100127109 3300005343 Bacteria 1467
109 Ga0070687_100232399 3300005343 Bacteria 1135
110 Ga0070687_101369961 3300005343 Bacteria 528
111 Ga0070661_101478697 3300005344 Bacteria 573
112 Ga0070692_10102432 3300005345 Bacteria 1571
113 Ga0070692_10510609 3300005345 Bacteria 781
114 Ga0070692_10621542 3300005345 Bacteria 717
115 Ga0070668_100646667 3300005347 Bacteria 929
116 Ga0070668_100713017 3300005347 Bacteria 885
117 Ga0070668_100729157 3300005347 Bacteria 876
118 Ga0070669_100478705 3300005353 Bacteria 1030
119 Ga0070669_101260253 3300005353 Bacteria 640
120 Ga0070675_100082776 3300005354 Bacteria 2678
121 Ga0070675_100095801 3300005354 Bacteria 2492
122 Ga0070675_100253957 3300005354 Bacteria 1539
123 Ga0070675_100417906 3300005354 Bacteria 1199
124 Ga0070675_100760983 3300005354 Bacteria 884
125 Ga0070675_101504990 3300005354 Bacteria 621
126 Ga0070671_100060488 3300005355 Bacteria 3154
127 Ga0070671_100151685 3300005355 Bacteria 1957
128 Ga0070671_100341891 3300005355 Bacteria 1277
129 Ga0070671_100385131 3300005355 Bacteria 1199
130 Ga0070671_100455397 3300005355 Bacteria 1098
131 Ga0070674_100041590 3300005356 Bacteria 3116
132 Ga0070674_100238837 3300005356 Bacteria 1421
133 Ga0070674_100305444 3300005356 Bacteria 1270
134 Ga0070674_101879946 3300005356 Bacteria 544
135 Ga0070673_100019981 3300005364 Bacteria 4821
136 Ga0070673_100296296 3300005364 Bacteria 1423
137 Ga0070688_100043252 3300005365 Bacteria 2774
138 Ga0070688_100123596 3300005365 Bacteria 1736
139 Ga0070659_100012148 3300005366 Bacteria 6380
140 Ga0070659_100018706 3300005366 Bacteria 5230
141 Ga0070659_100126270 3300005366 Bacteria 2075
142 Ga0070659_100179838 3300005366 Bacteria 1735
143 Ga0070667_100644816 3300005367 Bacteria 978
144 Ga0070667_100882763 3300005367 Bacteria 832
145 Ga0070703_10026297 3300005406 Bacteria 1730
146 Ga0070709_10186968 3300005434 Bacteria 1459
147 Ga0070714_100005269 3300005435 Bacteria 9852
148 Ga0070714_101557988 3300005435 Bacteria 645
149 Ga0070713_100081990 3300005436 Bacteria 2753
150 Ga0070710_10029185 3300005437 Bacteria 2957
151 Ga0070710_10090852 3300005437 Bacteria 1801
152 Ga0070710_10233310 3300005437 Bacteria 1176
153 Ga0070701_10014791 3300005438 Bacteria 3587
154 Ga0070701_10218853 3300005438 Bacteria 1134
155 Ga0070701_10751579 3300005438 Bacteria 661
156 Ga0070711_100019741 3300005439 Bacteria 4329
157 Ga0070711_100030873 3300005439 Bacteria 3552
158 Ga0070705_100012679 3300005440 Bacteria 4292
159 Ga0070705_100064677 3300005440 Bacteria 2186
160 Ga0070705_100117451 3300005440 Bacteria 1711
161 Ga0070705_100212079 3300005440 Bacteria 1335
162 Ga0070705_100856494 3300005440 Bacteria 728
163 Ga0070700_100014624 3300005441 Bacteria 4434
164 Ga0070700_100117428 3300005441 Bacteria 1777
165 Ga0070700_100181285 3300005441 Bacteria 1466
166 Ga0070700_100409710 3300005441 Bacteria 1021
167 Ga0070700_101440306 3300005441 Bacteria 584
168 Ga0070694_100072132 3300005444 Bacteria 2382
169 Ga0070694_100213642 3300005444 Bacteria 1444
170 Ga0070694_100330046 3300005444 Bacteria 1176
171 Ga0070694_100648214 3300005444 Bacteria 854
172 Ga0070708_100015734 3300005445 Bacteria 6252
173 Ga0070708_100127832 3300005445 Bacteria 2350
174 Ga0070708_100737148 3300005445 Bacteria 927
175 Ga0070708_100770417 3300005445 Bacteria 905
176 Ga0070663_100177563 3300005455 Bacteria 1649
177 Ga0070663_100288192 3300005455 Bacteria 1311
178 Ga0070663_100405282 3300005455 Bacteria 1115
179 Ga0070663_100721741 3300005455 Bacteria 849
180 Ga0070663_100739854 3300005455 Bacteria 839
181 Ga0070663_101787956 3300005455 Bacteria 551
182 Ga0070678_100058968 3300005456 Bacteria 2819
183 Ga0070678_100068279 3300005456 Bacteria 2649
184 Ga0070678_100524499 3300005456 Bacteria 1048
185 Ga0070678_100550805 3300005456 Bacteria 1024
186 Ga0070662_100494365 3300005457 Bacteria 1020
187 Ga0070662_100565695 3300005457 Bacteria 954
188 Ga0070681_10128448 3300005458 Bacteria 2467
189 Ga0070681_10166145 3300005458 Bacteria 2129
190 Ga0070681_10377690 3300005458 Bacteria 1328
191 Ga0070681_10471198 3300005458 Bacteria 1168
192 Ga0070681_11316024 3300005458 Bacteria 645
193 Ga0068867_100049389 3300005459 Bacteria 3097
194 Ga0068867_100261733 3300005459 Bacteria 1410
195 Ga0068867_100470533 3300005459 Bacteria 1075
196 Ga0070685_10030710 3300005466 Bacteria 2996
197 Ga0070685_10067598 3300005466 Bacteria 2108
198 Ga0070706_100001187 3300005467 Bacteria 27899
199 Ga0070706_100011787 3300005467 Bacteria 8115
200 Ga0070706_100531095 3300005467 Bacteria 1094
201 Ga0070707_100005867 3300005468 Bacteria 11451
202 Ga0070707_100038225 3300005468 Bacteria 4583
203 Ga0070707_100064600 3300005468 Bacteria 3514
204 Ga0070707_100223342 3300005468 Bacteria 1834
205 Ga0070707_101013754 3300005468 Bacteria 796
206 Ga0070698_100094301 3300005471 Bacteria 2972
207 Ga0070698_100104288 3300005471 Bacteria 2805
208 Ga0070698_102076193 3300005471 Bacteria 522
209 Ga0070699_100058035 3300005518 Bacteria 3352
210 Ga0070679_100025472 3300005530 Bacteria 5805
211 Ga0070679_100038792 3300005530 Bacteria 4736
212 Ga0070679_100575647 3300005530 Bacteria 1070
213 Ga0070679_101455700 3300005530 Bacteria 632
214 Ga0070679_101882188 3300005530 Bacteria 547
215 Ga0070684_100051018 3300005535 Bacteria 3594
216 Ga0070684_100076715 3300005535 Bacteria 2950
217 Ga0070684_100092545 3300005535 Bacteria 2690
218 Ga0070684_100114067 3300005535 Bacteria 2425
219 Ga0070684_100308206 3300005535 Bacteria 1453
220 Ga0070684_100454164 3300005535 Bacteria 1184
221 Ga0070684_100520389 3300005535 Bacteria 1102
222 Ga0070684_100721633 3300005535 Bacteria 930
223 Ga0070697_100025528 3300005536 Bacteria 4713
224 Ga0070697_100055682 3300005536 Bacteria 3216
225 Ga0070697_100098342 3300005536 Bacteria 2428
226 Ga0070697_100316355 3300005536 Bacteria 1344
227 Ga0070697_100758674 3300005536 Bacteria 857
228 Ga0070697_102107727 3300005536 Bacteria 505
229 Ga0068853_100047078 3300005539 Bacteria 3701
230 Ga0068853_100167867 3300005539 Bacteria 1984
231 Ga0068853_100353953 3300005539 Bacteria 1366
232 Ga0068853_101812360 3300005539 Bacteria 592
233 Ga0068853_102263871 3300005539 Bacteria 527
234 Ga0070672_100130525 3300005543 Bacteria 2064
235 Ga0070672_100823102 3300005543 Bacteria 818
236 Ga0070686_100008884 3300005544 Bacteria 5633
237 Ga0070686_100042639 3300005544 Bacteria 2843
238 Ga0070686_100200306 3300005544 Bacteria 1431
239 Ga0070686_100814129 3300005544 Bacteria 754
240 Ga0070695_100156634 3300005545 Bacteria 1595
241 Ga0070695_100206721 3300005545 Bacteria 1406
242 Ga0070695_100577631 3300005545 Bacteria 879
243 Ga0070696_100006963 3300005546 Bacteria 7545
244 Ga0070696_100082401 3300005546 Bacteria 2280
245 Ga0070696_100082497 3300005546 Bacteria 2279
246 Ga0070696_100116381 3300005546 Bacteria 1930
247 Ga0070696_100260895 3300005546 Bacteria 1314
248 Ga0070696_100288614 3300005546 Bacteria 1253
249 Ga0070696_100318727 3300005546 Bacteria 1196
250 Ga0070696_100534091 3300005546 Bacteria 937
251 Ga0070696_100617234 3300005546 Bacteria 876
252 Ga0070696_100885697 3300005546 Bacteria 740
253 Ga0070696_101576902 3300005546 Bacteria 563
254 Ga0070693_100011341 3300005547 Bacteria 4488
255 Ga0070693_100045839 3300005547 Bacteria 2480
256 Ga0070693_100139888 3300005547 Bacteria 1522
257 Ga0070693_100353398 3300005547 Bacteria 1006
258 Ga0070693_100355640 3300005547 Bacteria 1004
259 Ga0070693_100598675 3300005547 Bacteria 795
260 Ga0070665_100355567 3300005548 Bacteria 1470
261 Ga0070665_100360118 3300005548 Bacteria 1460
262 Ga0070704_100016174 3300005549 Bacteria 4709
263 Ga0070704_100866435 3300005549 Bacteria 810
264 Ga0070704_100879611 3300005549 Bacteria 805
265 Ga0068855_100026947 3300005563 Bacteria 6877
266 Ga0068855_100052631 3300005563 Bacteria 4792
267 Ga0068855_100066868 3300005563 Bacteria 4189
268 Ga0068855_101539999 3300005563 Bacteria 682
269 Ga0068855_102164059 3300005563 Bacteria 559
270 Ga0070664_100010033 3300005564 Bacteria 7675
271 Ga0070664_100100347 3300005564 Bacteria 2517
272 Ga0070664_100217308 3300005564 Bacteria 1709
273 Ga0070664_101278998 3300005564 Bacteria 693
274 Ga0070664_101783163 3300005564 Bacteria 584
275 Ga0068857_100129395 3300005577 Bacteria 2276
276 Ga0068857_100481910 3300005577 Bacteria 1162
277 Ga0068857_100670337 3300005577 Bacteria 984
278 Ga0068857_101846732 3300005577 Bacteria 592
279 Ga0068854_100030804 3300005578 Bacteria 3724
280 Ga0068854_101577851 3300005578 Bacteria 598
281 Ga0068856_100048606 3300005614 Bacteria 4181
282 Ga0068856_100061274 3300005614 Bacteria 3716
283 Ga0068856_100102656 3300005614 Bacteria 2853
284 Ga0068856_100230255 3300005614 Bacteria 1868
285 Ga0068856_100290876 3300005614 Bacteria 1650
286 Ga0068856_100366475 3300005614 Bacteria 1459
287 Ga0070702_100016072 3300005615 Bacteria 3833
288 Ga0070702_100161541 3300005615 Bacteria 1449
289 Ga0070702_100234700 3300005615 Bacteria 1234
290 Ga0068852_100082296 3300005616 Bacteria 2860
291 Ga0068852_100132206 3300005616 Bacteria 2299
292 Ga0068852_100302958 3300005616 Bacteria 1547
293 Ga0068852_101304543 3300005616 Bacteria 748
294 Ga0068852_102847750 3300005616 Bacteria 502
295 Ga0068859_100038389 3300005617 Bacteria 4805
296 Ga0068859_101887037 3300005617 Bacteria 660
297 Ga0068864_100083353 3300005618 Bacteria 2808
298 Ga0068864_100571654 3300005618 Bacteria 1094
299 Ga0068866_10036626 3300005718 Bacteria 2404
300 Ga0068866_10136583 3300005718 Bacteria 1402
301 Ga0068866_10712135 3300005718 Bacteria 690
302 Ga0068861_100105850 3300005719 Bacteria 2246
303 Ga0068861_100316610 3300005719 Bacteria 1358
304 Ga0068861_100482997 3300005719 Bacteria 1116
305 Ga0068861_100893563 3300005719 Bacteria 841
306 Ga0068861_101168994 3300005719 Bacteria 742
307 Ga0068861_102551714 3300005719 Bacteria 515
308 Ga0068851_10282940 3300005834 Bacteria 949
309 Ga0068870_10084742 3300005840 Bacteria 1760
310 Ga0068870_10934948 3300005840 Bacteria 614
311 Ga0068863_100260616 3300005841 Bacteria 1676
312 Ga0068863_100344654 3300005841 Bacteria 1450
313 Ga0068858_100046786 3300005842 Bacteria 4010
314 Ga0068858_100161047 3300005842 Bacteria 2113
315 Ga0068858_100693419 3300005842 Bacteria 991
316 Ga0068860_100027971 3300005843 Bacteria 5429
317 Ga0068860_100344499 3300005843 Bacteria 1466
318 Ga0068860_100505616 3300005843 Bacteria 1207
319 Ga0068860_100928713 3300005843 Bacteria 887
320 Ga0068862_100395989 3300005844 Bacteria 1291
321 Ga0068862_100556312 3300005844 Bacteria 1096
322 Ga0068862_101352363 3300005844 Bacteria 715
323 Ga0081455_10047065 3300005937 Bacteria 3738
324 Ga0081455_10236082 3300005937 Bacteria 1346
325 Ga0081539_10003252 3300005985 Bacteria 20412
326 Ga0081539_10012303 3300005985 Bacteria 6619
327 Ga0070717_10033904 3300006028 Bacteria 4122
328 Ga0070717_10047424 3300006028 Bacteria 3520
329 Ga0070717_10241231 3300006028 Bacteria 1594
330 Ga0075364_10055931 3300006051 Bacteria 2582
331 Ga0075432_10015139 3300006058 Bacteria 2629
332 Ga0070716_100545422 3300006173 Bacteria 863
333 Ga0070716_101271164 3300006173 Bacteria 594
334 Ga0070712_100012347 3300006175 Bacteria 5428
335 Ga0070712_100266878 3300006175 Bacteria 1374
336 Ga0097621_100013802 3300006237 Bacteria 6030
337 Ga0097621_100024219 3300006237 Bacteria 4737
338 Ga0097621_100355537 3300006237 Bacteria 1304
339 Ga0097621_100587813 3300006237 Bacteria 1016
340 Ga0097621_100810564 3300006237 Bacteria 868
341 Ga0075370_10264234 3300006353 Bacteria 1021
342 Ga0068871_100027934 3300006358 Bacteria 4418
343 Ga0075428_100000694 3300006844 Bacteria 34739
344 Ga0075428_100004768 3300006844 Bacteria 15015
345 Ga0075428_100294355 3300006844 Bacteria 1746
346 Ga0075428_100587336 3300006844 Bacteria 1190
347 Ga0075433_10043437 3300006852 Bacteria 3901
348 Ga0075433_10080542 3300006852 Bacteria 2871
349 Ga0075433_10178155 3300006852 Bacteria 1891
350 Ga0075433_10210759 3300006852 Bacteria 1727
351 Ga0075433_10345789 3300006852 Bacteria 1314
352 Ga0075434_100007021 3300006871 Bacteria 10385
353 Ga0075434_100233167 3300006871 Bacteria 1860
354 Ga0075434_100260368 3300006871 Bacteria 1754
355 Ga0075434_100261099 3300006871 Bacteria 1751
356 Ga0075434_100268762 3300006871 Bacteria 1725
357 Ga0075434_100278696 3300006871 Bacteria 1692
358 Ga0075434_100438986 3300006871 Bacteria 1327
359 Ga0075434_101034808 3300006871 Bacteria 835
360 Ga0075429_100411179 3300006880 Bacteria 1185
361 Ga0075429_100626261 3300006880 Bacteria 942
362 Ga0068865_100031053 3300006881 Bacteria 3559
363 Ga0068865_100064080 3300006881 Bacteria 2586
364 Ga0068865_100140491 3300006881 Bacteria 1820
365 Ga0068865_100163955 3300006881 Bacteria 1698
366 Ga0068865_102057633 3300006881 Bacteria 519
367 Ga0075436_100073498 3300006914 Bacteria 2366
368 Ga0097620_100038389 3300006931 Bacteria 4805
369 Ga0097620_101887085 3300006931 Bacteria 660
370 Ga0075435_100013055 3300007076 Bacteria 6169
371 Ga0075435_100167058 3300007076 Bacteria 1855
372 Ga0075435_100621124 3300007076 Bacteria 937
373 Ga0075435_100730755 3300007076 Bacteria 861
374 Ga0105240_10142595 3300009093 Bacteria 2863
375 Ga0105240_10535128 3300009093 Bacteria 1298
376 Ga0111539_10008690 3300009094 Bacteria 12890
377 Ga0111539_10148167 3300009094 Bacteria 2748
378 Ga0111539_11913215 3300009094 Bacteria 688
379 Ga0111539_12017782 3300009094 Bacteria 669
380 Ga0105245_10036956 3300009098 Bacteria 4340
381 Ga0105245_10048434 3300009098 Bacteria 3802
382 Ga0105245_10091660 3300009098 Bacteria 2797
383 Ga0105245_10251918 3300009098 Bacteria 1716
384 Ga0105245_10484083 3300009098 Bacteria 1251
385 Ga0105245_10778720 3300009098 Bacteria 994
386 Ga0105245_10874176 3300009098 Bacteria 940
387 Ga0105247_10046136 3300009101 Bacteria 2674
388 Ga0105247_10907461 3300009101 Bacteria 681
389 Ga0114129_10009938 3300009147 Bacteria 13563
390 Ga0114129_10015434 3300009147 Bacteria 10865
391 Ga0114129_10022103 3300009147 Bacteria 9026
392 Ga0105243_10035607 3300009148 Bacteria 3860
393 Ga0105243_10152057 3300009148 Bacteria 1986
394 Ga0105243_10422171 3300009148 Bacteria 1244
395 Ga0105243_10718801 3300009148 Bacteria 976
396 Ga0105243_10955436 3300009148 Bacteria 856
397 Ga0105243_10997357 3300009148 Bacteria 840
398 Ga0105241_10023878 3300009174 Bacteria 4538
399 Ga0105241_10189650 3300009174 Bacteria 1711
400 Ga0105241_10382493 3300009174 Bacteria 1230
401 Ga0105241_10411926 3300009174 Bacteria 1188
402 Ga0105242_10081594 3300009176 Bacteria 2705
403 Ga0105242_10104555 3300009176 Bacteria 2404
404 Ga0105242_10106171 3300009176 Bacteria 2386
405 Ga0105242_10117748 3300009176 Bacteria 2275
406 Ga0105242_10254553 3300009176 Bacteria 1583
407 Ga0105242_10843581 3300009176 Bacteria 911
408 Ga0105242_11392689 3300009176 Bacteria 728
409 Ga0105248_10105254 3300009177 Bacteria 3181
410 Ga0105248_10421419 3300009177 Bacteria 1503
411 Ga0105248_10556440 3300009177 Bacteria 1294
412 Ga0105248_10621293 3300009177 Bacteria 1219
413 Ga0105237_10037185 3300009545 Bacteria 4922
414 Ga0105237_10358146 3300009545 Bacteria 1463
415 Ga0105237_11194597 3300009545 Bacteria 767
416 Ga0105238_10017104 3300009551 Bacteria 7360
417 Ga0105238_10069677 3300009551 Bacteria 3517
418 Ga0105238_10366945 3300009551 Bacteria 1430
419 Ga0105238_10369097 3300009551 Bacteria 1425
420 Ga0105238_10450806 3300009551 Bacteria 1283
421 Ga0105249_10283460 3300009553 Bacteria 1655
422 Ga0105249_10689710 3300009553 Bacteria 1081
423 Ga0105249_10772853 3300009553 Bacteria 1023
424 Ga0105249_11107463 3300009553 Bacteria 862
425 Ga0105249_11995395 3300009553 Bacteria 653
426 Ga0105029_112195 3300009984 Bacteria 666
427 Ga0105239_10226875 3300010375 Bacteria 2095
428 Ga0105239_10389075 3300010375 Bacteria 1577
429 Ga0105239_10427946 3300010375 Bacteria 1500
430 Ga0105239_10442962 3300010375 Bacteria 1473
431 Ga0105239_10466363 3300010375 Bacteria 1434
432 Ga0105239_10557683 3300010375 Bacteria 1305
433 Ga0105239_11495136 3300010375 Bacteria 780
434 Ga0105246_10049177 3300011119 Bacteria 2886
435 Ga0105246_10057920 3300011119 Bacteria 2683
436 Ga0105246_10177519 3300011119 Bacteria 1637
437 Ga0105246_10182799 3300011119 Bacteria 1616
438 Ga0105246_10287073 3300011119 Bacteria 1323
439 Ga0105246_11105564 3300011119 Bacteria 724
440 Ga0157341_1023156 3300012494 Bacteria 626
441 Ga0154019_108401 3300013044 Bacteria 1138
442 Ga0154016_109853 3300013045 Bacteria 723
443 Ga0154014_155088 3300013052 Bacteria 1086
444 Ga0154012_174592 3300013059 Bacteria 1223
445 Ga0154010_169846 3300013062 Bacteria 1093
446 Ga0157373_10129520 3300013100 Bacteria 1774
447 Ga0157373_10252116 3300013100 Bacteria 1248
448 Ga0157373_10269428 3300013100 Bacteria 1205
449 Ga0157371_10917546 3300013102 Bacteria 665
450 Ga0157371_11319145 3300013102 Bacteria 559
451 Ga0157370_10288553 3300013104 Bacteria 1516
452 Ga0157370_10472846 3300013104 Bacteria 1152
453 Ga0157370_10645810 3300013104 Bacteria 967
454 Ga0157370_10868953 3300013104 Bacteria 819
455 Ga0157369_10040784 3300013105 Bacteria 5068
456 Ga0157369_10054751 3300013105 Bacteria 4307
457 Ga0157369_10160525 3300013105 Bacteria 2373
458 Ga0157369_10368741 3300013105 Bacteria 1491
459 Ga0157369_10490498 3300013105 Bacteria 1271
460 Ga0157369_11135253 3300013105 Bacteria 798
461 Ga0157369_11734600 3300013105 Bacteria 634
462 Ga0157374_10524581 3300013296 Bacteria 1190
463 Ga0157374_10959560 3300013296 Bacteria 874
464 Ga0157374_11907935 3300013296 Bacteria 620
465 Ga0157378_10151859 3300013297 Bacteria 2159
466 Ga0157378_10266849 3300013297 Bacteria 1644
467 Ga0157378_10284059 3300013297 Bacteria 1596
468 Ga0157378_10428887 3300013297 Bacteria 1308
469 Ga0157378_10724113 3300013297 Bacteria 1016
470 Ga0157378_11885732 3300013297 Bacteria 647
471 Ga0157378_13075037 3300013297 Bacteria 518
472 Ga0163162_10046453 3300013306 Bacteria 4353
473 Ga0163162_10099425 3300013306 Bacteria 3000
474 Ga0163162_10414718 3300013306 Bacteria 1479
475 Ga0163162_10415409 3300013306 Bacteria 1478
476 Ga0163162_10415666 3300013306 Bacteria 1477
477 Ga0163162_10432833 3300013306 Bacteria 1448
478 Ga0163162_11026675 3300013306 Bacteria 933
479 Ga0163162_11356503 3300013306 Bacteria 809
480 Ga0163162_11863438 3300013306 Bacteria 688
481 Ga0157372_10046776 3300013307 Bacteria 4804
482 Ga0157372_10060128 3300013307 Bacteria 4251
483 Ga0157372_10079691 3300013307 Bacteria 3704
484 Ga0157372_10418862 3300013307 Bacteria 1561
485 Ga0157372_10555161 3300013307 Bacteria 1339
486 Ga0157372_10743218 3300013307 Bacteria 1141
487 Ga0157372_10883289 3300013307 Bacteria 1037
488 Ga0157372_11425747 3300013307 Bacteria 798
489 Ga0157372_11487203 3300013307 Bacteria 780
490 Ga0157372_11630064 3300013307 Bacteria 743
491 Ga0157375_10064914 3300013308 Bacteria 3637
492 Ga0157375_10139200 3300013308 Bacteria 2553
493 Ga0157375_10316555 3300013308 Bacteria 1725
494 Ga0157375_10525836 3300013308 Bacteria 1346
495 Ga0157375_10724968 3300013308 Bacteria 1147
496 Ga0157375_11946183 3300013308 Bacteria 698
497 Ga0163163_10096702 3300014325 Bacteria 2974
498 Ga0163163_10176943 3300014325 Bacteria 2180
499 Ga0163163_10208613 3300014325 Bacteria 2002
500 Ga0163163_10268245 3300014325 Bacteria 1758
501 Ga0163163_10339457 3300014325 Bacteria 1557
502 Ga0163163_11371723 3300014325 Bacteria 769
503 Ga0163163_13039115 3300014325 Bacteria 523
504 Ga0157380_10047519 3300014326 Bacteria 3377
505 Ga0157380_10288228 3300014326 Bacteria 1506
506 Ga0157380_10376954 3300014326 Bacteria 1337
507 Ga0157380_10400833 3300014326 Bacteria 1302
508 Ga0157380_10572893 3300014326 Bacteria 1112
509 Ga0157380_11516359 3300014326 Bacteria 724
510 Ga0157380_11524265 3300014326 Bacteria 722
511 Ga0157380_12711699 3300014326 Bacteria 562
512 Ga0157377_10026594 3300014745 Bacteria 3098
513 Ga0157377_10314041 3300014745 Bacteria 1039
514 Ga0157377_10356594 3300014745 Bacteria 983
515 Ga0157377_10592670 3300014745 Bacteria 789
516 Ga0157377_10928095 3300014745 Bacteria 653
517 Ga0157377_11023182 3300014745 Bacteria 627
518 Ga0157379_10147410 3300014968 Bacteria 2122
519 Ga0157379_10325637 3300014968 Bacteria 1403
520 Ga0157379_10431168 3300014968 Bacteria 1215
521 Ga0157379_10531124 3300014968 Bacteria 1093
522 Ga0157379_11248177 3300014968 Bacteria 716
523 Ga0157379_11739537 3300014968 Bacteria 611
524 Ga0157379_12341885 3300014968 Bacteria 532
525 Ga0157376_10045570 3300014969 Bacteria 3612
526 Ga0157376_10046239 3300014969 Bacteria 3588
527 Ga0157376_10087652 3300014969 Bacteria 2687
528 Ga0157376_10570685 3300014969 Bacteria 1122
529 Ga0157376_11387150 3300014969 Bacteria 734
530 Ga0157376_11728483 3300014969 Bacteria 661
531 Ga0157376_12257065 3300014969 Bacteria 583
532 Ga0163161_10081962 3300017792 Bacteria 2376
533 Ga0163161_10105842 3300017792 Bacteria 2099
534 Ga0163161_12029694 3300017792 Bacteria 511
535 Ga0197907_10050194 3300020069 Bacteria 1325
536 Ga0197907_10086159 3300020069 Bacteria 1008
537 Ga0197907_10212903 3300020069 Bacteria 772
538 Ga0197907_10268076 3300020069 Bacteria 952
539 Ga0197907_10378803 3300020069 Bacteria 1042
540 Ga0197907_10533934 3300020069 Bacteria 1607
541 Ga0197907_10881670 3300020069 Bacteria 764
542 Ga0197907_11286071 3300020069 Bacteria 1575
543 Ga0197907_11298433 3300020069 Bacteria 709
544 Ga0197907_11482061 3300020069 Bacteria 807
545 Ga0206356_10124042 3300020070 Bacteria 611
546 Ga0206356_10200830 3300020070 Bacteria 593
547 Ga0206356_10361125 3300020070 Bacteria 1257
548 Ga0206356_10509057 3300020070 Bacteria 916
549 Ga0206356_10516737 3300020070 Bacteria 5046
550 Ga0206356_10824910 3300020070 Bacteria 2830
551 Ga0206356_10913331 3300020070 Bacteria 1383
552 Ga0206356_11044350 3300020070 Bacteria 657
553 Ga0206356_11156669 3300020070 Bacteria 1263
554 Ga0206356_11286683 3300020070 Bacteria 874
555 Ga0206349_1386548 3300020075 Bacteria 1246
556 Ga0206349_1530271 3300020075 Bacteria 614
557 Ga0206349_1613375 3300020075 Bacteria 1472
558 Ga0206355_1018340 3300020076 Bacteria 583
559 Ga0206355_1035334 3300020076 Bacteria 2191
560 Ga0206355_1055070 3300020076 Bacteria 877
561 Ga0206355_1328705 3300020076 Bacteria 1923
562 Ga0206355_1630452 3300020076 Bacteria 526
563 Ga0206351_10072365 3300020077 Bacteria 2191
564 Ga0206351_10093131 3300020077 Bacteria 1078
565 Ga0206351_10468617 3300020077 Bacteria 1652
566 Ga0206351_10495414 3300020077 Bacteria 1010
567 Ga0206351_10796045 3300020077 Bacteria 952
568 Ga0206351_10858444 3300020077 Bacteria 1021
569 Ga0206352_10254721 3300020078 Bacteria 837
570 Ga0206352_10314452 3300020078 Bacteria 856
571 Ga0206352_10341291 3300020078 Bacteria 602
572 Ga0206352_10408147 3300020078 Bacteria 984
573 Ga0206352_10649957 3300020078 Bacteria 959
574 Ga0206352_10815645 3300020078 Bacteria 1286
575 Ga0206352_10939620 3300020078 Bacteria 793
576 Ga0206352_11168067 3300020078 Bacteria 999
577 Ga0206352_11295788 3300020078 Bacteria 658
578 Ga0206350_10430818 3300020080 Bacteria 1907
579 Ga0206350_10432378 3300020080 Bacteria 1085
580 Ga0206350_10544636 3300020080 Bacteria 3726
581 Ga0206350_11196555 3300020080 Bacteria 1542
582 Ga0206350_11654020 3300020080 Bacteria 1018
583 Ga0206354_10074904 3300020081 Bacteria 569
584 Ga0206354_10208883 3300020081 Bacteria 628
585 Ga0206354_10331979 3300020081 Bacteria 1229
586 Ga0206354_11017939 3300020081 Bacteria 836
587 Ga0206354_11068226 3300020081 Bacteria 586
588 Ga0206354_11172408 3300020081 Bacteria 1283
589 Ga0206354_11291340 3300020081 Bacteria 746
590 Ga0206354_11520797 3300020081 Bacteria 669
591 Ga0206354_11614879 3300020081 Bacteria 605
592 Ga0206353_10014677 3300020082 Bacteria 3231
593 Ga0206353_10282636 3300020082 Bacteria 1565
594 Ga0206353_10330275 3300020082 Bacteria 528
595 Ga0206353_10591683 3300020082 Bacteria 754
596 Ga0206353_10790039 3300020082 Bacteria 511
597 Ga0206353_11192759 3300020082 Bacteria 2000
598 Ga0206353_11631527 3300020082 Bacteria 521
599 Ga0206353_11688786 3300020082 Bacteria 1043
600 Ga0206353_11996101 3300020082 Bacteria 607
601 Ga0154015_1068933 3300020610 Bacteria 884
602 Ga0154015_1105291 3300020610 Bacteria 867
603 Ga0154015_1142575 3300020610 Bacteria 1155
604 Ga0154015_1285479 3300020610 Bacteria 1538
605 Ga0154015_1417016 3300020610 Bacteria 703
606 Ga0154015_1538444 3300020610 Bacteria 734
607 Ga0224712_10001495 3300022467 Bacteria 5409
608 Ga0224712_10011859 3300022467 Bacteria 2720
609 Ga0224712_10015890 3300022467 Bacteria 2459
610 Ga0224712_10024023 3300022467 Bacteria 2124
611 Ga0224712_10038926 3300022467 Bacteria 1779
612 Ga0224712_10101446 3300022467 Bacteria 1221
613 Ga0209566_100066 3300025225 Bacteria 186951
614 Ga0209674_100001 3300025226 Bacteria 4013750
615 Ga0209672_100039 3300025228 Bacteria 283064
616 Ga0209147_100954 3300025229 Bacteria 12700
617 Ga0209563_100001 3300025230 Bacteria 4013775
618 Ga0207427_100042 3300025231 Bacteria 254170
619 Ga0209437_100538 3300025233 Bacteria 26230
620 Ga0209258_101761 3300025242 Bacteria 6673
621 Ga0209677_100001 3300025253 Bacteria 4013787
622 Ga0209677_102161 3300025253 Bacteria 7674
623 Ga0209148_1000004 3300025254 Bacteria 1844481
624 Ga0209233_1000001 3300025261 Bacteria 2992747
625 Ga0209455_1000117 3300025272 Bacteria 176940
626 Ga0209455_1003952 3300025272 Bacteria 5035
627 Ga0207697_10119287 3300025315 Bacteria 1134
628 Ga0207656_10013795 3300025321 Bacteria 3098
629 Ga0207653_10047439 3300025885 Bacteria 1422
630 Ga0207692_10007776 3300025898 Bacteria 4407
631 Ga0207692_10288443 3300025898 Bacteria 995
632 Ga0207642_10204023 3300025899 Bacteria 1094
633 Ga0207642_10773310 3300025899 Bacteria 609
634 Ga0207642_10836266 3300025899 Bacteria 587
635 Ga0207710_10436641 3300025900 Bacteria 675
636 Ga0207688_10003165 3300025901 Bacteria 8975
637 Ga0207688_10016881 3300025901 Bacteria 3965
638 Ga0207688_10036391 3300025901 Bacteria 2728
639 Ga0207688_10167179 3300025901 Bacteria 1306
640 Ga0207680_10598528 3300025903 Bacteria 788
641 Ga0207647_10021889 3300025904 Bacteria 4256
642 Ga0207647_10028990 3300025904 Bacteria 3588
643 Ga0207647_10090838 3300025904 Bacteria 1821
644 Ga0207685_10619191 3300025905 Bacteria 582
645 Ga0207699_10099923 3300025906 Bacteria 1839
646 Ga0207645_10064369 3300025907 Bacteria 2343
647 Ga0207645_10137521 3300025907 Bacteria 1591
648 Ga0207645_10149679 3300025907 Bacteria 1523
649 Ga0207643_10011474 3300025908 Bacteria 4785
650 Ga0207643_10048389 3300025908 Bacteria 2408
651 Ga0207643_10050065 3300025908 Bacteria 2368
652 Ga0207643_10199074 3300025908 Bacteria 1219
653 Ga0207643_10202123 3300025908 Bacteria 1210
654 Ga0207705_10013197 3300025909 Bacteria 5964
655 Ga0207705_10120089 3300025909 Bacteria 1950
656 Ga0207705_10202859 3300025909 Bacteria 1503
657 Ga0207684_10002793 3300025910 Bacteria 17346
658 Ga0207684_10018534 3300025910 Bacteria 5958
659 Ga0207684_10116254 3300025910 Bacteria 2291
660 Ga0207684_10745082 3300025910 Bacteria 831
661 Ga0207684_10830059 3300025910 Bacteria 780
662 Ga0207684_10897040 3300025910 Bacteria 745
663 Ga0207654_10060489 3300025911 Bacteria 2213
664 Ga0207654_10081460 3300025911 Bacteria 1949
665 Ga0207654_10873031 3300025911 Bacteria 651
666 Ga0207707_10112966 3300025912 Bacteria 2374
667 Ga0207707_10115185 3300025912 Bacteria 2349
668 Ga0207707_10471034 3300025912 Bacteria 1073
669 Ga0207707_10547397 3300025912 Bacteria 983
670 Ga0207707_10689187 3300025912 Bacteria 859
671 Ga0207695_10129689 3300025913 Bacteria 2480
672 Ga0207671_10080469 3300025914 Bacteria 2442
673 Ga0207671_10508695 3300025914 Bacteria 960
674 Ga0207693_10022846 3300025915 Bacteria 4966
675 Ga0207693_10258912 3300025915 Bacteria 1364
676 Ga0207693_10900110 3300025915 Bacteria 679
677 Ga0207693_10910752 3300025915 Bacteria 674
678 Ga0207663_10011677 3300025916 Bacteria 4727
679 Ga0207663_11442947 3300025916 Bacteria 554
680 Ga0207660_10000002 3300025917 Bacteria 883566
681 Ga0207660_10117448 3300025917 Bacteria 2011
682 Ga0207660_10197986 3300025917 Bacteria 1568
683 Ga0207660_10318694 3300025917 Bacteria 1241
684 Ga0207660_11056144 3300025917 Bacteria 662
685 Ga0207662_10397766 3300025918 Bacteria 933
686 Ga0207657_10001055 3300025919 Bacteria 29226
687 Ga0207657_10031572 3300025919 Bacteria 4797
688 Ga0207657_10044718 3300025919 Bacteria 3891
689 Ga0207657_10171230 3300025919 Bacteria 1759
690 Ga0207657_10404575 3300025919 Bacteria 1073
691 Ga0207649_10730382 3300025920 Bacteria 769
692 Ga0207649_10978365 3300025920 Bacteria 665
693 Ga0207652_10015058 3300025921 Bacteria 6274
694 Ga0207652_10079196 3300025921 Bacteria 2870
695 Ga0207652_10447665 3300025921 Bacteria 1164
696 Ga0207652_10542269 3300025921 Bacteria 1046
697 Ga0207646_10028575 3300025922 Bacteria 5073
698 Ga0207646_10037146 3300025922 Bacteria 4392
699 Ga0207646_10048634 3300025922 Bacteria 3801
700 Ga0207646_10067220 3300025922 Bacteria 3200
701 Ga0207681_10357039 3300025923 Bacteria 1171
702 Ga0207681_10982571 3300025923 Bacteria 708
703 Ga0207694_10006100 3300025924 Bacteria 9215
704 Ga0207694_10010017 3300025924 Bacteria 7144
705 Ga0207694_10079437 3300025924 Bacteria 2573
706 Ga0207694_10261073 3300025924 Bacteria 1419
707 Ga0207694_10321104 3300025924 Bacteria 1278
708 Ga0207650_10263591 3300025925 Bacteria 1398
709 Ga0207650_10358983 3300025925 Bacteria 1200
710 Ga0207659_10083284 3300025926 Bacteria 2371
711 Ga0207659_10100407 3300025926 Bacteria 2180
712 Ga0207659_10659337 3300025926 Bacteria 895
713 Ga0207687_10000332 3300025927 Bacteria 31692
714 Ga0207687_10068636 3300025927 Bacteria 2526
715 Ga0207687_10076469 3300025927 Bacteria 2405
716 Ga0207687_10486464 3300025927 Bacteria 1028
717 Ga0207687_11125178 3300025927 Bacteria 675
718 Ga0207687_11342338 3300025927 Bacteria 615
719 Ga0207687_11533538 3300025927 Bacteria 572
720 Ga0207700_10199007 3300025928 Bacteria 1687
721 Ga0207700_11333167 3300025928 Bacteria 639
722 Ga0207664_10004696 3300025929 Bacteria 9271
723 Ga0207664_10106499 3300025929 Bacteria 2325
724 Ga0207644_10862613 3300025931 Bacteria 758
725 Ga0207644_10987685 3300025931 Bacteria 706
726 Ga0207690_10043139 3300025932 Bacteria 2967
727 Ga0207690_10096274 3300025932 Bacteria 2104
728 Ga0207690_10623211 3300025932 Bacteria 882
729 Ga0207690_11518080 3300025932 Bacteria 560
730 Ga0207706_10012543 3300025933 Bacteria 7718
731 Ga0207706_10196299 3300025933 Bacteria 1771
732 Ga0207706_10199972 3300025933 Bacteria 1753
733 Ga0207706_10482472 3300025933 Bacteria 1071
734 Ga0207706_10603301 3300025933 Bacteria 943
735 Ga0207686_10020647 3300025934 Bacteria 3766
736 Ga0207686_10059068 3300025934 Bacteria 2421
737 Ga0207686_10465798 3300025934 Bacteria 975
738 Ga0207686_10991413 3300025934 Bacteria 681
739 Ga0207686_11206580 3300025934 Bacteria 619
740 Ga0207709_10020150 3300025935 Bacteria 3759
741 Ga0207709_10136935 3300025935 Bacteria 1678
742 Ga0207709_10179787 3300025935 Bacteria 1493
743 Ga0207709_10254716 3300025935 Bacteria 1284
744 Ga0207709_10554129 3300025935 Bacteria 905
745 Ga0207709_10575743 3300025935 Bacteria 889
746 Ga0207709_10593553 3300025935 Bacteria 876
747 Ga0207670_10055965 3300025936 Bacteria 2668
748 Ga0207670_10225281 3300025936 Bacteria 1437
749 Ga0207669_10039257 3300025937 Bacteria 2734
750 Ga0207669_10101044 3300025937 Bacteria 1907
751 Ga0207669_10174457 3300025937 Bacteria 1534
752 Ga0207669_10194744 3300025937 Bacteria 1465
753 Ga0207704_10061699 3300025938 Bacteria 2327
754 Ga0207704_10111612 3300025938 Bacteria 1849
755 Ga0207704_10412076 3300025938 Bacteria 1069
756 Ga0207704_10521277 3300025938 Bacteria 961
757 Ga0207665_10159641 3300025939 Bacteria 1621
758 Ga0207665_11145254 3300025939 Bacteria 620
759 Ga0207691_10138961 3300025940 Bacteria 2141
760 Ga0207691_10221557 3300025940 Bacteria 1640
761 Ga0207691_10527891 3300025940 Bacteria 1001
762 Ga0207691_11386318 3300025940 Bacteria 578
763 Ga0207711_10110582 3300025941 Bacteria 2443
764 Ga0207711_10113217 3300025941 Bacteria 2415
765 Ga0207711_10325705 3300025941 Bacteria 1420
766 Ga0207711_10488048 3300025941 Bacteria 1148
767 Ga0207689_10021685 3300025942 Bacteria 5403
768 Ga0207689_10029116 3300025942 Bacteria 4615
769 Ga0207689_10095522 3300025942 Bacteria 2441
770 Ga0207661_10000189 3300025944 Bacteria 40034
771 Ga0207661_10016251 3300025944 Bacteria 5489
772 Ga0207661_10030780 3300025944 Bacteria 4137
773 Ga0207661_10283621 3300025944 Bacteria 1481
774 Ga0207661_10508833 3300025944 Bacteria 1100
775 Ga0207661_10529277 3300025944 Bacteria 1078
776 Ga0207661_10772628 3300025944 Bacteria 884
777 Ga0207661_10966456 3300025944 Bacteria 784
778 Ga0207661_11445882 3300025944 Bacteria 630
779 Ga0207679_10216472 3300025945 Bacteria 1609
780 Ga0207679_10246993 3300025945 Bacteria 1515
781 Ga0207679_10673327 3300025945 Bacteria 937
782 Ga0207679_10700184 3300025945 Bacteria 919
783 Ga0207667_10011493 3300025949 Bacteria 10284
784 Ga0207667_10266250 3300025949 Bacteria 1752
785 Ga0207667_11307650 3300025949 Bacteria 701
786 Ga0207651_10602306 3300025960 Bacteria 960
787 Ga0207651_10793014 3300025960 Bacteria 839
788 Ga0207651_11378465 3300025960 Bacteria 634
789 Ga0207651_11583715 3300025960 Bacteria 590
790 Ga0207712_10153966 3300025961 Bacteria 1779
791 Ga0207712_10653681 3300025961 Bacteria 914
792 Ga0207712_10671211 3300025961 Bacteria 902
793 Ga0207712_11326639 3300025961 Bacteria 643
794 Ga0207640_10018900 3300025981 Bacteria 4059
795 Ga0207640_10063865 3300025981 Bacteria 2449
796 Ga0207640_10266741 3300025981 Bacteria 1337
797 Ga0207640_10616263 3300025981 Bacteria 921
798 Ga0207658_10125019 3300025986 Bacteria 2057
799 Ga0207658_10691348 3300025986 Bacteria 921
800 Ga0207677_10063649 3300026023 Bacteria 2565
801 Ga0207677_10114794 3300026023 Bacteria 2013
802 Ga0207677_10542254 3300026023 Bacteria 1012
803 Ga0207677_10566713 3300026023 Bacteria 992
804 Ga0207677_10696072 3300026023 Bacteria 901
805 Ga0207677_10723305 3300026023 Bacteria 885
806 Ga0207703_10074488 3300026035 Bacteria 2811
807 Ga0207703_11458167 3300026035 Bacteria 658
808 Ga0207639_10430698 3300026041 Bacteria 1194
809 Ga0207639_10764363 3300026041 Bacteria 899
810 Ga0207678_10112985 3300026067 Bacteria 2317
811 Ga0207678_10146870 3300026067 Bacteria 2013
812 Ga0207678_10330038 3300026067 Bacteria 1313
813 Ga0207678_10353523 3300026067 Bacteria 1267
814 Ga0207678_10509204 3300026067 Bacteria 1050
815 Ga0207678_10587647 3300026067 Bacteria 976
816 Ga0207678_10993361 3300026067 Bacteria 743
817 Ga0207708_10026038 3300026075 Bacteria 4425
818 Ga0207708_10090013 3300026075 Bacteria 2365
819 Ga0207708_10118012 3300026075 Bacteria 2065
820 Ga0207708_10153468 3300026075 Bacteria 1815
821 Ga0207708_10213965 3300026075 Bacteria 1542
822 Ga0207708_10321121 3300026075 Bacteria 1264
823 Ga0207708_10324981 3300026075 Bacteria 1256
824 Ga0207708_10568282 3300026075 Bacteria 958
825 Ga0207702_10033880 3300026078 Bacteria 4268
826 Ga0207702_10042541 3300026078 Bacteria 3811
827 Ga0207702_10149288 3300026078 Bacteria 2125
828 Ga0207702_10158054 3300026078 Bacteria 2068
829 Ga0207702_10503454 3300026078 Bacteria 1181
830 Ga0207702_10846700 3300026078 Bacteria 905
831 Ga0207702_11296370 3300026078 Bacteria 722
832 Ga0207641_10049012 3300026088 Bacteria 3568
833 Ga0207641_10308358 3300026088 Bacteria 1497
834 Ga0207648_10078065 3300026089 Bacteria 2888
835 Ga0207648_10151012 3300026089 Bacteria 2050
836 Ga0207648_10228692 3300026089 Bacteria 1654
837 Ga0207648_10334264 3300026089 Bacteria 1363
838 Ga0207676_10065702 3300026095 Bacteria 2889
839 Ga0207676_10140024 3300026095 Bacteria 2070
840 Ga0207676_10851219 3300026095 Bacteria 892
841 Ga0207674_10134020 3300026116 Bacteria 2440
842 Ga0207674_10162985 3300026116 Bacteria 2184
843 Ga0207674_10168198 3300026116 Bacteria 2146
844 Ga0207674_10455687 3300026116 Bacteria 1236
845 Ga0207674_10532577 3300026116 Bacteria 1135
846 Ga0207675_100082898 3300026118 Bacteria 3007
847 Ga0207675_100166279 3300026118 Bacteria 2107
848 Ga0207675_100195629 3300026118 Bacteria 1941
849 Ga0207675_101470333 3300026118 Bacteria 702
850 Ga0207683_10008575 3300026121 Bacteria 8749
851 Ga0207683_10067303 3300026121 Bacteria 3159
852 Ga0207683_10154003 3300026121 Bacteria 2076
853 Ga0207683_10358518 3300026121 Bacteria 1339
854 Ga0207683_10427335 3300026121 Bacteria 1220
855 Ga0207683_10461075 3300026121 Bacteria 1172
856 Ga0207683_10515193 3300026121 Bacteria 1105
857 Ga0207683_10740649 3300026121 Bacteria 912
858 Ga0207683_10957018 3300026121 Bacteria 795
859 Ga0207683_12149743 3300026121 Bacteria 506
860 Ga0207698_10020583 3300026142 Bacteria 4544
861 Ga0207698_10324013 3300026142 Bacteria 1444
862 Ga0209973_1020452 3300027252 Bacteria 874
863 Ga0209969_1032723 3300027360 Bacteria 797
864 Ga0209967_1013822 3300027364 Bacteria 1147
865 Ga0209996_1031334 3300027395 Bacteria 774
866 Ga0209995_1064474 3300027471 Bacteria 625
867 Ga0209968_1014896 3300027526 Bacteria 1226
868 Ga0209999_1010955 3300027543 Bacteria 1639
869 Ga0209982_1034364 3300027552 Bacteria 802
870 Ga0210002_1018339 3300027617 Bacteria 1118
871 Ga0209983_1058714 3300027665 Bacteria 848
872 Ga0209971_1007217 3300027682 Bacteria 2636
873 Ga0209966_1025954 3300027695 Bacteria 1165
874 Ga0209998_10007811 3300027717 Bacteria 2220
875 Ga0209998_10024310 3300027717 Bacteria 1314
876 Ga0209974_10019832 3300027876 Bacteria 2229
877 Ga0207428_10000181 3300027907 Bacteria 88299
878 Ga0268266_10338848 3300028379 Bacteria 1411
879 Ga0268266_10958393 3300028379 Bacteria 828
880 Ga0268265_10321086 3300028380 Bacteria 1402
881 Ga0268265_10997499 3300028380 Bacteria 827
882 Ga0268264_10102520 3300028381 Bacteria 2490
883 Ga0268264_10569197 3300028381 Bacteria 1113
884 Ga0268264_10591831 3300028381 Bacteria 1092
885 Ga0268264_10756906 3300028381 Bacteria 968
886 Ga0268264_11401749 3300028381 Bacteria 709
887 Ga0265337_1016621 3300028556 Bacteria 2373
888 Ga0265337_1035179 3300028556 Bacteria 1469
889 Ga0265326_10014445 3300028558 Bacteria 2300
890 Ga0265319_1000855 3300028563 Bacteria 19414
891 Ga0265319_1101346 3300028563 Bacteria 904
892 Ga0265334_10030082 3300028573 Bacteria 2175
893 Ga0265318_10033646 3300028577 Bacteria 1977
894 Ga0265323_10078944 3300028653 Bacteria 1114
895 Ga0265322_10010856 3300028654 Bacteria 2644
896 Ga0265336_10167246 3300028666 Bacteria 654
897 Ga0265338_10030239 3300028800 Bacteria 5344
898 Ga0265338_10739638 3300028800 Bacteria 677
899 Ga0265324_10006460 3300029957 Bacteria 4886
900 Ga0265324_10017063 3300029957 Bacteria 2642
901 Ga0265330_10010314 3300031235 Bacteria 4409
902 Ga0265330_10013785 3300031235 Bacteria 3761
903 Ga0265332_10023897 3300031238 Bacteria 2693
904 Ga0265332_10030283 3300031238 Bacteria 2364
905 Ga0265332_10153172 3300031238 Bacteria 964
906 Ga0265320_10002674 3300031240 Bacteria 12328
907 Ga0265320_10004554 3300031240 Bacteria 9068
908 Ga0265325_10004083 3300031241 Bacteria 9300
909 Ga0265329_10003710 3300031242 Bacteria 6583
910 Ga0265329_10004401 3300031242 Bacteria 5872
911 Ga0265340_10004482 3300031247 Bacteria 7797
912 Ga0265339_10098430 3300031249 Bacteria 1525
913 Ga0265327_10003480 3300031251 Bacteria 14979
914 Ga0265327_10075274 3300031251 Bacteria 1679
915 Ga0265316_10007887 3300031344 Bacteria 9962
916 Ga0265316_10023310 3300031344 Bacteria 5201
917 Ga0265316_10059571 3300031344 Bacteria 2969
918 Ga0265313_10053419 3300031595 Bacteria 1923
919 Ga0307514_10020272 3300031649 Bacteria 5427
920 Ga0316575_10006117 3300031665 Bacteria 4320
921 Ga0316575_10317684 3300031665 Bacteria 660
922 Ga0316579_10023159 3300031691 Bacteria 2784
923 Ga0316579_10066726 3300031691 Bacteria 1699
924 Ga0316579_10130380 3300031691 Bacteria 1211
925 Ga0316579_10145130 3300031691 Bacteria 1144
926 Ga0316579_10219317 3300031691 Bacteria 920
927 Ga0316579_10503885 3300031691 Bacteria 586
928 Ga0265314_10016170 3300031711 Bacteria 5907
929 Ga0265314_10116285 3300031711 Bacteria 1691
930 Ga0265342_10001795 3300031712 Bacteria 19520
931 Ga0265342_10034561 3300031712 Bacteria 3101
932 Ga0316576_10037846 3300031727 Bacteria 3456
933 Ga0316576_10043431 3300031727 Bacteria 3243
934 Ga0316576_10074501 3300031727 Bacteria 2510
935 Ga0316576_10076538 3300031727 Bacteria 2476
936 Ga0316576_10240448 3300031727 Bacteria 1360
937 Ga0316576_10689990 3300031727 Bacteria 740
938 Ga0316578_10100243 3300031728 Bacteria 1736
939 Ga0316578_10132551 3300031728 Bacteria 1500
940 Ga0316578_10445361 3300031728 Bacteria 765
941 Ga0307405_11648287 3300031731 Bacteria 567
942 Ga0316577_10017827 3300031733 Bacteria 3924
943 Ga0316577_10083780 3300031733 Bacteria 1783
944 Ga0316577_10092089 3300031733 Bacteria 1697
945 Ga0316577_10224268 3300031733 Bacteria 1063
946 Ga0316577_10232320 3300031733 Bacteria 1043
947 Ga0316577_10249295 3300031733 Bacteria 1005
948 Ga0316577_10305216 3300031733 Bacteria 902
949 Ga0316577_10520103 3300031733 Bacteria 676
950 Ga0307410_10454535 3300031852 Bacteria 1045
951 Ga0307412_11506679 3300031911 Bacteria 612
952 Ga0307409_100096715 3300031995 Bacteria 2437
953 Ga0307409_100548092 3300031995 Bacteria 1135
954 Ga0307409_101808684 3300031995 Bacteria 640
955 Ga0307416_100613719 3300032002 Bacteria 1169
956 Ga0307416_100855774 3300032002 Bacteria 1007
957 Ga0307415_100625789 3300032126 Bacteria 961
958 Ga0316583_10023673 3300032133 Bacteria 2192
959 Ga0316583_10061258 3300032133 Bacteria 1319
960 Ga0316585_10004351 3300032137 Bacteria 3939
961 Ga0316585_10091378 3300032137 Bacteria 995
962 Ga0316585_10181001 3300032137 Bacteria 696
963 Ga0316593_10053135 3300032168 Bacteria 1372
964 Ga0316593_10120476 3300032168 Bacteria 942
965 Ga0316593_10250320 3300032168 Bacteria 663
966 Ga0316593_10367576 3300032168 Bacteria 552
967 Ga0316592_1013793 3300033524 Bacteria 1671
968 Ga0316592_1021646 3300033524 Bacteria 1370
969 Ga0316592_1026831 3300033524 Bacteria 1244
970 Ga0316592_1096925 3300033524 Bacteria 677
971 Ga0316586_1058871 3300033527 Bacteria 696
972 Ga0316587_1081568 3300033529 Bacteria 612
973 Ga0316596_1025941 3300033541 Bacteria 1509
974 Ga0316596_1040913 3300033541 Bacteria 1218
975 Ga0316596_1058524 3300033541 Bacteria 1026
976 Ga0316596_1130116 3300033541 Bacteria 687
977 Ga0316596_1146706 3300033541 Bacteria 647
978 Ga0373948_0133675 3300034817 Bacteria 609
979 Ga0373959_0036141 3300034820 Bacteria 1018
980 Ga0373959_0037465 3300034820 Bacteria 1005
981 Ga0373959_0117360 3300034820 Bacteria 648
982 Ga0373938_0029372 3300034957 Bacteria 1167
983 Ga0373926_0098922 3300035083 Bacteria 1089
984 Ga0373929_0133040 3300035085 Bacteria 654
985 Ga0373934_0069319 3300035086 Bacteria 1409
986 Ga0373940_0077785 3300035088 Bacteria 976
987 Ga0373944_0317673 3300035089 Bacteria 587
988 Ga0373949_0048275 3300035090 Bacteria 1066
989 Ga0373949_0076228 3300035090 Bacteria 886
990 Ga0373951_0017339 3300035091 Bacteria 1629
991 Ga0373952_0009679 3300035092 Bacteria 1851
992 Ga0373952_0029204 3300035092 Bacteria 1214
993 Ga0373952_0089127 3300035092 Bacteria 799
994 Ga0373952_0110733 3300035092 Bacteria 735
995 Ga0373923_0007437 3300035111 Bacteria 3851
996 Ga0373932_0013656 3300035112 Bacteria 2026
997 Ga0373932_0075009 3300035112 Bacteria 1057
998 Ga0373936_0273187 3300035113 Bacteria 759
999 Ga0373941_0043255 3300035115 Bacteria 1401
1000 Ga0373941_0068497 3300035115 Bacteria 1172
1001 Ga0373941_0148827 3300035115 Bacteria 857
1002 Ga0373945_0092711 3300035116 Bacteria 1171
1003 Ga0373945_0157657 3300035116 Bacteria 924
1004 Ga0373953_0038654 3300035117 Bacteria 1889
1005 Ga0373953_0091225 3300035117 Bacteria 1275
1006 Ga0373954_0023325 3300035118 Bacteria 2813
1007 Ga0373956_0264297 3300035119 Bacteria 818
1008 Ga0373956_0525352 3300035119 Bacteria 565
1009 Ga0373957_0010245 3300035120 Bacteria 3092
1010 Ga0373957_0134599 3300035120 Bacteria 1008
1011 Ga0373957_0152183 3300035120 Bacteria 950
1012 Ga0373960_0125435 3300035121 Bacteria 856
1013 Ga0373943_0004020 3300035170 Bacteria 6689
1014 Ga0373943_0416805 3300035170 Bacteria 777
1015 Ga0373943_0761783 3300035170 Bacteria 575
1016 Ga0373946_0028376 3300035171 Bacteria 2219
1017 Ga0373955_0106446 3300035172 Bacteria 1617
1018 Ga0373955_0575158 3300035172 Bacteria 689
1019 Ga0373942_0006705 3300035207 Bacteria 2660
1020 Ga0373942_0276851 3300035207 Bacteria 577
1021 Ga0373961_0032995 3300035241 Bacteria 1456
1022 Ga0373961_0197210 3300035241 Bacteria 708
1023 Ga0373962_0057119 3300035242 Bacteria 1138
1024 Ga0373962_0083237 3300035242 Bacteria 975
1025 Ga0373962_0148661 3300035242 Bacteria 766
1026 Ga0316574_0071591 3300035398 Bacteria 2190
1027 Ga0316574_0098761 3300035398 Bacteria 1867
1028 Ga0316574_0172997 3300035398 Bacteria 1390
1029 Ga0316574_0224946 3300035398 Bacteria 1202
1030 Ga0316574_0232470 3300035398 Bacteria 1179
1031 Ga0316574_0392708 3300035398 Bacteria 874
1032 Ga0316574_0427029 3300035398 Bacteria 832
1033 Ga0373924_0037789 3300035410 Bacteria 1967
1034 Ga0373924_0231086 3300035410 Bacteria 818
1035 Ga0373931_0029997 3300035691 Bacteria 2797
1036 Ga0373931_0116969 3300035691 Bacteria 1519
1037 Ga0373931_0126812 3300035691 Bacteria 1465
1038 Ga0373931_1135771 3300035691 Bacteria 533
1039 Ga0373935_0012638 3300035692 Bacteria 5079
1040 Ga0373927_0308574 3300035695 Bacteria 1041
1041 Ga0373933_0181960 3300035724 Bacteria 1341
1042 Ga0373933_0412599 3300035724 Bacteria 882
1043 Ga0373947_0015474 3300035725 Bacteria 4380
1044 Ga0373947_0101636 3300035725 Bacteria 1808
1045 Ga0373947_0245579 3300035725 Bacteria 1182
1046 Ga0373937_0278938 3300036401 Bacteria 1578
1047 Ga0373937_0445807 3300036401 Bacteria 1229
1048 Ga0373937_0516876 3300036401 Bacteria 1134
1049 Ga0373937_0708534 3300036401 Bacteria 953
1050 Ga0373937_0744223 3300036401 Bacteria 928
1051 Ga0265778_022895 3300036457 Bacteria 780
1052 Ga0316582_0016976 3300036647 Bacteria 4199
1053 Ga0316582_0019246 3300036647 Bacteria 3992
1054 Ga0316582_0180659 3300036647 Bacteria 1435
1055 Ga0316582_0240395 3300036647 Bacteria 1240
1056 Ga0316582_0435598 3300036647 Bacteria 903
1057 Ga0316582_0493860 3300036647 Bacteria 843
1058 Ga0316582_0790219 3300036647 Bacteria 650
1059 Ga0316584_0003848 3300036712 Bacteria 9841
1060 Ga0316584_0008456 3300036712 Bacteria 7094
1061 Ga0316584_0032481 3300036712 Bacteria 3864
1062 Ga0316584_0122179 3300036712 Bacteria 1946
1063 Ga0316584_0225132 3300036712 Bacteria 1376
1064 Ga0316584_0229218 3300036712 Bacteria 1362
1065 Ga0316584_0278001 3300036712 Bacteria 1217
1066 Ga0316584_0359630 3300036712 Bacteria 1044
1067 Ga0316584_0361671 3300036712 Bacteria 1040
1068 Ga0316584_0863698 3300036712 Bacteria 611
1069 Ga0373925_0013236 3300037068 Bacteria 5970
1070 Ga0373925_1026623 3300037068 Bacteria 679
1071 Ga0395899_0166028 3300037312 Bacteria 1557
1072 Ga0395900_0061899 3300037418 Bacteria 3847
1073 Ga0395900_0078136 3300037418 Bacteria 3401
1074 Ga0395900_0103562 3300037418 Bacteria 2923
1075 Ga0395900_0113402 3300037418 Bacteria 2782
1076 Ga0395898_0000381 3300037466 Bacteria 97274
1077 Ga0395898_0240350 3300037466 Bacteria 1727
1078 Ga0395905_0518375 3300037471 Bacteria 1093
1079 Ga0395905_0822163 3300037471 Bacteria 832
1080 Ga0316581_0002334 3300037588 Bacteria 4514
1081 Ga0316581_0030105 3300037588 Bacteria 1632
1082 Ga0316581_0060460 3300037588 Bacteria 1162
1083 Ga0395901_0150442 3300038443 Bacteria 2446
1084 Ga0395901_0172994 3300038443 Bacteria 2266
1085 Ga0395901_0233292 3300038443 Bacteria 1921
1086 Ga0395901_0492651 3300038443 Bacteria 1249
1087 Ga0242420_122642 3300038996 Bacteria 568
1088 Ga0242420_165300 3300038996 Bacteria 503
1089 Ga0400489_12849 3300039093 Bacteria 1605
1090 Ga0436365_0144673 3300039437 Bacteria 1603
1091 Ga0436365_1046517 3300039437 Bacteria 847
1092 Ga0436361_0793921 3300039447 Bacteria 537
1093 Ga0436363_0126624 3300039450 Bacteria 569
1094 Ga0436362_0739222 3300039453 Bacteria 621
1095 Ga0439465_0020112 3300041413 Bacteria 2089
1096 Ga0451789_0724155 3300041443 Bacteria 657
1097 Ga0451793_1457874 3300041452 Bacteria 1382
1098 Ga0451798_0847145 3300041458 Bacteria 1307
1099 Ga0451805_017166 3300041461 Bacteria 776
1100 Ga0451807_2770562 3300041486 Bacteria 703
1101 Ga0451833_0697339 3300041491 Bacteria 628
1102 Ga0451839_1230110 3300041496 Bacteria 1062
1103 Ga0451845_0305454 3300041501 Bacteria 515
1104 Ga0451845_0608312 3300041501 Bacteria 794
1105 Ga0451849_0000801 3300041505 Bacteria 675
1106 Ga0451851_0422564 3300041507 Bacteria 644
1107 Ga0451843_0725649 3300041509 Bacteria 545
1108 Ga0451855_1617624 3300041511 Bacteria 869
1109 Ga0451853_0600829 3300041512 Bacteria 775
1110 Ga0451853_1418465 3300041512 Bacteria 1213
1111 Ga0439448_0011384 3300042005 Bacteria 2651
1112 Ga0439448_0202695 3300042005 Bacteria 696
1113 Ga0439450_122795 3300042008 Bacteria 670
1114 Ga0439450_227377 3300042008 Bacteria 503
1115 Ga0439455_0104539 3300042012 Bacteria 784
1116 Ga0439456_043915 3300042013 Bacteria 972
1117 Ga0450920_007738 3300042122 Bacteria 1950
1118 Ga0450923_014865 3300042125 Bacteria 1448
1119 Ga0450906_008981 3300042145 Bacteria 1918
1120 Ga0450907_037255 3300042146 Bacteria 831
1121 Ga0439458_0148677 3300042157 Bacteria 627
1122 Ga0439434_0060393 3300042435 Bacteria 1184
1123 Ga0439435_0070056 3300042436 Bacteria 1037
1124 Ga0439444_0050696 3300042437 Bacteria 843
1125 Ga0439464_0165014 3300042439 Bacteria 697
1126 Ga0439460_0311138 3300042461 Bacteria 551
1127 Ga0450916_022216 3300042530 Bacteria 878
1128 Ga0450918_013050 3300042531 Bacteria 1445
1129 Ga0451577_0016881 3300042876 Bacteria 6752
1130 Ga0451577_0117036 3300042876 Bacteria 2387
1131 Ga0451577_0143807 3300042876 Bacteria 2144
1132 Ga0451577_0276905 3300042876 Bacteria 1520
1133 Ga0451577_0314814 3300042876 Bacteria 1419
1134 Ga0439440_0115149 3300042993 Bacteria 743
1135 Ga0466969_0103990 3300044656 Bacteria 1334
1136 Ga0466972_0005615 3300044658 Bacteria 6284
1137 Ga0466972_0234463 3300044658 Bacteria 858
1138 Ga0453683_0036050 3300044673 Bacteria 3114
1139 Ga0453683_0154124 3300044673 Bacteria 1452
1140 Ga0453683_0466537 3300044673 Bacteria 818
1141 Ga0466965_0006167 3300044683 Bacteria 5423
1142 Ga0466965_0014387 3300044683 Bacteria 3743
1143 Ga0466965_0107260 3300044683 Bacteria 1433
1144 Ga0466966_0010977 3300044684 Bacteria 6011
1145 Ga0466961_0087743 3300044693 Bacteria 1965
1146 Ga0466961_0201841 3300044693 Bacteria 1229
1147 Ga0466961_0204689 3300044693 Bacteria 1220
1148 Ga0466963_0083412 3300044694 Bacteria 2168
1149 Ga0466963_1016940 3300044694 Bacteria 583
1150 Ga0466964_0180154 3300044706 Bacteria 1001
1151 Ga0466964_0224970 3300044706 Bacteria 913
1152 Ga0453684_0060759 3300044712 Bacteria 4857
1153 Ga0453684_0088810 3300044712 Bacteria 3826
1154 Ga0453684_0456657 3300044712 Bacteria 1421
1155 Ga0453684_0491965 3300044712 Bacteria 1359
1156 Ga0453684_0526506 3300044712 Bacteria 1305
1157 Ga0453684_0627939 3300044712 Bacteria 1174
1158 Ga0453684_1134237 3300044712 Bacteria 824
1159 Ga0453684_2424098 3300044712 Bacteria 519
1160 Ga0466971_0059038 3300044719 Bacteria 1732
1161 Ga0466971_0183400 3300044719 Bacteria 984
1162 Ga0466971_0608400 3300044719 Bacteria 545
1163 Ga0466968_0354300 3300044735 Bacteria 713
1164 Ga0466968_0381720 3300044735 Bacteria 688
1165 Ga0466968_0491539 3300044735 Bacteria 610
1166 Ga0466970_0033983 3300044765 Bacteria 2697
1167 Ga0466970_0072211 3300044765 Bacteria 1856
1168 Ga0466957_0038195 3300044842 Bacteria 2892
1169 Ga0466957_0052384 3300044842 Bacteria 2485
1170 Ga0466957_0070960 3300044842 Bacteria 2153
1171 Ga0466957_0196793 3300044842 Bacteria 1322
1172 Ga0466957_0224728 3300044842 Bacteria 1241
1173 Ga0466957_0247951 3300044842 Bacteria 1183
1174 Ga0466960_0019581 3300044901 Bacteria 2985
1175 Ga0466960_0057834 3300044901 Bacteria 1892
1176 Ga0466960_0059399 3300044901 Bacteria 1870
1177 Ga0466959_0004261 3300045049 Bacteria 9543
1178 Ga0466959_0039513 3300045049 Bacteria 3486
1179 Ga0451576_0034109 3300045051 Bacteria 5406
1180 Ga0451576_0185581 3300045051 Bacteria 2172
1181 Ga0466958_0002151 3300045836 Bacteria 9809
1182 Ga0466958_0018252 3300045836 Bacteria 4068
1183 Ga0466958_0031221 3300045836 Bacteria 3166
1184 Ga0466958_0087216 3300045836 Bacteria 1927
1185 Ga0466958_0399398 3300045836 Bacteria 887
1186 Ga0466967_0266913 3300045976 Bacteria 1639
1187 Ga0466967_0903807 3300045976 Bacteria 878
1188 Ga0466967_1299685 3300045976 Bacteria 724
1189 Ga0466967_2311786 3300045976 Bacteria 533
1190 Ga0495592_0065934 3300046454 Bacteria 2650
1191 Ga0495592_0233423 3300046454 Bacteria 1224
1192 Ga0495592_0286511 3300046454 Bacteria 1075
1193 Ga0495592_0685808 3300046454 Bacteria 617
1194 Ga0495603_0009479 3300046455 Bacteria 5882
1195 Ga0495603_0097528 3300046455 Bacteria 1716
1196 Ga0495603_0191092 3300046455 Bacteria 1184
1197 Ga0495629_0124017 3300046459 Bacteria 1799
1198 Ga0495629_0161553 3300046459 Bacteria 1556
1199 Ga0495641_0006189 3300046461 Bacteria 7821
1200 Ga0495641_0055802 3300046461 Bacteria 1792
1201 Ga0495641_0060859 3300046461 Bacteria 1705
1202 Ga0495651_0041297 3300046462 Bacteria 3583
1203 Ga0495653_0011794 3300046463 Bacteria 7137
1204 Ga0495653_0025679 3300046463 Bacteria 4729
1205 Ga0495653_0308089 3300046463 Bacteria 1031
1206 Ga0495650_0040933 3300046471 Bacteria 1985
1207 Ga0495650_0048271 3300046471 Bacteria 1775
1208 Ga0495650_0111255 3300046471 Bacteria 1017
1209 Ga0495580_0120527 3300046472 Bacteria 1821
1210 Ga0495582_0031758 3300046473 Bacteria 2903
1211 Ga0495582_0080740 3300046473 Bacteria 1806
1212 Ga0495582_0233016 3300046473 Bacteria 1054
1213 Ga0495639_0172417 3300046475 Bacteria 1050
1214 Ga0495639_0373464 3300046475 Bacteria 718
1215 Ga0495662_0019242 3300046476 Bacteria 3302
1216 Ga0495662_0180519 3300046476 Bacteria 1040
1217 Ga0495664_0145839 3300046477 Bacteria 1435
1218 Ga0495664_0226434 3300046477 Bacteria 1132
1219 Ga0495664_0949774 3300046477 Bacteria 502
1220 Ga0495584_0228811 3300046491 Bacteria 945
1221 Ga0495584_0337063 3300046491 Bacteria 766
1222 Ga0495584_0385238 3300046491 Bacteria 712
1223 Ga0495594_0367075 3300046499 Bacteria 819
1224 Ga0495594_0423396 3300046499 Bacteria 757
1225 Ga0495596_0087503 3300046500 Bacteria 1209
1226 Ga0495606_0259492 3300046507 Bacteria 960
1227 Ga0495608_0060429 3300046511 Bacteria 2493
1228 Ga0495608_0127238 3300046511 Bacteria 1632
1229 Ga0495616_0228237 3300046513 Bacteria 808
1230 Ga0495618_0029382 3300046514 Bacteria 3430
1231 Ga0495618_0060714 3300046514 Bacteria 2397
1232 Ga0495618_0238478 3300046514 Bacteria 1144
1233 Ga0495620_0263375 3300046515 Bacteria 657
1234 Ga0495628_0043996 3300046516 Bacteria 3554
1235 Ga0495628_0867295 3300046516 Bacteria 628
1236 Ga0495630_0035741 3300046517 Bacteria 3712
1237 Ga0495630_0170906 3300046517 Bacteria 1656
1238 Ga0495637_0254397 3300046520 Bacteria 632
1239 Ga0495644_0187506 3300046523 Bacteria 796
1240 Ga0495648_0033982 3300046524 Bacteria 3325
1241 Ga0495663_0125873 3300046525 Bacteria 861
1242 Ga0495663_0224886 3300046525 Bacteria 661
1243 Ga0495666_0031409 3300046526 Bacteria 2602
1244 Ga0495666_0545796 3300046526 Bacteria 517
1245 Ga0495652_0127724 3300046529 Bacteria 2017
1246 Ga0495652_0333093 3300046529 Bacteria 1093
1247 Ga0495652_0787729 3300046529 Bacteria 634
1248 Ga0495652_1016440 3300046529 Bacteria 542
1249 Ga0495665_0018361 3300046531 Bacteria 3758
1250 Ga0495640_0021538 3300046533 Bacteria 4729
1251 Ga0495640_0302808 3300046533 Bacteria 992
1252 Ga0495587_0223807 3300046536 Bacteria 1061
1253 Ga0495598_0165374 3300046537 Bacteria 781
1254 Ga0495609_0151753 3300046538 Bacteria 985
1255 Ga0495645_0071267 3300046543 Bacteria 2506
1256 Ga0495645_0316647 3300046543 Bacteria 1014
1257 Ga0495645_0495045 3300046543 Bacteria 765
1258 Ga0495667_0077476 3300046559 Bacteria 2162
1259 Ga0495667_0516058 3300046559 Bacteria 748
1260 Ga0495656_0019032 3300046615 Bacteria 2645
1261 Ga0495656_0410222 3300046615 Bacteria 710
1262 Ga0495634_0008932 3300046642 Bacteria 7419
1263 Ga0495634_0132568 3300046642 Bacteria 1587
1264 Ga0495635_0063284 3300046663 Bacteria 2540
1265 Ga0495635_0206729 3300046663 Bacteria 1330
1266 Ga0495635_0788357 3300046663 Bacteria 613
1267 Ga0495588_0006175 3300046674 Bacteria 5381
1268 Ga0495657_0003110 3300046675 Bacteria 13700
1269 Ga0495599_0151254 3300046678 Bacteria 1437
1270 Ga0495599_0735957 3300046678 Bacteria 567
1271 Ga0495623_0296175 3300046679 Bacteria 895
1272 Ga0495646_0093243 3300046680 Bacteria 1735
1273 Ga0495646_0168405 3300046680 Bacteria 1209
1274 Ga0495647_0003870 3300046681 Bacteria 4826
1275 Ga0495647_0004692 3300046681 Bacteria 4456
1276 Ga0495647_0432965 3300046681 Bacteria 607
1277 Ga0495647_0507820 3300046681 Bacteria 561
1278 Ga0495658_0064282 3300046683 Bacteria 2113
1279 Ga0495658_0070216 3300046683 Bacteria 2032
1280 Ga0495658_0081948 3300046683 Bacteria 1895
1281 Ga0495658_0133954 3300046683 Bacteria 1511
1282 Ga0495658_0692567 3300046683 Bacteria 653
1283 Ga0495669_0117319 3300046684 Bacteria 1246
1284 Ga0495613_0026405 3300046689 Bacteria 4326
1285 Ga0495613_0030825 3300046689 Bacteria 3984
1286 Ga0495613_0306163 3300046689 Bacteria 1099
1287 Ga0495624_0156737 3300046690 Bacteria 1391
1288 Ga0495624_0440497 3300046690 Bacteria 781
1289 Ga0495589_0031760 3300046794 Bacteria 2658
1290 Ga0495600_0003596 3300046809 Bacteria 9135
1291 Ga0495600_0183782 3300046809 Bacteria 1347
1292 Ga0495581_0004186 3300047315 Bacteria 8314
1293 Ga0495581_0217471 3300047315 Bacteria 1117
1294 Ga0495604_0016907 3300047317 Bacteria 5832
1295 Ga0495604_0288647 3300047317 Bacteria 1106
1296 Ga0495604_0337907 3300047317 Bacteria 1003
1297 Ga0495674_0012859 3300047319 Bacteria 7883
1298 Ga0495674_0023760 3300047319 Bacteria 5644
1299 Ga0495674_0238423 3300047319 Bacteria 1499
1300 Ga0495672_0004778 3300047320 Bacteria 10928
1301 Ga0495676_0251165 3300047321 Bacteria 1206
1302 Ga0495676_0435511 3300047321 Bacteria 866
1303 Ga0495676_0474316 3300047321 Bacteria 823
1304 Ga0495680_0018449 3300047322 Bacteria 5924
1305 Ga0495680_0074503 3300047322 Bacteria 2578
1306 Ga0495680_0281901 3300047322 Bacteria 1171
1307 Ga0495680_0445908 3300047322 Bacteria 886
1308 Ga0495675_0035654 3300047444 Bacteria 3176
1309 Ga0495677_0172211 3300047445 Bacteria 838
1310 Ga0495684_0014399 3300047471 Bacteria 6085
1311 Ga0495684_0014428 3300047471 Bacteria 6079
1312 Ga0495686_0155677 3300047472 Bacteria 1339
1313 Ga0495593_0010386 3300047673 Bacteria 5382
1314 Ga0495593_0499110 3300047673 Bacteria 610
1315 Ga0495602_0048098 3300048088 Bacteria 3837
1316 Ga0495602_0598083 3300048088 Bacteria 759
1317 Ga0495614_0002806 3300048089 Bacteria 7750
1318 Ga0496100_0020442 3300048903 Bacteria 3969
1319 Ga0496100_0037424 3300048903 Bacteria 3067
1320 Ga0496100_0046263 3300048903 Bacteria 2797
1321 Ga0496100_0129847 3300048903 Bacteria 1773
1322 Ga0496100_0156060 3300048903 Bacteria 1632
1323 Ga0496100_0263667 3300048903 Bacteria 1278
1324 Ga0496100_0275060 3300048903 Bacteria 1253
1325 Ga0496100_0532940 3300048903 Bacteria 907
1326 Ga0496100_0798570 3300048903 Bacteria 739
1327 Ga0496101_0029830 3300048904 Bacteria 3816
1328 Ga0496101_0064090 3300048904 Bacteria 2676
1329 Ga0496101_0156944 3300048904 Bacteria 1743
1330 Ga0496101_0331525 3300048904 Bacteria 1194
1331 Ga0496101_0415467 3300048904 Bacteria 1060
1332 Ga0496101_0475184 3300048904 Bacteria 987
1333 Ga0496101_1526072 3300048904 Bacteria 520
1334 Ga0496102_0008426 3300048905 Bacteria 8836
1335 Ga0496102_0039336 3300048905 Bacteria 4273
1336 Ga0496102_0256404 3300048905 Bacteria 1649
1337 Ga0496102_0355090 3300048905 Bacteria 1380
1338 Ga0496102_0520129 3300048905 Bacteria 1112
1339 Ga0496102_0596746 3300048905 Bacteria 1027
1340 Ga0496102_0782946 3300048905 Bacteria 876
1341 Ga0496102_0816894 3300048905 Bacteria 854
1342 Ga0496102_1254518 3300048905 Bacteria 660
1343 Ga0496103_0019667 3300048906 Bacteria 4053
1344 Ga0496103_0039276 3300048906 Bacteria 2908
1345 Ga0496103_0185811 3300048906 Bacteria 1336
1346 Ga0496103_0377231 3300048906 Bacteria 911
1347 Ga0496103_0458330 3300048906 Bacteria 817
1348 Ga0496103_0663379 3300048906 Bacteria 662
1349 Ga0496104_0008605 3300048907 Bacteria 9075
1350 Ga0496104_0045348 3300048907 Bacteria 4134
1351 Ga0496104_0054378 3300048907 Bacteria 3783
1352 Ga0496104_0106807 3300048907 Bacteria 2683
1353 Ga0496104_0136994 3300048907 Bacteria 2352
1354 Ga0496104_0181317 3300048907 Bacteria 2016
1355 Ga0496104_0958994 3300048907 Bacteria 760
1356 Ga0496105_0034806 3300048908 Bacteria 4144
1357 Ga0496105_0036308 3300048908 Bacteria 4059
1358 Ga0496105_0054080 3300048908 Bacteria 3316
1359 Ga0496105_0069692 3300048908 Bacteria 2906
1360 Ga0496105_0070961 3300048908 Bacteria 2879
1361 Ga0496105_0115593 3300048908 Bacteria 2213
1362 Ga0496105_0204619 3300048908 Bacteria 1610
1363 Ga0496105_0839121 3300048908 Bacteria 696
1364 Ga0496105_1279356 3300048908 Bacteria 536
1365 Ga0496106_0019758 3300048909 Bacteria 4995
1366 Ga0496106_0077650 3300048909 Bacteria 2546
1367 Ga0496106_0169102 3300048909 Bacteria 1732
1368 Ga0496106_0245166 3300048909 Bacteria 1432
1369 Ga0496106_0284688 3300048909 Bacteria 1324
1370 Ga0496106_0433338 3300048909 Bacteria 1056
1371 Ga0496106_0625231 3300048909 Bacteria 861
1372 Ga0496106_0742049 3300048909 Bacteria 781
1373 Ga0496106_1279327 3300048909 Bacteria 570
1374 Ga0496107_0018477 3300048910 Bacteria 4909
1375 Ga0496107_0023742 3300048910 Bacteria 4334
1376 Ga0496107_0033346 3300048910 Bacteria 3684
1377 Ga0496107_0053046 3300048910 Bacteria 2925
1378 Ga0496107_0140243 3300048910 Bacteria 1787
1379 Ga0496107_0480403 3300048910 Bacteria 922
1380 Ga0496108_0009320 3300048911 Bacteria 7947
1381 Ga0496108_0010462 3300048911 Bacteria 7536
1382 Ga0496108_0277693 3300048911 Bacteria 1458
1383 Ga0496108_0574227 3300048911 Bacteria 983
1384 Ga0496108_0719853 3300048911 Bacteria 865
1385 Ga0496109_0000445 3300048912 Bacteria 35570
1386 Ga0496109_0003257 3300048912 Bacteria 13535
1387 Ga0496109_0082254 3300048912 Bacteria 2967
1388 Ga0496109_0161488 3300048912 Bacteria 2099
1389 Ga0496109_0169101 3300048912 Bacteria 2050
1390 Ga0496109_0190345 3300048912 Bacteria 1928
1391 Ga0496109_0217162 3300048912 Bacteria 1798
1392 Ga0496109_0225976 3300048912 Bacteria 1760
1393 Ga0496109_0775071 3300048912 Bacteria 897
1394 Ga0496109_1874503 3300048912 Bacteria 532
1395 Ga0496110_0000079 3300048913 Bacteria 50026
1396 Ga0496110_0000983 3300048913 Bacteria 19971
1397 Ga0496110_0017812 3300048913 Bacteria 5945
1398 Ga0496110_0032177 3300048913 Bacteria 4528
1399 Ga0496110_0207399 3300048913 Bacteria 1781
1400 Ga0496110_0915272 3300048913 Bacteria 783
1401 Ga0496110_0940903 3300048913 Bacteria 771
1402 Ga0496111_0000557 3300048914 Bacteria 19378
1403 Ga0496111_0001267 3300048914 Bacteria 14151
1404 Ga0496111_0096517 3300048914 Bacteria 2169
1405 Ga0496111_0204837 3300048914 Bacteria 1466
1406 Ga0496111_0647267 3300048914 Bacteria 771
1407 Ga0496111_0954755 3300048914 Bacteria 616
1408 Ga0496112_0000007 3300048915 Bacteria 338850
1409 Ga0496112_0008451 3300048915 Bacteria 9223
1410 Ga0496112_0017728 3300048915 Bacteria 6701
1411 Ga0496112_0055603 3300048915 Bacteria 3892
1412 Ga0496112_0078197 3300048915 Bacteria 3272
1413 Ga0496112_1011175 3300048915 Bacteria 751
1414 Ga0496112_1397289 3300048915 Bacteria 615
1415 Ga0496112_1623170 3300048915 Bacteria 560
1416 Ga0496113_0017092 3300048916 Bacteria 5029
1417 Ga0496113_0020455 3300048916 Bacteria 4652
1418 Ga0496113_0061383 3300048916 Bacteria 2836
1419 Ga0496113_1519630 3300048916 Bacteria 516
1420 Ga0496114_0004840 3300048917 Bacteria 10491
1421 Ga0496114_0006753 3300048917 Bacteria 9038
1422 Ga0496114_0037031 3300048917 Bacteria 4034
1423 Ga0496114_0046560 3300048917 Bacteria 3604
1424 Ga0496114_0056294 3300048917 Bacteria 3281
1425 Ga0496114_0064981 3300048917 Bacteria 3056
1426 Ga0496114_0117309 3300048917 Bacteria 2286
1427 Ga0496114_0241471 3300048917 Bacteria 1588
1428 Ga0496114_0623169 3300048917 Bacteria 950
1429 Ga0496114_1089561 3300048917 Bacteria 683
1430 Ga0496115_0010379 3300048918 Bacteria 6958
1431 Ga0496115_0012343 3300048918 Bacteria 6424
1432 Ga0496115_0027891 3300048918 Bacteria 4420
1433 Ga0496115_0037851 3300048918 Bacteria 3824
1434 Ga0496115_0056073 3300048918 Bacteria 3166
1435 Ga0496115_0073003 3300048918 Bacteria 2784
1436 Ga0496115_0094650 3300048918 Bacteria 2444
1437 Ga0496115_0153982 3300048918 Bacteria 1899
1438 Ga0496115_0173105 3300048918 Bacteria 1785
1439 Ga0496115_0783581 3300048918 Bacteria 743
1440 Ga0496116_0073590 3300048919 Bacteria 2153
1441 Ga0496117_0085314 3300048920 Bacteria 2056
1442 Ga0496117_0294273 3300048920 Bacteria 863
1443 Ga0496118_0005764 3300048921 Bacteria 13915
1444 Ga0496118_0194341 3300048921 Bacteria 1210
1445 Ga0496119_0012846 3300048922 Bacteria 6753
1446 Ga0496120_0033281 3300048923 Bacteria 3098
1447 Ga0496121_0267441 3300048924 Bacteria 1177
1448 Ga0496122_0313017 3300048925 Bacteria 839
1449 Ga0496126_0016860 3300048929 Bacteria 7291
1450 Ga0496126_0023859 3300048929 Bacteria 5919
1451 Ga0496126_0093794 3300048929 Bacteria 2635
1452 Ga0501306_015803 3300049127 Bacteria 1008
1453 Ga0501308_008067 3300049128 Bacteria 1118
1454 Ga0501309_033628 3300049129 Bacteria 764
1455 Ga0501310_007316 3300049130 Bacteria 1177
1456 Ga0501305_018823 3300049161 Bacteria 1003
1457 Ga0501307_059577 3300049162 Bacteria 590
1458 Ga0501317_013459 3300049533 Bacteria 1023
1459 Ga0501031_0205302 3300049568 Bacteria 1285
1460 Ga0501031_0303543 3300049568 Bacteria 1034
1461 Ga0501031_0370991 3300049568 Bacteria 926
1462 Ga0501031_0441178 3300049568 Bacteria 841
1463 Ga0501031_0877668 3300049568 Bacteria 574
1464 Ga0501032_0243871 3300049569 Bacteria 1167
1465 Ga0501032_0267891 3300049569 Bacteria 1107
1466 Ga0501032_0318392 3300049569 Bacteria 1004
1467 Ga0501032_1025586 3300049569 Bacteria 518
1468 Ga0501033_0335291 3300049570 Bacteria 1061
1469 Ga0501033_0450220 3300049570 Bacteria 894
1470 Ga0501033_0780734 3300049570 Bacteria 647
1471 Ga0501034_0012529 3300049571 Bacteria 8754
1472 Ga0501034_0371459 3300049571 Bacteria 1356
1473 Ga0501034_0694229 3300049571 Bacteria 917
1474 Ga0501036_0036626 3300049572 Bacteria 4152
1475 Ga0501036_0084524 3300049572 Bacteria 2683
1476 Ga0501036_0530272 3300049572 Bacteria 979
1477 Ga0501037_0295303 3300049573 Bacteria 1126
1478 Ga0501037_0389098 3300049573 Bacteria 957
1479 Ga0501038_0041796 3300049574 Bacteria 3997
1480 Ga0501039_0007709 3300049575 Bacteria 8218
1481 Ga0501039_0012581 3300049575 Bacteria 6466
1482 Ga0501039_0332426 3300049575 Bacteria 1194
1483 Ga0501039_0947982 3300049575 Bacteria 669
1484 Ga0501039_1363484 3300049575 Bacteria 546
1485 Ga0501040_0004923 3300049576 Bacteria 8643
1486 Ga0501040_0079281 3300049576 Bacteria 2273
1487 Ga0501040_0264550 3300049576 Bacteria 1227
1488 Ga0501040_0334470 3300049576 Bacteria 1084
1489 Ga0501040_0473144 3300049576 Bacteria 902
1490 Ga0501040_0541266 3300049576 Bacteria 840
1491 Ga0501041_0038812 3300049577 Bacteria 2888
1492 Ga0501041_0071912 3300049577 Bacteria 2124
1493 Ga0501041_0222709 3300049577 Bacteria 1184
1494 Ga0501041_0470904 3300049577 Bacteria 798
1495 Ga0501041_0512440 3300049577 Bacteria 763
1496 Ga0501042_0027184 3300049578 Bacteria 4022
1497 Ga0501042_0326457 3300049578 Bacteria 1109
1498 Ga0501042_0514206 3300049578 Bacteria 870
1499 Ga0501042_0612620 3300049578 Bacteria 792
1500 Ga0501043_0022634 3300049579 Bacteria 4927
1501 Ga0501043_0361287 3300049579 Bacteria 1102
1502 Ga0501043_0386469 3300049579 Bacteria 1059
1503 Ga0501046_0134747 3300049580 Bacteria 1871
1504 Ga0501046_0820294 3300049580 Bacteria 651
1505 Ga0501047_0099339 3300049581 Bacteria 2789
1506 Ga0501047_0583711 3300049581 Bacteria 940
1507 Ga0501048_0010287 3300049582 Bacteria 6994
1508 Ga0501048_0132559 3300049582 Bacteria 1761
1509 Ga0501048_0307824 3300049582 Bacteria 1128
1510 Ga0501067_0003078 3300049583 Bacteria 9202
1511 Ga0501067_0042917 3300049583 Bacteria 2512
1512 Ga0501067_0265468 3300049583 Bacteria 956
1513 Ga0501067_0379170 3300049583 Bacteria 788
1514 Ga0501068_0002322 3300049584 Bacteria 10142
1515 Ga0501068_0033823 3300049584 Bacteria 3046
1516 Ga0501068_0400123 3300049584 Bacteria 885
1517 Ga0501068_0441565 3300049584 Bacteria 841
1518 Ga0501069_0000453 3300049585 Bacteria 18732
1519 Ga0501069_0023498 3300049585 Bacteria 3362
1520 Ga0501069_0063145 3300049585 Bacteria 2068
1521 Ga0501069_0120939 3300049585 Bacteria 1495
1522 Ga0501069_0625440 3300049585 Bacteria 647
1523 Ga0501070_0003383 3300049586 Bacteria 13839
1524 Ga0501070_0005689 3300049586 Bacteria 10626
1525 Ga0501070_0078845 3300049586 Bacteria 2725
1526 Ga0501070_0082198 3300049586 Bacteria 2666
1527 Ga0501070_0824638 3300049586 Bacteria 727
1528 Ga0501071_0000119 3300049587 Bacteria 31338
1529 Ga0501071_0001083 3300049587 Bacteria 15121
1530 Ga0501071_0003597 3300049587 Bacteria 9710
1531 Ga0501071_0013395 3300049587 Bacteria 5587
1532 Ga0501071_0035692 3300049587 Bacteria 3543
1533 Ga0501071_0079974 3300049587 Bacteria 2390
1534 Ga0501071_0093200 3300049587 Bacteria 2215
1535 Ga0501071_0186402 3300049587 Bacteria 1555
1536 Ga0501071_0232425 3300049587 Bacteria 1389
1537 Ga0501071_0325563 3300049587 Bacteria 1167
1538 Ga0501071_0594473 3300049587 Bacteria 851
1539 Ga0501071_0649097 3300049587 Bacteria 812
1540 Ga0501072_0003791 3300049588 Bacteria 11412
1541 Ga0501072_0196150 3300049588 Bacteria 1610
1542 Ga0501072_0391552 3300049588 Bacteria 1102
1543 Ga0501072_0838180 3300049588 Bacteria 719
1544 Ga0501073_0050481 3300049589 Bacteria 2915
1545 Ga0501073_0348598 3300049589 Bacteria 1022
1546 Ga0501073_0397229 3300049589 Bacteria 952
1547 Ga0501074_0080636 3300049590 Bacteria 2334
1548 Ga0501074_0201833 3300049590 Bacteria 1417
1549 Ga0501074_0219858 3300049590 Bacteria 1352
1550 Ga0501074_0460017 3300049590 Bacteria 902
1551 Ga0501075_0003018 3300049591 Bacteria 11243
1552 Ga0501075_0017924 3300049591 Bacteria 5116
1553 Ga0501075_0065727 3300049591 Bacteria 2737
1554 Ga0501075_0417306 3300049591 Bacteria 1023
1555 Ga0501075_0724896 3300049591 Bacteria 757
1556 Ga0501076_0011794 3300049592 Bacteria 6526
1557 Ga0501076_0018028 3300049592 Bacteria 5372
1558 Ga0501076_0025886 3300049592 Bacteria 4542
1559 Ga0501076_0235600 3300049592 Bacteria 1497
1560 Ga0501076_0395260 3300049592 Bacteria 1137
1561 Ga0501076_0626588 3300049592 Bacteria 887
1562 Ga0501076_0969926 3300049592 Bacteria 700
1563 Ga0501077_0001393 3300049593 Bacteria 14562
1564 Ga0501077_0013176 3300049593 Bacteria 5181
1565 Ga0501077_0341118 3300049593 Bacteria 956
1566 Ga0501077_0547376 3300049593 Bacteria 743
1567 Ga0501079_0001191 3300049741 Bacteria 18223
1568 Ga0501079_0008393 3300049741 Bacteria 7829
1569 Ga0501079_0294174 3300049741 Bacteria 1270
1570 Ga0501079_0296414 3300049741 Bacteria 1265
1571 Ga0501079_0369740 3300049741 Bacteria 1124
1572 Ga0501079_0721627 3300049741 Bacteria 784
1573 Ga0501080_0058666 3300049742 Bacteria 3582
1574 Ga0501080_0208610 3300049742 Bacteria 1791
1575 Ga0501080_0621568 3300049742 Bacteria 958
1576 Ga0501080_0715172 3300049742 Bacteria 883
1577 Ga0501080_0931016 3300049742 Bacteria 756
1578 Ga0501080_1081449 3300049742 Bacteria 693
1579 Ga0501081_0000266 3300049743 Bacteria 27345
1580 Ga0501081_0016532 3300049743 Bacteria 4877
1581 Ga0501081_0536745 3300049743 Bacteria 873
1582 Ga0501081_1153071 3300049743 Bacteria 587
1583 Ga0501083_0058547 3300049744 Bacteria 2578
1584 Ga0501083_0111389 3300049744 Bacteria 1799
1585 Ga0501083_0539371 3300049744 Bacteria 759
1586 Ga0501083_0655407 3300049744 Bacteria 683
1587 Ga0501083_0761909 3300049744 Bacteria 630
1588 Ga0501035_0834418 3300049822 Bacteria 734
1589 Ga0501044_0553545 3300049823 Bacteria 1047
1590 Ga0501045_0010860 3300049824 Bacteria 6381
1591 Ga0501045_0031322 3300049824 Bacteria 3852
1592 Ga0501045_0159456 3300049824 Bacteria 1679
1593 Ga0501045_0165912 3300049824 Bacteria 1645
1594 Ga0501045_0284278 3300049824 Bacteria 1231
1595 Ga0501045_0918306 3300049824 Bacteria 643
1596 nmdc:mga00v17_41757_c1 3300050491 Bacteria 2756
1597 nmdc:mga0yw44_18369_c1 3300050492 Bacteria 3828
1598 nmdc:mga0yw44_310776_c1 3300050492 Bacteria 1057
1599 nmdc:mga0yw44_47549_c1 3300050492 Bacteria 2583
1600 nmdc:mga06z11_349474_c1 3300050494 Bacteria 885
1601 nmdc:mga07m45_108234_c1 3300050496 Bacteria 1599
1602 nmdc:mga05p37_24103_c1 3300050507 Bacteria 7391
1603 nmdc:mga05p37_33875_c1 3300050507 Bacteria 6257
1604 nmdc:mga05p37_3540_c1 3300050507 Bacteria 18225
1605 nmdc:mga09592_208420_c2 3300050508 Bacteria 939
1606 nmdc:mga09592_51891_c1 3300050508 Bacteria 3460
1607 nmdc:mga0qj67_418401_c1 3300050509 Bacteria 1080
1608 nmdc:mga06r32_134251_c1 3300050510 Bacteria 2449
1609 nmdc:mga08y16_1246015_c1 3300050511 Bacteria 713
1610 nmdc:mga08y16_266255_c1 3300050511 Bacteria 1769
1611 nmdc:mga08y16_433649_c1 3300050511 Bacteria 1342
1612 nmdc:mga08y16_82947_c1 3300050511 Bacteria 3342
1613 nmdc:mga0n895_1104575_c1 3300050512 Bacteria 770
1614 nmdc:mga0n895_21002_c1 3300050512 Bacteria 6100
1615 nmdc:mga0n895_279161_c1 3300050512 Bacteria 1694
1616 nmdc:mga0n895_363286_c1 3300050512 Bacteria 1466
1617 nmdc:mga0n895_479689_c1 3300050512 Bacteria 1254
1618 nmdc:mga0n895_489885_c1 3300050512 Bacteria 1239
1619 nmdc:mga0n895_56580_c1 3300050512 Bacteria 3864
1620 nmdc:mga0n895_719278_c1 3300050512 Bacteria 993
1621 nmdc:mga0rr50_179533_c1 3300050513 Bacteria 1730
1622 nmdc:mga0rr50_199265_c1 3300050513 Bacteria 1644
1623 nmdc:mga0rr50_368092_c1 3300050513 Bacteria 1211
1624 nmdc:mga0rr50_67644_c1 3300050513 Bacteria 2714
1625 nmdc:mga08x19_338891_c1 3300050514 Bacteria 1048
1626 nmdc:mga08x19_367925_c1 3300050514 Bacteria 1005
1627 nmdc:mga08x19_425770_c1 3300050514 Bacteria 933
1628 nmdc:mga0a205_1468245_c1 3300050515 Bacteria 530
1629 nmdc:mga0a205_2010_c1 3300050515 Bacteria 17745
1630 nmdc:mga0a205_252371_c1 3300050515 Bacteria 1643
1631 nmdc:mga0a205_25674_c1 3300050515 Bacteria 5615
1632 nmdc:mga0a205_271456_c1 3300050515 Bacteria 1573
1633 nmdc:mga0a205_327973_c1 3300050515 Bacteria 1401
1634 Ga0495601_0016271 3300053077 Bacteria 4506
1635 Ga0495601_0045561 3300053077 Bacteria 2758
1636 Ga0495601_0050354 3300053077 Bacteria 2627
1637 Ga0495601_0073549 3300053077 Bacteria 2185
1638 Ga0495601_0157372 3300053077 Bacteria 1484
1639 Ga0495601_0459998 3300053077 Bacteria 822
1640 Ga0495601_0598805 3300053077 Bacteria 707
1641 Ga0495612_0109786 3300053078 Bacteria 1179
1642 Ga0495612_0125030 3300053078 Bacteria 1108
1643 Ga0500635_0000204 3300053080 Bacteria 29368
1644 Ga0495655_0079213 3300053083 Bacteria 936
1645 Ga0495595_0046669 3300053084 Bacteria 1996
1646 Ga0495595_0088470 3300053084 Bacteria 1483
1647 Ga0495619_0007866 3300053085 Bacteria 6745
1648 Ga0495619_0026075 3300053085 Bacteria 3758
1649 Ga0495619_0067168 3300053085 Bacteria 2393
1650 Ga0495619_0250509 3300053085 Bacteria 1227
1651 Ga0495619_0550580 3300053085 Bacteria 791
1652 Ga0501084_0006409 3300054114 Bacteria 9674
1653 Ga0501084_0015419 3300054114 Bacteria 6336
1654 Ga0501084_0162417 3300054114 Bacteria 1885
1655 Ga0501084_0179330 3300054114 Bacteria 1788
1656 Ga0590071_046949 3300059421 Bacteria 1044
1657 Ga0587084_008557 3300059477 Bacteria 1299
1658 Ga0587084_093124 3300059477 Bacteria 600
1659 Ga0587093_032545 3300059478 Bacteria 757
1660 Ga0587066_105217 3300059490 Bacteria 647
1661 Ga0587070_026154 3300059491 Bacteria 1023
1662 Ga0587070_056270 3300059491 Bacteria 800
1663 Ga0587070_057172 3300059491 Bacteria 796
1664 Ga0587070_101553 3300059491 Bacteria 662
1665 Ga0587073_0070967 3300059492 Bacteria 841
1666 Ga0587073_0217606 3300059492 Bacteria 582
1667 Ga0587077_077231 3300059493 Bacteria 756
1668 Ga0587077_132746 3300059493 Bacteria 633
1669 Ga0587077_261026 3300059493 Bacteria 505
1670 Ga0587080_028007 3300059503 Bacteria 965
1671 Ga0587080_029121 3300059503 Bacteria 952
1672 Ga0587080_033122 3300059503 Bacteria 910
1673 Ga0587080_078742 3300059503 Bacteria 672
1674 Ga0587080_153072 3300059503 Bacteria 535
1675 Ga0587082_108034 3300059504 Bacteria 615
1676 Ga0587083_0003623 3300059505 Bacteria 2071
1677 Ga0587083_0097976 3300059505 Bacteria 726
1678 Ga0587083_0122413 3300059505 Bacteria 673
1679 Ga0587083_0258639 3300059505 Bacteria 522
1680 Ga0587085_009458 3300059506 Bacteria 1270
1681 Ga0587088_003103 3300059508 Bacteria 1972
1682 Ga0587088_061741 3300059508 Bacteria 761
1683 Ga0587089_015017 3300059509 Bacteria 1018
1684 Ga0587090_021586 3300059510 Bacteria 1011
1685 Ga0587090_034598 3300059510 Bacteria 862
1686 Ga0587091_018726 3300059511 Bacteria 1182
1687 Ga0587091_018976 3300059511 Bacteria 1177
1688 Ga0587091_041792 3300059511 Bacteria 907
1689 Ga0587091_068825 3300059511 Bacteria 770
1690 Ga0587091_080519 3300059511 Bacteria 730
1691 Ga0587092_043274 3300059512 Bacteria 792
1692 Ga0587094_126096 3300059513 Bacteria 517
1693 Ga0587098_037316 3300059604 Bacteria 694
1694 Ga0587098_088197 3300059604 Bacteria 526
1695 Ga0587106_135570 3300059605 Bacteria 535
1696 Ga0587101_045628 3300059623 Bacteria 738
1697 Ga0587122_000616 3300059628 Bacteria 1976
1698 Ga0587122_045407 3300059628 Bacteria 557
1699 Ga0587128_000395 3300059630 Bacteria 3139
1700 Ga0587128_022020 3300059630 Bacteria 988
1701 Ga0587128_045034 3300059630 Bacteria 786
1702 Ga0587128_046109 3300059630 Bacteria 780
1703 Ga0587062_075427 3300059639 Bacteria 617
1704 Ga0587067_058027 3300059640 Bacteria 803
1705 Ga0587067_130653 3300059640 Bacteria 612
1706 Ga0587067_152189 3300059640 Bacteria 582
1707 Ga0587068_008623 3300059641 Bacteria 1483
1708 Ga0587069_014182 3300059642 Bacteria 1108
1709 Ga0587069_061781 3300059642 Bacteria 692
1710 Ga0587072_126320 3300059643 Bacteria 598
1711 Ga0587075_018259 3300059644 Bacteria 1016
1712 Ga0587075_053703 3300059644 Bacteria 710
1713 Ga0587076_014556 3300059645 Bacteria 1213
1714 Ga0587076_035987 3300059645 Bacteria 903
1715 Ga0587079_050510 3300059647 Bacteria 871
1716 Ga0587079_063562 3300059647 Bacteria 806
1717 Ga0587102_001277 3300059649 Bacteria 1726
1718 Ga0587107_068402 3300059652 Bacteria 643
1719 Ga0587107_104737 3300059652 Bacteria 564
1720 Ga0587110_016957 3300059654 Bacteria 793
1721 Ga0587110_038518 3300059654 Bacteria 607
1722 Ga0587114_009697 3300059655 Bacteria 1160
1723 Ga0587114_070143 3300059655 Bacteria 633
1724 Ga0587120_026200 3300059659 Bacteria 578
1725 Ga0587071_063222 3300060344 Bacteria 791
1726 Ga0587071_074609 3300060344 Bacteria 745
1727 Ga0587071_088613 3300060344 Bacteria 700
1728 Ga0587071_089239 3300060344 Bacteria 698
1729 Ga0587071_102775 3300060344 Bacteria 663
1730 Ga0587111_0081325 3300060346 Bacteria 775
1731 Ga0587111_0119404 3300060346 Bacteria 677
1732 Ga0587111_0178622 3300060346 Bacteria 588
1733 Ga0501082_0014508 3300060353 Bacteria 6784
1734 Ga0501082_0020323 3300060353 Bacteria 5724
1735 Ga0501082_0410999 3300060353 Bacteria 1181
1736 Ga0501082_0521707 3300060353 Bacteria 1038
1737 Ga0501082_1212715 3300060353 Bacteria 659
1738 Ga0501082_1991016 3300060353 Bacteria 506
1739 Ga0466962_0032211 3300061719 Bacteria 2509
1740 Ga0530510_0042730 3300061734 Bacteria 3274
1741 Ga0530510_0061548 3300061734 Bacteria 2717
1742 Ga0530510_0126308 3300061734 Bacteria 1880
1743 Ga0530510_0641936 3300061734 Bacteria 808
1744 Ga0530510_1078602 3300061734 Bacteria 615

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044673 Ga0453683_0466537 Ga0453683_0466537_167_532 118
2 3300060346 Ga0587111_0119404 Ga0587111_0119404_127_510 119
3 iso_pu_bacteria 2547132111 2547411357 120
4 iso_pu_bacteria 2554235005 2554256760 120
5 iso_pu_bacteria 2616644814 2616696762 120
6 iso_pu_bacteria 2616644941 2616901906 120
7 iso_pu_bacteria 2643221678 2644439365 120
8 iso_pu_bacteria 2643221714 2644633261 120
9 iso_pu_bacteria 2784132148 2784589770 120
10 iso_pu_bacteria 2808606359 2808843366 120
11 iso_pu_bacteria 2808606448 2809233440 120
12 iso_pu_bacteria 2811994879 2812356679 120
13 iso_pu_bacteria 2811994917 2812479392 120
14 iso_pu_bacteria 2852635781 2852643123 120
15 iso_pu_bacteria 2862178590 2862185297 120
16 iso_pu_bacteria 2862290372 2862292094 120
17 iso_pu_bacteria 2862507626 2862516757 120
18 iso_pu_bacteria 2867428634 2867429963 120
19 iso_pu_bacteria 2912715099 2912718428 120
20 iso_pu_bacteria 2912723979 2912730754 120
21 iso_pu_bacteria 2919468124 2919470265 120
22 iso_pu_bacteria 2935390628 2935395234 120
23 iso_pu_bacteria 2946064051 2946069192 120
24 iso_pu_bacteria 2946072368 2946077140 120
25 iso_pu_bacteria 2947224130 2947227742 120
26 iso_pu_bacteria 2954691527 2954695554 120
27 iso_pu_bacteria 2954701450 2954710748 120
28 iso_pu_bacteria 2954711539 2954714977 120
29 iso_pu_bacteria 2954721474 2954724919 120
30 iso_pu_bacteria 2954731030 2954736899 120
31 iso_pu_bacteria 2954740390 2954743845 120
32 iso_pu_bacteria 2954749733 2954755747 120
33 iso_pu_bacteria 2954759201 2954762798 120
34 iso_pu_bacteria 3006393351 3006398680 120
35 iso_pu_bacteria 3006486233 3006490571 120
36 iso_pu_bacteria 3006493962 3006498854 120
37 iso_pu_bacteria 8002784119 8002784650 120
38 iso_pu_bacteria 8023623736 8023626963 120
39 iso_pu_bacteria 8025413630 8025417220 120
40 iso_pu_bacteria 8033684223 8033691144 120
41 iso_pu_bacteria 8056829672 8056837587 120
42 3300034817 Ga0373948_0133675 Ga0373948_0133675_19_387 122
43 3300044712 Ga0453684_0060759 Ga0453684_0060759_460_828 122
44 3300046507 Ga0495606_0259492 Ga0495606_0259492_495_863 122
45 3300049570 Ga0501033_0335291 Ga0501033_0335291_361_729 122
46 3300049572 Ga0501036_0084524 Ga0501036_0084524_1393_1761 122
47 3300049576 Ga0501040_0079281 Ga0501040_0079281_550_918 122
48 3300049582 Ga0501048_0132559 Ga0501048_0132559_665_1033 122
49 3300049587 Ga0501071_0186402 Ga0501071_0186402_563_931 122
50 3300049588 Ga0501072_0838180 Ga0501072_0838180_56_424 122
51 3300049591 Ga0501075_0724896 Ga0501075_0724896_308_676 122
52 3300049741 Ga0501079_0296414 Ga0501079_0296414_460_828 122
53 3300049742 Ga0501080_0931016 Ga0501080_0931016_131_499 122
54 3300049744 Ga0501083_0655407 Ga0501083_0655407_274_642 122
55 3300049822 Ga0501035_0834418 Ga0501035_0834418_113_481 122
56 3300049824 Ga0501045_0284278 Ga0501045_0284278_333_701 122
57 3300060353 Ga0501082_0521707 Ga0501082_0521707_657_1025 122
58 3300061734 Ga0530510_0061548 Ga0530510_0061548_1742_2110 122
59 3300002075 JGI24738J21930_10026481 JGI24738J21930_100264813 123
60 3300002459 JGI24751J29686_10064209 JGI24751J29686_100642091 123
61 3300003203 JGI25406J46586_10006196 JGI25406J46586_100061969 123
62 3300003203 JGI25406J46586_10008605 JGI25406J46586_100086053 123
63 3300004800 Ga0058861_10046230 Ga0058861_100462301 123
64 3300004801 Ga0058860_12198917 Ga0058860_121989171 123
65 3300004803 Ga0058862_10153948 Ga0058862_101539481 123
66 3300005328 Ga0070676_10224730 Ga0070676_102247303 123
67 3300005329 Ga0070683_100274263 Ga0070683_1002742632 123
68 3300005330 Ga0070690_100396542 Ga0070690_1003965422 123
69 3300005330 Ga0070690_100835503 Ga0070690_1008355032 123
70 3300005331 Ga0070670_101091103 Ga0070670_1010911031 123
71 3300005334 Ga0068869_100062239 Ga0068869_1000622394 123
72 3300005334 Ga0068869_100168006 Ga0068869_1001680061 123
73 3300005336 Ga0070680_100093789 Ga0070680_1000937893 123
74 3300005336 Ga0070680_100153032 Ga0070680_1001530322 123
75 3300005337 Ga0070682_100236792 Ga0070682_1002367921 123
76 3300005338 Ga0068868_100005144 Ga0068868_1000051442 123
77 3300005338 Ga0068868_100122450 Ga0068868_1001224503 123
78 3300005339 Ga0070660_100128075 Ga0070660_1001280752 123
79 3300005339 Ga0070660_100134654 Ga0070660_1001346543 123
80 3300005340 Ga0070689_100158604 Ga0070689_1001586042 123
81 3300005341 Ga0070691_10024314 Ga0070691_100243142 123
82 3300005341 Ga0070691_10043635 Ga0070691_100436352 123
83 3300005347 Ga0070668_100729157 Ga0070668_1007291571 123
84 3300005353 Ga0070669_100478705 Ga0070669_1004787052 123
85 3300005354 Ga0070675_100082776 Ga0070675_1000827764 123
86 3300005354 Ga0070675_100417906 Ga0070675_1004179063 123
87 3300005354 Ga0070675_100760983 Ga0070675_1007609831 123
88 3300005355 Ga0070671_100151685 Ga0070671_1001516852 123
89 3300005355 Ga0070671_100341891 Ga0070671_1003418913 123
90 3300005356 Ga0070674_100238837 Ga0070674_1002388371 123
91 3300005365 Ga0070688_100043252 Ga0070688_1000432522 123
92 3300005366 Ga0070659_100012148 Ga0070659_10001214810 123
93 3300005366 Ga0070659_100018706 Ga0070659_1000187064 123
94 3300005367 Ga0070667_100882763 Ga0070667_1008827631 123
95 3300005434 Ga0070709_10186968 Ga0070709_101869681 123
96 3300005435 Ga0070714_100005269 Ga0070714_10000526911 123
97 3300005435 Ga0070714_101557988 Ga0070714_1015579881 123
98 3300005436 Ga0070713_100081990 Ga0070713_1000819904 123
99 3300005437 Ga0070710_10029185 Ga0070710_100291852 123
100 3300005437 Ga0070710_10090852 Ga0070710_100908523 123
101 3300005438 Ga0070701_10014791 Ga0070701_100147915 123
102 3300005439 Ga0070711_100019741 Ga0070711_1000197412 123
103 3300005439 Ga0070711_100030873 Ga0070711_1000308734 123
104 3300005440 Ga0070705_100064677 Ga0070705_1000646773 123
105 3300005441 Ga0070700_100014624 Ga0070700_1000146244 123
106 3300005441 Ga0070700_100181285 Ga0070700_1001812852 123
107 3300005444 Ga0070694_100213642 Ga0070694_1002136422 123
108 3300005445 Ga0070708_100770417 Ga0070708_1007704172 123
109 3300005455 Ga0070663_100405282 Ga0070663_1004052821 123
110 3300005455 Ga0070663_100739854 Ga0070663_1007398541 123
111 3300005456 Ga0070678_100068279 Ga0070678_1000682794 123
112 3300005457 Ga0070662_100494365 Ga0070662_1004943652 123
113 3300005457 Ga0070662_100565695 Ga0070662_1005656951 123
114 3300005458 Ga0070681_10377690 Ga0070681_103776903 123
115 3300005459 Ga0068867_100261733 Ga0068867_1002617332 123
116 3300005466 Ga0070685_10030710 Ga0070685_100307102 123
117 3300005467 Ga0070706_100531095 Ga0070706_1005310952 123
118 3300005468 Ga0070707_101013754 Ga0070707_1010137542 123
119 3300005530 Ga0070679_100575647 Ga0070679_1005756472 123
120 3300005535 Ga0070684_100051018 Ga0070684_1000510183 123
121 3300005536 Ga0070697_100758674 Ga0070697_1007586741 123
122 3300005539 Ga0068853_100047078 Ga0068853_1000470783 123
123 3300005544 Ga0070686_100008884 Ga0070686_1000088844 123
124 3300005544 Ga0070686_100200306 Ga0070686_1002003062 123
125 3300005546 Ga0070696_100082401 Ga0070696_1000824012 123
126 3300005546 Ga0070696_100260895 Ga0070696_1002608952 123
127 3300005546 Ga0070696_100318727 Ga0070696_1003187272 123
128 3300005546 Ga0070696_100617234 Ga0070696_1006172342 123
129 3300005547 Ga0070693_100011341 Ga0070693_1000113416 123
130 3300005547 Ga0070693_100355640 Ga0070693_1003556402 123
131 3300005548 Ga0070665_100355567 Ga0070665_1003555673 123
132 3300005549 Ga0070704_100879611 Ga0070704_1008796111 123
133 3300005563 Ga0068855_100026947 Ga0068855_1000269474 123
134 3300005563 Ga0068855_100052631 Ga0068855_1000526317 123
135 3300005564 Ga0070664_100100347 Ga0070664_1001003473 123
136 3300005564 Ga0070664_101278998 Ga0070664_1012789982 123
137 3300005577 Ga0068857_100481910 Ga0068857_1004819101 123
138 3300005577 Ga0068857_101846732 Ga0068857_1018467322 123
139 3300005578 Ga0068854_100030804 Ga0068854_1000308044 123
140 3300005614 Ga0068856_100048606 Ga0068856_1000486066 123
141 3300005614 Ga0068856_100061274 Ga0068856_1000612744 123
142 3300005614 Ga0068856_100230255 Ga0068856_1002302553 123
143 3300005615 Ga0070702_100016072 Ga0070702_1000160725 123
144 3300005616 Ga0068852_100132206 Ga0068852_1001322063 123
145 3300005618 Ga0068864_100571654 Ga0068864_1005716542 123
146 3300005718 Ga0068866_10036626 Ga0068866_100366262 123
147 3300005718 Ga0068866_10136583 Ga0068866_101365832 123
148 3300005719 Ga0068861_100316610 Ga0068861_1003166103 123
149 3300005719 Ga0068861_102551714 Ga0068861_1025517141 123
150 3300005834 Ga0068851_10282940 Ga0068851_102829402 123
151 3300005840 Ga0068870_10084742 Ga0068870_100847423 123
152 3300005841 Ga0068863_100260616 Ga0068863_1002606163 123
153 3300005841 Ga0068863_100344654 Ga0068863_1003446543 123
154 3300005842 Ga0068858_100161047 Ga0068858_1001610472 123
155 3300005843 Ga0068860_100505616 Ga0068860_1005056163 123
156 3300005843 Ga0068860_100928713 Ga0068860_1009287132 123
157 3300005844 Ga0068862_100556312 Ga0068862_1005563123 123
158 3300005937 Ga0081455_10236082 Ga0081455_102360821 123
159 3300005985 Ga0081539_10003252 Ga0081539_100032523 123
160 3300005985 Ga0081539_10012303 Ga0081539_100123032 123
161 3300006028 Ga0070717_10033904 Ga0070717_100339046 123
162 3300006028 Ga0070717_10047424 Ga0070717_100474243 123
163 3300006173 Ga0070716_100545422 Ga0070716_1005454222 123
164 3300006173 Ga0070716_101271164 Ga0070716_1012711642 123
165 3300006175 Ga0070712_100012347 Ga0070712_1000123474 123
166 3300006237 Ga0097621_100013802 Ga0097621_1000138024 123
167 3300006237 Ga0097621_100355537 Ga0097621_1003555373 123
168 3300006237 Ga0097621_100587813 Ga0097621_1005878132 123
169 3300006358 Ga0068871_100027934 Ga0068871_1000279345 123
170 3300006844 Ga0075428_100587336 Ga0075428_1005873362 123
171 3300006852 Ga0075433_10080542 Ga0075433_100805424 123
172 3300006871 Ga0075434_100007021 Ga0075434_10000702118 123
173 3300006871 Ga0075434_100261099 Ga0075434_1002610994 123
174 3300006871 Ga0075434_100268762 Ga0075434_1002687623 123
175 3300006880 Ga0075429_100411179 Ga0075429_1004111791 123
176 3300006881 Ga0068865_100031053 Ga0068865_1000310534 123
177 3300006881 Ga0068865_102057633 Ga0068865_1020576331 123
178 3300006914 Ga0075436_100073498 Ga0075436_1000734981 123
179 3300007076 Ga0075435_100013055 Ga0075435_1000130552 123
180 3300009093 Ga0105240_10142595 Ga0105240_101425953 123
181 3300009094 Ga0111539_10148167 Ga0111539_101481674 123
182 3300009094 Ga0111539_12017782 Ga0111539_120177821 123
183 3300009098 Ga0105245_10036956 Ga0105245_100369566 123
184 3300009098 Ga0105245_10091660 Ga0105245_100916604 123
185 3300009098 Ga0105245_10484083 Ga0105245_104840832 123
186 3300009147 Ga0114129_10015434 Ga0114129_1001543411 123
187 3300009148 Ga0105243_10422171 Ga0105243_104221712 123
188 3300009148 Ga0105243_10955436 Ga0105243_109554362 123
189 3300009174 Ga0105241_10023878 Ga0105241_100238784 123
190 3300009174 Ga0105241_10189650 Ga0105241_101896502 123
191 3300009176 Ga0105242_10081594 Ga0105242_100815944 123
192 3300009176 Ga0105242_10106171 Ga0105242_101061712 123
193 3300009176 Ga0105242_10843581 Ga0105242_108435811 123
194 3300009177 Ga0105248_10105254 Ga0105248_101052542 123
195 3300009177 Ga0105248_10556440 Ga0105248_105564402 123
196 3300009545 Ga0105237_10037185 Ga0105237_100371854 123
197 3300009551 Ga0105238_10017104 Ga0105238_100171048 123
198 3300009551 Ga0105238_10069677 Ga0105238_100696772 123
199 3300009553 Ga0105249_10689710 Ga0105249_106897102 123
200 3300009553 Ga0105249_11995395 Ga0105249_119953952 123
201 3300009984 Ga0105029_112195 Ga0105029_1121951 123
202 3300010375 Ga0105239_10427946 Ga0105239_104279462 123
203 3300010375 Ga0105239_10466363 Ga0105239_104663632 123
204 3300010375 Ga0105239_10557683 Ga0105239_105576833 123
205 3300010375 Ga0105239_11495136 Ga0105239_114951362 123
206 3300011119 Ga0105246_10057920 Ga0105246_100579203 123
207 3300011119 Ga0105246_10287073 Ga0105246_102870733 123
208 3300013104 Ga0157370_10868953 Ga0157370_108689533 123
209 3300013105 Ga0157369_10054751 Ga0157369_100547517 123
210 3300013105 Ga0157369_10160525 Ga0157369_101605252 123
211 3300013296 Ga0157374_10524581 Ga0157374_105245812 123
212 3300013296 Ga0157374_10959560 Ga0157374_109595603 123
213 3300013297 Ga0157378_10266849 Ga0157378_102668492 123
214 3300013297 Ga0157378_11885732 Ga0157378_118857322 123
215 3300013306 Ga0163162_10046453 Ga0163162_100464533 123
216 3300013306 Ga0163162_10099425 Ga0163162_100994255 123
217 3300013306 Ga0163162_11863438 Ga0163162_118634381 123
218 3300013307 Ga0157372_10046776 Ga0157372_100467764 123
219 3300013307 Ga0157372_10079691 Ga0157372_100796917 123
220 3300013308 Ga0157375_10064914 Ga0157375_100649146 123
221 3300013308 Ga0157375_10316555 Ga0157375_103165553 123
222 3300014326 Ga0157380_10288228 Ga0157380_102882281 123
223 3300014326 Ga0157380_10572893 Ga0157380_105728932 123
224 3300014745 Ga0157377_10026594 Ga0157377_100265945 123
225 3300014745 Ga0157377_10592670 Ga0157377_105926702 123
226 3300014745 Ga0157377_11023182 Ga0157377_110231822 123
227 3300014968 Ga0157379_10147410 Ga0157379_101474102 123
228 3300014968 Ga0157379_10531124 Ga0157379_105311243 123
229 3300014969 Ga0157376_10046239 Ga0157376_100462394 123
230 3300014969 Ga0157376_10087652 Ga0157376_100876522 123
231 3300014969 Ga0157376_11387150 Ga0157376_113871501 123
232 3300017792 Ga0163161_10105842 Ga0163161_101058423 123
233 3300020069 Ga0197907_11298433 Ga0197907_112984332 123
234 3300020069 Ga0197907_11482061 Ga0197907_114820612 123
235 3300020070 Ga0206356_10509057 Ga0206356_105090572 123
236 3300020070 Ga0206356_11044350 Ga0206356_110443501 123
237 3300020078 Ga0206352_10341291 Ga0206352_103412911 123
238 3300020078 Ga0206352_10815645 Ga0206352_108156453 123
239 3300020081 Ga0206354_10074904 Ga0206354_100749041 123
240 3300025898 Ga0207692_10007776 Ga0207692_100077764 123
241 3300025899 Ga0207642_10204023 Ga0207642_102040232 123
242 3300025901 Ga0207688_10003165 Ga0207688_100031652 123
243 3300025903 Ga0207680_10598528 Ga0207680_105985281 123
244 3300025904 Ga0207647_10090838 Ga0207647_100908382 123
245 3300025905 Ga0207685_10619191 Ga0207685_106191911 123
246 3300025906 Ga0207699_10099923 Ga0207699_100999231 123
247 3300025907 Ga0207645_10137521 Ga0207645_101375212 123
248 3300025908 Ga0207643_10050065 Ga0207643_100500654 123
249 3300025910 Ga0207684_10745082 Ga0207684_107450822 123
250 3300025910 Ga0207684_10897040 Ga0207684_108970401 123
251 3300025911 Ga0207654_10081460 Ga0207654_100814604 123
252 3300025913 Ga0207695_10129689 Ga0207695_101296893 123
253 3300025914 Ga0207671_10080469 Ga0207671_100804693 123
254 3300025915 Ga0207693_10022846 Ga0207693_100228464 123
255 3300025915 Ga0207693_10258912 Ga0207693_102589121 123
256 3300025915 Ga0207693_10900110 Ga0207693_109001101 123
257 3300025916 Ga0207663_10011677 Ga0207663_100116773 123
258 3300025916 Ga0207663_11442947 Ga0207663_114429471 123
259 3300025917 Ga0207660_10117448 Ga0207660_101174483 123
260 3300025919 Ga0207657_10001055 Ga0207657_1000105532 123
261 3300025919 Ga0207657_10044718 Ga0207657_100447184 123
262 3300025921 Ga0207652_10542269 Ga0207652_105422692 123
263 3300025922 Ga0207646_10067220 Ga0207646_100672203 123
264 3300025923 Ga0207681_10357039 Ga0207681_103570392 123
265 3300025924 Ga0207694_10006100 Ga0207694_100061006 123
266 3300025924 Ga0207694_10079437 Ga0207694_100794374 123
267 3300025926 Ga0207659_10083284 Ga0207659_100832843 123
268 3300025926 Ga0207659_10659337 Ga0207659_106593372 123
269 3300025927 Ga0207687_10000332 Ga0207687_1000033233 123
270 3300025927 Ga0207687_10486464 Ga0207687_104864642 123
271 3300025928 Ga0207700_10199007 Ga0207700_101990072 123
272 3300025928 Ga0207700_11333167 Ga0207700_113331671 123
273 3300025929 Ga0207664_10004696 Ga0207664_100046962 123
274 3300025929 Ga0207664_10106499 Ga0207664_101064994 123
275 3300025932 Ga0207690_10043139 Ga0207690_100431394 123
276 3300025932 Ga0207690_11518080 Ga0207690_115180801 123
277 3300025933 Ga0207706_10199972 Ga0207706_101999722 123
278 3300025933 Ga0207706_10482472 Ga0207706_104824722 123
279 3300025934 Ga0207686_10465798 Ga0207686_104657982 123
280 3300025934 Ga0207686_10991413 Ga0207686_109914131 123
281 3300025935 Ga0207709_10179787 Ga0207709_101797872 123
282 3300025936 Ga0207670_10055965 Ga0207670_100559654 123
283 3300025937 Ga0207669_10174457 Ga0207669_101744572 123
284 3300025938 Ga0207704_10111612 Ga0207704_101116123 123
285 3300025939 Ga0207665_10159641 Ga0207665_101596414 123
286 3300025939 Ga0207665_11145254 Ga0207665_111452542 123
287 3300025940 Ga0207691_10138961 Ga0207691_101389613 123
288 3300025940 Ga0207691_10221557 Ga0207691_102215572 123
289 3300025940 Ga0207691_11386318 Ga0207691_113863181 123
290 3300025941 Ga0207711_10110582 Ga0207711_101105822 123
291 3300025942 Ga0207689_10021685 Ga0207689_100216859 123
292 3300025944 Ga0207661_10016251 Ga0207661_100162515 123
293 3300025949 Ga0207667_10011493 Ga0207667_1001149310 123
294 3300025949 Ga0207667_11307650 Ga0207667_113076502 123
295 3300025961 Ga0207712_11326639 Ga0207712_113266392 123
296 3300025981 Ga0207640_10018900 Ga0207640_100189005 123
297 3300025986 Ga0207658_10125019 Ga0207658_101250192 123
298 3300026023 Ga0207677_10063649 Ga0207677_100636495 123
299 3300026023 Ga0207677_10723305 Ga0207677_107233053 123
300 3300026035 Ga0207703_10074488 Ga0207703_100744884 123
301 3300026041 Ga0207639_10430698 Ga0207639_104306982 123
302 3300026067 Ga0207678_10112985 Ga0207678_101129854 123
303 3300026075 Ga0207708_10026038 Ga0207708_100260384 123
304 3300026075 Ga0207708_10213965 Ga0207708_102139653 123
305 3300026075 Ga0207708_10324981 Ga0207708_103249812 123
306 3300026078 Ga0207702_10042541 Ga0207702_100425414 123
307 3300026078 Ga0207702_10846700 Ga0207702_108467002 123
308 3300026078 Ga0207702_11296370 Ga0207702_112963702 123
309 3300026088 Ga0207641_10308358 Ga0207641_103083583 123
310 3300026089 Ga0207648_10078065 Ga0207648_100780654 123
311 3300026095 Ga0207676_10140024 Ga0207676_101400242 123
312 3300026095 Ga0207676_10851219 Ga0207676_108512192 123
313 3300026116 Ga0207674_10168198 Ga0207674_101681983 123
314 3300026118 Ga0207675_100166279 Ga0207675_1001662794 123
315 3300026121 Ga0207683_10008575 Ga0207683_100085757 123
316 3300026121 Ga0207683_10067303 Ga0207683_100673033 123
317 3300026121 Ga0207683_10740649 Ga0207683_107406492 123
318 3300027252 Ga0209973_1020452 Ga0209973_10204522 123
319 3300027364 Ga0209967_1013822 Ga0209967_10138222 123
320 3300027395 Ga0209996_1031334 Ga0209996_10313341 123
321 3300027471 Ga0209995_1064474 Ga0209995_10644741 123
322 3300027526 Ga0209968_1014896 Ga0209968_10148962 123
323 3300027543 Ga0209999_1010955 Ga0209999_10109553 123
324 3300027552 Ga0209982_1034364 Ga0209982_10343642 123
325 3300027617 Ga0210002_1018339 Ga0210002_10183392 123
326 3300027665 Ga0209983_1058714 Ga0209983_10587141 123
327 3300027682 Ga0209971_1007217 Ga0209971_10072172 123
328 3300027695 Ga0209966_1025954 Ga0209966_10259542 123
329 3300027717 Ga0209998_10007811 Ga0209998_100078113 123
330 3300027717 Ga0209998_10024310 Ga0209998_100243102 123
331 3300027876 Ga0209974_10019832 Ga0209974_100198323 123
332 3300028379 Ga0268266_10338848 Ga0268266_103388483 123
333 3300028381 Ga0268264_10591831 Ga0268264_105918312 123
334 3300028381 Ga0268264_10756906 Ga0268264_107569062 123
335 3300028556 Ga0265337_1035179 Ga0265337_10351792 123
336 3300028558 Ga0265326_10014445 Ga0265326_100144452 123
337 3300028563 Ga0265319_1000855 Ga0265319_100085512 123
338 3300028563 Ga0265319_1101346 Ga0265319_11013462 123
339 3300028573 Ga0265334_10030082 Ga0265334_100300824 123
340 3300028577 Ga0265318_10033646 Ga0265318_100336462 123
341 3300028653 Ga0265323_10078944 Ga0265323_100789442 123
342 3300028654 Ga0265322_10010856 Ga0265322_100108564 123
343 3300028666 Ga0265336_10167246 Ga0265336_101672461 123
344 3300028800 Ga0265338_10030239 Ga0265338_100302391 123
345 3300029957 Ga0265324_10006460 Ga0265324_100064605 123
346 3300029957 Ga0265324_10017063 Ga0265324_100170633 123
347 3300031235 Ga0265330_10010314 Ga0265330_100103146 123
348 3300031235 Ga0265330_10013785 Ga0265330_100137853 123
349 3300031238 Ga0265332_10023897 Ga0265332_100238975 123
350 3300031238 Ga0265332_10030283 Ga0265332_100302834 123
351 3300031238 Ga0265332_10153172 Ga0265332_101531722 123
352 3300031240 Ga0265320_10002674 Ga0265320_100026747 123
353 3300031240 Ga0265320_10004554 Ga0265320_100045546 123
354 3300031241 Ga0265325_10004083 Ga0265325_1000408311 123
355 3300031242 Ga0265329_10003710 Ga0265329_100037104 123
356 3300031242 Ga0265329_10004401 Ga0265329_100044018 123
357 3300031247 Ga0265340_10004482 Ga0265340_100044825 123
358 3300031249 Ga0265339_10098430 Ga0265339_100984301 123
359 3300031251 Ga0265327_10003480 Ga0265327_1000348017 123
360 3300031344 Ga0265316_10007887 Ga0265316_1000788711 123
361 3300031344 Ga0265316_10023310 Ga0265316_100233102 123
362 3300031344 Ga0265316_10059571 Ga0265316_100595712 123
363 3300031595 Ga0265313_10053419 Ga0265313_100534192 123
364 3300031691 Ga0316579_10219317 Ga0316579_102193172 123
365 3300031691 Ga0316579_10503885 Ga0316579_105038852 123
366 3300031711 Ga0265314_10016170 Ga0265314_100161704 123
367 3300031711 Ga0265314_10116285 Ga0265314_101162854 123
368 3300031712 Ga0265342_10001795 Ga0265342_1000179527 123
369 3300031712 Ga0265342_10034561 Ga0265342_100345614 123
370 3300031727 Ga0316576_10037846 Ga0316576_100378464 123
371 3300031727 Ga0316576_10043431 Ga0316576_100434313 123
372 3300031727 Ga0316576_10076538 Ga0316576_100765382 123
373 3300031727 Ga0316576_10240448 Ga0316576_102404481 123
374 3300031728 Ga0316578_10100243 Ga0316578_101002433 123
375 3300031728 Ga0316578_10445361 Ga0316578_104453612 123
376 3300031731 Ga0307405_11648287 Ga0307405_116482871 123
377 3300031733 Ga0316577_10305216 Ga0316577_103052162 123
378 3300032133 Ga0316583_10023673 Ga0316583_100236734 123
379 3300032137 Ga0316585_10181001 Ga0316585_101810012 123
380 3300032168 Ga0316593_10053135 Ga0316593_100531352 123
381 3300032168 Ga0316593_10120476 Ga0316593_101204762 123
382 3300032168 Ga0316593_10250320 Ga0316593_102503202 123
383 3300033524 Ga0316592_1013793 Ga0316592_10137933 123
384 3300033524 Ga0316592_1021646 Ga0316592_10216462 123
385 3300033524 Ga0316592_1026831 Ga0316592_10268312 123
386 3300033524 Ga0316592_1096925 Ga0316592_10969252 123
387 3300033527 Ga0316586_1058871 Ga0316586_10588712 123
388 3300033529 Ga0316587_1081568 Ga0316587_10815682 123
389 3300033541 Ga0316596_1025941 Ga0316596_10259413 123
390 3300033541 Ga0316596_1040913 Ga0316596_10409132 123
391 3300033541 Ga0316596_1058524 Ga0316596_10585242 123
392 3300033541 Ga0316596_1130116 Ga0316596_11301162 123
393 3300033541 Ga0316596_1146706 Ga0316596_11467061 123
394 3300034820 Ga0373959_0037465 Ga0373959_0037465_135_506 123
395 3300035083 Ga0373926_0098922 Ga0373926_0098922_391_762 123
396 3300035085 Ga0373929_0133040 Ga0373929_0133040_15_386 123
397 3300035086 Ga0373934_0069319 Ga0373934_0069319_517_888 123
398 3300035089 Ga0373944_0317673 Ga0373944_0317673_194_565 123
399 3300035111 Ga0373923_0007437 Ga0373923_0007437_2614_2985 123
400 3300035112 Ga0373932_0075009 Ga0373932_0075009_350_721 123
401 3300035113 Ga0373936_0273187 Ga0373936_0273187_253_624 123
402 3300035115 Ga0373941_0068497 Ga0373941_0068497_488_859 123
403 3300035116 Ga0373945_0092711 Ga0373945_0092711_368_739 123
404 3300035116 Ga0373945_0157657 Ga0373945_0157657_326_697 123
405 3300035117 Ga0373953_0038654 Ga0373953_0038654_310_681 123
406 3300035118 Ga0373954_0023325 Ga0373954_0023325_2177_2548 123
407 3300035119 Ga0373956_0264297 Ga0373956_0264297_252_623 123
408 3300035120 Ga0373957_0010245 Ga0373957_0010245_2395_2766 123
409 3300035120 Ga0373957_0152183 Ga0373957_0152183_233_604 123
410 3300035170 Ga0373943_0004020 Ga0373943_0004020_1923_2294 123
411 3300035170 Ga0373943_0761783 Ga0373943_0761783_87_458 123
412 3300035171 Ga0373946_0028376 Ga0373946_0028376_1440_1811 123
413 3300035172 Ga0373955_0575158 Ga0373955_0575158_179_550 123
414 3300035242 Ga0373962_0148661 Ga0373962_0148661_332_703 123
415 3300035398 Ga0316574_0071591 Ga0316574_0071591_1676_2047 123
416 3300035398 Ga0316574_0098761 Ga0316574_0098761_786_1157 123
417 3300035398 Ga0316574_0172997 Ga0316574_0172997_91_462 123
418 3300035398 Ga0316574_0224946 Ga0316574_0224946_465_836 123
419 3300035398 Ga0316574_0392708 Ga0316574_0392708_326_697 123
420 3300035398 Ga0316574_0427029 Ga0316574_0427029_73_444 123
421 3300035410 Ga0373924_0037789 Ga0373924_0037789_1458_1829 123
422 3300035691 Ga0373931_1135771 Ga0373931_1135771_150_521 123
423 3300035692 Ga0373935_0012638 Ga0373935_0012638_1305_1676 123
424 3300035695 Ga0373927_0308574 Ga0373927_0308574_394_765 123
425 3300035724 Ga0373933_0181960 Ga0373933_0181960_591_962 123
426 3300035724 Ga0373933_0412599 Ga0373933_0412599_193_564 123
427 3300035725 Ga0373947_0015474 Ga0373947_0015474_2727_3098 123
428 3300035725 Ga0373947_0101636 Ga0373947_0101636_694_1065 123
429 3300035725 Ga0373947_0245579 Ga0373947_0245579_253_624 123
430 3300036401 Ga0373937_0278938 Ga0373937_0278938_716_1087 123
431 3300036401 Ga0373937_0516876 Ga0373937_0516876_389_760 123
432 3300036647 Ga0316582_0180659 Ga0316582_0180659_20_391 123
433 3300036712 Ga0316584_0225132 Ga0316584_0225132_835_1206 123
434 3300036712 Ga0316584_0359630 Ga0316584_0359630_246_617 123
435 3300036712 Ga0316584_0361671 Ga0316584_0361671_651_1022 123
436 3300036712 Ga0316584_0863698 Ga0316584_0863698_11_382 123
437 3300037068 Ga0373925_0013236 Ga0373925_0013236_4837_5208 123
438 3300037418 Ga0395900_0078136 Ga0395900_0078136_1502_1873 123
439 3300037471 Ga0395905_0822163 Ga0395905_0822163_340_711 123
440 3300038443 Ga0395901_0172994 Ga0395901_0172994_1489_1860 123
441 3300038443 Ga0395901_0233292 Ga0395901_0233292_1484_1855 123
442 3300038996 Ga0242420_165300 Ga0242420_165300_97_468 123
443 3300039437 Ga0436365_0144673 Ga0436365_0144673_638_1009 123
444 3300039437 Ga0436365_1046517 Ga0436365_1046517_341_712 123
445 3300041413 Ga0439465_0020112 Ga0439465_0020112_1626_1997 123
446 3300042876 Ga0451577_0143807 Ga0451577_0143807_1566_1937 123
447 3300042876 Ga0451577_0276905 Ga0451577_0276905_79_450 123
448 3300042993 Ga0439440_0115149 Ga0439440_0115149_134_505 123
449 3300044683 Ga0466965_0107260 Ga0466965_0107260_747_1118 123
450 3300044712 Ga0453684_0456657 Ga0453684_0456657_427_798 123
451 3300044712 Ga0453684_1134237 Ga0453684_1134237_110_481 123
452 3300044712 Ga0453684_2424098 Ga0453684_2424098_80_451 123
453 3300044735 Ga0466968_0381720 Ga0466968_0381720_175_546 123
454 3300044842 Ga0466957_0224728 Ga0466957_0224728_140_511 123
455 3300044901 Ga0466960_0057834 Ga0466960_0057834_190_561 123
456 3300045976 Ga0466967_0266913 Ga0466967_0266913_88_459 123
457 3300045976 Ga0466967_0903807 Ga0466967_0903807_339_710 123
458 3300046454 Ga0495592_0065934 Ga0495592_0065934_211_582 123
459 3300046454 Ga0495592_0286511 Ga0495592_0286511_217_588 123
460 3300046454 Ga0495592_0685808 Ga0495592_0685808_165_536 123
461 3300046455 Ga0495603_0097528 Ga0495603_0097528_381_752 123
462 3300046459 Ga0495629_0124017 Ga0495629_0124017_21_392 123
463 3300046461 Ga0495641_0006189 Ga0495641_0006189_2603_2974 123
464 3300046461 Ga0495641_0060859 Ga0495641_0060859_635_1006 123
465 3300046462 Ga0495651_0041297 Ga0495651_0041297_1953_2324 123
466 3300046463 Ga0495653_0011794 Ga0495653_0011794_6632_7003 123
467 3300046463 Ga0495653_0025679 Ga0495653_0025679_1486_1857 123
468 3300046472 Ga0495580_0120527 Ga0495580_0120527_1270_1641 123
469 3300046473 Ga0495582_0031758 Ga0495582_0031758_58_429 123
470 3300046473 Ga0495582_0233016 Ga0495582_0233016_618_989 123
471 3300046475 Ga0495639_0172417 Ga0495639_0172417_546_917 123
472 3300046475 Ga0495639_0373464 Ga0495639_0373464_91_462 123
473 3300046476 Ga0495662_0019242 Ga0495662_0019242_149_520 123
474 3300046476 Ga0495662_0180519 Ga0495662_0180519_639_1010 123
475 3300046477 Ga0495664_0145839 Ga0495664_0145839_564_935 123
476 3300046477 Ga0495664_0949774 Ga0495664_0949774_105_476 123
477 3300046491 Ga0495584_0385238 Ga0495584_0385238_154_525 123
478 3300046499 Ga0495594_0367075 Ga0495594_0367075_299_670 123
479 3300046499 Ga0495594_0423396 Ga0495594_0423396_292_663 123
480 3300046511 Ga0495608_0060429 Ga0495608_0060429_1255_1626 123
481 3300046511 Ga0495608_0127238 Ga0495608_0127238_1095_1466 123
482 3300046514 Ga0495618_0029382 Ga0495618_0029382_2243_2614 123
483 3300046514 Ga0495618_0060714 Ga0495618_0060714_1152_1523 123
484 3300046516 Ga0495628_0043996 Ga0495628_0043996_671_1042 123
485 3300046516 Ga0495628_0867295 Ga0495628_0867295_130_501 123
486 3300046517 Ga0495630_0035741 Ga0495630_0035741_1441_1812 123
487 3300046517 Ga0495630_0170906 Ga0495630_0170906_187_558 123
488 3300046520 Ga0495637_0254397 Ga0495637_0254397_196_567 123
489 3300046526 Ga0495666_0031409 Ga0495666_0031409_148_519 123
490 3300046526 Ga0495666_0545796 Ga0495666_0545796_95_466 123
491 3300046529 Ga0495652_0127724 Ga0495652_0127724_924_1295 123
492 3300046529 Ga0495652_0333093 Ga0495652_0333093_165_536 123
493 3300046531 Ga0495665_0018361 Ga0495665_0018361_713_1084 123
494 3300046533 Ga0495640_0021538 Ga0495640_0021538_2866_3237 123
495 3300046533 Ga0495640_0302808 Ga0495640_0302808_601_972 123
496 3300046543 Ga0495645_0071267 Ga0495645_0071267_1789_2160 123
497 3300046543 Ga0495645_0316647 Ga0495645_0316647_431_802 123
498 3300046543 Ga0495645_0495045 Ga0495645_0495045_310_681 123
499 3300046559 Ga0495667_0077476 Ga0495667_0077476_386_757 123
500 3300046615 Ga0495656_0410222 Ga0495656_0410222_185_556 123
501 3300046642 Ga0495634_0008932 Ga0495634_0008932_3626_3997 123
502 3300046642 Ga0495634_0132568 Ga0495634_0132568_465_836 123
503 3300046663 Ga0495635_0063284 Ga0495635_0063284_2029_2400 123
504 3300046663 Ga0495635_0206729 Ga0495635_0206729_436_807 123
505 3300046663 Ga0495635_0788357 Ga0495635_0788357_227_598 123
506 3300046674 Ga0495588_0006175 Ga0495588_0006175_2507_2878 123
507 3300046675 Ga0495657_0003110 Ga0495657_0003110_5046_5417 123
508 3300046678 Ga0495599_0151254 Ga0495599_0151254_218_589 123
509 3300046679 Ga0495623_0296175 Ga0495623_0296175_499_870 123
510 3300046680 Ga0495646_0093243 Ga0495646_0093243_431_802 123
511 3300046680 Ga0495646_0168405 Ga0495646_0168405_699_1070 123
512 3300046681 Ga0495647_0003870 Ga0495647_0003870_1981_2352 123
513 3300046681 Ga0495647_0004692 Ga0495647_0004692_2895_3266 123
514 3300046681 Ga0495647_0432965 Ga0495647_0432965_167_538 123
515 3300046683 Ga0495658_0064282 Ga0495658_0064282_939_1310 123
516 3300046683 Ga0495658_0081948 Ga0495658_0081948_1253_1624 123
517 3300046683 Ga0495658_0133954 Ga0495658_0133954_203_574 123
518 3300046689 Ga0495613_0026405 Ga0495613_0026405_3754_4125 123
519 3300046689 Ga0495613_0030825 Ga0495613_0030825_880_1251 123
520 3300046690 Ga0495624_0156737 Ga0495624_0156737_149_520 123
521 3300046809 Ga0495600_0003596 Ga0495600_0003596_7698_8069 123
522 3300046809 Ga0495600_0183782 Ga0495600_0183782_424_795 123
523 3300047315 Ga0495581_0004186 Ga0495581_0004186_4511_4882 123
524 3300047317 Ga0495604_0016907 Ga0495604_0016907_3068_3439 123
525 3300047319 Ga0495674_0023760 Ga0495674_0023760_745_1116 123
526 3300047319 Ga0495674_0238423 Ga0495674_0238423_261_632 123
527 3300047321 Ga0495676_0251165 Ga0495676_0251165_675_1046 123
528 3300047321 Ga0495676_0435511 Ga0495676_0435511_143_514 123
529 3300047321 Ga0495676_0474316 Ga0495676_0474316_113_484 123
530 3300047322 Ga0495680_0018449 Ga0495680_0018449_1162_1533 123
531 3300047322 Ga0495680_0074503 Ga0495680_0074503_1678_2049 123
532 3300047322 Ga0495680_0445908 Ga0495680_0445908_375_746 123
533 3300047444 Ga0495675_0035654 Ga0495675_0035654_2204_2575 123
534 3300047471 Ga0495684_0014399 Ga0495684_0014399_867_1238 123
535 3300047471 Ga0495684_0014428 Ga0495684_0014428_5340_5711 123
536 3300047673 Ga0495593_0010386 Ga0495593_0010386_3433_3804 123
537 3300047673 Ga0495593_0499110 Ga0495593_0499110_100_471 123
538 3300048088 Ga0495602_0048098 Ga0495602_0048098_128_499 123
539 3300048088 Ga0495602_0598083 Ga0495602_0598083_364_735 123
540 3300048089 Ga0495614_0002806 Ga0495614_0002806_4235_4606 123
541 3300048903 Ga0496100_0046263 Ga0496100_0046263_823_1194 123
542 3300048903 Ga0496100_0129847 Ga0496100_0129847_1057_1428 123
543 3300048903 Ga0496100_0156060 Ga0496100_0156060_634_1005 123
544 3300048903 Ga0496100_0263667 Ga0496100_0263667_24_395 123
545 3300048903 Ga0496100_0275060 Ga0496100_0275060_838_1209 123
546 3300048904 Ga0496101_0029830 Ga0496101_0029830_2641_3012 123
547 3300048904 Ga0496101_0331525 Ga0496101_0331525_327_698 123
548 3300048905 Ga0496102_0008426 Ga0496102_0008426_1721_2092 123
549 3300048905 Ga0496102_0039336 Ga0496102_0039336_2641_3012 123
550 3300048905 Ga0496102_0355090 Ga0496102_0355090_853_1224 123
551 3300048905 Ga0496102_0520129 Ga0496102_0520129_142_513 123
552 3300048906 Ga0496103_0019667 Ga0496103_0019667_2016_2387 123
553 3300048906 Ga0496103_0185811 Ga0496103_0185811_497_868 123
554 3300048906 Ga0496103_0458330 Ga0496103_0458330_122_493 123
555 3300048906 Ga0496103_0663379 Ga0496103_0663379_158_529 123
556 3300048907 Ga0496104_0008605 Ga0496104_0008605_6966_7337 123
557 3300048907 Ga0496104_0045348 Ga0496104_0045348_2666_3037 123
558 3300048907 Ga0496104_0181317 Ga0496104_0181317_987_1358 123
559 3300048908 Ga0496105_0036308 Ga0496105_0036308_2120_2491 123
560 3300048908 Ga0496105_0070961 Ga0496105_0070961_55_426 123
561 3300048908 Ga0496105_0115593 Ga0496105_0115593_273_644 123
562 3300048908 Ga0496105_0839121 Ga0496105_0839121_149_520 123
563 3300048908 Ga0496105_1279356 Ga0496105_1279356_69_440 123
564 3300048909 Ga0496106_0019758 Ga0496106_0019758_2845_3216 123
565 3300048909 Ga0496106_0077650 Ga0496106_0077650_1941_2312 123
566 3300048909 Ga0496106_0245166 Ga0496106_0245166_921_1292 123
567 3300048909 Ga0496106_0284688 Ga0496106_0284688_213_584 123
568 3300048909 Ga0496106_1279327 Ga0496106_1279327_52_423 123
569 3300048910 Ga0496107_0053046 Ga0496107_0053046_293_664 123
570 3300048911 Ga0496108_0009320 Ga0496108_0009320_5588_5959 123
571 3300048911 Ga0496108_0277693 Ga0496108_0277693_159_530 123
572 3300048912 Ga0496109_0003257 Ga0496109_0003257_125_496 123
573 3300048912 Ga0496109_0082254 Ga0496109_0082254_1078_1449 123
574 3300048912 Ga0496109_0161488 Ga0496109_0161488_1604_1975 123
575 3300048912 Ga0496109_0169101 Ga0496109_0169101_1453_1824 123
576 3300048912 Ga0496109_0225976 Ga0496109_0225976_241_612 123
577 3300048912 Ga0496109_0775071 Ga0496109_0775071_399_770 123
578 3300048913 Ga0496110_0000983 Ga0496110_0000983_1649_2020 123
579 3300048913 Ga0496110_0032177 Ga0496110_0032177_3123_3494 123
580 3300048913 Ga0496110_0207399 Ga0496110_0207399_881_1252 123
581 3300048913 Ga0496110_0940903 Ga0496110_0940903_339_710 123
582 3300048914 Ga0496111_0001267 Ga0496111_0001267_2341_2712 123
583 3300048914 Ga0496111_0204837 Ga0496111_0204837_34_405 123
584 3300048914 Ga0496111_0647267 Ga0496111_0647267_282_653 123
585 3300048914 Ga0496111_0954755 Ga0496111_0954755_183_554 123
586 3300048915 Ga0496112_0008451 Ga0496112_0008451_8635_9006 123
587 3300048915 Ga0496112_0055603 Ga0496112_0055603_2553_2924 123
588 3300048915 Ga0496112_0078197 Ga0496112_0078197_2142_2513 123
589 3300048915 Ga0496112_1011175 Ga0496112_1011175_245_616 123
590 3300048916 Ga0496113_0017092 Ga0496113_0017092_841_1212 123
591 3300048916 Ga0496113_0020455 Ga0496113_0020455_125_496 123
592 3300048916 Ga0496113_1519630 Ga0496113_1519630_125_496 123
593 3300048917 Ga0496114_0006753 Ga0496114_0006753_7321_7692 123
594 3300048917 Ga0496114_0046560 Ga0496114_0046560_865_1236 123
595 3300048917 Ga0496114_0056294 Ga0496114_0056294_1266_1637 123
596 3300048917 Ga0496114_0117309 Ga0496114_0117309_99_470 123
597 3300048917 Ga0496114_0241471 Ga0496114_0241471_218_589 123
598 3300048917 Ga0496114_1089561 Ga0496114_1089561_242_613 123
599 3300048918 Ga0496115_0012343 Ga0496115_0012343_2899_3270 123
600 3300048918 Ga0496115_0056073 Ga0496115_0056073_995_1366 123
601 3300048918 Ga0496115_0073003 Ga0496115_0073003_201_572 123
602 3300048918 Ga0496115_0094650 Ga0496115_0094650_2048_2419 123
603 3300048918 Ga0496115_0153982 Ga0496115_0153982_1383_1754 123
604 3300048918 Ga0496115_0783581 Ga0496115_0783581_224_595 123
605 3300049568 Ga0501031_0205302 Ga0501031_0205302_14_385 123
606 3300049568 Ga0501031_0303543 Ga0501031_0303543_333_704 123
607 3300049568 Ga0501031_0370991 Ga0501031_0370991_428_799 123
608 3300049568 Ga0501031_0877668 Ga0501031_0877668_175_546 123
609 3300049569 Ga0501032_0243871 Ga0501032_0243871_714_1085 123
610 3300049569 Ga0501032_0267891 Ga0501032_0267891_134_505 123
611 3300049569 Ga0501032_1025586 Ga0501032_1025586_84_455 123
612 3300049570 Ga0501033_0450220 Ga0501033_0450220_425_796 123
613 3300049570 Ga0501033_0780734 Ga0501033_0780734_45_416 123
614 3300049571 Ga0501034_0371459 Ga0501034_0371459_600_971 123
615 3300049571 Ga0501034_0694229 Ga0501034_0694229_148_519 123
616 3300049572 Ga0501036_0530272 Ga0501036_0530272_148_522 123
617 3300049573 Ga0501037_0389098 Ga0501037_0389098_427_798 123
618 3300049574 Ga0501038_0041796 Ga0501038_0041796_3313_3684 123
619 3300049575 Ga0501039_0012581 Ga0501039_0012581_56_427 123
620 3300049575 Ga0501039_0332426 Ga0501039_0332426_348_719 123
621 3300049575 Ga0501039_1363484 Ga0501039_1363484_13_384 123
622 3300049576 Ga0501040_0004923 Ga0501040_0004923_4581_4952 123
623 3300049576 Ga0501040_0334470 Ga0501040_0334470_221_592 123
624 3300049576 Ga0501040_0473144 Ga0501040_0473144_434_805 123
625 3300049577 Ga0501041_0071912 Ga0501041_0071912_820_1191 123
626 3300049577 Ga0501041_0222709 Ga0501041_0222709_49_420 123
627 3300049577 Ga0501041_0512440 Ga0501041_0512440_47_418 123
628 3300049578 Ga0501042_0027184 Ga0501042_0027184_3129_3500 123
629 3300049578 Ga0501042_0326457 Ga0501042_0326457_318_689 123
630 3300049578 Ga0501042_0612620 Ga0501042_0612620_100_471 123
631 3300049579 Ga0501043_0361287 Ga0501043_0361287_271_642 123
632 3300049580 Ga0501046_0134747 Ga0501046_0134747_1420_1791 123
633 3300049580 Ga0501046_0820294 Ga0501046_0820294_134_505 123
634 3300049581 Ga0501047_0099339 Ga0501047_0099339_682_1053 123
635 3300049581 Ga0501047_0583711 Ga0501047_0583711_352_723 123
636 3300049582 Ga0501048_0010287 Ga0501048_0010287_6285_6656 123
637 3300049582 Ga0501048_0307824 Ga0501048_0307824_71_442 123
638 3300049583 Ga0501067_0003078 Ga0501067_0003078_1982_2353 123
639 3300049583 Ga0501067_0042917 Ga0501067_0042917_603_974 123
640 3300049584 Ga0501068_0002322 Ga0501068_0002322_5767_6138 123
641 3300049584 Ga0501068_0033823 Ga0501068_0033823_410_781 123
642 3300049584 Ga0501068_0400123 Ga0501068_0400123_448_819 123
643 3300049584 Ga0501068_0441565 Ga0501068_0441565_75_446 123
644 3300049585 Ga0501069_0000453 Ga0501069_0000453_13316_13687 123
645 3300049585 Ga0501069_0063145 Ga0501069_0063145_501_872 123
646 3300049586 Ga0501070_0078845 Ga0501070_0078845_988_1359 123
647 3300049586 Ga0501070_0082198 Ga0501070_0082198_1333_1704 123
648 3300049586 Ga0501070_0824638 Ga0501070_0824638_195_566 123
649 3300049587 Ga0501071_0003597 Ga0501071_0003597_6782_7153 123
650 3300049587 Ga0501071_0035692 Ga0501071_0035692_452_823 123
651 3300049587 Ga0501071_0079974 Ga0501071_0079974_1164_1535 123
652 3300049587 Ga0501071_0093200 Ga0501071_0093200_248_619 123
653 3300049587 Ga0501071_0232425 Ga0501071_0232425_410_781 123
654 3300049587 Ga0501071_0325563 Ga0501071_0325563_461_832 123
655 3300049588 Ga0501072_0003791 Ga0501072_0003791_6028_6399 123
656 3300049588 Ga0501072_0196150 Ga0501072_0196150_600_971 123
657 3300049589 Ga0501073_0397229 Ga0501073_0397229_33_404 123
658 3300049590 Ga0501074_0080636 Ga0501074_0080636_98_469 123
659 3300049590 Ga0501074_0201833 Ga0501074_0201833_343_714 123
660 3300049591 Ga0501075_0017924 Ga0501075_0017924_572_943 123
661 3300049591 Ga0501075_0065727 Ga0501075_0065727_1355_1726 123
662 3300049592 Ga0501076_0018028 Ga0501076_0018028_101_472 123
663 3300049592 Ga0501076_0235600 Ga0501076_0235600_287_658 123
664 3300049592 Ga0501076_0969926 Ga0501076_0969926_17_388 123
665 3300049593 Ga0501077_0013176 Ga0501077_0013176_797_1168 123
666 3300049741 Ga0501079_0001191 Ga0501079_0001191_7262_7633 123
667 3300049741 Ga0501079_0369740 Ga0501079_0369740_332_703 123
668 3300049742 Ga0501080_0621568 Ga0501080_0621568_196_567 123
669 3300049742 Ga0501080_1081449 Ga0501080_1081449_152_523 123
670 3300049743 Ga0501081_0000266 Ga0501081_0000266_5141_5512 123
671 3300049744 Ga0501083_0058547 Ga0501083_0058547_2158_2529 123
672 3300049744 Ga0501083_0539371 Ga0501083_0539371_232_603 123
673 3300049823 Ga0501044_0553545 Ga0501044_0553545_470_841 123
674 3300049824 Ga0501045_0031322 Ga0501045_0031322_3397_3768 123
675 3300049824 Ga0501045_0165912 Ga0501045_0165912_843_1214 123
676 3300049824 Ga0501045_0918306 Ga0501045_0918306_17_388 123
677 3300050507 nmdc:mga05p37_24103_c1 nmdc:mga05p37_24103_c1_4062_4433 123
678 3300050509 nmdc:mga0qj67_418401_c1 nmdc:mga0qj67_418401_c1_223_594 123
679 3300050511 nmdc:mga08y16_266255_c1 nmdc:mga08y16_266255_c1_275_646 123
680 3300050511 nmdc:mga08y16_433649_c1 nmdc:mga08y16_433649_c1_950_1321 123
681 3300050512 nmdc:mga0n895_21002_c1 nmdc:mga0n895_21002_c1_3281_3652 123
682 3300050512 nmdc:mga0n895_489885_c1 nmdc:mga0n895_489885_c1_302_673 123
683 3300050512 nmdc:mga0n895_56580_c1 nmdc:mga0n895_56580_c1_1157_1528 123
684 3300050513 nmdc:mga0rr50_179533_c1 nmdc:mga0rr50_179533_c1_347_718 123
685 3300050513 nmdc:mga0rr50_67644_c1 nmdc:mga0rr50_67644_c1_833_1204 123
686 3300050514 nmdc:mga08x19_338891_c1 nmdc:mga08x19_338891_c1_492_863 123
687 3300050514 nmdc:mga08x19_425770_c1 nmdc:mga08x19_425770_c1_510_881 123
688 3300050515 nmdc:mga0a205_252371_c1 nmdc:mga0a205_252371_c1_54_425 123
689 3300053077 Ga0495601_0016271 Ga0495601_0016271_3963_4334 123
690 3300053077 Ga0495601_0045561 Ga0495601_0045561_853_1224 123
691 3300053077 Ga0495601_0157372 Ga0495601_0157372_640_1011 123
692 3300053077 Ga0495601_0459998 Ga0495601_0459998_152_523 123
693 3300053078 Ga0495612_0109786 Ga0495612_0109786_624_995 123
694 3300053078 Ga0495612_0125030 Ga0495612_0125030_554_925 123
695 3300053084 Ga0495595_0046669 Ga0495595_0046669_474_845 123
696 3300053084 Ga0495595_0088470 Ga0495595_0088470_1022_1393 123
697 3300053085 Ga0495619_0026075 Ga0495619_0026075_1982_2353 123
698 3300053085 Ga0495619_0067168 Ga0495619_0067168_173_544 123
699 3300053085 Ga0495619_0250509 Ga0495619_0250509_424_795 123
700 3300053085 Ga0495619_0550580 Ga0495619_0550580_327_698 123
701 3300054114 Ga0501084_0006409 Ga0501084_0006409_4927_5298 123
702 3300054114 Ga0501084_0162417 Ga0501084_0162417_1337_1708 123
703 3300054114 Ga0501084_0179330 Ga0501084_0179330_545_916 123
704 3300059421 Ga0590071_046949 Ga0590071_046949_545_916 123
705 3300059477 Ga0587084_093124 Ga0587084_093124_12_383 123
706 3300059478 Ga0587093_032545 Ga0587093_032545_277_648 123
707 3300059490 Ga0587066_105217 Ga0587066_105217_42_413 123
708 3300059491 Ga0587070_026154 Ga0587070_026154_262_633 123
709 3300059491 Ga0587070_057172 Ga0587070_057172_332_703 123
710 3300059492 Ga0587073_0217606 Ga0587073_0217606_113_484 123
711 3300059493 Ga0587077_077231 Ga0587077_077231_176_547 123
712 3300059493 Ga0587077_132746 Ga0587077_132746_237_608 123
713 3300059493 Ga0587077_261026 Ga0587077_261026_90_461 123
714 3300059505 Ga0587083_0097976 Ga0587083_0097976_301_672 123
715 3300059505 Ga0587083_0258639 Ga0587083_0258639_70_441 123
716 3300059506 Ga0587085_009458 Ga0587085_009458_803_1174 123
717 3300059511 Ga0587091_018726 Ga0587091_018726_714_1085 123
718 3300059511 Ga0587091_018976 Ga0587091_018976_223_594 123
719 3300059511 Ga0587091_041792 Ga0587091_041792_138_509 123
720 3300059511 Ga0587091_068825 Ga0587091_068825_336_707 123
721 3300059511 Ga0587091_080519 Ga0587091_080519_335_706 123
722 3300059512 Ga0587092_043274 Ga0587092_043274_259_630 123
723 3300059605 Ga0587106_135570 Ga0587106_135570_108_479 123
724 3300059623 Ga0587101_045628 Ga0587101_045628_90_461 123
725 3300059628 Ga0587122_045407 Ga0587122_045407_96_467 123
726 3300059630 Ga0587128_022020 Ga0587128_022020_286_657 123
727 3300059639 Ga0587062_075427 Ga0587062_075427_69_440 123
728 3300059640 Ga0587067_152189 Ga0587067_152189_23_394 123
729 3300059642 Ga0587069_061781 Ga0587069_061781_179_550 123
730 3300059645 Ga0587076_014556 Ga0587076_014556_151_522 123
731 3300059647 Ga0587079_050510 Ga0587079_050510_172_543 123
732 3300059652 Ga0587107_068402 Ga0587107_068402_247_618 123
733 3300059654 Ga0587110_016957 Ga0587110_016957_262_633 123
734 3300059654 Ga0587110_038518 Ga0587110_038518_122_493 123
735 3300059655 Ga0587114_070143 Ga0587114_070143_38_409 123
736 3300059659 Ga0587120_026200 Ga0587120_026200_181_552 123
737 3300060344 Ga0587071_063222 Ga0587071_063222_178_549 123
738 3300060344 Ga0587071_088613 Ga0587071_088613_131_502 123
739 3300060344 Ga0587071_089239 Ga0587071_089239_109_480 123
740 3300060344 Ga0587071_102775 Ga0587071_102775_194_565 123
741 3300060346 Ga0587111_0081325 Ga0587111_0081325_236_607 123
742 3300060346 Ga0587111_0178622 Ga0587111_0178622_11_382 123
743 3300060353 Ga0501082_0020323 Ga0501082_0020323_2665_3036 123
744 3300060353 Ga0501082_0410999 Ga0501082_0410999_679_1050 123
745 3300060353 Ga0501082_1212715 Ga0501082_1212715_163_534 123
746 3300060353 Ga0501082_1991016 Ga0501082_1991016_32_403 123
747 3300061734 Ga0530510_0042730 Ga0530510_0042730_1618_1989 123
748 3300061734 Ga0530510_1078602 Ga0530510_1078602_106_477 123
749 3300001977 JGI24746J21847_1010606 JGI24746J21847_10106064 124
750 3300001978 JGI24747J21853_1004561 JGI24747J21853_10045612 124
751 3300001979 JGI24740J21852_10074867 JGI24740J21852_100748671 124
752 3300001989 JGI24739J22299_10014218 JGI24739J22299_100142184 124
753 3300001989 JGI24739J22299_10031467 JGI24739J22299_100314674 124
754 3300001990 JGI24737J22298_10014055 JGI24737J22298_100140551 124
755 3300001990 JGI24737J22298_10255683 JGI24737J22298_102556831 124
756 3300002070 JGI24750J21931_1025217 JGI24750J21931_10252172 124
757 3300002073 JGI24745J21846_1002378 JGI24745J21846_10023783 124
758 3300002077 JGI24744J21845_10009983 JGI24744J21845_100099833 124
759 3300002239 JGI24034J26672_10019434 JGI24034J26672_100194343 124
760 3300002244 JGI24742J22300_10008900 JGI24742J22300_100089003 124
761 3300002737 JGI25162J39368_1003458 JGI25162J39368_10034583 124
762 3300002772 JGI25164J39214_1000679 JGI25164J39214_100067912 124
763 3300003162 Ga0006778J45830_1037313 Ga0006778J45830_10373132 124
764 3300003163 Ga0006759J45824_1035239 Ga0006759J45824_10352392 124
765 3300003214 JGI25165J46597_1000061 JGI25165J46597_100006154 124
766 3300003577 Ga0007416J51690_1057683 Ga0007416J51690_10576832 124
767 3300003579 Ga0007429J51699_1088480 Ga0007429J51699_10884801 124
768 3300003579 Ga0007429J51699_1088481 Ga0007429J51699_10884811 124
769 3300003693 Ga0032354_1022066 Ga0032354_10220662 124
770 3300003752 Ga0055539_1000808 Ga0055539_100080810 124
771 3300003756 Ga0055533_1000001 Ga0055533_10000011666 124
772 3300003760 Ga0055527_1000017 Ga0055527_100001760 124
773 3300003762 Ga0055542_1000044 Ga0055542_100004460 124
774 3300003763 Ga0055529_1000279 Ga0055529_100027915 124
775 3300003763 Ga0055529_1039149 Ga0055529_10391492 124
776 3300003841 Ga0055541_1009606 Ga0055541_10096061 124
777 3300004785 Ga0058858_1434606 Ga0058858_14346062 124
778 3300004798 Ga0058859_10032894 Ga0058859_100328941 124
779 3300004799 Ga0058863_10079837 Ga0058863_100798372 124
780 3300004799 Ga0058863_10092482 Ga0058863_100924822 124
781 3300004799 Ga0058863_11902506 Ga0058863_119025062 124
782 3300004799 Ga0058863_11911031 Ga0058863_119110312 124
783 3300004800 Ga0058861_10002618 Ga0058861_100026182 124
784 3300004800 Ga0058861_10039056 Ga0058861_100390562 124
785 3300004800 Ga0058861_10088000 Ga0058861_100880002 124
786 3300004800 Ga0058861_11840072 Ga0058861_118400722 124
787 3300004800 Ga0058861_12025964 Ga0058861_120259642 124
788 3300004801 Ga0058860_10225518 Ga0058860_102255182 124
789 3300004801 Ga0058860_12169112 Ga0058860_121691122 124
790 3300004803 Ga0058862_10139641 Ga0058862_101396412 124
791 3300004803 Ga0058862_10202782 Ga0058862_102027822 124
792 3300004803 Ga0058862_10277273 Ga0058862_102772731 124
793 3300004803 Ga0058862_12205953 Ga0058862_122059531 124
794 3300004803 Ga0058862_12730137 Ga0058862_127301371 124
795 3300005288 Ga0065714_10021838 Ga0065714_100218382 124
796 3300005327 Ga0070658_10028535 Ga0070658_100285357 124
797 3300005327 Ga0070658_10028947 Ga0070658_100289475 124
798 3300005327 Ga0070658_10258464 Ga0070658_102584643 124
799 3300005327 Ga0070658_10271826 Ga0070658_102718263 124
800 3300005327 Ga0070658_11038680 Ga0070658_110386801 124
801 3300005328 Ga0070676_10414025 Ga0070676_104140252 124
802 3300005329 Ga0070683_100029975 Ga0070683_1000299753 124
803 3300005329 Ga0070683_100285358 Ga0070683_1002853581 124
804 3300005329 Ga0070683_100306297 Ga0070683_1003062972 124
805 3300005329 Ga0070683_100332725 Ga0070683_1003327254 124
806 3300005329 Ga0070683_100346506 Ga0070683_1003465063 124
807 3300005329 Ga0070683_100481930 Ga0070683_1004819302 124
808 3300005330 Ga0070690_100194908 Ga0070690_1001949082 124
809 3300005330 Ga0070690_100523026 Ga0070690_1005230262 124
810 3300005330 Ga0070690_100645872 Ga0070690_1006458722 124
811 3300005331 Ga0070670_100568059 Ga0070670_1005680592 124
812 3300005333 Ga0070677_10336382 Ga0070677_103363821 124
813 3300005334 Ga0068869_100012691 Ga0068869_1000126918 124
814 3300005334 Ga0068869_100509726 Ga0068869_1005097261 124
815 3300005334 Ga0068869_101838502 Ga0068869_1018385021 124
816 3300005336 Ga0070680_100000015 Ga0070680_10000001590 124
817 3300005336 Ga0070680_100033020 Ga0070680_1000330207 124
818 3300005336 Ga0070680_100356170 Ga0070680_1003561703 124
819 3300005336 Ga0070680_100432224 Ga0070680_1004322242 124
820 3300005336 Ga0070680_100834179 Ga0070680_1008341792 124
821 3300005337 Ga0070682_100011705 Ga0070682_1000117058 124
822 3300005337 Ga0070682_100203653 Ga0070682_1002036533 124
823 3300005337 Ga0070682_100246860 Ga0070682_1002468603 124
824 3300005338 Ga0068868_100382455 Ga0068868_1003824552 124
825 3300005338 Ga0068868_100459711 Ga0068868_1004597112 124
826 3300005339 Ga0070660_100059135 Ga0070660_1000591352 124
827 3300005339 Ga0070660_100329375 Ga0070660_1003293752 124
828 3300005340 Ga0070689_100029463 Ga0070689_1000294633 124
829 3300005340 Ga0070689_100818584 Ga0070689_1008185842 124
830 3300005341 Ga0070691_10003867 Ga0070691_100038678 124
831 3300005341 Ga0070691_10206936 Ga0070691_102069362 124
832 3300005343 Ga0070687_100127109 Ga0070687_1001271093 124
833 3300005343 Ga0070687_100232399 Ga0070687_1002323992 124
834 3300005343 Ga0070687_101369961 Ga0070687_1013699611 124
835 3300005344 Ga0070661_101478697 Ga0070661_1014786971 124
836 3300005345 Ga0070692_10102432 Ga0070692_101024322 124
837 3300005345 Ga0070692_10510609 Ga0070692_105106092 124
838 3300005345 Ga0070692_10621542 Ga0070692_106215421 124
839 3300005347 Ga0070668_100646667 Ga0070668_1006466671 124
840 3300005347 Ga0070668_100713017 Ga0070668_1007130171 124
841 3300005353 Ga0070669_101260253 Ga0070669_1012602532 124
842 3300005354 Ga0070675_100095801 Ga0070675_1000958014 124
843 3300005354 Ga0070675_100253957 Ga0070675_1002539573 124
844 3300005354 Ga0070675_101504990 Ga0070675_1015049901 124
845 3300005355 Ga0070671_100060488 Ga0070671_1000604884 124
846 3300005355 Ga0070671_100385131 Ga0070671_1003851311 124
847 3300005355 Ga0070671_100455397 Ga0070671_1004553972 124
848 3300005356 Ga0070674_100041590 Ga0070674_1000415905 124
849 3300005356 Ga0070674_100305444 Ga0070674_1003054442 124
850 3300005356 Ga0070674_101879946 Ga0070674_1018799461 124
851 3300005364 Ga0070673_100019981 Ga0070673_1000199814 124
852 3300005364 Ga0070673_100296296 Ga0070673_1002962962 124
853 3300005365 Ga0070688_100123596 Ga0070688_1001235962 124
854 3300005366 Ga0070659_100126270 Ga0070659_1001262704 124
855 3300005366 Ga0070659_100179838 Ga0070659_1001798383 124
856 3300005367 Ga0070667_100644816 Ga0070667_1006448162 124
857 3300005406 Ga0070703_10026297 Ga0070703_100262973 124
858 3300005437 Ga0070710_10233310 Ga0070710_102333101 124
859 3300005438 Ga0070701_10218853 Ga0070701_102188532 124
860 3300005438 Ga0070701_10751579 Ga0070701_107515791 124
861 3300005440 Ga0070705_100012679 Ga0070705_1000126795 124
862 3300005440 Ga0070705_100117451 Ga0070705_1001174512 124
863 3300005440 Ga0070705_100212079 Ga0070705_1002120792 124
864 3300005440 Ga0070705_100856494 Ga0070705_1008564942 124
865 3300005441 Ga0070700_100117428 Ga0070700_1001174283 124
866 3300005441 Ga0070700_100409710 Ga0070700_1004097101 124
867 3300005441 Ga0070700_101440306 Ga0070700_1014403061 124
868 3300005444 Ga0070694_100072132 Ga0070694_1000721323 124
869 3300005444 Ga0070694_100330046 Ga0070694_1003300461 124
870 3300005444 Ga0070694_100648214 Ga0070694_1006482142 124
871 3300005445 Ga0070708_100015734 Ga0070708_1000157345 124
872 3300005445 Ga0070708_100127832 Ga0070708_1001278321 124
873 3300005445 Ga0070708_100737148 Ga0070708_1007371482 124
874 3300005455 Ga0070663_100177563 Ga0070663_1001775632 124
875 3300005455 Ga0070663_100288192 Ga0070663_1002881922 124
876 3300005455 Ga0070663_100721741 Ga0070663_1007217411 124
877 3300005455 Ga0070663_101787956 Ga0070663_1017879561 124
878 3300005456 Ga0070678_100058968 Ga0070678_1000589685 124
879 3300005456 Ga0070678_100524499 Ga0070678_1005244992 124
880 3300005456 Ga0070678_100550805 Ga0070678_1005508051 124
881 3300005458 Ga0070681_10128448 Ga0070681_101284483 124
882 3300005458 Ga0070681_10166145 Ga0070681_101661452 124
883 3300005458 Ga0070681_10471198 Ga0070681_104711982 124
884 3300005458 Ga0070681_11316024 Ga0070681_113160241 124
885 3300005459 Ga0068867_100049389 Ga0068867_1000493894 124
886 3300005459 Ga0068867_100470533 Ga0068867_1004705332 124
887 3300005466 Ga0070685_10067598 Ga0070685_100675983 124
888 3300005467 Ga0070706_100001187 Ga0070706_10000118715 124
889 3300005467 Ga0070706_100011787 Ga0070706_1000117878 124
890 3300005468 Ga0070707_100005867 Ga0070707_1000058673 124
891 3300005468 Ga0070707_100038225 Ga0070707_1000382255 124
892 3300005468 Ga0070707_100064600 Ga0070707_1000646004 124
893 3300005468 Ga0070707_100223342 Ga0070707_1002233423 124
894 3300005471 Ga0070698_100094301 Ga0070698_1000943013 124
895 3300005471 Ga0070698_100104288 Ga0070698_1001042883 124
896 3300005471 Ga0070698_102076193 Ga0070698_1020761931 124
897 3300005518 Ga0070699_100058035 Ga0070699_1000580354 124
898 3300005530 Ga0070679_100025472 Ga0070679_1000254722 124
899 3300005530 Ga0070679_100038792 Ga0070679_1000387921 124
900 3300005530 Ga0070679_101455700 Ga0070679_1014557002 124
901 3300005530 Ga0070679_101882188 Ga0070679_1018821881 124
902 3300005535 Ga0070684_100076715 Ga0070684_1000767152 124
903 3300005535 Ga0070684_100092545 Ga0070684_1000925454 124
904 3300005535 Ga0070684_100114067 Ga0070684_1001140671 124
905 3300005535 Ga0070684_100308206 Ga0070684_1003082062 124
906 3300005535 Ga0070684_100454164 Ga0070684_1004541642 124
907 3300005535 Ga0070684_100520389 Ga0070684_1005203892 124
908 3300005535 Ga0070684_100721633 Ga0070684_1007216331 124
909 3300005536 Ga0070697_100025528 Ga0070697_1000255286 124
910 3300005536 Ga0070697_100055682 Ga0070697_1000556825 124
911 3300005536 Ga0070697_100098342 Ga0070697_1000983424 124
912 3300005536 Ga0070697_100316355 Ga0070697_1003163553 124
913 3300005536 Ga0070697_102107727 Ga0070697_1021077271 124
914 3300005539 Ga0068853_100167867 Ga0068853_1001678672 124
915 3300005539 Ga0068853_100353953 Ga0068853_1003539533 124
916 3300005539 Ga0068853_101812360 Ga0068853_1018123601 124
917 3300005539 Ga0068853_102263871 Ga0068853_1022638711 124
918 3300005543 Ga0070672_100130525 Ga0070672_1001305254 124
919 3300005543 Ga0070672_100823102 Ga0070672_1008231021 124
920 3300005544 Ga0070686_100042639 Ga0070686_1000426394 124
921 3300005544 Ga0070686_100814129 Ga0070686_1008141291 124
922 3300005545 Ga0070695_100156634 Ga0070695_1001566342 124
923 3300005545 Ga0070695_100206721 Ga0070695_1002067211 124
924 3300005545 Ga0070695_100577631 Ga0070695_1005776312 124
925 3300005546 Ga0070696_100006963 Ga0070696_10000696313 124
926 3300005546 Ga0070696_100082497 Ga0070696_1000824974 124
927 3300005546 Ga0070696_100116381 Ga0070696_1001163811 124
928 3300005546 Ga0070696_100288614 Ga0070696_1002886143 124
929 3300005546 Ga0070696_100534091 Ga0070696_1005340912 124
930 3300005546 Ga0070696_100885697 Ga0070696_1008856971 124
931 3300005546 Ga0070696_101576902 Ga0070696_1015769021 124
932 3300005547 Ga0070693_100045839 Ga0070693_1000458392 124
933 3300005547 Ga0070693_100139888 Ga0070693_1001398883 124
934 3300005547 Ga0070693_100353398 Ga0070693_1003533982 124
935 3300005547 Ga0070693_100598675 Ga0070693_1005986752 124
936 3300005548 Ga0070665_100360118 Ga0070665_1003601183 124
937 3300005549 Ga0070704_100016174 Ga0070704_1000161745 124
938 3300005549 Ga0070704_100866435 Ga0070704_1008664352 124
939 3300005563 Ga0068855_100066868 Ga0068855_1000668687 124
940 3300005563 Ga0068855_101539999 Ga0068855_1015399992 124
941 3300005563 Ga0068855_102164059 Ga0068855_1021640591 124
942 3300005564 Ga0070664_100010033 Ga0070664_1000100339 124
943 3300005564 Ga0070664_100217308 Ga0070664_1002173083 124
944 3300005564 Ga0070664_101783163 Ga0070664_1017831631 124
945 3300005577 Ga0068857_100129395 Ga0068857_1001293954 124
946 3300005577 Ga0068857_100670337 Ga0068857_1006703372 124
947 3300005578 Ga0068854_101577851 Ga0068854_1015778511 124
948 3300005614 Ga0068856_100102656 Ga0068856_1001026562 124
949 3300005614 Ga0068856_100290876 Ga0068856_1002908764 124
950 3300005614 Ga0068856_100366475 Ga0068856_1003664752 124
951 3300005615 Ga0070702_100161541 Ga0070702_1001615412 124
952 3300005615 Ga0070702_100234700 Ga0070702_1002347003 124
953 3300005616 Ga0068852_100082296 Ga0068852_1000822964 124
954 3300005616 Ga0068852_100302958 Ga0068852_1003029583 124
955 3300005616 Ga0068852_101304543 Ga0068852_1013045432 124
956 3300005616 Ga0068852_102847750 Ga0068852_1028477501 124
957 3300005617 Ga0068859_100038389 Ga0068859_1000383898 124
958 3300005617 Ga0068859_101887037 Ga0068859_1018870372 124
959 3300005618 Ga0068864_100083353 Ga0068864_1000833533 124
960 3300005718 Ga0068866_10712135 Ga0068866_107121352 124
961 3300005719 Ga0068861_100105850 Ga0068861_1001058503 124
962 3300005719 Ga0068861_100482997 Ga0068861_1004829973 124
963 3300005719 Ga0068861_100893563 Ga0068861_1008935633 124
964 3300005719 Ga0068861_101168994 Ga0068861_1011689941 124
965 3300005840 Ga0068870_10934948 Ga0068870_109349482 124
966 3300005842 Ga0068858_100046786 Ga0068858_1000467864 124
967 3300005842 Ga0068858_100693419 Ga0068858_1006934192 124
968 3300005843 Ga0068860_100027971 Ga0068860_1000279714 124
969 3300005843 Ga0068860_100344499 Ga0068860_1003444993 124
970 3300005844 Ga0068862_100395989 Ga0068862_1003959894 124
971 3300005844 Ga0068862_101352363 Ga0068862_1013523632 124
972 3300005937 Ga0081455_10047065 Ga0081455_100470654 124
973 3300006028 Ga0070717_10241231 Ga0070717_102412312 124
974 3300006051 Ga0075364_10055931 Ga0075364_100559314 124
975 3300006058 Ga0075432_10015139 Ga0075432_100151395 124
976 3300006175 Ga0070712_100266878 Ga0070712_1002668782 124
977 3300006237 Ga0097621_100024219 Ga0097621_1000242195 124
978 3300006237 Ga0097621_100810564 Ga0097621_1008105642 124
979 3300006353 Ga0075370_10264234 Ga0075370_102642342 124
980 3300006844 Ga0075428_100000694 Ga0075428_10000069426 124
981 3300006844 Ga0075428_100004768 Ga0075428_10000476815 124
982 3300006844 Ga0075428_100294355 Ga0075428_1002943553 124
983 3300006852 Ga0075433_10043437 Ga0075433_100434376 124
984 3300006852 Ga0075433_10178155 Ga0075433_101781553 124
985 3300006852 Ga0075433_10210759 Ga0075433_102107592 124
986 3300006852 Ga0075433_10345789 Ga0075433_103457893 124
987 3300006871 Ga0075434_100233167 Ga0075434_1002331672 124
988 3300006871 Ga0075434_100260368 Ga0075434_1002603684 124
989 3300006871 Ga0075434_100278696 Ga0075434_1002786962 124
990 3300006871 Ga0075434_100438986 Ga0075434_1004389863 124
991 3300006871 Ga0075434_101034808 Ga0075434_1010348083 124
992 3300006880 Ga0075429_100626261 Ga0075429_1006262612 124
993 3300006881 Ga0068865_100064080 Ga0068865_1000640804 124
994 3300006881 Ga0068865_100140491 Ga0068865_1001404914 124
995 3300006881 Ga0068865_100163955 Ga0068865_1001639552 124
996 3300006931 Ga0097620_100038389 Ga0097620_1000383898 124
997 3300006931 Ga0097620_101887085 Ga0097620_1018870852 124
998 3300007076 Ga0075435_100167058 Ga0075435_1001670582 124
999 3300007076 Ga0075435_100621124 Ga0075435_1006211242 124
1000 3300007076 Ga0075435_100730755 Ga0075435_1007307551 124
1001 3300009093 Ga0105240_10535128 Ga0105240_105351283 124
1002 3300009094 Ga0111539_10008690 Ga0111539_1000869023 124
1003 3300009094 Ga0111539_11913215 Ga0111539_119132152 124
1004 3300009098 Ga0105245_10048434 Ga0105245_100484343 124
1005 3300009098 Ga0105245_10251918 Ga0105245_102519183 124
1006 3300009098 Ga0105245_10778720 Ga0105245_107787201 124
1007 3300009098 Ga0105245_10874176 Ga0105245_108741762 124
1008 3300009101 Ga0105247_10046136 Ga0105247_100461362 124
1009 3300009101 Ga0105247_10907461 Ga0105247_109074612 124
1010 3300009147 Ga0114129_10009938 Ga0114129_1000993815 124
1011 3300009147 Ga0114129_10022103 Ga0114129_100221033 124
1012 3300009148 Ga0105243_10035607 Ga0105243_100356073 124
1013 3300009148 Ga0105243_10152057 Ga0105243_101520574 124
1014 3300009148 Ga0105243_10718801 Ga0105243_107188012 124
1015 3300009148 Ga0105243_10997357 Ga0105243_109973572 124
1016 3300009174 Ga0105241_10382493 Ga0105241_103824933 124
1017 3300009174 Ga0105241_10411926 Ga0105241_104119262 124
1018 3300009176 Ga0105242_10104555 Ga0105242_101045554 124
1019 3300009176 Ga0105242_10117748 Ga0105242_101177481 124
1020 3300009176 Ga0105242_10254553 Ga0105242_102545532 124
1021 3300009176 Ga0105242_11392689 Ga0105242_113926891 124
1022 3300009177 Ga0105248_10421419 Ga0105248_104214193 124
1023 3300009177 Ga0105248_10621293 Ga0105248_106212932 124
1024 3300009545 Ga0105237_10358146 Ga0105237_103581462 124
1025 3300009545 Ga0105237_11194597 Ga0105237_111945972 124
1026 3300009551 Ga0105238_10366945 Ga0105238_103669451 124
1027 3300009551 Ga0105238_10369097 Ga0105238_103690972 124
1028 3300009551 Ga0105238_10450806 Ga0105238_104508063 124
1029 3300009553 Ga0105249_10283460 Ga0105249_102834603 124
1030 3300009553 Ga0105249_10772853 Ga0105249_107728532 124
1031 3300009553 Ga0105249_11107463 Ga0105249_111074631 124
1032 3300010375 Ga0105239_10226875 Ga0105239_102268754 124
1033 3300010375 Ga0105239_10389075 Ga0105239_103890753 124
1034 3300010375 Ga0105239_10442962 Ga0105239_104429622 124
1035 3300011119 Ga0105246_10049177 Ga0105246_100491772 124
1036 3300011119 Ga0105246_10177519 Ga0105246_101775193 124
1037 3300011119 Ga0105246_10182799 Ga0105246_101827991 124
1038 3300011119 Ga0105246_11105564 Ga0105246_111055642 124
1039 3300012494 Ga0157341_1023156 Ga0157341_10231562 124
1040 3300013044 Ga0154019_108401 Ga0154019_1084012 124
1041 3300013045 Ga0154016_109853 Ga0154016_1098532 124
1042 3300013052 Ga0154014_155088 Ga0154014_1550883 124
1043 3300013059 Ga0154012_174592 Ga0154012_1745923 124
1044 3300013062 Ga0154010_169846 Ga0154010_1698463 124
1045 3300013100 Ga0157373_10129520 Ga0157373_101295203 124
1046 3300013100 Ga0157373_10252116 Ga0157373_102521163 124
1047 3300013100 Ga0157373_10269428 Ga0157373_102694282 124
1048 3300013102 Ga0157371_10917546 Ga0157371_109175461 124
1049 3300013102 Ga0157371_11319145 Ga0157371_113191451 124
1050 3300013104 Ga0157370_10288553 Ga0157370_102885532 124
1051 3300013104 Ga0157370_10472846 Ga0157370_104728462 124
1052 3300013104 Ga0157370_10645810 Ga0157370_106458102 124
1053 3300013105 Ga0157369_10040784 Ga0157369_100407842 124
1054 3300013105 Ga0157369_10368741 Ga0157369_103687412 124
1055 3300013105 Ga0157369_10490498 Ga0157369_104904982 124
1056 3300013105 Ga0157369_11135253 Ga0157369_111352532 124
1057 3300013105 Ga0157369_11734600 Ga0157369_117346002 124
1058 3300013296 Ga0157374_11907935 Ga0157374_119079352 124
1059 3300013297 Ga0157378_10151859 Ga0157378_101518591 124
1060 3300013297 Ga0157378_10284059 Ga0157378_102840592 124
1061 3300013297 Ga0157378_10428887 Ga0157378_104288873 124
1062 3300013297 Ga0157378_10724113 Ga0157378_107241132 124
1063 3300013297 Ga0157378_13075037 Ga0157378_130750372 124
1064 3300013306 Ga0163162_10414718 Ga0163162_104147182 124
1065 3300013306 Ga0163162_10415409 Ga0163162_104154093 124
1066 3300013306 Ga0163162_10415666 Ga0163162_104156664 124
1067 3300013306 Ga0163162_10432833 Ga0163162_104328331 124
1068 3300013306 Ga0163162_11026675 Ga0163162_110266752 124
1069 3300013306 Ga0163162_11356503 Ga0163162_113565031 124
1070 3300013307 Ga0157372_10060128 Ga0157372_100601286 124
1071 3300013307 Ga0157372_10418862 Ga0157372_104188621 124
1072 3300013307 Ga0157372_10555161 Ga0157372_105551611 124
1073 3300013307 Ga0157372_10743218 Ga0157372_107432182 124
1074 3300013307 Ga0157372_10883289 Ga0157372_108832891 124
1075 3300013307 Ga0157372_11425747 Ga0157372_114257471 124
1076 3300013307 Ga0157372_11487203 Ga0157372_114872032 124
1077 3300013307 Ga0157372_11630064 Ga0157372_116300642 124
1078 3300013308 Ga0157375_10139200 Ga0157375_101392004 124
1079 3300013308 Ga0157375_10525836 Ga0157375_105258363 124
1080 3300013308 Ga0157375_10724968 Ga0157375_107249682 124
1081 3300013308 Ga0157375_11946183 Ga0157375_119461832 124
1082 3300014325 Ga0163163_10096702 Ga0163163_100967023 124
1083 3300014325 Ga0163163_10176943 Ga0163163_101769434 124
1084 3300014325 Ga0163163_10208613 Ga0163163_102086133 124
1085 3300014325 Ga0163163_10268245 Ga0163163_102682454 124
1086 3300014325 Ga0163163_10339457 Ga0163163_103394573 124
1087 3300014325 Ga0163163_11371723 Ga0163163_113717232 124
1088 3300014325 Ga0163163_13039115 Ga0163163_130391151 124
1089 3300014326 Ga0157380_10047519 Ga0157380_100475192 124
1090 3300014326 Ga0157380_10376954 Ga0157380_103769543 124
1091 3300014326 Ga0157380_10400833 Ga0157380_104008333 124
1092 3300014326 Ga0157380_11516359 Ga0157380_115163592 124
1093 3300014326 Ga0157380_11524265 Ga0157380_115242652 124
1094 3300014326 Ga0157380_12711699 Ga0157380_127116991 124
1095 3300014745 Ga0157377_10314041 Ga0157377_103140412 124
1096 3300014745 Ga0157377_10356594 Ga0157377_103565942 124
1097 3300014745 Ga0157377_10928095 Ga0157377_109280952 124
1098 3300014968 Ga0157379_10325637 Ga0157379_103256372 124
1099 3300014968 Ga0157379_10431168 Ga0157379_104311682 124
1100 3300014968 Ga0157379_11248177 Ga0157379_112481771 124
1101 3300014968 Ga0157379_11739537 Ga0157379_117395372 124
1102 3300014968 Ga0157379_12341885 Ga0157379_123418851 124
1103 3300014969 Ga0157376_10045570 Ga0157376_100455705 124
1104 3300014969 Ga0157376_10570685 Ga0157376_105706852 124
1105 3300014969 Ga0157376_11728483 Ga0157376_117284831 124
1106 3300014969 Ga0157376_12257065 Ga0157376_122570651 124
1107 3300017792 Ga0163161_10081962 Ga0163161_100819622 124
1108 3300017792 Ga0163161_12029694 Ga0163161_120296941 124
1109 3300020069 Ga0197907_10050194 Ga0197907_100501943 124
1110 3300020069 Ga0197907_10086159 Ga0197907_100861592 124
1111 3300020069 Ga0197907_10212903 Ga0197907_102129031 124
1112 3300020069 Ga0197907_10268076 Ga0197907_102680761 124
1113 3300020069 Ga0197907_10378803 Ga0197907_103788031 124
1114 3300020069 Ga0197907_10533934 Ga0197907_105339343 124
1115 3300020069 Ga0197907_10881670 Ga0197907_108816702 124
1116 3300020069 Ga0197907_11286071 Ga0197907_112860712 124
1117 3300020070 Ga0206356_10124042 Ga0206356_101240422 124
1118 3300020070 Ga0206356_10200830 Ga0206356_102008301 124
1119 3300020070 Ga0206356_10361125 Ga0206356_103611253 124
1120 3300020070 Ga0206356_10516737 Ga0206356_105167374 124
1121 3300020070 Ga0206356_10824910 Ga0206356_108249102 124
1122 3300020070 Ga0206356_10913331 Ga0206356_109133313 124
1123 3300020070 Ga0206356_11156669 Ga0206356_111566691 124
1124 3300020070 Ga0206356_11286683 Ga0206356_112866831 124
1125 3300020075 Ga0206349_1386548 Ga0206349_13865483 124
1126 3300020075 Ga0206349_1530271 Ga0206349_15302711 124
1127 3300020075 Ga0206349_1613375 Ga0206349_16133751 124
1128 3300020076 Ga0206355_1018340 Ga0206355_10183401 124
1129 3300020076 Ga0206355_1035334 Ga0206355_10353343 124
1130 3300020076 Ga0206355_1055070 Ga0206355_10550701 124
1131 3300020076 Ga0206355_1328705 Ga0206355_13287053 124
1132 3300020076 Ga0206355_1630452 Ga0206355_16304521 124
1133 3300020077 Ga0206351_10072365 Ga0206351_100723653 124
1134 3300020077 Ga0206351_10093131 Ga0206351_100931311 124
1135 3300020077 Ga0206351_10468617 Ga0206351_104686173 124
1136 3300020077 Ga0206351_10495414 Ga0206351_104954141 124
1137 3300020077 Ga0206351_10796045 Ga0206351_107960452 124
1138 3300020077 Ga0206351_10858444 Ga0206351_108584442 124
1139 3300020078 Ga0206352_10254721 Ga0206352_102547211 124
1140 3300020078 Ga0206352_10314452 Ga0206352_103144521 124
1141 3300020078 Ga0206352_10408147 Ga0206352_104081473 124
1142 3300020078 Ga0206352_10649957 Ga0206352_106499572 124
1143 3300020078 Ga0206352_10939620 Ga0206352_109396201 124
1144 3300020078 Ga0206352_11168067 Ga0206352_111680672 124
1145 3300020078 Ga0206352_11295788 Ga0206352_112957882 124
1146 3300020080 Ga0206350_10430818 Ga0206350_104308183 124
1147 3300020080 Ga0206350_10432378 Ga0206350_104323781 124
1148 3300020080 Ga0206350_10544636 Ga0206350_105446364 124
1149 3300020080 Ga0206350_11196555 Ga0206350_111965552 124
1150 3300020080 Ga0206350_11654020 Ga0206350_116540202 124
1151 3300020081 Ga0206354_10208883 Ga0206354_102088832 124
1152 3300020081 Ga0206354_10331979 Ga0206354_103319792 124
1153 3300020081 Ga0206354_11017939 Ga0206354_110179391 124
1154 3300020081 Ga0206354_11068226 Ga0206354_110682262 124
1155 3300020081 Ga0206354_11172408 Ga0206354_111724083 124
1156 3300020081 Ga0206354_11291340 Ga0206354_112913401 124
1157 3300020081 Ga0206354_11520797 Ga0206354_115207972 124
1158 3300020081 Ga0206354_11614879 Ga0206354_116148792 124
1159 3300020082 Ga0206353_10014677 Ga0206353_100146775 124
1160 3300020082 Ga0206353_10282636 Ga0206353_102826363 124
1161 3300020082 Ga0206353_10330275 Ga0206353_103302751 124
1162 3300020082 Ga0206353_10591683 Ga0206353_105916832 124
1163 3300020082 Ga0206353_10790039 Ga0206353_107900391 124
1164 3300020082 Ga0206353_11192759 Ga0206353_111927592 124
1165 3300020082 Ga0206353_11631527 Ga0206353_116315271 124
1166 3300020082 Ga0206353_11688786 Ga0206353_116887861 124
1167 3300020082 Ga0206353_11996101 Ga0206353_119961012 124
1168 3300020610 Ga0154015_1068933 Ga0154015_10689332 124
1169 3300020610 Ga0154015_1105291 Ga0154015_11052912 124
1170 3300020610 Ga0154015_1142575 Ga0154015_11425752 124
1171 3300020610 Ga0154015_1285479 Ga0154015_12854793 124
1172 3300020610 Ga0154015_1417016 Ga0154015_14170161 124
1173 3300020610 Ga0154015_1538444 Ga0154015_15384442 124
1174 3300022467 Ga0224712_10001495 Ga0224712_100014956 124
1175 3300022467 Ga0224712_10011859 Ga0224712_100118592 124
1176 3300022467 Ga0224712_10015890 Ga0224712_100158903 124
1177 3300022467 Ga0224712_10024023 Ga0224712_100240231 124
1178 3300022467 Ga0224712_10038926 Ga0224712_100389262 124
1179 3300022467 Ga0224712_10101446 Ga0224712_101014463 124
1180 3300025225 Ga0209566_100066 Ga0209566_100066162 124
1181 3300025226 Ga0209674_100001 Ga0209674_1000011668 124
1182 3300025228 Ga0209672_100039 Ga0209672_10003961 124
1183 3300025229 Ga0209147_100954 Ga0209147_10095412 124
1184 3300025230 Ga0209563_100001 Ga0209563_1000011668 124
1185 3300025231 Ga0207427_100042 Ga0207427_10004248 124
1186 3300025233 Ga0209437_100538 Ga0209437_10053824 124
1187 3300025242 Ga0209258_101761 Ga0209258_1017615 124
1188 3300025253 Ga0209677_100001 Ga0209677_1000011668 124
1189 3300025253 Ga0209677_102161 Ga0209677_1021616 124
1190 3300025254 Ga0209148_1000004 Ga0209148_100000461 124
1191 3300025261 Ga0209233_1000001 Ga0209233_10000011134 124
1192 3300025272 Ga0209455_1000117 Ga0209455_1000117172 124
1193 3300025272 Ga0209455_1003952 Ga0209455_10039521 124
1194 3300025315 Ga0207697_10119287 Ga0207697_101192872 124
1195 3300025321 Ga0207656_10013795 Ga0207656_100137952 124
1196 3300025885 Ga0207653_10047439 Ga0207653_100474393 124
1197 3300025898 Ga0207692_10288443 Ga0207692_102884432 124
1198 3300025899 Ga0207642_10773310 Ga0207642_107733101 124
1199 3300025899 Ga0207642_10836266 Ga0207642_108362661 124
1200 3300025900 Ga0207710_10436641 Ga0207710_104366411 124
1201 3300025901 Ga0207688_10016881 Ga0207688_100168816 124
1202 3300025901 Ga0207688_10036391 Ga0207688_100363913 124
1203 3300025901 Ga0207688_10167179 Ga0207688_101671793 124
1204 3300025904 Ga0207647_10021889 Ga0207647_100218895 124
1205 3300025904 Ga0207647_10028990 Ga0207647_100289902 124
1206 3300025907 Ga0207645_10064369 Ga0207645_100643692 124
1207 3300025907 Ga0207645_10149679 Ga0207645_101496791 124
1208 3300025908 Ga0207643_10011474 Ga0207643_100114748 124
1209 3300025908 Ga0207643_10048389 Ga0207643_100483892 124
1210 3300025908 Ga0207643_10199074 Ga0207643_101990743 124
1211 3300025908 Ga0207643_10202123 Ga0207643_102021232 124
1212 3300025909 Ga0207705_10013197 Ga0207705_100131976 124
1213 3300025909 Ga0207705_10120089 Ga0207705_101200892 124
1214 3300025909 Ga0207705_10202859 Ga0207705_102028593 124
1215 3300025910 Ga0207684_10002793 Ga0207684_1000279314 124
1216 3300025910 Ga0207684_10018534 Ga0207684_100185344 124
1217 3300025910 Ga0207684_10116254 Ga0207684_101162544 124
1218 3300025910 Ga0207684_10830059 Ga0207684_108300591 124
1219 3300025911 Ga0207654_10060489 Ga0207654_100604893 124
1220 3300025911 Ga0207654_10873031 Ga0207654_108730312 124
1221 3300025912 Ga0207707_10112966 Ga0207707_101129662 124
1222 3300025912 Ga0207707_10115185 Ga0207707_101151852 124
1223 3300025912 Ga0207707_10471034 Ga0207707_104710342 124
1224 3300025912 Ga0207707_10547397 Ga0207707_105473972 124
1225 3300025912 Ga0207707_10689187 Ga0207707_106891872 124
1226 3300025914 Ga0207671_10508695 Ga0207671_105086952 124
1227 3300025915 Ga0207693_10910752 Ga0207693_109107522 124
1228 3300025917 Ga0207660_10000002 Ga0207660_10000002334 124
1229 3300025917 Ga0207660_10197986 Ga0207660_101979863 124
1230 3300025917 Ga0207660_10318694 Ga0207660_103186942 124
1231 3300025917 Ga0207660_11056144 Ga0207660_110561441 124
1232 3300025918 Ga0207662_10397766 Ga0207662_103977662 124
1233 3300025919 Ga0207657_10031572 Ga0207657_100315723 124
1234 3300025919 Ga0207657_10171230 Ga0207657_101712302 124
1235 3300025919 Ga0207657_10404575 Ga0207657_104045752 124
1236 3300025920 Ga0207649_10730382 Ga0207649_107303821 124
1237 3300025920 Ga0207649_10978365 Ga0207649_109783652 124
1238 3300025921 Ga0207652_10015058 Ga0207652_100150581 124
1239 3300025921 Ga0207652_10079196 Ga0207652_100791962 124
1240 3300025921 Ga0207652_10447665 Ga0207652_104476652 124
1241 3300025922 Ga0207646_10028575 Ga0207646_100285754 124
1242 3300025922 Ga0207646_10037146 Ga0207646_100371464 124
1243 3300025922 Ga0207646_10048634 Ga0207646_100486344 124
1244 3300025923 Ga0207681_10982571 Ga0207681_109825711 124
1245 3300025924 Ga0207694_10010017 Ga0207694_100100176 124
1246 3300025924 Ga0207694_10261073 Ga0207694_102610731 124
1247 3300025924 Ga0207694_10321104 Ga0207694_103211042 124
1248 3300025925 Ga0207650_10263591 Ga0207650_102635912 124
1249 3300025925 Ga0207650_10358983 Ga0207650_103589833 124
1250 3300025926 Ga0207659_10100407 Ga0207659_101004072 124
1251 3300025927 Ga0207687_10068636 Ga0207687_100686364 124
1252 3300025927 Ga0207687_10076469 Ga0207687_100764691 124
1253 3300025927 Ga0207687_11125178 Ga0207687_111251781 124
1254 3300025927 Ga0207687_11342338 Ga0207687_113423381 124
1255 3300025927 Ga0207687_11533538 Ga0207687_115335381 124
1256 3300025931 Ga0207644_10862613 Ga0207644_108626131 124
1257 3300025931 Ga0207644_10987685 Ga0207644_109876851 124
1258 3300025932 Ga0207690_10096274 Ga0207690_100962742 124
1259 3300025932 Ga0207690_10623211 Ga0207690_106232112 124
1260 3300025933 Ga0207706_10012543 Ga0207706_1001254310 124
1261 3300025933 Ga0207706_10196299 Ga0207706_101962994 124
1262 3300025933 Ga0207706_10603301 Ga0207706_106033011 124
1263 3300025934 Ga0207686_10020647 Ga0207686_100206474 124
1264 3300025934 Ga0207686_10059068 Ga0207686_100590682 124
1265 3300025934 Ga0207686_11206580 Ga0207686_112065802 124
1266 3300025935 Ga0207709_10020150 Ga0207709_100201504 124
1267 3300025935 Ga0207709_10136935 Ga0207709_101369352 124
1268 3300025935 Ga0207709_10254716 Ga0207709_102547162 124
1269 3300025935 Ga0207709_10554129 Ga0207709_105541292 124
1270 3300025935 Ga0207709_10575743 Ga0207709_105757432 124
1271 3300025935 Ga0207709_10593553 Ga0207709_105935531 124
1272 3300025936 Ga0207670_10225281 Ga0207670_102252812 124
1273 3300025937 Ga0207669_10039257 Ga0207669_100392571 124
1274 3300025937 Ga0207669_10101044 Ga0207669_101010443 124
1275 3300025937 Ga0207669_10194744 Ga0207669_101947443 124
1276 3300025938 Ga0207704_10061699 Ga0207704_100616994 124
1277 3300025938 Ga0207704_10412076 Ga0207704_104120762 124
1278 3300025938 Ga0207704_10521277 Ga0207704_105212772 124
1279 3300025940 Ga0207691_10527891 Ga0207691_105278912 124
1280 3300025941 Ga0207711_10113217 Ga0207711_101132172 124
1281 3300025941 Ga0207711_10325705 Ga0207711_103257052 124
1282 3300025941 Ga0207711_10488048 Ga0207711_104880482 124
1283 3300025942 Ga0207689_10029116 Ga0207689_100291162 124
1284 3300025942 Ga0207689_10095522 Ga0207689_100955223 124
1285 3300025944 Ga0207661_10000189 Ga0207661_1000018912 124
1286 3300025944 Ga0207661_10030780 Ga0207661_100307804 124
1287 3300025944 Ga0207661_10283621 Ga0207661_102836212 124
1288 3300025944 Ga0207661_10508833 Ga0207661_105088332 124
1289 3300025944 Ga0207661_10529277 Ga0207661_105292773 124
1290 3300025944 Ga0207661_10772628 Ga0207661_107726282 124
1291 3300025944 Ga0207661_10966456 Ga0207661_109664561 124
1292 3300025944 Ga0207661_11445882 Ga0207661_114458821 124
1293 3300025945 Ga0207679_10216472 Ga0207679_102164722 124
1294 3300025945 Ga0207679_10246993 Ga0207679_102469933 124
1295 3300025945 Ga0207679_10673327 Ga0207679_106733271 124
1296 3300025945 Ga0207679_10700184 Ga0207679_107001841 124
1297 3300025949 Ga0207667_10266250 Ga0207667_102662503 124
1298 3300025960 Ga0207651_10602306 Ga0207651_106023062 124
1299 3300025960 Ga0207651_10793014 Ga0207651_107930141 124
1300 3300025960 Ga0207651_11378465 Ga0207651_113784652 124
1301 3300025960 Ga0207651_11583715 Ga0207651_115837151 124
1302 3300025961 Ga0207712_10153966 Ga0207712_101539662 124
1303 3300025961 Ga0207712_10653681 Ga0207712_106536812 124
1304 3300025961 Ga0207712_10671211 Ga0207712_106712112 124
1305 3300025981 Ga0207640_10063865 Ga0207640_100638651 124
1306 3300025981 Ga0207640_10266741 Ga0207640_102667413 124
1307 3300025981 Ga0207640_10616263 Ga0207640_106162632 124
1308 3300025986 Ga0207658_10691348 Ga0207658_106913482 124
1309 3300026023 Ga0207677_10114794 Ga0207677_101147941 124
1310 3300026023 Ga0207677_10542254 Ga0207677_105422542 124
1311 3300026023 Ga0207677_10566713 Ga0207677_105667132 124
1312 3300026023 Ga0207677_10696072 Ga0207677_106960722 124
1313 3300026035 Ga0207703_11458167 Ga0207703_114581672 124
1314 3300026041 Ga0207639_10764363 Ga0207639_107643632 124
1315 3300026067 Ga0207678_10146870 Ga0207678_101468703 124
1316 3300026067 Ga0207678_10330038 Ga0207678_103300382 124
1317 3300026067 Ga0207678_10353523 Ga0207678_103535233 124
1318 3300026067 Ga0207678_10509204 Ga0207678_105092042 124
1319 3300026067 Ga0207678_10587647 Ga0207678_105876471 124
1320 3300026067 Ga0207678_10993361 Ga0207678_109933611 124
1321 3300026075 Ga0207708_10090013 Ga0207708_100900132 124
1322 3300026075 Ga0207708_10118012 Ga0207708_101180124 124
1323 3300026075 Ga0207708_10153468 Ga0207708_101534684 124
1324 3300026075 Ga0207708_10321121 Ga0207708_103211212 124
1325 3300026075 Ga0207708_10568282 Ga0207708_105682821 124
1326 3300026078 Ga0207702_10033880 Ga0207702_100338808 124
1327 3300026078 Ga0207702_10149288 Ga0207702_101492882 124
1328 3300026078 Ga0207702_10158054 Ga0207702_101580542 124
1329 3300026078 Ga0207702_10503454 Ga0207702_105034544 124
1330 3300026088 Ga0207641_10049012 Ga0207641_100490123 124
1331 3300026089 Ga0207648_10151012 Ga0207648_101510124 124
1332 3300026089 Ga0207648_10228692 Ga0207648_102286923 124
1333 3300026089 Ga0207648_10334264 Ga0207648_103342643 124
1334 3300026095 Ga0207676_10065702 Ga0207676_100657023 124
1335 3300026116 Ga0207674_10134020 Ga0207674_101340202 124
1336 3300026116 Ga0207674_10162985 Ga0207674_101629852 124
1337 3300026116 Ga0207674_10455687 Ga0207674_104556873 124
1338 3300026116 Ga0207674_10532577 Ga0207674_105325771 124
1339 3300026118 Ga0207675_100082898 Ga0207675_1000828982 124
1340 3300026118 Ga0207675_100195629 Ga0207675_1001956293 124
1341 3300026118 Ga0207675_101470333 Ga0207675_1014703332 124
1342 3300026121 Ga0207683_10154003 Ga0207683_101540032 124
1343 3300026121 Ga0207683_10358518 Ga0207683_103585183 124
1344 3300026121 Ga0207683_10427335 Ga0207683_104273352 124
1345 3300026121 Ga0207683_10461075 Ga0207683_104610752 124
1346 3300026121 Ga0207683_10515193 Ga0207683_105151931 124
1347 3300026121 Ga0207683_10957018 Ga0207683_109570182 124
1348 3300026121 Ga0207683_12149743 Ga0207683_121497431 124
1349 3300026142 Ga0207698_10020583 Ga0207698_100205838 124
1350 3300026142 Ga0207698_10324013 Ga0207698_103240133 124
1351 3300027360 Ga0209969_1032723 Ga0209969_10327232 124
1352 3300027907 Ga0207428_10000181 Ga0207428_1000018175 124
1353 3300028379 Ga0268266_10958393 Ga0268266_109583932 124
1354 3300028380 Ga0268265_10321086 Ga0268265_103210862 124
1355 3300028380 Ga0268265_10997499 Ga0268265_109974992 124
1356 3300028381 Ga0268264_10102520 Ga0268264_101025203 124
1357 3300028381 Ga0268264_10569197 Ga0268264_105691972 124
1358 3300028381 Ga0268264_11401749 Ga0268264_114017492 124
1359 3300028556 Ga0265337_1016621 Ga0265337_10166211 124
1360 3300028800 Ga0265338_10739638 Ga0265338_107396381 124
1361 3300031251 Ga0265327_10075274 Ga0265327_100752742 124
1362 3300031649 Ga0307514_10020272 Ga0307514_100202721 124
1363 3300031665 Ga0316575_10006117 Ga0316575_100061171 124
1364 3300031665 Ga0316575_10317684 Ga0316575_103176842 124
1365 3300031691 Ga0316579_10023159 Ga0316579_100231594 124
1366 3300031691 Ga0316579_10066726 Ga0316579_100667263 124
1367 3300031691 Ga0316579_10130380 Ga0316579_101303801 124
1368 3300031691 Ga0316579_10145130 Ga0316579_101451302 124
1369 3300031727 Ga0316576_10074501 Ga0316576_100745013 124
1370 3300031727 Ga0316576_10689990 Ga0316576_106899901 124
1371 3300031728 Ga0316578_10132551 Ga0316578_101325512 124
1372 3300031733 Ga0316577_10017827 Ga0316577_100178274 124
1373 3300031733 Ga0316577_10083780 Ga0316577_100837802 124
1374 3300031733 Ga0316577_10092089 Ga0316577_100920892 124
1375 3300031733 Ga0316577_10224268 Ga0316577_102242682 124
1376 3300031733 Ga0316577_10232320 Ga0316577_102323201 124
1377 3300031733 Ga0316577_10249295 Ga0316577_102492952 124
1378 3300031733 Ga0316577_10520103 Ga0316577_105201032 124
1379 3300031852 Ga0307410_10454535 Ga0307410_104545352 124
1380 3300031911 Ga0307412_11506679 Ga0307412_115066792 124
1381 3300031995 Ga0307409_100096715 Ga0307409_1000967153 124
1382 3300031995 Ga0307409_100548092 Ga0307409_1005480923 124
1383 3300031995 Ga0307409_101808684 Ga0307409_1018086842 124
1384 3300032002 Ga0307416_100613719 Ga0307416_1006137192 124
1385 3300032002 Ga0307416_100855774 Ga0307416_1008557742 124
1386 3300032126 Ga0307415_100625789 Ga0307415_1006257892 124
1387 3300032133 Ga0316583_10061258 Ga0316583_100612581 124
1388 3300032137 Ga0316585_10004351 Ga0316585_100043514 124
1389 3300032137 Ga0316585_10091378 Ga0316585_100913782 124
1390 3300032168 Ga0316593_10367576 Ga0316593_103675761 124
1391 3300034820 Ga0373959_0036141 Ga0373959_0036141_118_492 124
1392 3300034820 Ga0373959_0117360 Ga0373959_0117360_82_459 124
1393 3300034957 Ga0373938_0029372 Ga0373938_0029372_757_1131 124
1394 3300035088 Ga0373940_0077785 Ga0373940_0077785_339_716 124
1395 3300035090 Ga0373949_0048275 Ga0373949_0048275_126_500 124
1396 3300035090 Ga0373949_0076228 Ga0373949_0076228_73_447 124
1397 3300035091 Ga0373951_0017339 Ga0373951_0017339_982_1356 124
1398 3300035092 Ga0373952_0009679 Ga0373952_0009679_1151_1525 124
1399 3300035092 Ga0373952_0029204 Ga0373952_0029204_632_1015 124
1400 3300035092 Ga0373952_0089127 Ga0373952_0089127_95_469 124
1401 3300035092 Ga0373952_0110733 Ga0373952_0110733_65_442 124
1402 3300035112 Ga0373932_0013656 Ga0373932_0013656_947_1321 124
1403 3300035115 Ga0373941_0043255 Ga0373941_0043255_113_490 124
1404 3300035115 Ga0373941_0148827 Ga0373941_0148827_321_695 124
1405 3300035117 Ga0373953_0091225 Ga0373953_0091225_853_1233 124
1406 3300035119 Ga0373956_0525352 Ga0373956_0525352_81_461 124
1407 3300035120 Ga0373957_0134599 Ga0373957_0134599_319_699 124
1408 3300035121 Ga0373960_0125435 Ga0373960_0125435_136_510 124
1409 3300035170 Ga0373943_0416805 Ga0373943_0416805_51_431 124
1410 3300035172 Ga0373955_0106446 Ga0373955_0106446_648_1028 124
1411 3300035207 Ga0373942_0006705 Ga0373942_0006705_120_497 124
1412 3300035207 Ga0373942_0276851 Ga0373942_0276851_43_417 124
1413 3300035241 Ga0373961_0032995 Ga0373961_0032995_644_1018 124
1414 3300035241 Ga0373961_0197210 Ga0373961_0197210_103_477 124
1415 3300035242 Ga0373962_0057119 Ga0373962_0057119_521_898 124
1416 3300035242 Ga0373962_0083237 Ga0373962_0083237_156_533 124
1417 3300035398 Ga0316574_0232470 Ga0316574_0232470_84_464 124
1418 3300035410 Ga0373924_0231086 Ga0373924_0231086_361_741 124
1419 3300035691 Ga0373931_0029997 Ga0373931_0029997_842_1219 124
1420 3300035691 Ga0373931_0116969 Ga0373931_0116969_655_1029 124
1421 3300035691 Ga0373931_0126812 Ga0373931_0126812_509_886 124
1422 3300036401 Ga0373937_0445807 Ga0373937_0445807_429_809 124
1423 3300036401 Ga0373937_0708534 Ga0373937_0708534_328_708 124
1424 3300036401 Ga0373937_0744223 Ga0373937_0744223_422_874 124
1425 3300036457 Ga0265778_022895 Ga0265778_022895_342_716 124
1426 3300036647 Ga0316582_0016976 Ga0316582_0016976_18_401 124
1427 3300036647 Ga0316582_0019246 Ga0316582_0019246_805_1188 124
1428 3300036647 Ga0316582_0240395 Ga0316582_0240395_591_974 124
1429 3300036647 Ga0316582_0435598 Ga0316582_0435598_59_442 124
1430 3300036647 Ga0316582_0493860 Ga0316582_0493860_18_401 124
1431 3300036647 Ga0316582_0790219 Ga0316582_0790219_142_525 124
1432 3300036712 Ga0316584_0003848 Ga0316584_0003848_5957_6340 124
1433 3300036712 Ga0316584_0008456 Ga0316584_0008456_5582_5965 124
1434 3300036712 Ga0316584_0032481 Ga0316584_0032481_466_849 124
1435 3300036712 Ga0316584_0122179 Ga0316584_0122179_1035_1418 124
1436 3300036712 Ga0316584_0229218 Ga0316584_0229218_203_586 124
1437 3300036712 Ga0316584_0278001 Ga0316584_0278001_453_836 124
1438 3300037068 Ga0373925_1026623 Ga0373925_1026623_145_519 124
1439 3300037312 Ga0395899_0166028 Ga0395899_0166028_956_1330 124
1440 3300037418 Ga0395900_0061899 Ga0395900_0061899_2494_2868 124
1441 3300037418 Ga0395900_0103562 Ga0395900_0103562_2040_2414 124
1442 3300037418 Ga0395900_0113402 Ga0395900_0113402_875_1249 124
1443 3300037466 Ga0395898_0000381 Ga0395898_0000381_89109_89483 124
1444 3300037466 Ga0395898_0240350 Ga0395898_0240350_807_1181 124
1445 3300037471 Ga0395905_0518375 Ga0395905_0518375_531_908 124
1446 3300037588 Ga0316581_0002334 Ga0316581_0002334_3923_4306 124
1447 3300037588 Ga0316581_0030105 Ga0316581_0030105_225_608 124
1448 3300037588 Ga0316581_0060460 Ga0316581_0060460_139_522 124
1449 3300038443 Ga0395901_0150442 Ga0395901_0150442_1139_1513 124
1450 3300038443 Ga0395901_0492651 Ga0395901_0492651_463_837 124
1451 3300038996 Ga0242420_122642 Ga0242420_122642_144_521 124
1452 3300039093 Ga0400489_12849 Ga0400489_12849_568_942 124
1453 3300039447 Ga0436361_0793921 Ga0436361_0793921_107_484 124
1454 3300039450 Ga0436363_0126624 Ga0436363_0126624_28_405 124
1455 3300039453 Ga0436362_0739222 Ga0436362_0739222_118_495 124
1456 3300041443 Ga0451789_0724155 Ga0451789_0724155_28_402 124
1457 3300041452 Ga0451793_1457874 Ga0451793_1457874_792_1166 124
1458 3300041458 Ga0451798_0847145 Ga0451798_0847145_858_1232 124
1459 3300041461 Ga0451805_017166 Ga0451805_017166_341_715 124
1460 3300041486 Ga0451807_2770562 Ga0451807_2770562_42_416 124
1461 3300041491 Ga0451833_0697339 Ga0451833_0697339_228_602 124
1462 3300041496 Ga0451839_1230110 Ga0451839_1230110_498_872 124
1463 3300041501 Ga0451845_0305454 Ga0451845_0305454_37_411 124
1464 3300041501 Ga0451845_0608312 Ga0451845_0608312_76_450 124
1465 3300041505 Ga0451849_0000801 Ga0451849_0000801_22_396 124
1466 3300041507 Ga0451851_0422564 Ga0451851_0422564_111_485 124
1467 3300041509 Ga0451843_0725649 Ga0451843_0725649_58_432 124
1468 3300041511 Ga0451855_1617624 Ga0451855_1617624_407_781 124
1469 3300041512 Ga0451853_0600829 Ga0451853_0600829_178_552 124
1470 3300041512 Ga0451853_1418465 Ga0451853_1418465_703_1077 124
1471 3300042005 Ga0439448_0011384 Ga0439448_0011384_1621_1995 124
1472 3300042005 Ga0439448_0202695 Ga0439448_0202695_47_430 124
1473 3300042008 Ga0439450_122795 Ga0439450_122795_168_545 124
1474 3300042008 Ga0439450_227377 Ga0439450_227377_41_418 124
1475 3300042012 Ga0439455_0104539 Ga0439455_0104539_258_632 124
1476 3300042013 Ga0439456_043915 Ga0439456_043915_261_641 124
1477 3300042122 Ga0450920_007738 Ga0450920_007738_236_610 124
1478 3300042125 Ga0450923_014865 Ga0450923_014865_320_694 124
1479 3300042145 Ga0450906_008981 Ga0450906_008981_885_1259 124
1480 3300042146 Ga0450907_037255 Ga0450907_037255_331_711 124
1481 3300042157 Ga0439458_0148677 Ga0439458_0148677_112_486 124
1482 3300042435 Ga0439434_0060393 Ga0439434_0060393_79_456 124
1483 3300042436 Ga0439435_0070056 Ga0439435_0070056_17_394 124
1484 3300042437 Ga0439444_0050696 Ga0439444_0050696_116_493 124
1485 3300042439 Ga0439464_0165014 Ga0439464_0165014_230_607 124
1486 3300042461 Ga0439460_0311138 Ga0439460_0311138_100_477 124
1487 3300042530 Ga0450916_022216 Ga0450916_022216_311_685 124
1488 3300042531 Ga0450918_013050 Ga0450918_013050_433_813 124
1489 3300042876 Ga0451577_0016881 Ga0451577_0016881_1977_2351 124
1490 3300042876 Ga0451577_0117036 Ga0451577_0117036_1486_1863 124
1491 3300042876 Ga0451577_0314814 Ga0451577_0314814_580_963 124
1492 3300044656 Ga0466969_0103990 Ga0466969_0103990_607_981 124
1493 3300044658 Ga0466972_0005615 Ga0466972_0005615_2321_2695 124
1494 3300044658 Ga0466972_0234463 Ga0466972_0234463_280_654 124
1495 3300044673 Ga0453683_0036050 Ga0453683_0036050_1160_1537 124
1496 3300044673 Ga0453683_0154124 Ga0453683_0154124_791_1168 124
1497 3300044683 Ga0466965_0006167 Ga0466965_0006167_3597_3971 124
1498 3300044683 Ga0466965_0014387 Ga0466965_0014387_748_1122 124
1499 3300044684 Ga0466966_0010977 Ga0466966_0010977_3584_3958 124
1500 3300044693 Ga0466961_0087743 Ga0466961_0087743_995_1369 124
1501 3300044693 Ga0466961_0201841 Ga0466961_0201841_265_639 124
1502 3300044693 Ga0466961_0204689 Ga0466961_0204689_131_514 124
1503 3300044694 Ga0466963_0083412 Ga0466963_0083412_1217_1600 124
1504 3300044694 Ga0466963_1016940 Ga0466963_1016940_61_438 124
1505 3300044706 Ga0466964_0180154 Ga0466964_0180154_561_935 124
1506 3300044706 Ga0466964_0224970 Ga0466964_0224970_484_867 124
1507 3300044712 Ga0453684_0088810 Ga0453684_0088810_2373_2756 124
1508 3300044712 Ga0453684_0491965 Ga0453684_0491965_323_697 124
1509 3300044712 Ga0453684_0526506 Ga0453684_0526506_682_1065 124
1510 3300044712 Ga0453684_0627939 Ga0453684_0627939_199_576 124
1511 3300044719 Ga0466971_0059038 Ga0466971_0059038_940_1314 124
1512 3300044719 Ga0466971_0183400 Ga0466971_0183400_407_781 124
1513 3300044719 Ga0466971_0608400 Ga0466971_0608400_36_419 124
1514 3300044735 Ga0466968_0354300 Ga0466968_0354300_168_542 124
1515 3300044735 Ga0466968_0491539 Ga0466968_0491539_137_511 124
1516 3300044765 Ga0466970_0033983 Ga0466970_0033983_1000_1374 124
1517 3300044765 Ga0466970_0072211 Ga0466970_0072211_825_1199 124
1518 3300044842 Ga0466957_0038195 Ga0466957_0038195_63_437 124
1519 3300044842 Ga0466957_0052384 Ga0466957_0052384_1192_1575 124
1520 3300044842 Ga0466957_0070960 Ga0466957_0070960_140_523 124
1521 3300044842 Ga0466957_0196793 Ga0466957_0196793_672_1046 124
1522 3300044842 Ga0466957_0247951 Ga0466957_0247951_553_936 124
1523 3300044901 Ga0466960_0019581 Ga0466960_0019581_1344_1718 124
1524 3300044901 Ga0466960_0059399 Ga0466960_0059399_631_1005 124
1525 3300045049 Ga0466959_0004261 Ga0466959_0004261_5230_5613 124
1526 3300045049 Ga0466959_0039513 Ga0466959_0039513_2310_2684 124
1527 3300045051 Ga0451576_0034109 Ga0451576_0034109_2831_3208 124
1528 3300045051 Ga0451576_0185581 Ga0451576_0185581_371_754 124
1529 3300045836 Ga0466958_0002151 Ga0466958_0002151_6487_6870 124
1530 3300045836 Ga0466958_0018252 Ga0466958_0018252_2398_2772 124
1531 3300045836 Ga0466958_0031221 Ga0466958_0031221_2475_2858 124
1532 3300045836 Ga0466958_0087216 Ga0466958_0087216_1160_1543 124
1533 3300045836 Ga0466958_0399398 Ga0466958_0399398_356_739 124
1534 3300045976 Ga0466967_1299685 Ga0466967_1299685_154_537 124
1535 3300045976 Ga0466967_2311786 Ga0466967_2311786_125_502 124
1536 3300046454 Ga0495592_0233423 Ga0495592_0233423_382_756 124
1537 3300046455 Ga0495603_0009479 Ga0495603_0009479_762_1136 124
1538 3300046455 Ga0495603_0191092 Ga0495603_0191092_146_520 124
1539 3300046459 Ga0495629_0161553 Ga0495629_0161553_764_1138 124
1540 3300046461 Ga0495641_0055802 Ga0495641_0055802_172_546 124
1541 3300046463 Ga0495653_0308089 Ga0495653_0308089_219_599 124
1542 3300046471 Ga0495650_0040933 Ga0495650_0040933_1349_1723 124
1543 3300046471 Ga0495650_0048271 Ga0495650_0048271_201_581 124
1544 3300046471 Ga0495650_0111255 Ga0495650_0111255_161_541 124
1545 3300046473 Ga0495582_0080740 Ga0495582_0080740_505_879 124
1546 3300046477 Ga0495664_0226434 Ga0495664_0226434_602_982 124
1547 3300046491 Ga0495584_0228811 Ga0495584_0228811_455_838 124
1548 3300046491 Ga0495584_0337063 Ga0495584_0337063_371_745 124
1549 3300046500 Ga0495596_0087503 Ga0495596_0087503_796_1170 124
1550 3300046513 Ga0495616_0228237 Ga0495616_0228237_357_731 124
1551 3300046514 Ga0495618_0238478 Ga0495618_0238478_615_989 124
1552 3300046515 Ga0495620_0263375 Ga0495620_0263375_151_525 124
1553 3300046523 Ga0495644_0187506 Ga0495644_0187506_253_627 124
1554 3300046524 Ga0495648_0033982 Ga0495648_0033982_2638_3018 124
1555 3300046525 Ga0495663_0125873 Ga0495663_0125873_401_778 124
1556 3300046525 Ga0495663_0224886 Ga0495663_0224886_34_417 124
1557 3300046529 Ga0495652_0787729 Ga0495652_0787729_64_438 124
1558 3300046529 Ga0495652_1016440 Ga0495652_1016440_40_414 124
1559 3300046536 Ga0495587_0223807 Ga0495587_0223807_426_800 124
1560 3300046537 Ga0495598_0165374 Ga0495598_0165374_35_409 124
1561 3300046538 Ga0495609_0151753 Ga0495609_0151753_322_696 124
1562 3300046559 Ga0495667_0516058 Ga0495667_0516058_358_732 124
1563 3300046615 Ga0495656_0019032 Ga0495656_0019032_506_880 124
1564 3300046678 Ga0495599_0735957 Ga0495599_0735957_93_473 124
1565 3300046681 Ga0495647_0507820 Ga0495647_0507820_169_543 124
1566 3300046683 Ga0495658_0070216 Ga0495658_0070216_609_983 124
1567 3300046683 Ga0495658_0692567 Ga0495658_0692567_78_452 124
1568 3300046684 Ga0495669_0117319 Ga0495669_0117319_356_730 124
1569 3300046689 Ga0495613_0306163 Ga0495613_0306163_325_699 124
1570 3300046690 Ga0495624_0440497 Ga0495624_0440497_217_591 124
1571 3300046794 Ga0495589_0031760 Ga0495589_0031760_429_803 124
1572 3300047315 Ga0495581_0217471 Ga0495581_0217471_327_701 124
1573 3300047317 Ga0495604_0288647 Ga0495604_0288647_157_609 124
1574 3300047317 Ga0495604_0337907 Ga0495604_0337907_484_858 124
1575 3300047319 Ga0495674_0012859 Ga0495674_0012859_5497_5877 124
1576 3300047320 Ga0495672_0004778 Ga0495672_0004778_10039_10419 124
1577 3300047322 Ga0495680_0281901 Ga0495680_0281901_452_826 124
1578 3300047445 Ga0495677_0172211 Ga0495677_0172211_48_422 124
1579 3300047472 Ga0495686_0155677 Ga0495686_0155677_122_496 124
1580 3300048903 Ga0496100_0020442 Ga0496100_0020442_2772_3146 124
1581 3300048903 Ga0496100_0037424 Ga0496100_0037424_2564_2938 124
1582 3300048903 Ga0496100_0532940 Ga0496100_0532940_510_884 124
1583 3300048903 Ga0496100_0798570 Ga0496100_0798570_74_448 124
1584 3300048904 Ga0496101_0064090 Ga0496101_0064090_1230_1604 124
1585 3300048904 Ga0496101_0156944 Ga0496101_0156944_90_464 124
1586 3300048904 Ga0496101_0415467 Ga0496101_0415467_423_797 124
1587 3300048904 Ga0496101_0475184 Ga0496101_0475184_165_539 124
1588 3300048904 Ga0496101_1526072 Ga0496101_1526072_91_468 124
1589 3300048905 Ga0496102_0256404 Ga0496102_0256404_1245_1619 124
1590 3300048905 Ga0496102_0596746 Ga0496102_0596746_534_908 124
1591 3300048905 Ga0496102_0782946 Ga0496102_0782946_61_435 124
1592 3300048905 Ga0496102_0816894 Ga0496102_0816894_322_696 124
1593 3300048905 Ga0496102_1254518 Ga0496102_1254518_135_512 124
1594 3300048906 Ga0496103_0039276 Ga0496103_0039276_1677_2051 124
1595 3300048906 Ga0496103_0377231 Ga0496103_0377231_88_465 124
1596 3300048907 Ga0496104_0054378 Ga0496104_0054378_2593_2967 124
1597 3300048907 Ga0496104_0106807 Ga0496104_0106807_1931_2305 124
1598 3300048907 Ga0496104_0136994 Ga0496104_0136994_607_981 124
1599 3300048907 Ga0496104_0958994 Ga0496104_0958994_171_545 124
1600 3300048908 Ga0496105_0034806 Ga0496105_0034806_2045_2419 124
1601 3300048908 Ga0496105_0054080 Ga0496105_0054080_1807_2181 124
1602 3300048908 Ga0496105_0069692 Ga0496105_0069692_478_852 124
1603 3300048908 Ga0496105_0204619 Ga0496105_0204619_65_439 124
1604 3300048909 Ga0496106_0169102 Ga0496106_0169102_940_1314 124
1605 3300048909 Ga0496106_0433338 Ga0496106_0433338_298_675 124
1606 3300048909 Ga0496106_0625231 Ga0496106_0625231_325_702 124
1607 3300048909 Ga0496106_0742049 Ga0496106_0742049_154_528 124
1608 3300048910 Ga0496107_0018477 Ga0496107_0018477_2651_3025 124
1609 3300048910 Ga0496107_0023742 Ga0496107_0023742_2263_2637 124
1610 3300048910 Ga0496107_0033346 Ga0496107_0033346_2138_2512 124
1611 3300048910 Ga0496107_0140243 Ga0496107_0140243_212_589 124
1612 3300048910 Ga0496107_0480403 Ga0496107_0480403_383_757 124
1613 3300048911 Ga0496108_0010462 Ga0496108_0010462_1574_1948 124
1614 3300048911 Ga0496108_0574227 Ga0496108_0574227_534_908 124
1615 3300048911 Ga0496108_0719853 Ga0496108_0719853_144_521 124
1616 3300048912 Ga0496109_0000445 Ga0496109_0000445_10277_10651 124
1617 3300048912 Ga0496109_0190345 Ga0496109_0190345_621_995 124
1618 3300048912 Ga0496109_0217162 Ga0496109_0217162_195_569 124
1619 3300048912 Ga0496109_1874503 Ga0496109_1874503_127_501 124
1620 3300048913 Ga0496110_0000079 Ga0496110_0000079_34919_35293 124
1621 3300048913 Ga0496110_0017812 Ga0496110_0017812_2407_2781 124
1622 3300048913 Ga0496110_0915272 Ga0496110_0915272_75_449 124
1623 3300048914 Ga0496111_0000557 Ga0496111_0000557_4102_4476 124
1624 3300048914 Ga0496111_0096517 Ga0496111_0096517_1443_1817 124
1625 3300048915 Ga0496112_0000007 Ga0496112_0000007_13529_13909 124
1626 3300048915 Ga0496112_0017728 Ga0496112_0017728_2911_3285 124
1627 3300048915 Ga0496112_1397289 Ga0496112_1397289_225_599 124
1628 3300048915 Ga0496112_1623170 Ga0496112_1623170_137_511 124
1629 3300048916 Ga0496113_0061383 Ga0496113_0061383_1775_2149 124
1630 3300048917 Ga0496114_0004840 Ga0496114_0004840_2062_2436 124
1631 3300048917 Ga0496114_0037031 Ga0496114_0037031_2703_3077 124
1632 3300048917 Ga0496114_0064981 Ga0496114_0064981_1213_1587 124
1633 3300048917 Ga0496114_0623169 Ga0496114_0623169_58_432 124
1634 3300048918 Ga0496115_0010379 Ga0496115_0010379_573_947 124
1635 3300048918 Ga0496115_0027891 Ga0496115_0027891_2002_2376 124
1636 3300048918 Ga0496115_0037851 Ga0496115_0037851_2930_3304 124
1637 3300048918 Ga0496115_0173105 Ga0496115_0173105_976_1350 124
1638 3300048919 Ga0496116_0073590 Ga0496116_0073590_251_625 124
1639 3300048920 Ga0496117_0085314 Ga0496117_0085314_1025_1399 124
1640 3300048920 Ga0496117_0294273 Ga0496117_0294273_426_800 124
1641 3300048921 Ga0496118_0005764 Ga0496118_0005764_3545_3919 124
1642 3300048921 Ga0496118_0194341 Ga0496118_0194341_781_1155 124
1643 3300048922 Ga0496119_0012846 Ga0496119_0012846_2566_2940 124
1644 3300048923 Ga0496120_0033281 Ga0496120_0033281_2203_2577 124
1645 3300048924 Ga0496121_0267441 Ga0496121_0267441_351_725 124
1646 3300048925 Ga0496122_0313017 Ga0496122_0313017_111_491 124
1647 3300048929 Ga0496126_0016860 Ga0496126_0016860_2154_2528 124
1648 3300048929 Ga0496126_0023859 Ga0496126_0023859_3501_3875 124
1649 3300048929 Ga0496126_0093794 Ga0496126_0093794_2246_2620 124
1650 3300049127 Ga0501306_015803 Ga0501306_015803_607_981 124
1651 3300049128 Ga0501308_008067 Ga0501308_008067_464_838 124
1652 3300049129 Ga0501309_033628 Ga0501309_033628_208_582 124
1653 3300049130 Ga0501310_007316 Ga0501310_007316_94_474 124
1654 3300049161 Ga0501305_018823 Ga0501305_018823_93_473 124
1655 3300049162 Ga0501307_059577 Ga0501307_059577_92_472 124
1656 3300049533 Ga0501317_013459 Ga0501317_013459_436_810 124
1657 3300049568 Ga0501031_0441178 Ga0501031_0441178_25_405 124
1658 3300049569 Ga0501032_0318392 Ga0501032_0318392_606_980 124
1659 3300049571 Ga0501034_0012529 Ga0501034_0012529_3739_4113 124
1660 3300049572 Ga0501036_0036626 Ga0501036_0036626_565_939 124
1661 3300049573 Ga0501037_0295303 Ga0501037_0295303_410_784 124
1662 3300049575 Ga0501039_0007709 Ga0501039_0007709_7340_7714 124
1663 3300049575 Ga0501039_0947982 Ga0501039_0947982_157_537 124
1664 3300049576 Ga0501040_0264550 Ga0501040_0264550_693_1067 124
1665 3300049576 Ga0501040_0541266 Ga0501040_0541266_158_535 124
1666 3300049577 Ga0501041_0038812 Ga0501041_0038812_502_876 124
1667 3300049577 Ga0501041_0470904 Ga0501041_0470904_62_442 124
1668 3300049578 Ga0501042_0514206 Ga0501042_0514206_264_641 124
1669 3300049579 Ga0501043_0022634 Ga0501043_0022634_2087_2461 124
1670 3300049579 Ga0501043_0386469 Ga0501043_0386469_559_933 124
1671 3300049583 Ga0501067_0265468 Ga0501067_0265468_516_899 124
1672 3300049583 Ga0501067_0379170 Ga0501067_0379170_149_523 124
1673 3300049585 Ga0501069_0023498 Ga0501069_0023498_2285_2659 124
1674 3300049585 Ga0501069_0120939 Ga0501069_0120939_1066_1446 124
1675 3300049585 Ga0501069_0625440 Ga0501069_0625440_252_626 124
1676 3300049586 Ga0501070_0003383 Ga0501070_0003383_6302_6676 124
1677 3300049586 Ga0501070_0005689 Ga0501070_0005689_7746_8120 124
1678 3300049587 Ga0501071_0000119 Ga0501071_0000119_17865_18239 124
1679 3300049587 Ga0501071_0001083 Ga0501071_0001083_1167_1541 124
1680 3300049587 Ga0501071_0013395 Ga0501071_0013395_2063_2437 124
1681 3300049587 Ga0501071_0594473 Ga0501071_0594473_201_575 124
1682 3300049587 Ga0501071_0649097 Ga0501071_0649097_295_672 124
1683 3300049588 Ga0501072_0391552 Ga0501072_0391552_301_675 124
1684 3300049589 Ga0501073_0050481 Ga0501073_0050481_1386_1760 124
1685 3300049589 Ga0501073_0348598 Ga0501073_0348598_300_674 124
1686 3300049590 Ga0501074_0219858 Ga0501074_0219858_415_789 124
1687 3300049590 Ga0501074_0460017 Ga0501074_0460017_49_423 124
1688 3300049591 Ga0501075_0003018 Ga0501075_0003018_4449_4823 124
1689 3300049591 Ga0501075_0417306 Ga0501075_0417306_356_730 124
1690 3300049592 Ga0501076_0011794 Ga0501076_0011794_1950_2324 124
1691 3300049592 Ga0501076_0025886 Ga0501076_0025886_3797_4171 124
1692 3300049592 Ga0501076_0395260 Ga0501076_0395260_666_1043 124
1693 3300049592 Ga0501076_0626588 Ga0501076_0626588_321_701 124
1694 3300049593 Ga0501077_0001393 Ga0501077_0001393_417_791 124
1695 3300049593 Ga0501077_0341118 Ga0501077_0341118_197_574 124
1696 3300049593 Ga0501077_0547376 Ga0501077_0547376_359_733 124
1697 3300049741 Ga0501079_0008393 Ga0501079_0008393_554_928 124
1698 3300049741 Ga0501079_0294174 Ga0501079_0294174_640_1020 124
1699 3300049741 Ga0501079_0721627 Ga0501079_0721627_373_747 124
1700 3300049742 Ga0501080_0058666 Ga0501080_0058666_242_616 124
1701 3300049742 Ga0501080_0208610 Ga0501080_0208610_701_1075 124
1702 3300049742 Ga0501080_0715172 Ga0501080_0715172_181_564 124
1703 3300049743 Ga0501081_0016532 Ga0501081_0016532_3420_3794 124
1704 3300049743 Ga0501081_0536745 Ga0501081_0536745_49_423 124
1705 3300049743 Ga0501081_1153071 Ga0501081_1153071_46_423 124
1706 3300049744 Ga0501083_0111389 Ga0501083_0111389_1031_1405 124
1707 3300049744 Ga0501083_0761909 Ga0501083_0761909_93_476 124
1708 3300049824 Ga0501045_0010860 Ga0501045_0010860_5454_5828 124
1709 3300049824 Ga0501045_0159456 Ga0501045_0159456_559_933 124
1710 3300050491 nmdc:mga00v17_41757_c1 nmdc:mga00v17_41757_c1_694_1068 124
1711 3300050492 nmdc:mga0yw44_18369_c1 nmdc:mga0yw44_18369_c1_1779_2153 124
1712 3300050492 nmdc:mga0yw44_310776_c1 nmdc:mga0yw44_310776_c1_472_846 124
1713 3300050492 nmdc:mga0yw44_47549_c1 nmdc:mga0yw44_47549_c1_321_695 124
1714 3300050494 nmdc:mga06z11_349474_c1 nmdc:mga06z11_349474_c1_403_777 124
1715 3300050496 nmdc:mga07m45_108234_c1 nmdc:mga07m45_108234_c1_381_755 124
1716 3300050507 nmdc:mga05p37_33875_c1 nmdc:mga05p37_33875_c1_2911_3288 124
1717 3300050507 nmdc:mga05p37_3540_c1 nmdc:mga05p37_3540_c1_304_678 124
1718 3300050508 nmdc:mga09592_208420_c2 nmdc:mga09592_208420_c2_165_542 124
1719 3300050508 nmdc:mga09592_51891_c1 nmdc:mga09592_51891_c1_32_406 124
1720 3300050510 nmdc:mga06r32_134251_c1 nmdc:mga06r32_134251_c1_1416_1790 124
1721 3300050511 nmdc:mga08y16_1246015_c1 nmdc:mga08y16_1246015_c1_98_472 124
1722 3300050511 nmdc:mga08y16_82947_c1 nmdc:mga08y16_82947_c1_674_1048 124
1723 3300050512 nmdc:mga0n895_1104575_c1 nmdc:mga0n895_1104575_c1_364_741 124
1724 3300050512 nmdc:mga0n895_279161_c1 nmdc:mga0n895_279161_c1_116_490 124
1725 3300050512 nmdc:mga0n895_363286_c1 nmdc:mga0n895_363286_c1_703_1080 124
1726 3300050512 nmdc:mga0n895_479689_c1 nmdc:mga0n895_479689_c1_417_791 124
1727 3300050512 nmdc:mga0n895_719278_c1 nmdc:mga0n895_719278_c1_99_473 124
1728 3300050513 nmdc:mga0rr50_199265_c1 nmdc:mga0rr50_199265_c1_27_410 124
1729 3300050513 nmdc:mga0rr50_368092_c1 nmdc:mga0rr50_368092_c1_664_1041 124
1730 3300050514 nmdc:mga08x19_367925_c1 nmdc:mga08x19_367925_c1_592_969 124
1731 3300050515 nmdc:mga0a205_1468245_c1 nmdc:mga0a205_1468245_c1_142_519 124
1732 3300050515 nmdc:mga0a205_2010_c1 nmdc:mga0a205_2010_c1_1484_1858 124
1733 3300050515 nmdc:mga0a205_25674_c1 nmdc:mga0a205_25674_c1_453_830 124
1734 3300050515 nmdc:mga0a205_271456_c1 nmdc:mga0a205_271456_c1_316_690 124
1735 3300050515 nmdc:mga0a205_327973_c1 nmdc:mga0a205_327973_c1_526_909 124
1736 3300053077 Ga0495601_0050354 Ga0495601_0050354_893_1345 124
1737 3300053077 Ga0495601_0073549 Ga0495601_0073549_811_1185 124
1738 3300053077 Ga0495601_0598805 Ga0495601_0598805_10_390 124
1739 3300053080 Ga0500635_0000204 Ga0500635_0000204_6676_7050 124
1740 3300053083 Ga0495655_0079213 Ga0495655_0079213_126_500 124
1741 3300053085 Ga0495619_0007866 Ga0495619_0007866_1004_1384 124
1742 3300054114 Ga0501084_0015419 Ga0501084_0015419_3298_3672 124
1743 3300059477 Ga0587084_008557 Ga0587084_008557_806_1180 124
1744 3300059491 Ga0587070_056270 Ga0587070_056270_250_630 124
1745 3300059491 Ga0587070_101553 Ga0587070_101553_191_574 124
1746 3300059492 Ga0587073_0070967 Ga0587073_0070967_453_827 124
1747 3300059503 Ga0587080_028007 Ga0587080_028007_219_593 124
1748 3300059503 Ga0587080_029121 Ga0587080_029121_451_825 124
1749 3300059503 Ga0587080_033122 Ga0587080_033122_453_827 124
1750 3300059503 Ga0587080_078742 Ga0587080_078742_251_631 124
1751 3300059503 Ga0587080_153072 Ga0587080_153072_126_500 124
1752 3300059504 Ga0587082_108034 Ga0587082_108034_118_492 124
1753 3300059505 Ga0587083_0003623 Ga0587083_0003623_289_663 124
1754 3300059505 Ga0587083_0122413 Ga0587083_0122413_175_552 124
1755 3300059508 Ga0587088_003103 Ga0587088_003103_670_1044 124
1756 3300059508 Ga0587088_061741 Ga0587088_061741_265_639 124
1757 3300059509 Ga0587089_015017 Ga0587089_015017_149_523 124
1758 3300059510 Ga0587090_021586 Ga0587090_021586_584_958 124
1759 3300059510 Ga0587090_034598 Ga0587090_034598_202_576 124
1760 3300059513 Ga0587094_126096 Ga0587094_126096_14_391 124
1761 3300059604 Ga0587098_037316 Ga0587098_037316_215_592 124
1762 3300059604 Ga0587098_088197 Ga0587098_088197_37_414 124
1763 3300059628 Ga0587122_000616 Ga0587122_000616_682_1056 124
1764 3300059630 Ga0587128_000395 Ga0587128_000395_2144_2518 124
1765 3300059630 Ga0587128_045034 Ga0587128_045034_173_547 124
1766 3300059630 Ga0587128_046109 Ga0587128_046109_214_591 124
1767 3300059640 Ga0587067_058027 Ga0587067_058027_415_792 124
1768 3300059640 Ga0587067_130653 Ga0587067_130653_36_416 124
1769 3300059641 Ga0587068_008623 Ga0587068_008623_514_891 124
1770 3300059642 Ga0587069_014182 Ga0587069_014182_238_612 124
1771 3300059643 Ga0587072_126320 Ga0587072_126320_175_558 124
1772 3300059644 Ga0587075_018259 Ga0587075_018259_468_848 124
1773 3300059644 Ga0587075_053703 Ga0587075_053703_60_509 124
1774 3300059645 Ga0587076_035987 Ga0587076_035987_396_776 124
1775 3300059647 Ga0587079_063562 Ga0587079_063562_413_790 124
1776 3300059649 Ga0587102_001277 Ga0587102_001277_958_1332 124
1777 3300059652 Ga0587107_104737 Ga0587107_104737_67_450 124
1778 3300059655 Ga0587114_009697 Ga0587114_009697_466_840 124
1779 3300060344 Ga0587071_074609 Ga0587071_074609_162_536 124
1780 3300060353 Ga0501082_0014508 Ga0501082_0014508_5272_5646 124
1781 3300061719 Ga0466962_0032211 Ga0466962_0032211_2047_2421 124
1782 3300061734 Ga0530510_0126308 Ga0530510_0126308_1237_1611 124
1783 3300061734 Ga0530510_0641936 Ga0530510_0641936_252_629 124

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00416

Ribosomal_S13

Ribosomal protein S13/S18

3

111

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1l2b-assembly1.cif.gz_A mutm (fpg) dna end-product structure 0.9115 25 58
3vk7-assembly2.cif.gz_B crystal structure of dna-glycosylase bound to dna containing 5-hydroxyuracil 0.9038 25 60
3a46-assembly2.cif.gz_B crystal structure of mvnei1/thf complex 0.9022 25 60
1l1z-assembly1.cif.gz_A mutm (fpg) covalent-dna intermediate 0.902 25 58
4nrw-assembly2.cif.gz_B mvnei1-g86d 0.9017 25 60
ID Description Score Start End Superfamily
1i94M01 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9273 14 63 1.10.8.50
af_Q8HCP0_1_71_1.10.8.50 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.903 1 70 1.10.8.50
af_P54019_1_77_1.10.8.50 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9012 2 60 1.10.8.50
af_A0A1D8PQQ5_1_82_1.10.8.50 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.8966 2 61 1.10.8.50
af_P9WH61_1_72_1.10.8.50 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.8963 1 71 1.10.8.50
ID Description Score Start End GO Terms
AF-A0A6A6K1H1-F1-model_v4 DNA-directed RNA polymerase (EC 2.7.7.6) (Plastid-encoded RNA polymerase subunit alpha) 0.9206 2 67 GO:0000428
GO:0001054
GO:0001055
GO:0001056
GO:0001057
GO:0001058
GO:0001065
GO:0001066
GO:0003677
GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:0019843
GO:0046983
GO:1990904
AF-M2S144-F1-model_v4 40S ribosomal protein S18 0.9139 1 61 GO:0003723
GO:0003735
GO:0005829
GO:0006412
GO:0015935
AF-A0A7C0UWM7-F1-model_v4 30S ribosomal protein S13 0.9136 2 60 GO:0003723
GO:0003735
GO:0005829
GO:0006412
GO:0015935
AF-A0A1J3D8M4-F1-model_v4 40S ribosomal protein S18 0.9114 2 62 GO:0003723
GO:0003735
GO:0005829
GO:0006412
GO:0015935
AF-A0A7I9XLN3-F1-model_v4 Small ribosomal subunit protein uS11 0.9052 3 67 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Feature Viewer

pLDDT pTM Quality
79.67 0.53 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map