F495333

General Info

Members Datasets Scaffolds Average Seq Length
1686 535 1686 126

Family's Representative Sequence

Representative Sequence 3300053087|Ga0500643_112762|Ga0500643_112762_199_663
Length 154
Sequence LETPFRRFSGASEQGMTARRSAACRNRSEVVARIAGVNIPTNKRVLIALQYIHGIGQKNAKDIMDKVHIPEDRRVSQLTDQEVLQIREVIDRDYMVEGDLRREVAVNIKRLMDLGCYRGLRHRKGLPVHGQRTHTNARTRKGPAKAIAGKKKTA

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
3 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
4 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
5 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
6 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
7 3300001430 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 Metagenome Rhizosphere
8 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
9 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
10 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
11 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
12 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
13 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
14 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
15 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
16 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
17 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
18 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
19 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
20 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
21 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
22 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
23 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
24 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
25 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
26 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
27 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
28 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
29 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
30 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
31 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
32 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
33 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
34 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
35 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
36 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
37 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
38 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
39 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
40 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
41 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
42 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
43 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
44 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
45 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
46 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
47 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
48 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
49 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
50 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
51 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
52 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
53 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
54 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
55 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
56 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
57 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
58 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
59 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
60 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
61 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
62 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
63 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
64 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
65 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
66 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
67 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
68 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
69 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
70 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
71 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
72 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
73 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
74 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
75 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
76 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
77 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
78 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
79 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
80 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
81 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
82 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
83 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
84 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
85 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
86 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
87 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
88 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
89 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
90 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
91 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
92 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
93 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
94 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
95 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
96 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
97 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
98 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
99 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
100 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
101 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
102 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
103 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
104 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
105 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
106 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
107 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
108 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
109 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
110 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
111 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
112 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
113 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
114 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
115 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
116 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
117 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
118 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
119 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
120 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
121 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
122 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
123 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
124 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
125 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
126 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
127 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
128 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
129 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
130 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
131 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
132 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
133 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
134 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
135 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
136 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
137 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
138 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
139 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
140 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
141 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
142 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
143 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
144 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
145 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
146 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
147 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
148 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
149 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
150 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
151 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
152 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
153 3300012473 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 Metagenome Rhizosphere
154 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
155 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
156 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
157 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
158 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
159 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
160 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
161 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
162 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
163 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
164 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
165 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
166 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
167 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
168 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
169 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
170 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
171 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
172 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
173 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
174 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
175 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
176 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
177 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
178 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
179 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
180 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
181 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
182 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
183 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
184 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
186 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
187 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
188 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
189 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
191 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
192 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
261 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
262 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
263 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
264 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
266 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
267 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
268 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
269 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
270 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
271 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
272 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
273 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
274 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
275 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
276 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
278 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
279 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
280 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
281 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
282 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
283 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
284 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
285 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
286 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
287 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
288 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
289 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
290 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
291 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
292 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
293 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
294 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
295 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
296 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
297 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
298 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
299 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
300 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
301 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
302 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
303 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
304 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
305 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
306 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
307 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
308 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
309 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
310 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
311 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
312 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
313 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
314 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
315 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
316 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
317 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
318 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
319 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
320 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
321 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
322 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
323 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
324 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
325 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
326 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
327 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
328 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
329 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
330 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
331 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
332 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
333 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
334 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
335 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
336 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
337 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
338 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
339 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
340 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
341 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
342 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
343 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
344 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
345 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
346 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
347 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
348 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
349 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
350 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
351 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
352 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
353 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
354 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
355 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
356 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
357 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
358 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
359 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
360 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
361 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
362 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
363 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
364 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
365 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
366 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
367 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
368 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
369 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
370 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
371 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
372 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
373 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
374 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
375 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
376 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
377 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
378 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
379 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
380 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
381 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
382 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
383 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
384 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
385 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
386 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
387 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
388 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
389 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
390 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
391 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
392 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
393 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
394 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
395 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
396 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
397 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
398 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
399 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
400 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
401 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
402 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
403 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
404 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
405 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
406 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
407 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
408 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
409 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
410 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
411 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
412 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
413 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
414 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
415 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
416 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
417 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
418 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
419 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
420 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
421 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
422 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
423 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
424 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
425 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
426 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
427 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
428 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
429 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
430 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
431 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
432 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
433 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
434 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
435 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
436 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
437 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
438 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
439 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
440 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
441 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
442 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
443 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
444 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
445 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
446 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
447 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
448 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
449 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
450 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
451 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
452 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
453 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
454 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
455 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
456 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
457 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
458 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
459 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
460 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
461 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
462 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
463 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
464 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
465 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
466 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
467 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
468 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
469 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
470 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
471 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
472 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
473 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
474 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
475 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
476 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
477 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
478 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
479 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
480 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
481 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
482 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
483 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
484 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
485 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
486 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
487 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
488 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
489 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
490 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
491 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
492 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
493 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
494 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
495 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
496 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
497 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
498 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
499 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
500 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
501 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
502 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
503 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
504 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
505 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
506 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
507 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
508 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
509 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
510 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
511 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
512 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
513 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
514 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
515 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
516 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
517 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
518 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
519 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
520 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
521 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
522 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
523 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
524 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
525 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
526 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
527 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
528 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
529 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
530 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
531 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
532 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
533 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
534 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
535 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.64
Metatranscriptomes 1.36
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.2
Nodule 0
Rhizoplane 6.29
Rhizosphere 89.38
Stem 0
Stem Tuber 0
Unclassified 1.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214828544 2209111006 Bacteria 9115
2 ARSoilYngRDRAFT_c00061 3300000042 Bacteria 17682
3 ARcpr5yngRDRAFT_c000075 3300000043 Bacteria 16570
4 ARSoilOldRDRAFT_c000053 3300000044 Bacteria 23841
5 ARCol0oldRDRAFT_c00087 3300000045 Bacteria 7959
6 ARCol0yngRDRAFT_1000025 3300000652 Bacteria 26845
7 JGI24032J14994_100056 3300001430 Bacteria 4583
8 JGI24741J21665_1021617 3300001915 Bacteria 1003
9 JGI24746J21847_1002046 3300001977 Bacteria 3222
10 JGI24747J21853_1011054 3300001978 Bacteria 910
11 JGI24739J22299_10019550 3300001989 Bacteria 2423
12 JGI24737J22298_10019784 3300001990 Bacteria 2152
13 JGI24737J22298_10034285 3300001990 Bacteria 1574
14 JGI24743J22301_10018255 3300001991 Bacteria 1324
15 JGI24743J22301_10048881 3300001991 Bacteria 859
16 JGI24735J21928_10183634 3300002067 Bacteria 606
17 JGI24750J21931_1000316 3300002070 Bacteria 8271
18 JGI24750J21931_1039382 3300002070 Bacteria 715
19 JGI24745J21846_1000643 3300002073 Bacteria 3139
20 JGI24748J21848_1006811 3300002074 Bacteria 1335
21 JGI24748J21848_1016126 3300002074 Bacteria 892
22 JGI24738J21930_10002068 3300002075 Bacteria 5382
23 JGI24749J21850_1001860 3300002076 Bacteria 2985
24 JGI24749J21850_1007303 3300002076 Bacteria 1540
25 JGI24749J21850_1016726 3300002076 Bacteria 1031
26 JGI24035J26624_1000222 3300002126 Bacteria 5221
27 JGI24033J26618_1006577 3300002155 Bacteria 1308
28 JGI24034J26672_10000885 3300002239 Bacteria 3903
29 JGI24742J22300_10001777 3300002244 Bacteria 3440
30 JGI25153J46596_10000830 3300003215 Bacteria 18874
31 JGI25153J46596_10012702 3300003215 Bacteria 3610
32 JGI25153J46596_10095157 3300003215 Bacteria 711
33 JGI26129J50193_1004460 3300003349 Bacteria 991
34 Ga0058862_12620432 3300004803 Bacteria 719
35 Ga0058862_12749426 3300004803 Bacteria 864
36 Ga0065716_1001548 3300005277 Bacteria 7149
37 Ga0065704_10136765 3300005289 Bacteria 1555
38 Ga0065712_10097334 3300005290 Bacteria 2154
39 Ga0065712_10154053 3300005290 Bacteria 1348
40 Ga0065712_10481422 3300005290 Bacteria 663
41 Ga0065715_10002477 3300005293 Bacteria 7875
42 Ga0065715_10137215 3300005293 Bacteria 1910
43 Ga0065707_10221977 3300005295 Bacteria 1221
44 Ga0070658_10032170 3300005327 Bacteria 4218
45 Ga0070676_10002419 3300005328 Bacteria 9571
46 Ga0070676_10069041 3300005328 Bacteria 2117
47 Ga0070676_10426446 3300005328 Bacteria 928
48 Ga0070683_100001083 3300005329 Bacteria 20468
49 Ga0070683_100016861 3300005329 Bacteria 6444
50 Ga0070683_100287619 3300005329 Bacteria 1563
51 Ga0070690_100018877 3300005330 Bacteria 4175
52 Ga0070690_100101714 3300005330 Bacteria 1906
53 Ga0070690_100193783 3300005330 Bacteria 1410
54 Ga0070670_100016356 3300005331 Bacteria 6370
55 Ga0070670_100620526 3300005331 Bacteria 968
56 Ga0070677_10000959 3300005333 Bacteria 9319
57 Ga0068869_100000755 3300005334 Bacteria 18338
58 Ga0068869_100772730 3300005334 Bacteria 824
59 Ga0070666_10127070 3300005335 Bacteria 1770
60 Ga0070680_100005733 3300005336 Bacteria 9421
61 Ga0070680_100006856 3300005336 Bacteria 8685
62 Ga0070680_100082555 3300005336 Bacteria 2653
63 Ga0070680_100109472 3300005336 Bacteria 2299
64 Ga0070680_100262774 3300005336 Bacteria 1460
65 Ga0070680_100460180 3300005336 Bacteria 1087
66 Ga0070680_101004180 3300005336 Bacteria 721
67 Ga0070682_100001636 3300005337 Bacteria 12449
68 Ga0070682_100038516 3300005337 Bacteria 2932
69 Ga0070682_100057704 3300005337 Bacteria 2446
70 Ga0070682_100721536 3300005337 Bacteria 801
71 Ga0068868_100006260 3300005338 Bacteria 8418
72 Ga0068868_100109693 3300005338 Bacteria 2241
73 Ga0068868_100134916 3300005338 Bacteria 2022
74 Ga0070660_100000245 3300005339 Bacteria 35915
75 Ga0070660_100015793 3300005339 Bacteria 5462
76 Ga0070660_100023815 3300005339 Bacteria 4538
77 Ga0070660_100036932 3300005339 Bacteria 3702
78 Ga0070660_100341261 3300005339 Bacteria 1232
79 Ga0070689_100005690 3300005340 Bacteria 8547
80 Ga0070689_100011434 3300005340 Bacteria 6358
81 Ga0070689_100258407 3300005340 Bacteria 1439
82 Ga0070691_10000386 3300005341 Bacteria 16019
83 Ga0070691_10002710 3300005341 Bacteria 7884
84 Ga0070691_10047921 3300005341 Bacteria 2032
85 Ga0070691_10496796 3300005341 Bacteria 704
86 Ga0070687_100000348 3300005343 Bacteria 15751
87 Ga0070687_100104754 3300005343 Bacteria 1590
88 Ga0070687_100928955 3300005343 Bacteria 626
89 Ga0070661_100000017 3300005344 Bacteria 153232
90 Ga0070661_100028862 3300005344 Bacteria 4003
91 Ga0070661_100252395 3300005344 Bacteria 1361
92 Ga0070661_100318049 3300005344 Bacteria 1215
93 Ga0070661_100353327 3300005344 Bacteria 1153
94 Ga0070661_101243042 3300005344 Bacteria 624
95 Ga0070692_10000101 3300005345 Bacteria 19118
96 Ga0070692_10618397 3300005345 Bacteria 719
97 Ga0070668_100054011 3300005347 Bacteria 3098
98 Ga0070668_100060030 3300005347 Bacteria 2944
99 Ga0070668_100078969 3300005347 Bacteria 2575
100 Ga0070669_100000314 3300005353 Bacteria 37924
101 Ga0070669_100349101 3300005353 Bacteria 1200
102 Ga0070675_100000161 3300005354 Bacteria 40950
103 Ga0070675_100074637 3300005354 Bacteria 2818
104 Ga0070675_100134504 3300005354 Bacteria 2109
105 Ga0070675_100276441 3300005354 Bacteria 1475
106 Ga0070671_100012885 3300005355 Bacteria 6741
107 Ga0070671_100259246 3300005355 Bacteria 1477
108 Ga0070674_100114332 3300005356 Bacteria 1987
109 Ga0070674_100428072 3300005356 Bacteria 1087
110 Ga0070673_100018429 3300005364 Bacteria 4985
111 Ga0070673_100049760 3300005364 Bacteria 3273
112 Ga0070673_100060499 3300005364 Bacteria 3001
113 Ga0070673_100076967 3300005364 Bacteria 2695
114 Ga0070673_100147687 3300005364 Bacteria 1989
115 Ga0070673_100301046 3300005364 Bacteria 1412
116 Ga0070688_100000991 3300005365 Bacteria 14237
117 Ga0070688_100004219 3300005365 Bacteria 7469
118 Ga0070688_100140355 3300005365 Bacteria 1640
119 Ga0070688_100152668 3300005365 Bacteria 1580
120 Ga0070659_100087845 3300005366 Bacteria 2489
121 Ga0070659_100173698 3300005366 Bacteria 1766
122 Ga0070659_100224119 3300005366 Bacteria 1553
123 Ga0070659_100680564 3300005366 Bacteria 888
124 Ga0070667_100006114 3300005367 Bacteria 10001
125 Ga0070667_100026201 3300005367 Bacteria 4849
126 Ga0070667_100085289 3300005367 Bacteria 2708
127 Ga0070667_100239074 3300005367 Bacteria 1621
128 Ga0070667_100281389 3300005367 Bacteria 1493
129 Ga0070703_10033785 3300005406 Bacteria 1558
130 Ga0070703_10339604 3300005406 Bacteria 638
131 Ga0070709_10003934 3300005434 Bacteria 8011
132 Ga0070709_10038757 3300005434 Bacteria 2920
133 Ga0070709_10053838 3300005434 Bacteria 2535
134 Ga0070709_10061805 3300005434 Bacteria 2386
135 Ga0070709_10131938 3300005434 Bacteria 1707
136 Ga0070709_10645083 3300005434 Bacteria 819
137 Ga0070714_100020676 3300005435 Bacteria 5379
138 Ga0070714_100222884 3300005435 Bacteria 1734
139 Ga0070714_100488848 3300005435 Bacteria 1173
140 Ga0070714_101006647 3300005435 Bacteria 811
141 Ga0070713_100001694 3300005436 Bacteria 14164
142 Ga0070713_100003041 3300005436 Bacteria 11020
143 Ga0070713_100015926 3300005436 Bacteria 5639
144 Ga0070713_100160468 3300005436 Bacteria 2006
145 Ga0070713_100178759 3300005436 Bacteria 1905
146 Ga0070713_100226838 3300005436 Bacteria 1696
147 Ga0070713_100242746 3300005436 Bacteria 1641
148 Ga0070713_100352058 3300005436 Bacteria 1367
149 Ga0070710_10015917 3300005437 Bacteria 3815
150 Ga0070710_10034381 3300005437 Bacteria 2757
151 Ga0070710_10066577 3300005437 Bacteria 2066
152 Ga0070710_10163657 3300005437 Bacteria 1381
153 Ga0070710_10394949 3300005437 Bacteria 926
154 Ga0070701_10000204 3300005438 Bacteria 18457
155 Ga0070701_10012407 3300005438 Bacteria 3843
156 Ga0070701_10466967 3300005438 Bacteria 813
157 Ga0070711_100007210 3300005439 Bacteria 6753
158 Ga0070711_100027936 3300005439 Bacteria 3708
159 Ga0070711_100056777 3300005439 Bacteria 2709
160 Ga0070711_100065901 3300005439 Bacteria 2535
161 Ga0070711_100196758 3300005439 Bacteria 1553
162 Ga0070711_100491404 3300005439 Bacteria 1010
163 Ga0070705_100004847 3300005440 Bacteria 6546
164 Ga0070705_100049688 3300005440 Bacteria 2436
165 Ga0070705_100396479 3300005440 Bacteria 1021
166 Ga0070700_100000856 3300005441 Bacteria 15021
167 Ga0070700_100194781 3300005441 Bacteria 1419
168 Ga0070700_100309989 3300005441 Bacteria 1155
169 Ga0070694_100021165 3300005444 Bacteria 4152
170 Ga0070694_100682990 3300005444 Bacteria 834
171 Ga0070708_100050068 3300005445 Bacteria 3698
172 Ga0070663_100000945 3300005455 Bacteria 15785
173 Ga0070663_100017856 3300005455 Bacteria 4637
174 Ga0070663_100048584 3300005455 Bacteria 3009
175 Ga0070663_100185939 3300005455 Bacteria 1614
176 Ga0070663_100775360 3300005455 Bacteria 820
177 Ga0070663_101097129 3300005455 Bacteria 696
178 Ga0070678_100007929 3300005456 Bacteria 6324
179 Ga0070678_100028978 3300005456 Bacteria 3784
180 Ga0070678_100132698 3300005456 Bacteria 1981
181 Ga0070678_100495806 3300005456 Bacteria 1077
182 Ga0070662_100026862 3300005457 Bacteria 3990
183 Ga0070662_100042156 3300005457 Bacteria 3259
184 Ga0070662_100506425 3300005457 Bacteria 1007
185 Ga0070681_10004121 3300005458 Bacteria 13747
186 Ga0070681_10005192 3300005458 Bacteria 12569
187 Ga0070681_10019257 3300005458 Bacteria 6829
188 Ga0070681_10045790 3300005458 Bacteria 4375
189 Ga0070681_10141034 3300005458 Bacteria 2340
190 Ga0070681_10210732 3300005458 Bacteria 1859
191 Ga0070681_10308652 3300005458 Bacteria 1491
192 Ga0070681_10676177 3300005458 Bacteria 947
193 Ga0068867_100002227 3300005459 Bacteria 13620
194 Ga0068867_100104555 3300005459 Bacteria 2167
195 Ga0070685_10019677 3300005466 Bacteria 3646
196 Ga0070685_10088882 3300005466 Bacteria 1867
197 Ga0070685_10284367 3300005466 Bacteria 1108
198 Ga0070685_10504412 3300005466 Bacteria 857
199 Ga0070706_100252183 3300005467 Bacteria 1647
200 Ga0070707_100343335 3300005468 Bacteria 1450
201 Ga0070698_100892384 3300005471 Bacteria 834
202 Ga0070698_101241090 3300005471 Bacteria 695
203 Ga0070699_100260514 3300005518 Bacteria 1551
204 Ga0070699_101395070 3300005518 Bacteria 643
205 Ga0070699_101775677 3300005518 Bacteria 565
206 Ga0070679_100008686 3300005530 Bacteria 9577
207 Ga0070679_100059322 3300005530 Bacteria 3814
208 Ga0070679_100075114 3300005530 Bacteria 3370
209 Ga0070679_100104463 3300005530 Bacteria 2819
210 Ga0070679_100142711 3300005530 Bacteria 2373
211 Ga0070679_100358533 3300005530 Bacteria 1406
212 Ga0070679_100517168 3300005530 Bacteria 1137
213 Ga0070684_100000365 3300005535 Bacteria 31110
214 Ga0070684_100113259 3300005535 Bacteria 2434
215 Ga0070684_100150473 3300005535 Bacteria 2108
216 Ga0070684_100220453 3300005535 Bacteria 1731
217 Ga0070697_100654122 3300005536 Bacteria 926
218 Ga0068853_100002095 3300005539 Bacteria 14797
219 Ga0068853_100002660 3300005539 Bacteria 13466
220 Ga0068853_100098304 3300005539 Bacteria 2584
221 Ga0068853_100108708 3300005539 Bacteria 2460
222 Ga0068853_100337036 3300005539 Bacteria 1401
223 Ga0070672_100049173 3300005543 Bacteria 3279
224 Ga0070672_100289492 3300005543 Bacteria 1386
225 Ga0070672_100799995 3300005543 Bacteria 829
226 Ga0070686_100002828 3300005544 Bacteria 9562
227 Ga0070686_100078063 3300005544 Bacteria 2185
228 Ga0070686_100426219 3300005544 Bacteria 1015
229 Ga0070686_100445279 3300005544 Bacteria 994
230 Ga0070686_100692544 3300005544 Bacteria 812
231 Ga0070695_100009518 3300005545 Bacteria 5789
232 Ga0070695_100012934 3300005545 Bacteria 5010
233 Ga0070695_100048370 3300005545 Bacteria 2719
234 Ga0070695_100090371 3300005545 Bacteria 2043
235 Ga0070696_100023478 3300005546 Bacteria 4192
236 Ga0070696_100152460 3300005546 Bacteria 1697
237 Ga0070696_101281157 3300005546 Bacteria 622
238 Ga0070696_101349775 3300005546 Bacteria 606
239 Ga0070693_100000905 3300005547 Bacteria 13209
240 Ga0070693_100025605 3300005547 Bacteria 3177
241 Ga0070693_100072749 3300005547 Bacteria 2028
242 Ga0070693_100119332 3300005547 Bacteria 1633
243 Ga0070693_100236837 3300005547 Bacteria 1204
244 Ga0070693_100319006 3300005547 Bacteria 1053
245 Ga0070693_100454253 3300005547 Bacteria 900
246 Ga0070693_100765753 3300005547 Bacteria 713
247 Ga0070665_100165224 3300005548 Bacteria 2216
248 Ga0070665_100391897 3300005548 Bacteria 1397
249 Ga0070665_101154306 3300005548 Bacteria 786
250 Ga0070665_101655400 3300005548 Bacteria 647
251 Ga0070665_102072235 3300005548 Bacteria 574
252 Ga0070704_100001366 3300005549 Bacteria 12945
253 Ga0070704_100021937 3300005549 Bacteria 4148
254 Ga0070704_100912527 3300005549 Bacteria 791
255 Ga0070704_101391183 3300005549 Bacteria 643
256 Ga0068855_100023189 3300005563 Bacteria 7435
257 Ga0068855_100030257 3300005563 Bacteria 6476
258 Ga0068855_100053934 3300005563 Bacteria 4729
259 Ga0068855_100076351 3300005563 Bacteria 3889
260 Ga0068855_100111493 3300005563 Bacteria 3140
261 Ga0070664_100002074 3300005564 Bacteria 16005
262 Ga0070664_100051635 3300005564 Bacteria 3481
263 Ga0068857_100003594 3300005577 Bacteria 12976
264 Ga0068857_100038829 3300005577 Bacteria 4216
265 Ga0068857_100079337 3300005577 Bacteria 2930
266 Ga0068857_100700986 3300005577 Bacteria 962
267 Ga0068854_100000749 3300005578 Bacteria 19195
268 Ga0068854_100149360 3300005578 Bacteria 1800
269 Ga0068854_100280698 3300005578 Bacteria 1341
270 Ga0068854_100530192 3300005578 Bacteria 996
271 Ga0068854_100851709 3300005578 Bacteria 798
272 Ga0068856_100000902 3300005614 Bacteria 31812
273 Ga0068856_100002049 3300005614 Bacteria 20920
274 Ga0068856_100109437 3300005614 Bacteria 2759
275 Ga0068856_100264284 3300005614 Bacteria 1736
276 Ga0068856_100307468 3300005614 Bacteria 1603
277 Ga0068856_100426777 3300005614 Bacteria 1346
278 Ga0068856_100826939 3300005614 Bacteria 945
279 Ga0070702_100007363 3300005615 Bacteria 5266
280 Ga0070702_100115751 3300005615 Bacteria 1670
281 Ga0070702_100302148 3300005615 Bacteria 1108
282 Ga0070702_101456277 3300005615 Bacteria 562
283 Ga0068852_100004111 3300005616 Bacteria 10239
284 Ga0068852_100278911 3300005616 Bacteria 1610
285 Ga0068852_100336671 3300005616 Bacteria 1470
286 Ga0068852_100817534 3300005616 Bacteria 947
287 Ga0068859_100006839 3300005617 Bacteria 11585
288 Ga0068859_100151443 3300005617 Bacteria 2395
289 Ga0068859_100188199 3300005617 Bacteria 2148
290 Ga0068859_100696719 3300005617 Bacteria 1106
291 Ga0068864_100000595 3300005618 Bacteria 30701
292 Ga0068864_100801079 3300005618 Bacteria 926
293 Ga0068864_100888443 3300005618 Bacteria 879
294 Ga0068864_100981964 3300005618 Bacteria 837
295 Ga0068864_101062893 3300005618 Bacteria 804
296 Ga0068864_101502968 3300005618 Bacteria 676
297 Ga0068866_10000834 3300005718 Bacteria 13673
298 Ga0068866_10673148 3300005718 Bacteria 707
299 Ga0068861_100000825 3300005719 Bacteria 18722
300 Ga0068861_100102398 3300005719 Bacteria 2279
301 Ga0068861_100224439 3300005719 Bacteria 1590
302 Ga0068851_10294186 3300005834 Bacteria 932
303 Ga0068870_10000112 3300005840 Bacteria 27710
304 Ga0068863_100012849 3300005841 Bacteria 8075
305 Ga0068863_101669683 3300005841 Bacteria 646
306 Ga0068858_100025610 3300005842 Bacteria 5489
307 Ga0068858_100042730 3300005842 Bacteria 4202
308 Ga0068858_100064539 3300005842 Bacteria 3389
309 Ga0068858_100112861 3300005842 Bacteria 2538
310 Ga0068858_100521962 3300005842 Bacteria 1148
311 Ga0068858_100875977 3300005842 Bacteria 877
312 Ga0068860_100070125 3300005843 Bacteria 3332
313 Ga0068860_100103943 3300005843 Bacteria 2711
314 Ga0068860_100121365 3300005843 Bacteria 2502
315 Ga0068860_100121893 3300005843 Bacteria 2497
316 Ga0068860_100539527 3300005843 Bacteria 1168
317 Ga0068862_100004649 3300005844 Bacteria 11570
318 Ga0068862_100030534 3300005844 Bacteria 4542
319 Ga0081455_10000048 3300005937 Bacteria 126551
320 Ga0081455_10002425 3300005937 Bacteria 22245
321 Ga0081455_10079670 3300005937 Bacteria 2688
322 Ga0081455_10094886 3300005937 Bacteria 2409
323 Ga0081538_10165839 3300005981 Bacteria 973
324 Ga0081540_1135422 3300005983 Bacteria 998
325 Ga0081539_10054428 3300005985 Bacteria 2234
326 Ga0070717_10007139 3300006028 Bacteria 8279
327 Ga0070717_10044826 3300006028 Bacteria 3614
328 Ga0070717_10123210 3300006028 Bacteria 2223
329 Ga0070717_10193261 3300006028 Bacteria 1779
330 Ga0070717_10203149 3300006028 Bacteria 1736
331 Ga0070717_10369763 3300006028 Bacteria 1284
332 Ga0070717_10554722 3300006028 Bacteria 1041
333 Ga0075365_10187528 3300006038 Bacteria 1447
334 Ga0075365_10303004 3300006038 Bacteria 1125
335 Ga0075365_10541360 3300006038 Bacteria 823
336 Ga0075365_10649278 3300006038 Bacteria 746
337 Ga0075368_10162971 3300006042 Bacteria 935
338 Ga0075364_10214500 3300006051 Bacteria 1305
339 Ga0075432_10070274 3300006058 Bacteria 1257
340 Ga0070715_10002476 3300006163 Bacteria 5677
341 Ga0070715_10051947 3300006163 Bacteria 1766
342 Ga0070716_100000346 3300006173 Bacteria 18854
343 Ga0070712_100123232 3300006175 Bacteria 1954
344 Ga0070712_100188090 3300006175 Bacteria 1614
345 Ga0070712_100305744 3300006175 Bacteria 1288
346 Ga0070712_100332996 3300006175 Bacteria 1237
347 Ga0070712_100421841 3300006175 Bacteria 1106
348 Ga0075362_10073846 3300006177 Bacteria 1562
349 Ga0075362_10240335 3300006177 Bacteria 889
350 Ga0075367_10061301 3300006178 Bacteria 2245
351 Ga0075367_10156657 3300006178 Bacteria 1415
352 Ga0075367_10260480 3300006178 Bacteria 1088
353 Ga0075427_10003839 3300006194 Bacteria 2097
354 Ga0075366_10038100 3300006195 Bacteria 2839
355 Ga0075366_10069373 3300006195 Bacteria 2098
356 Ga0075366_10731434 3300006195 Bacteria 615
357 Ga0097621_100000600 3300006237 Bacteria 25393
358 Ga0097621_100008260 3300006237 Bacteria 7491
359 Ga0097621_100083524 3300006237 Bacteria 2661
360 Ga0068871_100000118 3300006358 Bacteria 49211
361 Ga0068871_100003511 3300006358 Bacteria 10792
362 Ga0068871_100068572 3300006358 Bacteria 2912
363 Ga0075428_100006364 3300006844 Bacteria 13140
364 Ga0075428_100414073 3300006844 Bacteria 1444
365 Ga0075430_100000196 3300006846 Bacteria 40930
366 Ga0075431_100001183 3300006847 Bacteria 23547
367 Ga0075431_100030686 3300006847 Bacteria 5537
368 Ga0075433_10000991 3300006852 Bacteria 20176
369 Ga0075433_10058749 3300006852 Bacteria 3364
370 Ga0075433_10138919 3300006852 Bacteria 2160
371 Ga0075434_100006955 3300006871 Bacteria 10427
372 Ga0075434_100080382 3300006871 Bacteria 3256
373 Ga0075434_100156845 3300006871 Bacteria 2295
374 Ga0075434_100165496 3300006871 Bacteria 2231
375 Ga0075434_100622169 3300006871 Bacteria 1098
376 Ga0075434_100876859 3300006871 Bacteria 912
377 Ga0075434_101523690 3300006871 Bacteria 678
378 Ga0075429_100000573 3300006880 Bacteria 28269
379 Ga0068865_100002402 3300006881 Bacteria 11045
380 Ga0068865_100205807 3300006881 Bacteria 1530
381 Ga0068865_100909877 3300006881 Bacteria 766
382 Ga0075436_100050481 3300006914 Bacteria 2871
383 Ga0075436_100067120 3300006914 Bacteria 2479
384 Ga0075436_100248187 3300006914 Bacteria 1267
385 Ga0075436_100746364 3300006914 Bacteria 727
386 Ga0097620_100006838 3300006931 Bacteria 11585
387 Ga0097620_100151443 3300006931 Bacteria 2395
388 Ga0097620_100188203 3300006931 Bacteria 2148
389 Ga0097620_100696733 3300006931 Bacteria 1106
390 Ga0097620_101682728 3300006931 Bacteria 701
391 Ga0075435_100026184 3300007076 Bacteria 4547
392 Ga0075435_100065161 3300007076 Bacteria 2961
393 Ga0075435_100133219 3300007076 Bacteria 2080
394 Ga0075435_100136316 3300007076 Bacteria 2057
395 Ga0075435_101349340 3300007076 Bacteria 625
396 Ga0099794_10036846 3300007265 Bacteria 2314
397 Ga0099795_10096832 3300007788 Bacteria 1152
398 Ga0105251_10049977 3300009011 Bacteria 1999
399 Ga0105240_10001231 3300009093 Bacteria 44471
400 Ga0105240_10015848 3300009093 Bacteria 10226
401 Ga0105240_10029762 3300009093 Bacteria 7106
402 Ga0105240_10189209 3300009093 Bacteria 2421
403 Ga0105240_10322237 3300009093 Bacteria 1761
404 Ga0111539_10000683 3300009094 Bacteria 43914
405 Ga0111539_10004804 3300009094 Bacteria 17625
406 Ga0111539_10106813 3300009094 Bacteria 3284
407 Ga0111539_10619937 3300009094 Bacteria 1260
408 Ga0111539_11562896 3300009094 Bacteria 765
409 Ga0111539_12069171 3300009094 Bacteria 660
410 Ga0105245_10001982 3300009098 Bacteria 18594
411 Ga0105245_10032623 3300009098 Bacteria 4610
412 Ga0105245_10064026 3300009098 Bacteria 3323
413 Ga0105245_10069436 3300009098 Bacteria 3195
414 Ga0105245_10833457 3300009098 Bacteria 962
415 Ga0105245_10880734 3300009098 Bacteria 936
416 Ga0105247_10024545 3300009101 Bacteria 3634
417 Ga0105247_10405179 3300009101 Bacteria 973
418 Ga0105247_10672767 3300009101 Bacteria 776
419 Ga0105247_11052898 3300009101 Bacteria 639
420 Ga0114129_10008352 3300009147 Bacteria 14760
421 Ga0114129_10056000 3300009147 Bacteria 5525
422 Ga0114129_10365952 3300009147 Bacteria 1907
423 Ga0114129_10519926 3300009147 Bacteria 1552
424 Ga0114129_10912257 3300009147 Bacteria 1112
425 Ga0114129_11186942 3300009147 Bacteria 951
426 Ga0114129_11380762 3300009147 Bacteria 870
427 Ga0105243_10002278 3300009148 Bacteria 16096
428 Ga0105243_10107190 3300009148 Bacteria 2330
429 Ga0105243_10116075 3300009148 Bacteria 2248
430 Ga0105243_10244414 3300009148 Bacteria 1599
431 Ga0105243_11548818 3300009148 Bacteria 688
432 Ga0105243_11864334 3300009148 Bacteria 633
433 Ga0105241_10015281 3300009174 Bacteria 5623
434 Ga0105241_10019842 3300009174 Bacteria 4961
435 Ga0105241_10060378 3300009174 Bacteria 2917
436 Ga0105241_10116351 3300009174 Bacteria 2147
437 Ga0105241_10619995 3300009174 Bacteria 979
438 Ga0105242_10009023 3300009176 Bacteria 7661
439 Ga0105242_10033184 3300009176 Bacteria 4132
440 Ga0105242_10105043 3300009176 Bacteria 2398
441 Ga0105242_10434627 3300009176 Bacteria 1233
442 Ga0105248_10078593 3300009177 Bacteria 3708
443 Ga0105248_10118525 3300009177 Bacteria 2986
444 Ga0105248_10311914 3300009177 Bacteria 1772
445 Ga0105248_10640192 3300009177 Bacteria 1200
446 Ga0105248_10974446 3300009177 Bacteria 958
447 Ga0105248_11046118 3300009177 Bacteria 922
448 Ga0105248_12079175 3300009177 Bacteria 646
449 Ga0105237_10003253 3300009545 Bacteria 19420
450 Ga0105237_10199230 3300009545 Bacteria 2002
451 Ga0105237_11107575 3300009545 Bacteria 799
452 Ga0105238_10001939 3300009551 Bacteria 20807
453 Ga0105238_10125323 3300009551 Bacteria 2548
454 Ga0105238_10311988 3300009551 Bacteria 1558
455 Ga0105238_10329696 3300009551 Bacteria 1513
456 Ga0105238_10402467 3300009551 Bacteria 1362
457 Ga0105238_11668683 3300009551 Bacteria 668
458 Ga0105249_10001021 3300009553 Bacteria 24754
459 Ga0105249_10097100 3300009553 Bacteria 2765
460 Ga0105249_10399539 3300009553 Bacteria 1404
461 Ga0105249_11874339 3300009553 Bacteria 672
462 Ga0105035_124906 3300009988 Bacteria 576
463 Ga0105239_10024925 3300010375 Bacteria 6588
464 Ga0105239_10053067 3300010375 Bacteria 4447
465 Ga0105239_10071533 3300010375 Bacteria 3810
466 Ga0105239_10918552 3300010375 Bacteria 1005
467 Ga0105239_11000590 3300010375 Bacteria 961
468 Ga0105239_11100845 3300010375 Bacteria 914
469 Ga0105239_11672828 3300010375 Bacteria 736
470 Ga0105239_11676315 3300010375 Bacteria 736
471 Ga0105239_12004665 3300010375 Bacteria 672
472 Ga0105246_10007532 3300011119 Bacteria 6678
473 Ga0105246_10034231 3300011119 Bacteria 3383
474 Ga0105246_10133537 3300011119 Bacteria 1857
475 Ga0105246_10199036 3300011119 Bacteria 1556
476 Ga0105246_10533487 3300011119 Bacteria 1003
477 Ga0105246_10963115 3300011119 Bacteria 770
478 Ga0105246_11375884 3300011119 Bacteria 657
479 Ga0157340_1002355 3300012473 Bacteria 957
480 Ga0157340_1005064 3300012473 Bacteria 785
481 Ga0157317_1006105 3300012475 Bacteria 832
482 Ga0157337_1001743 3300012483 Bacteria 1161
483 Ga0157335_1001290 3300012492 Bacteria 1348
484 Ga0157319_1000744 3300012497 Bacteria 1525
485 Ga0157314_1004810 3300012500 Bacteria 1005
486 Ga0157347_1033880 3300012502 Bacteria 651
487 Ga0157316_1009216 3300012510 Bacteria 881
488 Ga0157326_1014555 3300012513 Bacteria 916
489 Ga0157373_10000820 3300013100 Bacteria 24076
490 Ga0157373_10038612 3300013100 Bacteria 3422
491 Ga0157373_10087904 3300013100 Bacteria 2190
492 Ga0157373_10230947 3300013100 Bacteria 1306
493 Ga0157373_10290017 3300013100 Bacteria 1160
494 Ga0157373_10779500 3300013100 Bacteria 704
495 Ga0157373_11315958 3300013100 Bacteria 547
496 Ga0157371_10056689 3300013102 Bacteria 2779
497 Ga0157371_10107692 3300013102 Bacteria 1978
498 Ga0157371_10363406 3300013102 Bacteria 1055
499 Ga0157371_10567848 3300013102 Bacteria 842
500 Ga0157370_10003448 3300013104 Bacteria 18559
501 Ga0157370_10140736 3300013104 Bacteria 2248
502 Ga0157370_10335875 3300013104 Bacteria 1393
503 Ga0157370_10697307 3300013104 Bacteria 927
504 Ga0157369_10001535 3300013105 Bacteria 28280
505 Ga0157369_10202540 3300013105 Bacteria 2083
506 Ga0157369_11317466 3300013105 Bacteria 736
507 Ga0157369_12025311 3300013105 Bacteria 584
508 Ga0157374_10066829 3300013296 Bacteria 3379
509 Ga0157374_10125118 3300013296 Bacteria 2485
510 Ga0157374_10140434 3300013296 Bacteria 2345
511 Ga0157374_10188020 3300013296 Bacteria 2020
512 Ga0157374_10232705 3300013296 Bacteria 1810
513 Ga0157374_10845647 3300013296 Bacteria 932
514 Ga0157374_11962262 3300013296 Bacteria 611
515 Ga0157378_10057104 3300013297 Bacteria 3478
516 Ga0157378_11067825 3300013297 Bacteria 844
517 Ga0157378_11280230 3300013297 Bacteria 774
518 Ga0157378_11375064 3300013297 Bacteria 748
519 Ga0163162_10009279 3300013306 Bacteria 9569
520 Ga0163162_10020735 3300013306 Bacteria 6461
521 Ga0163162_10172801 3300013306 Bacteria 2285
522 Ga0163162_10267056 3300013306 Bacteria 1842
523 Ga0163162_10464185 3300013306 Bacteria 1398
524 Ga0163162_11944940 3300013306 Bacteria 673
525 Ga0157372_10008268 3300013307 Bacteria 11062
526 Ga0157372_10210305 3300013307 Bacteria 2254
527 Ga0157372_11971534 3300013307 Bacteria 671
528 Ga0157375_10044270 3300013308 Bacteria 4323
529 Ga0163163_10060628 3300014325 Bacteria 3747
530 Ga0163163_10116861 3300014325 Bacteria 2699
531 Ga0163163_10382703 3300014325 Bacteria 1465
532 Ga0163163_10542471 3300014325 Bacteria 1225
533 Ga0163163_11759736 3300014325 Bacteria 680
534 Ga0163163_13027782 3300014325 Bacteria 524
535 Ga0157380_10026178 3300014326 Bacteria 4428
536 Ga0157380_10163009 3300014326 Bacteria 1940
537 Ga0157380_10198955 3300014326 Bacteria 1776
538 Ga0157380_10255117 3300014326 Bacteria 1590
539 Ga0157380_10518613 3300014326 Bacteria 1162
540 Ga0157380_10733136 3300014326 Bacteria 997
541 Ga0157380_10972099 3300014326 Bacteria 880
542 Ga0157380_11032515 3300014326 Bacteria 857
543 Ga0157379_10007681 3300014968 Bacteria 9336
544 Ga0157379_10074738 3300014968 Bacteria 3033
545 Ga0157379_10094699 3300014968 Bacteria 2680
546 Ga0157379_10169891 3300014968 Bacteria 1968
547 Ga0157379_12084888 3300014968 Bacteria 562
548 Ga0157376_10025272 3300014969 Bacteria 4676
549 Ga0157376_10095317 3300014969 Bacteria 2588
550 Ga0157376_10135960 3300014969 Bacteria 2200
551 Ga0157376_10207521 3300014969 Bacteria 1807
552 Ga0157376_12201688 3300014969 Bacteria 590
553 Ga0182007_10293798 3300015262 Bacteria 595
554 Ga0163161_10000415 3300017792 Bacteria 35797
555 Ga0163161_11575846 3300017792 Bacteria 579
556 Ga0197907_10403598 3300020069 Bacteria 910
557 Ga0197907_10450514 3300020069 Bacteria 1247
558 Ga0206356_10699909 3300020070 Bacteria 619
559 Ga0206356_11260616 3300020070 Bacteria 1900
560 Ga0206356_11379387 3300020070 Bacteria 562
561 Ga0206355_1694710 3300020076 Bacteria 1165
562 Ga0206352_10038065 3300020078 Bacteria 510
563 Ga0206352_10652386 3300020078 Bacteria 698
564 Ga0206352_10824787 3300020078 Bacteria 1151
565 Ga0206352_11021523 3300020078 Bacteria 559
566 Ga0206350_11469831 3300020080 Bacteria 655
567 Ga0206354_10362155 3300020081 Bacteria 637
568 Ga0206353_10245002 3300020082 Bacteria 798
569 Ga0206353_10402798 3300020082 Bacteria 680
570 Ga0154015_1621370 3300020610 Bacteria 1064
571 Ga0213872_10049499 3300021361 Bacteria 1909
572 Ga0213872_10110389 3300021361 Bacteria 1222
573 Ga0213874_10101088 3300021377 Bacteria 958
574 Ga0213876_10000421 3300021384 Bacteria 35344
575 Ga0224712_10200510 3300022467 Bacteria 907
576 Ga0207666_1000073 3300025271 Bacteria 16742
577 Ga0207666_1011580 3300025271 Bacteria 1221
578 Ga0209758_1000013 3300025297 Bacteria 873003
579 Ga0209758_1000548 3300025297 Bacteria 59657
580 Ga0209758_1052742 3300025297 Bacteria 1403
581 Ga0207426_1024287 3300025302 Bacteria 2059
582 Ga0207697_10024143 3300025315 Bacteria 2490
583 Ga0207697_10024296 3300025315 Bacteria 2481
584 Ga0207656_10051797 3300025321 Bacteria 1776
585 Ga0207656_10503287 3300025321 Bacteria 615
586 Ga0207713_1112270 3300025735 Bacteria 925
587 Ga0207653_10002714 3300025885 Bacteria 5629
588 Ga0207653_10052962 3300025885 Bacteria 1355
589 Ga0207682_10000350 3300025893 Bacteria 21096
590 Ga0207692_10009320 3300025898 Bacteria 4094
591 Ga0207692_10047506 3300025898 Bacteria 2156
592 Ga0207692_10679238 3300025898 Bacteria 667
593 Ga0207642_10000638 3300025899 Bacteria 10749
594 Ga0207642_10112122 3300025899 Bacteria 1391
595 Ga0207642_10531658 3300025899 Bacteria 724
596 Ga0207710_10127171 3300025900 Bacteria 1222
597 Ga0207688_10000001 3300025901 Bacteria 107505
598 Ga0207688_10073044 3300025901 Bacteria 1949
599 Ga0207688_10230680 3300025901 Bacteria 1117
600 Ga0207680_10026966 3300025903 Bacteria 3191
601 Ga0207680_10075759 3300025903 Bacteria 2099
602 Ga0207647_10002852 3300025904 Bacteria 13027
603 Ga0207647_10065304 3300025904 Bacteria 2210
604 Ga0207685_10049007 3300025905 Bacteria 1621
605 Ga0207685_10170302 3300025905 Bacteria 1002
606 Ga0207685_10191194 3300025905 Bacteria 956
607 Ga0207685_10366055 3300025905 Bacteria 731
608 Ga0207699_10002264 3300025906 Bacteria 9081
609 Ga0207699_10048706 3300025906 Bacteria 2490
610 Ga0207699_10125854 3300025906 Bacteria 1664
611 Ga0207699_10285012 3300025906 Bacteria 1149
612 Ga0207699_10442126 3300025906 Bacteria 931
613 Ga0207699_10640397 3300025906 Bacteria 776
614 Ga0207699_11106439 3300025906 Bacteria 586
615 Ga0207645_10000222 3300025907 Bacteria 47139
616 Ga0207645_10065550 3300025907 Bacteria 2321
617 Ga0207645_10405126 3300025907 Bacteria 918
618 Ga0207643_10000009 3300025908 Bacteria 160496
619 Ga0207643_10732483 3300025908 Bacteria 640
620 Ga0207705_10005544 3300025909 Bacteria 9436
621 Ga0207654_10053603 3300025911 Bacteria 2329
622 Ga0207654_10123061 3300025911 Bacteria 1632
623 Ga0207654_10243534 3300025911 Bacteria 1203
624 Ga0207707_10009792 3300025912 Bacteria 8311
625 Ga0207707_10027971 3300025912 Bacteria 4930
626 Ga0207707_10034403 3300025912 Bacteria 4433
627 Ga0207707_10045417 3300025912 Bacteria 3828
628 Ga0207707_10229371 3300025912 Bacteria 1616
629 Ga0207707_10267476 3300025912 Bacteria 1482
630 Ga0207707_11101696 3300025912 Bacteria 647
631 Ga0207707_11109240 3300025912 Bacteria 644
632 Ga0207695_10001037 3300025913 Bacteria 48830
633 Ga0207695_10012684 3300025913 Bacteria 10093
634 Ga0207695_10120619 3300025913 Bacteria 2591
635 Ga0207695_10161789 3300025913 Bacteria 2169
636 Ga0207695_10497021 3300025913 Bacteria 1102
637 Ga0207671_10041568 3300025914 Bacteria 3403
638 Ga0207671_10186930 3300025914 Bacteria 1614
639 Ga0207693_10004694 3300025915 Bacteria 11503
640 Ga0207693_10028016 3300025915 Bacteria 4452
641 Ga0207693_10074737 3300025915 Bacteria 2654
642 Ga0207693_10161048 3300025915 Bacteria 1765
643 Ga0207693_10346813 3300025915 Bacteria 1162
644 Ga0207693_10817221 3300025915 Bacteria 718
645 Ga0207663_10017267 3300025916 Bacteria 4017
646 Ga0207663_10121328 3300025916 Bacteria 1791
647 Ga0207663_10123374 3300025916 Bacteria 1777
648 Ga0207663_10157314 3300025916 Bacteria 1600
649 Ga0207660_10000197 3300025917 Bacteria 38486
650 Ga0207660_10016311 3300025917 Bacteria 4916
651 Ga0207660_10019663 3300025917 Bacteria 4519
652 Ga0207660_10023826 3300025917 Bacteria 4138
653 Ga0207660_10352527 3300025917 Bacteria 1179
654 Ga0207660_10669287 3300025917 Bacteria 846
655 Ga0207660_11581187 3300025917 Bacteria 529
656 Ga0207662_10028451 3300025918 Bacteria 3231
657 Ga0207662_10154682 3300025918 Bacteria 1461
658 Ga0207662_10740236 3300025918 Bacteria 691
659 Ga0207657_10044442 3300025919 Bacteria 3905
660 Ga0207657_10055996 3300025919 Bacteria 3404
661 Ga0207657_10104175 3300025919 Bacteria 2351
662 Ga0207657_10107088 3300025919 Bacteria 2313
663 Ga0207657_10151486 3300025919 Bacteria 1889
664 Ga0207649_10000052 3300025920 Bacteria 106800
665 Ga0207649_10091718 3300025920 Bacteria 1990
666 Ga0207649_10104851 3300025920 Bacteria 1878
667 Ga0207649_10383648 3300025920 Bacteria 1048
668 Ga0207652_10001438 3300025921 Bacteria 21098
669 Ga0207652_10013408 3300025921 Bacteria 6634
670 Ga0207652_10071805 3300025921 Bacteria 3008
671 Ga0207652_10096158 3300025921 Bacteria 2609
672 Ga0207652_10269135 3300025921 Bacteria 1537
673 Ga0207652_10440775 3300025921 Bacteria 1174
674 Ga0207652_11272228 3300025921 Bacteria 638
675 Ga0207646_10045479 3300025922 Bacteria 3941
676 Ga0207681_10002118 3300025923 Bacteria 12708
677 Ga0207681_10126410 3300025923 Bacteria 1883
678 Ga0207694_10085177 3300025924 Bacteria 2487
679 Ga0207694_10151947 3300025924 Bacteria 1866
680 Ga0207694_10227025 3300025924 Bacteria 1524
681 Ga0207694_10969752 3300025924 Bacteria 719
682 Ga0207650_10068752 3300025925 Bacteria 2660
683 Ga0207650_10444364 3300025925 Bacteria 1078
684 Ga0207650_10801544 3300025925 Bacteria 798
685 Ga0207659_10000132 3300025926 Bacteria 43798
686 Ga0207687_10000174 3300025927 Bacteria 42351
687 Ga0207687_10104768 3300025927 Bacteria 2089
688 Ga0207700_10029101 3300025928 Bacteria 3894
689 Ga0207700_10071813 3300025928 Bacteria 2666
690 Ga0207700_10114416 3300025928 Bacteria 2177
691 Ga0207700_10229483 3300025928 Bacteria 1577
692 Ga0207700_10256038 3300025928 Bacteria 1497
693 Ga0207700_10476709 3300025928 Bacteria 1102
694 Ga0207700_10694273 3300025928 Bacteria 908
695 Ga0207700_11079816 3300025928 Bacteria 718
696 Ga0207664_10000478 3300025929 Bacteria 28408
697 Ga0207664_10006275 3300025929 Bacteria 8170
698 Ga0207664_10072425 3300025929 Bacteria 2778
699 Ga0207664_10197031 3300025929 Bacteria 1737
700 Ga0207664_10208600 3300025929 Bacteria 1689
701 Ga0207664_10286647 3300025929 Bacteria 1446
702 Ga0207664_10456449 3300025929 Bacteria 1141
703 Ga0207644_10000212 3300025931 Bacteria 40175
704 Ga0207644_10451134 3300025931 Bacteria 1056
705 Ga0207690_10001288 3300025932 Bacteria 15841
706 Ga0207690_10302921 3300025932 Bacteria 1251
707 Ga0207690_11858231 3300025932 Bacteria 503
708 Ga0207706_10041870 3300025933 Bacteria 4059
709 Ga0207706_10063219 3300025933 Bacteria 3259
710 Ga0207706_10101430 3300025933 Bacteria 2532
711 Ga0207706_10162826 3300025933 Bacteria 1961
712 Ga0207706_11321384 3300025933 Bacteria 595
713 Ga0207686_10001289 3300025934 Bacteria 14380
714 Ga0207686_10147807 3300025934 Bacteria 1632
715 Ga0207686_10423954 3300025934 Bacteria 1018
716 Ga0207686_10595939 3300025934 Bacteria 869
717 Ga0207709_10000530 3300025935 Bacteria 33097
718 Ga0207709_10215518 3300025935 Bacteria 1381
719 Ga0207670_10000523 3300025936 Bacteria 21171
720 Ga0207670_10108831 3300025936 Bacteria 1993
721 Ga0207670_10266778 3300025936 Bacteria 1329
722 Ga0207669_10000235 3300025937 Bacteria 25138
723 Ga0207669_10078273 3300025937 Bacteria 2106
724 Ga0207669_11208647 3300025937 Bacteria 640
725 Ga0207704_10000198 3300025938 Bacteria 31182
726 Ga0207704_10204288 3300025938 Bacteria 1449
727 Ga0207704_10335882 3300025938 Bacteria 1171
728 Ga0207704_10453855 3300025938 Bacteria 1024
729 Ga0207665_10000273 3300025939 Bacteria 35752
730 Ga0207665_10052174 3300025939 Bacteria 2755
731 Ga0207665_10065544 3300025939 Bacteria 2470
732 Ga0207665_10196776 3300025939 Bacteria 1467
733 Ga0207665_10276631 3300025939 Bacteria 1248
734 Ga0207691_10000517 3300025940 Bacteria 38398
735 Ga0207691_10057922 3300025940 Bacteria 3525
736 Ga0207691_10619330 3300025940 Bacteria 916
737 Ga0207711_10006368 3300025941 Bacteria 9949
738 Ga0207711_10011248 3300025941 Bacteria 7435
739 Ga0207711_10127471 3300025941 Bacteria 2278
740 Ga0207711_10857677 3300025941 Bacteria 845
741 Ga0207689_10000031 3300025942 Bacteria 97131
742 Ga0207689_10388743 3300025942 Bacteria 1162
743 Ga0207661_10001228 3300025944 Bacteria 17172
744 Ga0207679_10000183 3300025945 Bacteria 51645
745 Ga0207679_10192673 3300025945 Bacteria 1696
746 Ga0207667_10004001 3300025949 Bacteria 18104
747 Ga0207667_10012207 3300025949 Bacteria 9924
748 Ga0207667_10039092 3300025949 Bacteria 5059
749 Ga0207667_10062790 3300025949 Bacteria 3883
750 Ga0207667_10255836 3300025949 Bacteria 1791
751 Ga0207667_11524714 3300025949 Bacteria 639
752 Ga0207651_10000051 3300025960 Bacteria 54163
753 Ga0207651_10067548 3300025960 Bacteria 2516
754 Ga0207651_10567714 3300025960 Bacteria 988
755 Ga0207651_11168551 3300025960 Bacteria 690
756 Ga0207712_10000738 3300025961 Bacteria 24767
757 Ga0207712_10048716 3300025961 Bacteria 2949
758 Ga0207712_10206744 3300025961 Bacteria 1560
759 Ga0207668_10000664 3300025972 Bacteria 21087
760 Ga0207668_10200896 3300025972 Bacteria 1587
761 Ga0207668_10423622 3300025972 Bacteria 1130
762 Ga0207640_10000343 3300025981 Bacteria 30767
763 Ga0207640_10130022 3300025981 Bacteria 1819
764 Ga0207640_10521555 3300025981 Bacteria 993
765 Ga0207640_11040293 3300025981 Bacteria 722
766 Ga0207658_10057127 3300025986 Bacteria 2898
767 Ga0207658_10193076 3300025986 Bacteria 1694
768 Ga0207658_10498259 3300025986 Bacteria 1084
769 Ga0207677_10010253 3300026023 Bacteria 5297
770 Ga0207677_10018951 3300026023 Bacteria 4144
771 Ga0207677_11423901 3300026023 Bacteria 639
772 Ga0207703_10002904 3300026035 Bacteria 14594
773 Ga0207703_10028495 3300026035 Bacteria 4403
774 Ga0207703_10036270 3300026035 Bacteria 3924
775 Ga0207703_10266721 3300026035 Bacteria 1550
776 Ga0207703_10420806 3300026035 Bacteria 1243
777 Ga0207703_11572392 3300026035 Bacteria 633
778 Ga0207639_10001257 3300026041 Bacteria 17164
779 Ga0207639_10017714 3300026041 Bacteria 5051
780 Ga0207639_10635906 3300026041 Bacteria 986
781 Ga0207639_10913062 3300026041 Bacteria 821
782 Ga0207678_10060468 3300026067 Bacteria 3259
783 Ga0207678_10131444 3300026067 Bacteria 2136
784 Ga0207678_10136346 3300026067 Bacteria 2094
785 Ga0207678_10492824 3300026067 Bacteria 1068
786 Ga0207678_10670144 3300026067 Bacteria 912
787 Ga0207708_10048142 3300026075 Bacteria 3245
788 Ga0207708_10065374 3300026075 Bacteria 2780
789 Ga0207708_10093062 3300026075 Bacteria 2327
790 Ga0207708_10481178 3300026075 Bacteria 1038
791 Ga0207702_10003284 3300026078 Bacteria 14915
792 Ga0207702_10011946 3300026078 Bacteria 7224
793 Ga0207702_10088550 3300026078 Bacteria 2705
794 Ga0207702_10333595 3300026078 Bacteria 1447
795 Ga0207702_10518368 3300026078 Bacteria 1164
796 Ga0207702_11557403 3300026078 Bacteria 654
797 Ga0207641_10001831 3300026088 Bacteria 20447
798 Ga0207641_10041398 3300026088 Bacteria 3860
799 Ga0207641_11175904 3300026088 Bacteria 766
800 Ga0207648_10000581 3300026089 Bacteria 41019
801 Ga0207648_10097104 3300026089 Bacteria 2579
802 Ga0207648_10205752 3300026089 Bacteria 1747
803 Ga0207648_10206868 3300026089 Bacteria 1741
804 Ga0207648_10370771 3300026089 Bacteria 1293
805 Ga0207648_10505893 3300026089 Bacteria 1106
806 Ga0207676_10000124 3300026095 Bacteria 67747
807 Ga0207676_10048665 3300026095 Bacteria 3292
808 Ga0207676_10420265 3300026095 Bacteria 1254
809 Ga0207676_10486636 3300026095 Bacteria 1169
810 Ga0207674_10001605 3300026116 Bacteria 29115
811 Ga0207674_10128096 3300026116 Bacteria 2503
812 Ga0207674_10201166 3300026116 Bacteria 1941
813 Ga0207675_100000414 3300026118 Bacteria 41042
814 Ga0207675_100065029 3300026118 Bacteria 3409
815 Ga0207675_100141370 3300026118 Bacteria 2287
816 Ga0207683_10000242 3300026121 Bacteria 48576
817 Ga0207683_10012573 3300026121 Bacteria 7222
818 Ga0207683_10086140 3300026121 Bacteria 2793
819 Ga0207683_10970737 3300026121 Bacteria 789
820 Ga0207698_10000951 3300026142 Bacteria 16837
821 Ga0207698_10719028 3300026142 Bacteria 995
822 Ga0207698_11025287 3300026142 Bacteria 836
823 Ga0207698_11214340 3300026142 Bacteria 768
824 Ga0207698_11290832 3300026142 Bacteria 745
825 Ga0207698_11732545 3300026142 Bacteria 640
826 Ga0207698_12697065 3300026142 Bacteria 506
827 Ga0209973_1017621 3300027252 Bacteria 920
828 Ga0209973_1024243 3300027252 Bacteria 825
829 Ga0209969_1038746 3300027360 Bacteria 738
830 Ga0209996_1011196 3300027395 Bacteria 1196
831 Ga0209995_1021592 3300027471 Bacteria 1067
832 Ga0209995_1036100 3300027471 Bacteria 831
833 Ga0209179_1000116 3300027512 Bacteria 9269
834 Ga0209982_1008297 3300027552 Bacteria 1522
835 Ga0209970_1004927 3300027614 Bacteria 2208
836 Ga0210002_1001458 3300027617 Bacteria 3340
837 Ga0209983_1086438 3300027665 Bacteria 705
838 Ga0209588_1021222 3300027671 Bacteria 2038
839 Ga0209971_1039672 3300027682 Bacteria 1133
840 Ga0209966_1000641 3300027695 Bacteria 7848
841 Ga0209998_10011991 3300027717 Bacteria 1800
842 Ga0209998_10029104 3300027717 Bacteria 1217
843 Ga0209998_10057600 3300027717 Bacteria 910
844 Ga0209813_10101548 3300027866 Bacteria 979
845 Ga0209813_10170364 3300027866 Bacteria 791
846 Ga0209974_10009862 3300027876 Bacteria 3231
847 Ga0209974_10065145 3300027876 Bacteria 1237
848 Ga0207428_10000037 3300027907 Bacteria 218857
849 Ga0207428_10001773 3300027907 Bacteria 22109
850 Ga0207428_10002442 3300027907 Bacteria 18563
851 Ga0268266_10068513 3300028379 Bacteria 3072
852 Ga0268266_10220254 3300028379 Bacteria 1744
853 Ga0268266_10396400 3300028379 Bacteria 1304
854 Ga0268265_10003320 3300028380 Bacteria 11642
855 Ga0268265_10006176 3300028380 Bacteria 8113
856 Ga0268265_10031542 3300028380 Bacteria 3827
857 Ga0268265_12419870 3300028380 Bacteria 531
858 Ga0268264_10002331 3300028381 Bacteria 16789
859 Ga0268264_10029317 3300028381 Bacteria 4505
860 Ga0268264_10119996 3300028381 Bacteria 2316
861 Ga0268264_10411466 3300028381 Bacteria 1302
862 Ga0268264_10437869 3300028381 Bacteria 1264
863 Ga0265337_1000827 3300028556 Bacteria 16247
864 Ga0265337_1198661 3300028556 Bacteria 544
865 Ga0265334_10129897 3300028573 Bacteria 897
866 Ga0265334_10145145 3300028573 Bacteria 839
867 Ga0265334_10279855 3300028573 Bacteria 572
868 Ga0265338_10043919 3300028800 Bacteria 4135
869 Ga0265338_10462856 3300028800 Bacteria 897
870 Ga0265330_10153761 3300031235 Bacteria 977
871 Ga0265332_10121255 3300031238 Bacteria 1098
872 Ga0265332_10254443 3300031238 Bacteria 726
873 Ga0265328_10075839 3300031239 Bacteria 1237
874 Ga0265328_10407279 3300031239 Bacteria 534
875 Ga0265325_10001071 3300031241 Bacteria 19727
876 Ga0265325_10009381 3300031241 Bacteria 5714
877 Ga0265325_10069725 3300031241 Bacteria 1767
878 Ga0265325_10096452 3300031241 Bacteria 1452
879 Ga0265325_10104334 3300031241 Bacteria 1384
880 Ga0265325_10243580 3300031241 Bacteria 816
881 Ga0265329_10097503 3300031242 Bacteria 935
882 Ga0265340_10000595 3300031247 Bacteria 20131
883 Ga0265340_10010231 3300031247 Bacteria 5021
884 Ga0265340_10020380 3300031247 Bacteria 3408
885 Ga0265340_10023130 3300031247 Bacteria 3171
886 Ga0265340_10023676 3300031247 Bacteria 3129
887 Ga0265340_10071131 3300031247 Bacteria 1649
888 Ga0265340_10154642 3300031247 Bacteria 1044
889 Ga0265340_10268243 3300031247 Bacteria 759
890 Ga0265339_10001408 3300031249 Bacteria 17842
891 Ga0265339_10002105 3300031249 Bacteria 14517
892 Ga0265339_10013957 3300031249 Bacteria 4859
893 Ga0265339_10094870 3300031249 Bacteria 1559
894 Ga0265339_10552650 3300031249 Bacteria 529
895 Ga0265331_10014022 3300031250 Bacteria 4284
896 Ga0265316_10005588 3300031344 Bacteria 12187
897 Ga0265316_10079155 3300031344 Bacteria 2522
898 Ga0265316_10170001 3300031344 Bacteria 1626
899 Ga0307513_10475149 3300031456 Bacteria 971
900 Ga0307408_100910917 3300031548 Bacteria 805
901 Ga0265313_10000031 3300031595 Bacteria 128981
902 Ga0265313_10003687 3300031595 Bacteria 12218
903 Ga0265313_10003967 3300031595 Bacteria 11626
904 Ga0265313_10004533 3300031595 Bacteria 10604
905 Ga0265313_10005420 3300031595 Bacteria 9398
906 Ga0265313_10022796 3300031595 Bacteria 3388
907 Ga0265313_10036516 3300031595 Bacteria 2466
908 Ga0265313_10050230 3300031595 Bacteria 2002
909 Ga0265313_10063677 3300031595 Bacteria 1718
910 Ga0265313_10140853 3300031595 Bacteria 1037
911 Ga0265313_10183845 3300031595 Bacteria 877
912 Ga0265313_10242318 3300031595 Bacteria 737
913 Ga0265314_10004990 3300031711 Bacteria 12094
914 Ga0265314_10006134 3300031711 Bacteria 10680
915 Ga0265314_10116303 3300031711 Bacteria 1691
916 Ga0265314_10166868 3300031711 Bacteria 1333
917 Ga0265342_10002950 3300031712 Bacteria 14314
918 Ga0265342_10009052 3300031712 Bacteria 7065
919 Ga0265342_10017557 3300031712 Bacteria 4651
920 Ga0265342_10080105 3300031712 Bacteria 1888
921 Ga0265342_10112426 3300031712 Bacteria 1540
922 Ga0265342_10166813 3300031712 Bacteria 1214
923 Ga0265342_10230327 3300031712 Bacteria 995
924 Ga0307405_10541041 3300031731 Bacteria 941
925 Ga0307405_11571364 3300031731 Bacteria 580
926 Ga0307413_10463563 3300031824 Bacteria 1009
927 Ga0307410_10599571 3300031852 Bacteria 919
928 Ga0307406_11517626 3300031901 Bacteria 590
929 Ga0307406_11805906 3300031901 Bacteria 544
930 Ga0307407_10216363 3300031903 Bacteria 1293
931 Ga0307412_11650853 3300031911 Bacteria 586
932 Ga0307409_100297855 3300031995 Bacteria 1499
933 Ga0307409_101596973 3300031995 Bacteria 680
934 Ga0307409_101818529 3300031995 Bacteria 638
935 Ga0307416_100350392 3300032002 Bacteria 1494
936 Ga0373930_0000352 3300034816 Bacteria 5995
937 Ga0373930_0170420 3300034816 Bacteria 555
938 Ga0373948_0000262 3300034817 Bacteria 6336
939 Ga0373950_0000155 3300034818 Bacteria 10219
940 Ga0373958_0000136 3300034819 Bacteria 8194
941 Ga0373959_0000508 3300034820 Bacteria 7016
942 Ga0373938_0000013 3300034957 Bacteria 24269
943 Ga0373938_0010938 3300034957 Bacteria 1678
944 Ga0373938_0145369 3300034957 Bacteria 628
945 Ga0373926_0001371 3300035083 Bacteria 7372
946 Ga0373926_0155249 3300035083 Bacteria 872
947 Ga0373926_0261108 3300035083 Bacteria 672
948 Ga0373928_0000255 3300035084 Bacteria 10564
949 Ga0373928_0034036 3300035084 Bacteria 1142
950 Ga0373929_0002106 3300035085 Bacteria 3696
951 Ga0373929_0018776 3300035085 Bacteria 1377
952 Ga0373934_0095854 3300035086 Bacteria 1198
953 Ga0373940_0000097 3300035088 Bacteria 10516
954 Ga0373940_0096900 3300035088 Bacteria 891
955 Ga0373944_0007536 3300035089 Bacteria 2919
956 Ga0373949_0002652 3300035090 Bacteria 4507
957 Ga0373949_0027429 3300035090 Bacteria 1339
958 Ga0373949_0043701 3300035090 Bacteria 1109
959 Ga0373949_0146973 3300035090 Bacteria 679
960 Ga0373951_0004343 3300035091 Bacteria 3372
961 Ga0373952_0000182 3300035092 Bacteria 9790
962 Ga0373952_0001880 3300035092 Bacteria 3814
963 Ga0373923_0009752 3300035111 Bacteria 3472
964 Ga0373923_0037057 3300035111 Bacteria 1994
965 Ga0373923_0129868 3300035111 Bacteria 1131
966 Ga0373923_0275670 3300035111 Bacteria 792
967 Ga0373923_0381990 3300035111 Bacteria 676
968 Ga0373932_0000252 3300035112 Bacteria 16339
969 Ga0373932_0000830 3300035112 Bacteria 9130
970 Ga0373932_0110613 3300035112 Bacteria 905
971 Ga0373936_0007704 3300035113 Bacteria 4044
972 Ga0373936_0015784 3300035113 Bacteria 2897
973 Ga0373939_0001022 3300035114 Bacteria 6895
974 Ga0373939_0004646 3300035114 Bacteria 3253
975 Ga0373939_0011288 3300035114 Bacteria 2250
976 Ga0373941_0000125 3300035115 Bacteria 13305
977 Ga0373941_0091707 3300035115 Bacteria 1043
978 Ga0373941_0100106 3300035115 Bacteria 1008
979 Ga0373941_0295786 3300035115 Bacteria 645
980 Ga0373945_0035220 3300035116 Bacteria 1788
981 Ga0373945_0036416 3300035116 Bacteria 1763
982 Ga0373945_0060204 3300035116 Bacteria 1415
983 Ga0373953_0015314 3300035117 Bacteria 2776
984 Ga0373953_0026316 3300035117 Bacteria 2228
985 Ga0373953_0035794 3300035117 Bacteria 1952
986 Ga0373954_0002715 3300035118 Bacteria 7451
987 Ga0373954_0017164 3300035118 Bacteria 3246
988 Ga0373954_0052172 3300035118 Bacteria 1921
989 Ga0373954_0226256 3300035118 Bacteria 920
990 Ga0373956_0002024 3300035119 Bacteria 8399
991 Ga0373956_0008190 3300035119 Bacteria 4230
992 Ga0373956_0012364 3300035119 Bacteria 3536
993 Ga0373957_0017927 3300035120 Bacteria 2473
994 Ga0373957_0019472 3300035120 Bacteria 2388
995 Ga0373957_0057994 3300035120 Bacteria 1494
996 Ga0373957_0303102 3300035120 Bacteria 678
997 Ga0373960_0000068 3300035121 Bacteria 14664
998 Ga0373960_0005186 3300035121 Bacteria 3010
999 Ga0373960_0049576 3300035121 Bacteria 1242
1000 Ga0373943_0007567 3300035170 Bacteria 4879
1001 Ga0373943_0013145 3300035170 Bacteria 3735
1002 Ga0373943_0025295 3300035170 Bacteria 2774
1003 Ga0373943_0047950 3300035170 Bacteria 2091
1004 Ga0373946_0010959 3300035171 Bacteria 3370
1005 Ga0373946_0021880 3300035171 Bacteria 2483
1006 Ga0373946_0211283 3300035171 Bacteria 933
1007 Ga0373946_0401209 3300035171 Bacteria 692
1008 Ga0373955_0001002 3300035172 Bacteria 11996
1009 Ga0373955_0003246 3300035172 Bacteria 7124
1010 Ga0373955_0012262 3300035172 Bacteria 4116
1011 Ga0373955_0041789 3300035172 Bacteria 2459
1012 Ga0373942_0001496 3300035207 Bacteria 6007
1013 Ga0373942_0017748 3300035207 Bacteria 1758
1014 Ga0373961_0000638 3300035241 Bacteria 12665
1015 Ga0373961_0008988 3300035241 Bacteria 2437
1016 Ga0373961_0282338 3300035241 Bacteria 609
1017 Ga0373962_0000112 3300035242 Bacteria 16939
1018 Ga0373962_0003469 3300035242 Bacteria 3786
1019 Ga0373962_0006987 3300035242 Bacteria 2751
1020 Ga0373962_0087475 3300035242 Bacteria 955
1021 Ga0373924_0045870 3300035410 Bacteria 1798
1022 Ga0373924_0155771 3300035410 Bacteria 1000
1023 Ga0373924_0166202 3300035410 Bacteria 968
1024 Ga0373924_0255338 3300035410 Bacteria 776
1025 Ga0373931_0000305 3300035691 Bacteria 20657
1026 Ga0373931_0001634 3300035691 Bacteria 9691
1027 Ga0373931_0103890 3300035691 Bacteria 1602
1028 Ga0373931_0115030 3300035691 Bacteria 1531
1029 Ga0373931_0119175 3300035691 Bacteria 1506
1030 Ga0373931_0298677 3300035691 Bacteria 994
1031 Ga0373931_0460339 3300035691 Bacteria 815
1032 Ga0373931_0563181 3300035691 Bacteria 741
1033 Ga0373935_0000768 3300035692 Bacteria 17055
1034 Ga0373935_0033271 3300035692 Bacteria 3207
1035 Ga0373935_0060054 3300035692 Bacteria 2432
1036 Ga0373935_0069751 3300035692 Bacteria 2264
1037 Ga0373935_0198900 3300035692 Bacteria 1384
1038 Ga0373935_0729323 3300035692 Bacteria 729
1039 Ga0373927_0017282 3300035695 Bacteria 4748
1040 Ga0373927_0017738 3300035695 Bacteria 4683
1041 Ga0373933_0002755 3300035724 Bacteria 9806
1042 Ga0373933_0012124 3300035724 Bacteria 4760
1043 Ga0373933_0032980 3300035724 Bacteria 3010
1044 Ga0373933_0331363 3300035724 Bacteria 987
1045 Ga0373933_0337578 3300035724 Bacteria 978
1046 Ga0373947_0005394 3300035725 Bacteria 7462
1047 Ga0373947_0058158 3300035725 Bacteria 2342
1048 Ga0373947_0113971 3300035725 Bacteria 1711
1049 Ga0373937_0000057 3300036401 Bacteria 99491
1050 Ga0373937_0005145 3300036401 Bacteria 11151
1051 Ga0373937_0021076 3300036401 Bacteria 5849
1052 Ga0373937_0089618 3300036401 Bacteria 2848
1053 Ga0373937_0147389 3300036401 Bacteria 2203
1054 Ga0373937_0544377 3300036401 Bacteria 1102
1055 Ga0316582_0188075 3300036647 Bacteria 1406
1056 Ga0316584_0001009 3300036712 Bacteria 16241
1057 Ga0373925_0000435 3300037068 Bacteria 42178
1058 Ga0373925_0026064 3300037068 Bacteria 4275
1059 Ga0373925_0034339 3300037068 Bacteria 3738
1060 Ga0373925_0039839 3300037068 Bacteria 3477
1061 Ga0395899_0027617 3300037312 Bacteria 4276
1062 Ga0395899_0091027 3300037312 Bacteria 2211
1063 Ga0395899_0108346 3300037312 Bacteria 1999
1064 Ga0395899_0509727 3300037312 Bacteria 779
1065 Ga0395899_0628217 3300037312 Bacteria 681
1066 Ga0395899_0638165 3300037312 Bacteria 674
1067 Ga0395900_0021199 3300037418 Bacteria 6643
1068 Ga0395900_0079908 3300037418 Bacteria 3360
1069 Ga0395900_0366054 3300037418 Bacteria 1412
1070 Ga0395900_0810990 3300037418 Bacteria 863
1071 Ga0395900_1372975 3300037418 Bacteria 620
1072 Ga0395898_0012850 3300037466 Bacteria 8637
1073 Ga0395898_0120982 3300037466 Bacteria 2508
1074 Ga0395898_0216830 3300037466 Bacteria 1825
1075 Ga0395905_1858586 3300037471 Bacteria 508
1076 Ga0436364_0275541 3300037853 Bacteria 815
1077 Ga0395901_0032023 3300038443 Bacteria 5424
1078 Ga0395901_0132013 3300038443 Bacteria 2624
1079 Ga0395901_0206033 3300038443 Bacteria 2060
1080 Ga0395901_0214538 3300038443 Bacteria 2013
1081 Ga0395901_0286280 3300038443 Bacteria 1711
1082 Ga0242420_047701 3300038996 Bacteria 831
1083 Ga0400483_057660 3300039062 Bacteria 5388
1084 Ga0400483_114523 3300039062 Bacteria 3519
1085 Ga0400483_151905 3300039062 Bacteria 1759
1086 Ga0400483_217885 3300039062 Bacteria 12374
1087 Ga0436365_0682766 3300039437 Bacteria 641
1088 Ga0436365_0903794 3300039437 Bacteria 1392
1089 Ga0436365_1078722 3300039437 Bacteria 827
1090 Ga0436365_1131499 3300039437 Bacteria 661
1091 Ga0436360_1129497 3300039438 Bacteria 623
1092 Ga0436361_0097962 3300039447 Bacteria 2010
1093 Ga0436361_0555071 3300039447 Bacteria 920
1094 Ga0436361_0572950 3300039447 Bacteria 1151
1095 Ga0436363_0063809 3300039450 Bacteria 2193
1096 Ga0436363_1200183 3300039450 Bacteria 1001
1097 Ga0436363_1679896 3300039450 Bacteria 528
1098 Ga0436362_0103032 3300039453 Bacteria 1000
1099 Ga0439465_0047897 3300041413 Bacteria 1394
1100 Ga0439441_062304 3300042001 Bacteria 787
1101 Ga0439441_105782 3300042001 Bacteria 635
1102 Ga0439448_0152482 3300042005 Bacteria 802
1103 Ga0439450_053610 3300042008 Bacteria 963
1104 Ga0439455_0005610 3300042012 Bacteria 2558
1105 Ga0439456_038656 3300042013 Bacteria 1032
1106 Ga0450920_139308 3300042122 Bacteria 513
1107 Ga0450923_004336 3300042125 Bacteria 2224
1108 Ga0439459_0065286 3300042438 Bacteria 831
1109 Ga0439464_0022068 3300042439 Bacteria 1751
1110 Ga0451577_0102181 3300042876 Bacteria 2561
1111 Ga0466972_0457002 3300044658 Bacteria 600
1112 Ga0453683_0835583 3300044673 Bacteria 607
1113 Ga0466966_0067594 3300044684 Bacteria 2244
1114 Ga0466961_0407176 3300044693 Bacteria 825
1115 Ga0466963_0052778 3300044694 Bacteria 2698
1116 Ga0466963_0305327 3300044694 Bacteria 1119
1117 Ga0466963_0461061 3300044694 Bacteria 897
1118 Ga0453684_1338739 3300044712 Bacteria 745
1119 Ga0466971_0121746 3300044719 Bacteria 1208
1120 Ga0466968_0046854 3300044735 Bacteria 1837
1121 Ga0466970_0605719 3300044765 Bacteria 636
1122 Ga0466957_0042883 3300044842 Bacteria 2738
1123 Ga0466957_0287238 3300044842 Bacteria 1102
1124 Ga0466957_0528026 3300044842 Bacteria 821
1125 Ga0466960_0068146 3300044901 Bacteria 1764
1126 Ga0451576_0014613 3300045051 Bacteria 8726
1127 Ga0466958_0087166 3300045836 Bacteria 1927
1128 Ga0466958_0150677 3300045836 Bacteria 1467
1129 Ga0466958_0587406 3300045836 Bacteria 724
1130 Ga0466967_0150260 3300045976 Bacteria 2176
1131 Ga0466967_1060224 3300045976 Bacteria 807
1132 Ga0466967_1359010 3300045976 Bacteria 707
1133 Ga0466967_1727867 3300045976 Bacteria 623
1134 Ga0466967_1743619 3300045976 Bacteria 620
1135 Ga0466967_1871610 3300045976 Bacteria 597
1136 Ga0495592_0014401 3300046454 Bacteria 6005
1137 Ga0495592_0064894 3300046454 Bacteria 2674
1138 Ga0495592_0171347 3300046454 Bacteria 1486
1139 Ga0495603_0018592 3300046455 Bacteria 4204
1140 Ga0495590_0036240 3300046457 Bacteria 1721
1141 Ga0495629_0003401 3300046459 Bacteria 12036
1142 Ga0495629_0210900 3300046459 Bacteria 1341
1143 Ga0495638_0091275 3300046460 Bacteria 1835
1144 Ga0495638_0157555 3300046460 Bacteria 1312
1145 Ga0495641_0018852 3300046461 Bacteria 3548
1146 Ga0495651_0000205 3300046462 Bacteria 45135
1147 Ga0495651_0001390 3300046462 Bacteria 18780
1148 Ga0495651_0003040 3300046462 Bacteria 12936
1149 Ga0495651_0251434 3300046462 Bacteria 1207
1150 Ga0495651_0448229 3300046462 Bacteria 834
1151 Ga0495653_0000120 3300046463 Bacteria 65274
1152 Ga0495653_0003820 3300046463 Bacteria 12184
1153 Ga0495653_0069439 3300046463 Bacteria 2640
1154 Ga0495580_0209732 3300046472 Bacteria 1340
1155 Ga0495580_0804085 3300046472 Bacteria 609
1156 Ga0495582_0034706 3300046473 Bacteria 2772
1157 Ga0495582_0063214 3300046473 Bacteria 2045
1158 Ga0495582_0533630 3300046473 Bacteria 679
1159 Ga0495639_0017560 3300046475 Bacteria 3109
1160 Ga0495662_0001020 3300046476 Bacteria 13726
1161 Ga0495662_0030489 3300046476 Bacteria 2603
1162 Ga0495662_0118993 3300046476 Bacteria 1296
1163 Ga0495664_0000023 3300046477 Bacteria 126807
1164 Ga0495664_0003117 3300046477 Bacteria 9004
1165 Ga0495664_0247869 3300046477 Bacteria 1077
1166 Ga0495584_0031540 3300046491 Bacteria 2683
1167 Ga0495584_0094008 3300046491 Bacteria 1513
1168 Ga0495584_0362676 3300046491 Bacteria 736
1169 Ga0495585_0124105 3300046492 Bacteria 1364
1170 Ga0495585_0230885 3300046492 Bacteria 930
1171 Ga0495594_0035688 3300046499 Bacteria 2709
1172 Ga0495594_0239537 3300046499 Bacteria 1034
1173 Ga0495608_0000030 3300046511 Bacteria 145828
1174 Ga0495608_0004695 3300046511 Bacteria 9771
1175 Ga0495608_0079829 3300046511 Bacteria 2127
1176 Ga0495618_0000042 3300046514 Bacteria 96182
1177 Ga0495618_0009048 3300046514 Bacteria 6010
1178 Ga0495618_0044604 3300046514 Bacteria 2797
1179 Ga0495618_0557384 3300046514 Bacteria 685
1180 Ga0495628_0000027 3300046516 Bacteria 126537
1181 Ga0495628_0002285 3300046516 Bacteria 17341
1182 Ga0495628_0088235 3300046516 Bacteria 2404
1183 Ga0495628_0293242 3300046516 Bacteria 1205
1184 Ga0495630_0084001 3300046517 Bacteria 2404
1185 Ga0495630_0261513 3300046517 Bacteria 1322
1186 Ga0495630_0282749 3300046517 Bacteria 1267
1187 Ga0495630_0707189 3300046517 Bacteria 771
1188 Ga0495643_0311123 3300046522 Bacteria 715
1189 Ga0495666_0022479 3300046526 Bacteria 3123
1190 Ga0495642_0247247 3300046528 Bacteria 780
1191 Ga0495652_0000041 3300046529 Bacteria 126519
1192 Ga0495652_0005034 3300046529 Bacteria 12508
1193 Ga0495652_0008048 3300046529 Bacteria 9659
1194 Ga0495652_0104450 3300046529 Bacteria 2291
1195 Ga0495652_0156303 3300046529 Bacteria 1775
1196 Ga0495665_0024414 3300046531 Bacteria 3247
1197 Ga0495665_0088078 3300046531 Bacteria 1632
1198 Ga0495640_0000047 3300046533 Bacteria 64381
1199 Ga0495640_0015836 3300046533 Bacteria 5659
1200 Ga0495640_0061658 3300046533 Bacteria 2546
1201 Ga0495640_0276973 3300046533 Bacteria 1045
1202 Ga0495586_0082345 3300046535 Bacteria 1769
1203 Ga0495587_0000025 3300046536 Bacteria 147974
1204 Ga0495587_0001073 3300046536 Bacteria 17964
1205 Ga0495587_0021132 3300046536 Bacteria 4014
1206 Ga0495587_0039777 3300046536 Bacteria 2813
1207 Ga0495645_0000001 3300046543 Bacteria 657910
1208 Ga0495645_0002505 3300046543 Bacteria 12464
1209 Ga0495645_0046486 3300046543 Bacteria 3163
1210 Ga0495667_0000001 3300046559 Bacteria 834831
1211 Ga0495667_0004699 3300046559 Bacteria 9233
1212 Ga0495667_0013645 3300046559 Bacteria 5492
1213 Ga0495667_0036143 3300046559 Bacteria 3298
1214 Ga0495667_0060768 3300046559 Bacteria 2478
1215 Ga0495656_0145593 3300046615 Bacteria 1140
1216 Ga0495634_0002681 3300046642 Bacteria 14628
1217 Ga0495634_0122759 3300046642 Bacteria 1662
1218 Ga0495634_0248602 3300046642 Bacteria 1088
1219 Ga0495635_0000061 3300046663 Bacteria 66702
1220 Ga0495635_0013280 3300046663 Bacteria 5762
1221 Ga0495635_0101199 3300046663 Bacteria 1969
1222 Ga0495635_0157796 3300046663 Bacteria 1544
1223 Ga0495659_0054918 3300046664 Bacteria 1458
1224 Ga0495659_0496778 3300046664 Bacteria 534
1225 Ga0495588_0057546 3300046674 Bacteria 2008
1226 Ga0495657_0000204 3300046675 Bacteria 53010
1227 Ga0495657_0005935 3300046675 Bacteria 9597
1228 Ga0495657_0009621 3300046675 Bacteria 7320
1229 Ga0495657_0051550 3300046675 Bacteria 2763
1230 Ga0495657_0056504 3300046675 Bacteria 2613
1231 Ga0495599_0000021 3300046678 Bacteria 127591
1232 Ga0495599_0002367 3300046678 Bacteria 10955
1233 Ga0495599_0006958 3300046678 Bacteria 6841
1234 Ga0495599_0452307 3300046678 Bacteria 760
1235 Ga0495623_0000858 3300046679 Bacteria 20593
1236 Ga0495623_0001713 3300046679 Bacteria 14738
1237 Ga0495623_0061441 3300046679 Bacteria 2356
1238 Ga0495646_0000043 3300046680 Bacteria 65914
1239 Ga0495646_0003394 3300046680 Bacteria 9902
1240 Ga0495646_0193260 3300046680 Bacteria 1111
1241 Ga0495646_0562693 3300046680 Bacteria 581
1242 Ga0495647_0023189 3300046681 Bacteria 2249
1243 Ga0495647_0031601 3300046681 Bacteria 1969
1244 Ga0495658_0019075 3300046683 Bacteria 3575
1245 Ga0495658_0060255 3300046683 Bacteria 2176
1246 Ga0495669_0070805 3300046684 Bacteria 1589
1247 Ga0495669_0161196 3300046684 Bacteria 1065
1248 Ga0495613_0130268 3300046689 Bacteria 1801
1249 Ga0495613_0152619 3300046689 Bacteria 1646
1250 Ga0495613_0242912 3300046689 Bacteria 1258
1251 Ga0495613_0433095 3300046689 Bacteria 893
1252 Ga0495613_0792279 3300046689 Bacteria 619
1253 Ga0495624_0027753 3300046690 Bacteria 3704
1254 Ga0495624_0582130 3300046690 Bacteria 667
1255 Ga0495671_0295934 3300046692 Bacteria 779
1256 Ga0495589_0162433 3300046794 Bacteria 1064
1257 Ga0495589_0268839 3300046794 Bacteria 794
1258 Ga0495589_0291718 3300046794 Bacteria 757
1259 Ga0495600_0000082 3300046809 Bacteria 52098
1260 Ga0495600_0025274 3300046809 Bacteria 3827
1261 Ga0495600_0071319 3300046809 Bacteria 2269
1262 Ga0495600_0595037 3300046809 Bacteria 672
1263 Ga0495581_0041004 3300047315 Bacteria 2679
1264 Ga0495581_0093975 3300047315 Bacteria 1740
1265 Ga0495581_0486163 3300047315 Bacteria 718
1266 Ga0495604_0000036 3300047317 Bacteria 126707
1267 Ga0495604_0003635 3300047317 Bacteria 12295
1268 Ga0495604_0016633 3300047317 Bacteria 5881
1269 Ga0495604_0149828 3300047317 Bacteria 1659
1270 Ga0495674_0000085 3300047319 Bacteria 65389
1271 Ga0495674_0064384 3300047319 Bacteria 3187
1272 Ga0495674_0143635 3300047319 Bacteria 2004
1273 Ga0495672_0000511 3300047320 Bacteria 44639
1274 Ga0495676_0168077 3300047321 Bacteria 1545
1275 Ga0495676_0338761 3300047321 Bacteria 1007
1276 Ga0495680_0000201 3300047322 Bacteria 64686
1277 Ga0495680_0012190 3300047322 Bacteria 7581
1278 Ga0495680_0024378 3300047322 Bacteria 5018
1279 Ga0495680_0132942 3300047322 Bacteria 1826
1280 Ga0495680_0503811 3300047322 Bacteria 821
1281 Ga0495680_0522910 3300047322 Bacteria 803
1282 Ga0495675_0000203 3300047444 Bacteria 43496
1283 Ga0495675_0004449 3300047444 Bacteria 8477
1284 Ga0495675_0219460 3300047444 Bacteria 1151
1285 Ga0495677_0315950 3300047445 Bacteria 615
1286 Ga0495684_0000025 3300047471 Bacteria 127037
1287 Ga0495684_0116578 3300047471 Bacteria 2013
1288 Ga0495593_0005893 3300047673 Bacteria 7221
1289 Ga0495593_0026153 3300047673 Bacteria 3225
1290 Ga0495593_0095776 3300047673 Bacteria 1526
1291 Ga0495593_0495358 3300047673 Bacteria 612
1292 Ga0495602_0000097 3300048088 Bacteria 82301
1293 Ga0495602_0005814 3300048088 Bacteria 12947
1294 Ga0495602_0069117 3300048088 Bacteria 3029
1295 Ga0495614_0210554 3300048089 Bacteria 881
1296 Ga0496100_0000345 3300048903 Bacteria 22686
1297 Ga0496100_0040182 3300048903 Bacteria 2974
1298 Ga0496100_0196762 3300048903 Bacteria 1466
1299 Ga0496100_0210950 3300048903 Bacteria 1420
1300 Ga0496100_0381653 3300048903 Bacteria 1070
1301 Ga0496100_0819396 3300048903 Bacteria 729
1302 Ga0496101_0000866 3300048904 Bacteria 17903
1303 Ga0496101_0002577 3300048904 Bacteria 11131
1304 Ga0496101_0026764 3300048904 Bacteria 4010
1305 Ga0496101_0031736 3300048904 Bacteria 3715
1306 Ga0496101_0354354 3300048904 Bacteria 1153
1307 Ga0496101_0754094 3300048904 Bacteria 768
1308 Ga0496101_0879150 3300048904 Bacteria 706
1309 Ga0496101_1581763 3300048904 Bacteria 509
1310 Ga0496102_0001833 3300048905 Bacteria 18355
1311 Ga0496102_0001868 3300048905 Bacteria 18139
1312 Ga0496102_0035378 3300048905 Bacteria 4495
1313 Ga0496102_0227674 3300048905 Bacteria 1758
1314 Ga0496102_0713677 3300048905 Bacteria 925
1315 Ga0496102_0954535 3300048905 Bacteria 778
1316 Ga0496103_0001022 3300048906 Bacteria 19583
1317 Ga0496103_0033382 3300048906 Bacteria 3144
1318 Ga0496103_0039344 3300048906 Bacteria 2905
1319 Ga0496103_0046372 3300048906 Bacteria 2683
1320 Ga0496103_0159310 3300048906 Bacteria 1447
1321 Ga0496103_0246031 3300048906 Bacteria 1151
1322 Ga0496104_0000399 3300048907 Bacteria 38066
1323 Ga0496104_0000877 3300048907 Bacteria 25894
1324 Ga0496104_0041378 3300048907 Bacteria 4320
1325 Ga0496104_0392679 3300048907 Bacteria 1300
1326 Ga0496104_0395508 3300048907 Bacteria 1294
1327 Ga0496104_1192407 3300048907 Bacteria 664
1328 Ga0496105_0002417 3300048908 Bacteria 13529
1329 Ga0496105_0077228 3300048908 Bacteria 2750
1330 Ga0496105_0146792 3300048908 Bacteria 1939
1331 Ga0496105_0148486 3300048908 Bacteria 1927
1332 Ga0496105_0290849 3300048908 Bacteria 1315
1333 Ga0496105_0325436 3300048908 Bacteria 1231
1334 Ga0496106_0001110 3300048909 Bacteria 19925
1335 Ga0496106_0002528 3300048909 Bacteria 13620
1336 Ga0496106_0066180 3300048909 Bacteria 2752
1337 Ga0496106_0076854 3300048909 Bacteria 2559
1338 Ga0496106_0115700 3300048909 Bacteria 2091
1339 Ga0496106_0267836 3300048909 Bacteria 1367
1340 Ga0496106_0516860 3300048909 Bacteria 959
1341 Ga0496107_0002539 3300048910 Bacteria 11894
1342 Ga0496107_0017863 3300048910 Bacteria 4992
1343 Ga0496107_0033041 3300048910 Bacteria 3700
1344 Ga0496107_0794029 3300048910 Bacteria 693
1345 Ga0496108_0003711 3300048911 Bacteria 12246
1346 Ga0496108_0004403 3300048911 Bacteria 11337
1347 Ga0496108_0009905 3300048911 Bacteria 7726
1348 Ga0496108_0077559 3300048911 Bacteria 2810
1349 Ga0496108_0081887 3300048911 Bacteria 2736
1350 Ga0496108_0150271 3300048911 Bacteria 2009
1351 Ga0496108_0418359 3300048911 Bacteria 1170
1352 Ga0496108_0626557 3300048911 Bacteria 936
1353 Ga0496109_0002269 3300048912 Bacteria 15980
1354 Ga0496109_0005827 3300048912 Bacteria 10325
1355 Ga0496109_0010610 3300048912 Bacteria 7880
1356 Ga0496109_0072604 3300048912 Bacteria 3161
1357 Ga0496109_0104703 3300048912 Bacteria 2627
1358 Ga0496109_0107784 3300048912 Bacteria 2588
1359 Ga0496109_0178790 3300048912 Bacteria 1992
1360 Ga0496109_0742846 3300048912 Bacteria 919
1361 Ga0496110_0004757 3300048913 Bacteria 10571
1362 Ga0496110_0005009 3300048913 Bacteria 10350
1363 Ga0496110_0062768 3300048913 Bacteria 3282
1364 Ga0496110_0124293 3300048913 Bacteria 2327
1365 Ga0496110_0239896 3300048913 Bacteria 1649
1366 Ga0496110_0269768 3300048913 Bacteria 1549
1367 Ga0496110_0275705 3300048913 Bacteria 1531
1368 Ga0496110_0377198 3300048913 Bacteria 1292
1369 Ga0496110_0850670 3300048913 Bacteria 817
1370 Ga0496110_1800098 3300048913 Bacteria 522
1371 Ga0496111_0008486 3300048914 Bacteria 6803
1372 Ga0496111_0113696 3300048914 Bacteria 1995
1373 Ga0496111_0166009 3300048914 Bacteria 1639
1374 Ga0496111_0309448 3300048914 Bacteria 1171
1375 Ga0496111_0508565 3300048914 Bacteria 886
1376 Ga0496111_0686495 3300048914 Bacteria 745
1377 Ga0496112_0003321 3300048915 Bacteria 13273
1378 Ga0496112_0005896 3300048915 Bacteria 10679
1379 Ga0496112_0107323 3300048915 Bacteria 2762
1380 Ga0496112_0148666 3300048915 Bacteria 2310
1381 Ga0496112_0306057 3300048915 Bacteria 1534
1382 Ga0496112_1017178 3300048915 Bacteria 748
1383 Ga0496113_0049264 3300048916 Bacteria 3136
1384 Ga0496113_0160011 3300048916 Bacteria 1780
1385 Ga0496113_0204176 3300048916 Bacteria 1571
1386 Ga0496113_0214113 3300048916 Bacteria 1534
1387 Ga0496113_0219441 3300048916 Bacteria 1515
1388 Ga0496113_0331385 3300048916 Bacteria 1220
1389 Ga0496113_0459870 3300048916 Bacteria 1022
1390 Ga0496113_1037530 3300048916 Bacteria 645
1391 Ga0496113_1606315 3300048916 Bacteria 500
1392 Ga0496114_0007247 3300048917 Bacteria 8760
1393 Ga0496114_0091339 3300048917 Bacteria 2586
1394 Ga0496114_0279202 3300048917 Bacteria 1472
1395 Ga0496114_0409099 3300048917 Bacteria 1201
1396 Ga0496115_0007162 3300048918 Bacteria 8192
1397 Ga0496115_0079825 3300048918 Bacteria 2663
1398 Ga0496115_0096513 3300048918 Bacteria 2420
1399 Ga0496115_0368084 3300048918 Bacteria 1170
1400 Ga0496115_0507387 3300048918 Bacteria 968
1401 Ga0496115_0736324 3300048918 Bacteria 772
1402 Ga0496121_0001541 3300048924 Bacteria 38568
1403 Ga0496121_0006108 3300048924 Bacteria 15150
1404 Ga0496126_0031566 3300048929 Bacteria 5002
1405 Ga0496126_0355209 3300048929 Bacteria 1198
1406 Ga0501307_067962 3300049162 Bacteria 564
1407 Ga0501031_0007081 3300049568 Bacteria 7316
1408 Ga0501032_0000345 3300049569 Bacteria 38831
1409 Ga0501032_0011528 3300049569 Bacteria 6349
1410 Ga0501032_0404353 3300049569 Bacteria 877
1411 Ga0501033_0000094 3300049570 Bacteria 84669
1412 Ga0501033_0009628 3300049570 Bacteria 7434
1413 Ga0501033_0311759 3300049570 Bacteria 1106
1414 Ga0501033_0341811 3300049570 Bacteria 1049
1415 Ga0501033_0720528 3300049570 Bacteria 678
1416 Ga0501034_0000021 3300049571 Bacteria 266023
1417 Ga0501034_0064668 3300049571 Bacteria 3671
1418 Ga0501034_0181982 3300049571 Bacteria 2066
1419 Ga0501034_0185763 3300049571 Bacteria 2042
1420 Ga0501034_0313065 3300049571 Bacteria 1504
1421 Ga0501034_0313235 3300049571 Bacteria 1503
1422 Ga0501034_0371497 3300049571 Bacteria 1356
1423 Ga0501034_0514381 3300049571 Bacteria 1109
1424 Ga0501034_1172362 3300049571 Bacteria 647
1425 Ga0501036_0001704 3300049572 Bacteria 17077
1426 Ga0501036_0013016 3300049572 Bacteria 6907
1427 Ga0501036_0296427 3300049572 Bacteria 1353
1428 Ga0501036_0315601 3300049572 Bacteria 1306
1429 Ga0501036_0627337 3300049572 Bacteria 891
1430 Ga0501037_0000450 3300049573 Bacteria 33712
1431 Ga0501037_0061670 3300049573 Bacteria 2735
1432 Ga0501037_0081205 3300049573 Bacteria 2351
1433 Ga0501037_0084716 3300049573 Bacteria 2295
1434 Ga0501038_0000052 3300049574 Bacteria 94841
1435 Ga0501038_0028787 3300049574 Bacteria 4932
1436 Ga0501038_0066442 3300049574 Bacteria 3071
1437 Ga0501038_0139780 3300049574 Bacteria 1982
1438 Ga0501038_0479288 3300049574 Bacteria 954
1439 Ga0501038_0759286 3300049574 Bacteria 723
1440 Ga0501039_0000549 3300049575 Bacteria 27168
1441 Ga0501039_0838026 3300049575 Bacteria 717
1442 Ga0501039_0949539 3300049575 Bacteria 669
1443 Ga0501040_0195912 3300049576 Bacteria 1434
1444 Ga0501041_0197950 3300049577 Bacteria 1259
1445 Ga0501042_0090134 3300049578 Bacteria 2201
1446 Ga0501042_0119571 3300049578 Bacteria 1897
1447 Ga0501042_0912375 3300049578 Bacteria 640
1448 Ga0501043_0001704 3300049579 Bacteria 19033
1449 Ga0501043_0054177 3300049579 Bacteria 3150
1450 Ga0501043_0192378 3300049579 Bacteria 1586
1451 Ga0501043_0292192 3300049579 Bacteria 1247
1452 Ga0501043_0358593 3300049579 Bacteria 1107
1453 Ga0501046_0002237 3300049580 Bacteria 18256
1454 Ga0501046_0036672 3300049580 Bacteria 3945
1455 Ga0501046_0179458 3300049580 Bacteria 1584
1456 Ga0501046_0401674 3300049580 Bacteria 990
1457 Ga0501046_0518728 3300049580 Bacteria 852
1458 Ga0501046_0729312 3300049580 Bacteria 697
1459 Ga0501047_0000440 3300049581 Bacteria 46007
1460 Ga0501047_0016976 3300049581 Bacteria 6961
1461 Ga0501047_0030355 3300049581 Bacteria 5211
1462 Ga0501047_0063944 3300049581 Bacteria 3549
1463 Ga0501047_0138620 3300049581 Bacteria 2311
1464 Ga0501047_0427446 3300049581 Bacteria 1155
1465 Ga0501047_0527954 3300049581 Bacteria 1006
1466 Ga0501048_0001862 3300049582 Bacteria 16006
1467 Ga0501048_0360186 3300049582 Bacteria 1038
1468 Ga0501048_0365545 3300049582 Bacteria 1029
1469 Ga0501067_0000076 3300049583 Bacteria 56529
1470 Ga0501067_0008019 3300049583 Bacteria 5865
1471 Ga0501067_0046517 3300049583 Bacteria 2408
1472 Ga0501067_0167333 3300049583 Bacteria 1224
1473 Ga0501067_0873642 3300049583 Bacteria 507
1474 Ga0501068_0001049 3300049584 Bacteria 14641
1475 Ga0501068_0115513 3300049584 Bacteria 1671
1476 Ga0501068_0223426 3300049584 Bacteria 1197
1477 Ga0501068_0387204 3300049584 Bacteria 901
1478 Ga0501069_0018031 3300049585 Bacteria 3807
1479 Ga0501069_0048488 3300049585 Bacteria 2358
1480 Ga0501069_0145115 3300049585 Bacteria 1362
1481 Ga0501069_0173426 3300049585 Bacteria 1245
1482 Ga0501069_0228499 3300049585 Bacteria 1083
1483 Ga0501070_0010753 3300049586 Bacteria 7733
1484 Ga0501070_0054403 3300049586 Bacteria 3319
1485 Ga0501070_0097895 3300049586 Bacteria 2426
1486 Ga0501070_0120589 3300049586 Bacteria 2167
1487 Ga0501070_0146838 3300049586 Bacteria 1946
1488 Ga0501070_0148387 3300049586 Bacteria 1935
1489 Ga0501070_0160366 3300049586 Bacteria 1854
1490 Ga0501070_0833005 3300049586 Bacteria 723
1491 Ga0501070_1238427 3300049586 Bacteria 571
1492 Ga0501071_0127174 3300049587 Bacteria 1892
1493 Ga0501071_0209635 3300049587 Bacteria 1465
1494 Ga0501071_0315516 3300049587 Bacteria 1186
1495 Ga0501072_0002634 3300049588 Bacteria 13457
1496 Ga0501072_0235428 3300049588 Bacteria 1458
1497 Ga0501072_0238200 3300049588 Bacteria 1449
1498 Ga0501072_0239075 3300049588 Bacteria 1446
1499 Ga0501072_0373095 3300049588 Bacteria 1132
1500 Ga0501072_0693453 3300049588 Bacteria 800
1501 Ga0501072_0917579 3300049588 Bacteria 684
1502 Ga0501073_0000597 3300049589 Bacteria 25445
1503 Ga0501073_0024093 3300049589 Bacteria 4370
1504 Ga0501073_0037517 3300049589 Bacteria 3440
1505 Ga0501073_0041475 3300049589 Bacteria 3252
1506 Ga0501073_0044209 3300049589 Bacteria 3139
1507 Ga0501073_0274520 3300049589 Bacteria 1163
1508 Ga0501073_0275068 3300049589 Bacteria 1162
1509 Ga0501073_0315066 3300049589 Bacteria 1079
1510 Ga0501073_0464128 3300049589 Bacteria 875
1511 Ga0501073_0546339 3300049589 Bacteria 800
1512 Ga0501073_0911146 3300049589 Bacteria 605
1513 Ga0501074_0000285 3300049590 Bacteria 29182
1514 Ga0501074_0066499 3300049590 Bacteria 2593
1515 Ga0501074_0068214 3300049590 Bacteria 2557
1516 Ga0501074_0261439 3300049590 Bacteria 1230
1517 Ga0501074_0299330 3300049590 Bacteria 1142
1518 Ga0501074_0534590 3300049590 Bacteria 830
1519 Ga0501074_0830985 3300049590 Bacteria 651
1520 Ga0501075_0174523 3300049591 Bacteria 1640
1521 Ga0501075_0297766 3300049591 Bacteria 1229
1522 Ga0501075_0635401 3300049591 Bacteria 814
1523 Ga0501075_0964004 3300049591 Bacteria 648
1524 Ga0501075_1133616 3300049591 Bacteria 594
1525 Ga0501076_1377480 3300049592 Bacteria 580
1526 Ga0501077_0108309 3300049593 Bacteria 1760
1527 Ga0501077_0230131 3300049593 Bacteria 1178
1528 Ga0501077_0634198 3300049593 Bacteria 687
1529 Ga0501079_0027965 3300049741 Bacteria 4325
1530 Ga0501079_0086061 3300049741 Bacteria 2433
1531 Ga0501079_0110781 3300049741 Bacteria 2133
1532 Ga0501079_0193938 3300049741 Bacteria 1586
1533 Ga0501079_0328970 3300049741 Bacteria 1197
1534 Ga0501079_1331169 3300049741 Bacteria 565
1535 Ga0501080_0001080 3300049742 Bacteria 22459
1536 Ga0501080_0016495 3300049742 Bacteria 6823
1537 Ga0501080_0067975 3300049742 Bacteria 3314
1538 Ga0501080_0091018 3300049742 Bacteria 2833
1539 Ga0501080_0109688 3300049742 Bacteria 2558
1540 Ga0501080_0443378 3300049742 Bacteria 1164
1541 Ga0501080_0696167 3300049742 Bacteria 896
1542 Ga0501080_0709197 3300049742 Bacteria 887
1543 Ga0501080_1338100 3300049742 Bacteria 612
1544 Ga0501081_0018544 3300049743 Bacteria 4624
1545 Ga0501081_0090060 3300049743 Bacteria 2156
1546 Ga0501083_0000881 3300049744 Bacteria 19851
1547 Ga0501083_0007860 3300049744 Bacteria 7555
1548 Ga0501083_0024413 3300049744 Bacteria 4187
1549 Ga0501083_0061997 3300049744 Bacteria 2496
1550 Ga0501083_0086409 3300049744 Bacteria 2074
1551 Ga0501083_0090565 3300049744 Bacteria 2020
1552 Ga0501083_0455955 3300049744 Bacteria 832
1553 Ga0501035_0000255 3300049822 Bacteria 63841
1554 Ga0501035_0001116 3300049822 Bacteria 28096
1555 Ga0501035_0007660 3300049822 Bacteria 10086
1556 Ga0501035_0168444 3300049822 Bacteria 1893
1557 Ga0501035_0347401 3300049822 Bacteria 1242
1558 Ga0501035_0351623 3300049822 Bacteria 1233
1559 Ga0501035_0390304 3300049822 Bacteria 1160
1560 Ga0501035_0975551 3300049822 Bacteria 667
1561 Ga0501044_0000141 3300049823 Bacteria 88569
1562 Ga0501044_0060992 3300049823 Bacteria 3859
1563 Ga0501044_0061315 3300049823 Bacteria 3848
1564 Ga0501044_0074615 3300049823 Bacteria 3445
1565 Ga0501044_0182883 3300049823 Bacteria 2062
1566 Ga0501044_0272626 3300049823 Bacteria 1627
1567 Ga0501044_0485944 3300049823 Bacteria 1137
1568 Ga0501044_0685084 3300049823 Bacteria 911
1569 Ga0501044_0809778 3300049823 Bacteria 815
1570 nmdc:mga03683_175413_c1 3300050489 Bacteria 976
1571 nmdc:mga03683_58457_c1 3300050489 Bacteria 1625
1572 nmdc:mga00v17_384310_c1 3300050491 Bacteria 912
1573 nmdc:mga00v17_424560_c1 3300050491 Bacteria 863
1574 nmdc:mga00v17_82239_c1 3300050491 Bacteria 2012
1575 nmdc:mga0yw44_5776_c1 3300050492 Bacteria 5896
1576 nmdc:mga0k408_2835_c1 3300050493 Bacteria 9206
1577 nmdc:mga0k408_449502_c1 3300050493 Bacteria 765
1578 nmdc:mga0k408_7859_c1 3300050493 Bacteria 5706
1579 nmdc:mga06z11_771695_c1 3300050494 Bacteria 586
1580 nmdc:mga07m45_47271_c1 3300050496 Bacteria 2419
1581 nmdc:mga07m45_561051_c1 3300050496 Bacteria 660
1582 nmdc:mga05p37_14706_c1 3300050507 Bacteria 9402
1583 nmdc:mga05p37_2437_c1 3300050507 Bacteria 21635
1584 nmdc:mga05p37_265187_c1 3300050507 Bacteria 2054
1585 nmdc:mga05p37_910783_c1 3300050507 Bacteria 947
1586 nmdc:mga09592_1108952_c1 3300050508 Bacteria 657
1587 nmdc:mga09592_1370_c1 3300050508 Bacteria 19524
1588 nmdc:mga09592_266337_c1 3300050508 Bacteria 1486
1589 nmdc:mga09592_285401_c1 3300050508 Bacteria 1431
1590 nmdc:mga09592_8971_c1 3300050508 Bacteria 8131
1591 nmdc:mga0qj67_108691_c1 3300050509 Bacteria 2238
1592 nmdc:mga0qj67_969_c1 3300050509 Bacteria 19753
1593 nmdc:mga06r32_156819_c1 3300050510 Bacteria 2258
1594 nmdc:mga06r32_16932_c1 3300050510 Bacteria 5795
1595 nmdc:mga06r32_638_c1 3300050510 Bacteria 30472
1596 nmdc:mga06r32_87514_c1 3300050510 Bacteria 3040
1597 nmdc:mga08y16_1574170_c1 3300050511 Bacteria 616
1598 nmdc:mga08y16_3117_c1 3300050511 Bacteria 17166
1599 nmdc:mga08y16_333_c1 3300050511 Bacteria 42807
1600 nmdc:mga08y16_549_c1 3300050511 Bacteria 34756
1601 nmdc:mga0n895_1174_c1 3300050512 Bacteria 19193
1602 nmdc:mga0n895_124497_c1 3300050512 Bacteria 2601
1603 nmdc:mga0n895_534292_c1 3300050512 Bacteria 1179
1604 nmdc:mga0n895_857752_c1 3300050512 Bacteria 896
1605 nmdc:mga0rr50_20520_c1 3300050513 Bacteria 4491
1606 nmdc:mga0rr50_330858_c1 3300050513 Bacteria 1279
1607 nmdc:mga0rr50_493176_c1 3300050513 Bacteria 1041
1608 nmdc:mga0rr50_616040_c1 3300050513 Bacteria 926
1609 nmdc:mga0rr50_6776_c1 3300050513 Bacteria 7016
1610 nmdc:mga08x19_120860_c1 3300050514 Bacteria 1756
1611 nmdc:mga08x19_432681_c1 3300050514 Bacteria 925
1612 nmdc:mga08x19_683414_c1 3300050514 Bacteria 728
1613 nmdc:mga08x19_702090_c1 3300050514 Bacteria 718
1614 nmdc:mga08x19_82647_c1 3300050514 Bacteria 2110
1615 nmdc:mga08x19_855881_c1 3300050514 Bacteria 646
1616 nmdc:mga0a205_27812_c1 3300050515 Bacteria 5401
1617 nmdc:mga0a205_6917_c1 3300050515 Bacteria 10255
1618 nmdc:mga0a205_745_c1 3300050515 Bacteria 26246
1619 nmdc:mga0a205_86774_c1 3300050515 Bacteria 3023
1620 Ga0495601_0000025 3300053077 Bacteria 127736
1621 Ga0495601_0000869 3300053077 Bacteria 16487
1622 Ga0495601_0002429 3300053077 Bacteria 10574
1623 Ga0495601_0009249 3300053077 Bacteria 5823
1624 Ga0495601_0031396 3300053077 Bacteria 3301
1625 Ga0495601_0044802 3300053077 Bacteria 2780
1626 Ga0495601_1083712 3300053077 Bacteria 502
1627 Ga0495612_0000570 3300053078 Bacteria 14844
1628 Ga0495612_0018791 3300053078 Bacteria 2767
1629 Ga0495612_0019618 3300053078 Bacteria 2708
1630 Ga0495655_0069626 3300053083 Bacteria 980
1631 Ga0495655_0108503 3300053083 Bacteria 831
1632 Ga0495595_0000041 3300053084 Bacteria 67592
1633 Ga0495595_0001114 3300053084 Bacteria 10394
1634 Ga0495595_0001865 3300053084 Bacteria 8184
1635 Ga0495595_0003026 3300053084 Bacteria 6649
1636 Ga0495595_0131510 3300053084 Bacteria 1223
1637 Ga0495595_0283763 3300053084 Bacteria 832
1638 Ga0495595_0325298 3300053084 Bacteria 774
1639 Ga0495619_0000035 3300053085 Bacteria 126262
1640 Ga0495619_0000430 3300053085 Bacteria 28482
1641 Ga0495619_0001481 3300053085 Bacteria 15481
1642 Ga0495619_0038883 3300053085 Bacteria 3104
1643 Ga0495619_0044333 3300053085 Bacteria 2919
1644 Ga0495619_0364946 3300053085 Bacteria 998
1645 Ga0495619_0573316 3300053085 Bacteria 773
1646 Ga0500643_001596 3300053087 Bacteria 12817
1647 Ga0500643_112762 3300053087 Bacteria 734
1648 Ga0500644_0007015 3300053088 Bacteria 2916
1649 Ga0500651_0047561 3300053093 Bacteria 2696
1650 Ga0500566_0086112 3300053094 Bacteria 1742
1651 Ga0500650_0233840 3300053098 Bacteria 828
1652 Ga0500556_0190192 3300053104 Bacteria 811
1653 Ga0500595_000016 3300053119 Bacteria 211397
1654 Ga0500595_071208 3300053119 Bacteria 1031
1655 Ga0500642_0043920 3300053130 Bacteria 1944
1656 Ga0500652_132321 3300053131 Bacteria 1040
1657 Ga0500652_240738 3300053131 Bacteria 720
1658 Ga0500568_0212978 3300053139 Bacteria 706
1659 Ga0500568_0290997 3300053139 Bacteria 593
1660 Ga0500573_0139542 3300053140 Bacteria 1336
1661 Ga0500573_0434933 3300053140 Bacteria 611
1662 Ga0500577_0082986 3300053142 Bacteria 1282
1663 Ga0500616_0000006 3300053153 Bacteria 944738
1664 Ga0500645_021076 3300053730 Bacteria 2013
1665 Ga0501084_0290907 3300054114 Bacteria 1380
1666 Ga0501084_0396959 3300054114 Bacteria 1165
1667 Ga0501084_0636089 3300054114 Bacteria 901
1668 Ga0501084_0673691 3300054114 Bacteria 873
1669 Ga0501084_0835028 3300054114 Bacteria 775
1670 Ga0501084_0867267 3300054114 Bacteria 759
1671 Ga0587117_022658 3300059627 Bacteria 889
1672 Ga0587068_153057 3300059641 Bacteria 523
1673 Ga0587079_226678 3300059647 Bacteria 522
1674 Ga0587071_045962 3300060344 Bacteria 889
1675 Ga0501082_0024224 3300060353 Bacteria 5233
1676 Ga0501082_0024485 3300060353 Bacteria 5203
1677 Ga0501082_0395421 3300060353 Bacteria 1206
1678 Ga0501082_0508045 3300060353 Bacteria 1053
1679 Ga0501082_0807961 3300060353 Bacteria 820
1680 Ga0501082_1219068 3300060353 Bacteria 657
1681 Ga0501082_1244332 3300060353 Bacteria 650
1682 Ga0501082_1664670 3300060353 Bacteria 557
1683 Ga0466962_0127681 3300061719 Bacteria 1228
1684 Ga0466962_0273108 3300061719 Bacteria 833
1685 Ga0530510_0037913 3300061734 Bacteria 3477
1686 Ga0530510_0060643 3300061734 Bacteria 2738

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005354 Ga0070675_100276441 Ga0070675_1002764412 122
2 3300005364 Ga0070673_100018429 Ga0070673_1000184295 122
3 3300005367 Ga0070667_100239074 Ga0070667_1002390742 122
4 3300005436 Ga0070713_100226838 Ga0070713_1002268383 122
5 3300005436 Ga0070713_100242746 Ga0070713_1002427462 122
6 3300005544 Ga0070686_100692544 Ga0070686_1006925441 122
7 3300006028 Ga0070717_10193261 Ga0070717_101932613 122
8 3300006028 Ga0070717_10203149 Ga0070717_102031491 122
9 3300009098 Ga0105245_10069436 Ga0105245_100694363 122
10 3300009098 Ga0105245_10880734 Ga0105245_108807341 122
11 3300009147 Ga0114129_10365952 Ga0114129_103659522 122
12 3300009147 Ga0114129_10912257 Ga0114129_109122572 122
13 3300009147 Ga0114129_11186942 Ga0114129_111869421 122
14 3300009148 Ga0105243_10116075 Ga0105243_101160753 122
15 3300009177 Ga0105248_10640192 Ga0105248_106401922 122
16 3300009177 Ga0105248_11046118 Ga0105248_110461182 122
17 3300009551 Ga0105238_10329696 Ga0105238_103296961 122
18 3300009551 Ga0105238_10402467 Ga0105238_104024672 122
19 3300010375 Ga0105239_11676315 Ga0105239_116763151 122
20 3300011119 Ga0105246_10199036 Ga0105246_101990363 122
21 3300011119 Ga0105246_11375884 Ga0105246_113758841 122
22 3300013296 Ga0157374_10125118 Ga0157374_101251183 122
23 3300013296 Ga0157374_10845647 Ga0157374_108456471 122
24 3300014325 Ga0163163_10116861 Ga0163163_101168613 122
25 3300014326 Ga0157380_10518613 Ga0157380_105186132 122
26 3300014969 Ga0157376_10135960 Ga0157376_101359603 122
27 3300025906 Ga0207699_10285012 Ga0207699_102850122 122
28 3300025928 Ga0207700_10229483 Ga0207700_102294832 122
29 3300025929 Ga0207664_10208600 Ga0207664_102086003 122
30 3300025933 Ga0207706_10041870 Ga0207706_100418703 122
31 3300028379 Ga0268266_10220254 Ga0268266_102202541 122
32 3300036647 Ga0316582_0188075 Ga0316582_0188075_552_962 122
33 3300036712 Ga0316584_0001009 Ga0316584_0001009_9878_10288 122
34 3300037312 Ga0395899_0108346 Ga0395899_0108346_942_1319 122
35 3300037418 Ga0395900_0079908 Ga0395900_0079908_968_1345 122
36 3300037466 Ga0395898_0120982 Ga0395898_0120982_681_1058 122
37 3300038443 Ga0395901_0032023 Ga0395901_0032023_1520_1897 122
38 3300039437 Ga0436365_0903794 Ga0436365_0903794_813_1232 122
39 3300039438 Ga0436360_1129497 Ga0436360_1129497_86_463 122
40 3300039447 Ga0436361_0572950 Ga0436361_0572950_335_712 122
41 3300045976 Ga0466967_1743619 Ga0466967_1743619_37_411 122
42 3300046492 Ga0495585_0124105 Ga0495585_0124105_595_969 122
43 3300046615 Ga0495656_0145593 Ga0495656_0145593_337_711 122
44 3300046664 Ga0495659_0054918 Ga0495659_0054918_580_954 122
45 3300048903 Ga0496100_0210950 Ga0496100_0210950_770_1174 122
46 3300048903 Ga0496100_0381653 Ga0496100_0381653_583_957 122
47 3300048903 Ga0496100_0819396 Ga0496100_0819396_173_574 122
48 3300048904 Ga0496101_0002577 Ga0496101_0002577_1608_2009 122
49 3300048904 Ga0496101_0354354 Ga0496101_0354354_389_793 122
50 3300048904 Ga0496101_0879150 Ga0496101_0879150_187_597 122
51 3300048904 Ga0496101_1581763 Ga0496101_1581763_114_488 122
52 3300048905 Ga0496102_0001868 Ga0496102_0001868_5226_5627 122
53 3300048905 Ga0496102_0227674 Ga0496102_0227674_438_842 122
54 3300048905 Ga0496102_0954535 Ga0496102_0954535_230_604 122
55 3300048906 Ga0496103_0033382 Ga0496103_0033382_1072_1473 122
56 3300048906 Ga0496103_0246031 Ga0496103_0246031_144_548 122
57 3300048907 Ga0496104_0000877 Ga0496104_0000877_8909_9283 122
58 3300048907 Ga0496104_0395508 Ga0496104_0395508_458_862 122
59 3300048908 Ga0496105_0077228 Ga0496105_0077228_48_422 122
60 3300048908 Ga0496105_0325436 Ga0496105_0325436_506_907 122
61 3300048909 Ga0496106_0001110 Ga0496106_0001110_7670_8071 122
62 3300048909 Ga0496106_0066180 Ga0496106_0066180_1276_1680 122
63 3300048909 Ga0496106_0516860 Ga0496106_0516860_494_868 122
64 3300048910 Ga0496107_0017863 Ga0496107_0017863_1225_1626 122
65 3300048910 Ga0496107_0794029 Ga0496107_0794029_221_625 122
66 3300048911 Ga0496108_0004403 Ga0496108_0004403_738_1139 122
67 3300048911 Ga0496108_0077559 Ga0496108_0077559_2254_2655 122
68 3300048911 Ga0496108_0418359 Ga0496108_0418359_374_748 122
69 3300048912 Ga0496109_0005827 Ga0496109_0005827_1117_1518 122
70 3300048912 Ga0496109_0072604 Ga0496109_0072604_630_1031 122
71 3300048912 Ga0496109_0104703 Ga0496109_0104703_266_670 122
72 3300048912 Ga0496109_0178790 Ga0496109_0178790_480_854 122
73 3300048913 Ga0496110_0004757 Ga0496110_0004757_9123_9524 122
74 3300048913 Ga0496110_0005009 Ga0496110_0005009_5161_5562 122
75 3300048913 Ga0496110_0269768 Ga0496110_0269768_933_1307 122
76 3300048913 Ga0496110_0377198 Ga0496110_0377198_534_938 122
77 3300048914 Ga0496111_0113696 Ga0496111_0113696_1077_1451 122
78 3300048914 Ga0496111_0166009 Ga0496111_0166009_604_1005 122
79 3300048914 Ga0496111_0508565 Ga0496111_0508565_266_670 122
80 3300048915 Ga0496112_0005896 Ga0496112_0005896_8025_8426 122
81 3300048915 Ga0496112_0107323 Ga0496112_0107323_1777_2151 122
82 3300048915 Ga0496112_0148666 Ga0496112_0148666_1633_2034 122
83 3300048915 Ga0496112_0306057 Ga0496112_0306057_532_936 122
84 3300048916 Ga0496113_0160011 Ga0496113_0160011_1237_1611 122
85 3300048916 Ga0496113_0204176 Ga0496113_0204176_658_1059 122
86 3300048916 Ga0496113_0214113 Ga0496113_0214113_337_741 122
87 3300048916 Ga0496113_1037530 Ga0496113_1037530_112_486 122
88 3300048917 Ga0496114_0091339 Ga0496114_0091339_1758_2159 122
89 3300048918 Ga0496115_0079825 Ga0496115_0079825_2175_2549 122
90 3300048918 Ga0496115_0368084 Ga0496115_0368084_540_941 122
91 3300048918 Ga0496115_0507387 Ga0496115_0507387_374_778 122
92 3300048924 Ga0496121_0001541 Ga0496121_0001541_37441_37845 122
93 3300049568 Ga0501031_0007081 Ga0501031_0007081_1376_1771 122
94 3300049569 Ga0501032_0000345 Ga0501032_0000345_6444_6839 122
95 3300049569 Ga0501032_0011528 Ga0501032_0011528_5726_6103 122
96 3300049570 Ga0501033_0000094 Ga0501033_0000094_70829_71224 122
97 3300049570 Ga0501033_0009628 Ga0501033_0009628_519_896 122
98 3300049571 Ga0501034_0000021 Ga0501034_0000021_13563_13958 122
99 3300049571 Ga0501034_0313235 Ga0501034_0313235_675_1052 122
100 3300049572 Ga0501036_0001704 Ga0501036_0001704_3176_3571 122
101 3300049572 Ga0501036_0013016 Ga0501036_0013016_1949_2326 122
102 3300049572 Ga0501036_0627337 Ga0501036_0627337_94_468 122
103 3300049573 Ga0501037_0000450 Ga0501037_0000450_18747_19142 122
104 3300049573 Ga0501037_0084716 Ga0501037_0084716_1673_2050 122
105 3300049574 Ga0501038_0000052 Ga0501038_0000052_13576_13971 122
106 3300049574 Ga0501038_0028787 Ga0501038_0028787_3013_3390 122
107 3300049574 Ga0501038_0759286 Ga0501038_0759286_78_452 122
108 3300049575 Ga0501039_0000549 Ga0501039_0000549_13448_13843 122
109 3300049576 Ga0501040_0195912 Ga0501040_0195912_1008_1382 122
110 3300049577 Ga0501041_0197950 Ga0501041_0197950_453_827 122
111 3300049578 Ga0501042_0090134 Ga0501042_0090134_833_1210 122
112 3300049578 Ga0501042_0119571 Ga0501042_0119571_746_1120 122
113 3300049578 Ga0501042_0912375 Ga0501042_0912375_247_621 122
114 3300049579 Ga0501043_0001704 Ga0501043_0001704_1969_2364 122
115 3300049580 Ga0501046_0002237 Ga0501046_0002237_13576_13971 122
116 3300049580 Ga0501046_0036672 Ga0501046_0036672_260_637 122
117 3300049580 Ga0501046_0179458 Ga0501046_0179458_1188_1562 122
118 3300049580 Ga0501046_0401674 Ga0501046_0401674_160_534 122
119 3300049581 Ga0501047_0000440 Ga0501047_0000440_6809_7204 122
120 3300049581 Ga0501047_0427446 Ga0501047_0427446_259_636 122
121 3300049582 Ga0501048_0001862 Ga0501048_0001862_2036_2431 122
122 3300049582 Ga0501048_0365545 Ga0501048_0365545_74_451 122
123 3300049583 Ga0501067_0000076 Ga0501067_0000076_48929_49324 122
124 3300049584 Ga0501068_0001049 Ga0501068_0001049_14045_14440 122
125 3300049584 Ga0501068_0223426 Ga0501068_0223426_544_918 122
126 3300049585 Ga0501069_0018031 Ga0501069_0018031_364_759 122
127 3300049585 Ga0501069_0173426 Ga0501069_0173426_181_582 122
128 3300049586 Ga0501070_0010753 Ga0501070_0010753_1698_2093 122
129 3300049586 Ga0501070_0833005 Ga0501070_0833005_316_693 122
130 3300049587 Ga0501071_0315516 Ga0501071_0315516_381_755 122
131 3300049588 Ga0501072_0002634 Ga0501072_0002634_10543_10938 122
132 3300049588 Ga0501072_0373095 Ga0501072_0373095_108_482 122
133 3300049588 Ga0501072_0693453 Ga0501072_0693453_124_498 122
134 3300049589 Ga0501073_0000597 Ga0501073_0000597_11475_11870 122
135 3300049589 Ga0501073_0275068 Ga0501073_0275068_544_918 122
136 3300049590 Ga0501074_0000285 Ga0501074_0000285_12118_12513 122
137 3300049590 Ga0501074_0068214 Ga0501074_0068214_875_1249 122
138 3300049591 Ga0501075_0174523 Ga0501075_0174523_313_687 122
139 3300049591 Ga0501075_0635401 Ga0501075_0635401_125_499 122
140 3300049741 Ga0501079_0027965 Ga0501079_0027965_2941_3336 122
141 3300049741 Ga0501079_0193938 Ga0501079_0193938_48_422 122
142 3300049742 Ga0501080_0001080 Ga0501080_0001080_9675_10070 122
143 3300049743 Ga0501081_0090060 Ga0501081_0090060_406_780 122
144 3300049744 Ga0501083_0000881 Ga0501083_0000881_18327_18722 122
145 3300049744 Ga0501083_0086409 Ga0501083_0086409_552_929 122
146 3300049822 Ga0501035_0000255 Ga0501035_0000255_14571_14966 122
147 3300049822 Ga0501035_0007660 Ga0501035_0007660_7872_8249 122
148 3300049822 Ga0501035_0347401 Ga0501035_0347401_227_601 122
149 3300049823 Ga0501044_0000141 Ga0501044_0000141_5052_5447 122
150 3300049823 Ga0501044_0060992 Ga0501044_0060992_2903_3280 122
151 3300049823 Ga0501044_0485944 Ga0501044_0485944_476_871 122
152 3300050491 nmdc:mga00v17_82239_c1 nmdc:mga00v17_82239_c1_356_730 122
153 3300050492 nmdc:mga0yw44_5776_c1 nmdc:mga0yw44_5776_c1_1292_1666 122
154 3300050507 nmdc:mga05p37_910783_c1 nmdc:mga05p37_910783_c1_351_725 122
155 3300050508 nmdc:mga09592_266337_c1 nmdc:mga09592_266337_c1_960_1334 122
156 3300050508 nmdc:mga09592_8971_c1 nmdc:mga09592_8971_c1_3045_3419 122
157 3300050509 nmdc:mga0qj67_108691_c1 nmdc:mga0qj67_108691_c1_1420_1794 122
158 3300050510 nmdc:mga06r32_156819_c1 nmdc:mga06r32_156819_c1_1578_1952 122
159 3300050510 nmdc:mga06r32_16932_c1 nmdc:mga06r32_16932_c1_3044_3418 122
160 3300050511 nmdc:mga08y16_1574170_c1 nmdc:mga08y16_1574170_c1_129_503 122
161 3300050512 nmdc:mga0n895_534292_c1 nmdc:mga0n895_534292_c1_533_907 122
162 3300050513 nmdc:mga0rr50_493176_c1 nmdc:mga0rr50_493176_c1_503_904 122
163 3300053139 Ga0500568_0290997 Ga0500568_0290997_74_451 122
164 3300059627 Ga0587117_022658 Ga0587117_022658_409_783 122
165 3300060353 Ga0501082_0024224 Ga0501082_0024224_3220_3615 122
166 3300061734 Ga0530510_0037913 Ga0530510_0037913_1923_2297 122
167 3300005344 Ga0070661_101243042 Ga0070661_1012430421 123
168 3300005843 Ga0068860_100539527 Ga0068860_1005395272 123
169 3300006038 Ga0075365_10303004 Ga0075365_103030042 123
170 3300006038 Ga0075365_10541360 Ga0075365_105413602 123
171 3300006881 Ga0068865_100909877 Ga0068865_1009098772 123
172 3300011119 Ga0105246_10963115 Ga0105246_109631151 123
173 3300013297 Ga0157378_11280230 Ga0157378_112802301 123
174 3300014326 Ga0157380_10198955 Ga0157380_101989553 123
175 3300014968 Ga0157379_12084888 Ga0157379_120848882 123
176 3300003215 JGI25153J46596_10012702 JGI25153J46596_100127023 124
177 3300003215 JGI25153J46596_10095157 JGI25153J46596_100951571 124
178 3300004803 Ga0058862_12620432 Ga0058862_126204322 124
179 3300004803 Ga0058862_12749426 Ga0058862_127494261 124
180 3300005327 Ga0070658_10032170 Ga0070658_100321703 124
181 3300005336 Ga0070680_100005733 Ga0070680_1000057333 124
182 3300005336 Ga0070680_100109472 Ga0070680_1001094723 124
183 3300005339 Ga0070660_100023815 Ga0070660_1000238153 124
184 3300005339 Ga0070660_100036932 Ga0070660_1000369323 124
185 3300005345 Ga0070692_10618397 Ga0070692_106183971 124
186 3300005436 Ga0070713_100003041 Ga0070713_10000304111 124
187 3300005439 Ga0070711_100196758 Ga0070711_1001967582 124
188 3300005444 Ga0070694_100682990 Ga0070694_1006829902 124
189 3300005455 Ga0070663_101097129 Ga0070663_1010971292 124
190 3300005458 Ga0070681_10004121 Ga0070681_100041217 124
191 3300005458 Ga0070681_10141034 Ga0070681_101410342 124
192 3300005458 Ga0070681_10308652 Ga0070681_103086522 124
193 3300005467 Ga0070706_100252183 Ga0070706_1002521832 124
194 3300005468 Ga0070707_100343335 Ga0070707_1003433352 124
195 3300005471 Ga0070698_100892384 Ga0070698_1008923841 124
196 3300005471 Ga0070698_101241090 Ga0070698_1012410901 124
197 3300005530 Ga0070679_100008686 Ga0070679_10000868617 124
198 3300005530 Ga0070679_100059322 Ga0070679_1000593226 124
199 3300005530 Ga0070679_100517168 Ga0070679_1005171682 124
200 3300005547 Ga0070693_100072749 Ga0070693_1000727493 124
201 3300005549 Ga0070704_100912527 Ga0070704_1009125272 124
202 3300005563 Ga0068855_100030257 Ga0068855_1000302578 124
203 3300005616 Ga0068852_100817534 Ga0068852_1008175342 124
204 3300005617 Ga0068859_100696719 Ga0068859_1006967192 124
205 3300005618 Ga0068864_100981964 Ga0068864_1009819641 124
206 3300005937 Ga0081455_10002425 Ga0081455_1000242517 124
207 3300005937 Ga0081455_10094886 Ga0081455_100948862 124
208 3300005981 Ga0081538_10165839 Ga0081538_101658392 124
209 3300005983 Ga0081540_1135422 Ga0081540_11354222 124
210 3300005985 Ga0081539_10054428 Ga0081539_100544283 124
211 3300006028 Ga0070717_10554722 Ga0070717_105547221 124
212 3300006175 Ga0070712_100123232 Ga0070712_1001232322 124
213 3300006177 Ga0075362_10073846 Ga0075362_100738462 124
214 3300006177 Ga0075362_10240335 Ga0075362_102403352 124
215 3300006178 Ga0075367_10061301 Ga0075367_100613013 124
216 3300006195 Ga0075366_10038100 Ga0075366_100381003 124
217 3300006195 Ga0075366_10069373 Ga0075366_100693733 124
218 3300006195 Ga0075366_10731434 Ga0075366_107314341 124
219 3300006844 Ga0075428_100414073 Ga0075428_1004140733 124
220 3300006847 Ga0075431_100030686 Ga0075431_1000306866 124
221 3300006852 Ga0075433_10138919 Ga0075433_101389193 124
222 3300006871 Ga0075434_100156845 Ga0075434_1001568453 124
223 3300006871 Ga0075434_100165496 Ga0075434_1001654963 124
224 3300006931 Ga0097620_100696733 Ga0097620_1006967332 124
225 3300006931 Ga0097620_101682728 Ga0097620_1016827282 124
226 3300007076 Ga0075435_100133219 Ga0075435_1001332192 124
227 3300007076 Ga0075435_100136316 Ga0075435_1001363162 124
228 3300007265 Ga0099794_10036846 Ga0099794_100368461 124
229 3300007788 Ga0099795_10096832 Ga0099795_100968321 124
230 3300009093 Ga0105240_10015848 Ga0105240_100158482 124
231 3300009094 Ga0111539_11562896 Ga0111539_115628962 124
232 3300009147 Ga0114129_10056000 Ga0114129_100560003 124
233 3300009147 Ga0114129_11380762 Ga0114129_113807622 124
234 3300009148 Ga0105243_10244414 Ga0105243_102444142 124
235 3300009551 Ga0105238_11668683 Ga0105238_116686831 124
236 3300009988 Ga0105035_124906 Ga0105035_1249061 124
237 3300010375 Ga0105239_11000590 Ga0105239_110005902 124
238 3300012475 Ga0157317_1006105 Ga0157317_10061052 124
239 3300013100 Ga0157373_10779500 Ga0157373_107795001 124
240 3300013102 Ga0157371_10107692 Ga0157371_101076922 124
241 3300013102 Ga0157371_10363406 Ga0157371_103634062 124
242 3300013104 Ga0157370_10140736 Ga0157370_101407363 124
243 3300014326 Ga0157380_10255117 Ga0157380_102551172 124
244 3300014326 Ga0157380_10972099 Ga0157380_109720992 124
245 3300020069 Ga0197907_10403598 Ga0197907_104035982 124
246 3300020070 Ga0206356_11260616 Ga0206356_112606162 124
247 3300020076 Ga0206355_1694710 Ga0206355_16947103 124
248 3300021361 Ga0213872_10049499 Ga0213872_100494993 124
249 3300025297 Ga0209758_1000548 Ga0209758_100054836 124
250 3300025297 Ga0209758_1052742 Ga0209758_10527423 124
251 3300025302 Ga0207426_1024287 Ga0207426_10242873 124
252 3300025885 Ga0207653_10052962 Ga0207653_100529622 124
253 3300025909 Ga0207705_10005544 Ga0207705_100055442 124
254 3300025912 Ga0207707_10009792 Ga0207707_100097922 124
255 3300025912 Ga0207707_10034403 Ga0207707_100344032 124
256 3300025913 Ga0207695_10012684 Ga0207695_1001268417 124
257 3300025915 Ga0207693_10004694 Ga0207693_1000469420 124
258 3300025916 Ga0207663_10157314 Ga0207663_101573142 124
259 3300025917 Ga0207660_10016311 Ga0207660_100163112 124
260 3300025917 Ga0207660_10023826 Ga0207660_100238264 124
261 3300025917 Ga0207660_10352527 Ga0207660_103525272 124
262 3300025919 Ga0207657_10044442 Ga0207657_100444423 124
263 3300025919 Ga0207657_10151486 Ga0207657_101514862 124
264 3300025921 Ga0207652_10013408 Ga0207652_100134083 124
265 3300025921 Ga0207652_10071805 Ga0207652_100718053 124
266 3300025921 Ga0207652_10269135 Ga0207652_102691352 124
267 3300025922 Ga0207646_10045479 Ga0207646_100454793 124
268 3300025928 Ga0207700_10114416 Ga0207700_101144162 124
269 3300025929 Ga0207664_10000478 Ga0207664_1000047828 124
270 3300025949 Ga0207667_10004001 Ga0207667_100040015 124
271 3300026023 Ga0207677_11423901 Ga0207677_114239011 124
272 3300026067 Ga0207678_10492824 Ga0207678_104928242 124
273 3300026078 Ga0207702_10518368 Ga0207702_105183682 124
274 3300026089 Ga0207648_10097104 Ga0207648_100971043 124
275 3300026142 Ga0207698_10719028 Ga0207698_107190282 124
276 3300027671 Ga0209588_1021222 Ga0209588_10212221 124
277 3300028573 Ga0265334_10145145 Ga0265334_101451452 124
278 3300028800 Ga0265338_10043919 Ga0265338_100439193 124
279 3300028800 Ga0265338_10462856 Ga0265338_104628562 124
280 3300031235 Ga0265330_10153761 Ga0265330_101537612 124
281 3300031238 Ga0265332_10254443 Ga0265332_102544431 124
282 3300031239 Ga0265328_10075839 Ga0265328_100758392 124
283 3300031239 Ga0265328_10407279 Ga0265328_104072792 124
284 3300031241 Ga0265325_10069725 Ga0265325_100697252 124
285 3300031241 Ga0265325_10096452 Ga0265325_100964522 124
286 3300031241 Ga0265325_10104334 Ga0265325_101043342 124
287 3300031242 Ga0265329_10097503 Ga0265329_100975031 124
288 3300031247 Ga0265340_10000595 Ga0265340_100005953 124
289 3300031247 Ga0265340_10020380 Ga0265340_100203803 124
290 3300031247 Ga0265340_10023676 Ga0265340_100236765 124
291 3300031247 Ga0265340_10154642 Ga0265340_101546422 124
292 3300031249 Ga0265339_10002105 Ga0265339_1000210523 124
293 3300031249 Ga0265339_10013957 Ga0265339_100139573 124
294 3300031344 Ga0265316_10005588 Ga0265316_1000558811 124
295 3300031344 Ga0265316_10079155 Ga0265316_100791552 124
296 3300031456 Ga0307513_10475149 Ga0307513_104751492 124
297 3300031595 Ga0265313_10000031 Ga0265313_10000031101 124
298 3300031595 Ga0265313_10022796 Ga0265313_100227963 124
299 3300031595 Ga0265313_10050230 Ga0265313_100502302 124
300 3300031595 Ga0265313_10140853 Ga0265313_101408532 124
301 3300031595 Ga0265313_10242318 Ga0265313_102423182 124
302 3300031711 Ga0265314_10006134 Ga0265314_1000613413 124
303 3300031711 Ga0265314_10116303 Ga0265314_101163031 124
304 3300031711 Ga0265314_10166868 Ga0265314_101668682 124
305 3300031712 Ga0265342_10002950 Ga0265342_1000295012 124
306 3300031712 Ga0265342_10009052 Ga0265342_100090523 124
307 3300031712 Ga0265342_10017557 Ga0265342_100175573 124
308 3300031712 Ga0265342_10112426 Ga0265342_101124261 124
309 3300031712 Ga0265342_10166813 Ga0265342_101668131 124
310 3300031995 Ga0307409_101596973 Ga0307409_1015969731 124
311 3300035090 Ga0373949_0027429 Ga0373949_0027429_498_872 124
312 3300035171 Ga0373946_0401209 Ga0373946_0401209_174_548 124
313 3300035691 Ga0373931_0298677 Ga0373931_0298677_247_621 124
314 3300035695 Ga0373927_0017282 Ga0373927_0017282_451_825 124
315 3300035725 Ga0373947_0058158 Ga0373947_0058158_94_468 124
316 3300037312 Ga0395899_0027617 Ga0395899_0027617_3059_3433 124
317 3300037312 Ga0395899_0091027 Ga0395899_0091027_1689_2063 124
318 3300037312 Ga0395899_0509727 Ga0395899_0509727_126_500 124
319 3300037312 Ga0395899_0638165 Ga0395899_0638165_240_614 124
320 3300037418 Ga0395900_0021199 Ga0395900_0021199_6035_6409 124
321 3300037418 Ga0395900_0366054 Ga0395900_0366054_1024_1398 124
322 3300037418 Ga0395900_0810990 Ga0395900_0810990_301_675 124
323 3300037466 Ga0395898_0012850 Ga0395898_0012850_7517_7939 124
324 3300037466 Ga0395898_0216830 Ga0395898_0216830_1142_1516 124
325 3300037471 Ga0395905_1858586 Ga0395905_1858586_14_388 124
326 3300038443 Ga0395901_0132013 Ga0395901_0132013_728_1102 124
327 3300038443 Ga0395901_0206033 Ga0395901_0206033_1158_1532 124
328 3300038443 Ga0395901_0214538 Ga0395901_0214538_1026_1400 124
329 3300039447 Ga0436361_0555071 Ga0436361_0555071_251_625 124
330 3300042001 Ga0439441_105782 Ga0439441_105782_124_498 124
331 3300042013 Ga0439456_038656 Ga0439456_038656_107_481 124
332 3300042125 Ga0450923_004336 Ga0450923_004336_1155_1529 124
333 3300042438 Ga0439459_0065286 Ga0439459_0065286_296_670 124
334 3300044684 Ga0466966_0067594 Ga0466966_0067594_593_967 124
335 3300044693 Ga0466961_0407176 Ga0466961_0407176_36_410 124
336 3300044694 Ga0466963_0052778 Ga0466963_0052778_1000_1374 124
337 3300044694 Ga0466963_0305327 Ga0466963_0305327_423_797 124
338 3300044694 Ga0466963_0461061 Ga0466963_0461061_184_558 124
339 3300044719 Ga0466971_0121746 Ga0466971_0121746_488_862 124
340 3300044765 Ga0466970_0605719 Ga0466970_0605719_237_611 124
341 3300044842 Ga0466957_0042883 Ga0466957_0042883_1229_1603 124
342 3300044842 Ga0466957_0287238 Ga0466957_0287238_563_937 124
343 3300044842 Ga0466957_0528026 Ga0466957_0528026_75_449 124
344 3300045836 Ga0466958_0087166 Ga0466958_0087166_369_743 124
345 3300045836 Ga0466958_0150677 Ga0466958_0150677_493_867 124
346 3300045836 Ga0466958_0587406 Ga0466958_0587406_268_642 124
347 3300045976 Ga0466967_0150260 Ga0466967_0150260_451_825 124
348 3300045976 Ga0466967_1060224 Ga0466967_1060224_242_616 124
349 3300045976 Ga0466967_1359010 Ga0466967_1359010_319_693 124
350 3300045976 Ga0466967_1727867 Ga0466967_1727867_238_612 124
351 3300045976 Ga0466967_1871610 Ga0466967_1871610_78_452 124
352 3300046457 Ga0495590_0036240 Ga0495590_0036240_1200_1574 124
353 3300046460 Ga0495638_0091275 Ga0495638_0091275_890_1264 124
354 3300046460 Ga0495638_0157555 Ga0495638_0157555_888_1262 124
355 3300046473 Ga0495582_0063214 Ga0495582_0063214_307_681 124
356 3300046491 Ga0495584_0362676 Ga0495584_0362676_91_465 124
357 3300046492 Ga0495585_0230885 Ga0495585_0230885_384_758 124
358 3300046499 Ga0495594_0239537 Ga0495594_0239537_10_384 124
359 3300046517 Ga0495630_0261513 Ga0495630_0261513_669_1043 124
360 3300046681 Ga0495647_0023189 Ga0495647_0023189_1161_1535 124
361 3300046683 Ga0495658_0060255 Ga0495658_0060255_981_1355 124
362 3300046684 Ga0495669_0161196 Ga0495669_0161196_246_620 124
363 3300046689 Ga0495613_0433095 Ga0495613_0433095_72_446 124
364 3300046794 Ga0495589_0162433 Ga0495589_0162433_347_721 124
365 3300046794 Ga0495589_0291718 Ga0495589_0291718_252_626 124
366 3300047315 Ga0495581_0486163 Ga0495581_0486163_247_621 124
367 3300048913 Ga0496110_0062768 Ga0496110_0062768_823_1197 124
368 3300049569 Ga0501032_0404353 Ga0501032_0404353_303_677 124
369 3300049570 Ga0501033_0311759 Ga0501033_0311759_128_502 124
370 3300049570 Ga0501033_0341811 Ga0501033_0341811_58_432 124
371 3300049570 Ga0501033_0720528 Ga0501033_0720528_254_628 124
372 3300049571 Ga0501034_0064668 Ga0501034_0064668_2159_2533 124
373 3300049571 Ga0501034_0181982 Ga0501034_0181982_1611_1985 124
374 3300049571 Ga0501034_0185763 Ga0501034_0185763_284_658 124
375 3300049571 Ga0501034_0371497 Ga0501034_0371497_23_397 124
376 3300049571 Ga0501034_0514381 Ga0501034_0514381_692_1066 124
377 3300049571 Ga0501034_1172362 Ga0501034_1172362_26_400 124
378 3300049572 Ga0501036_0315601 Ga0501036_0315601_134_508 124
379 3300049573 Ga0501037_0061670 Ga0501037_0061670_1902_2276 124
380 3300049573 Ga0501037_0081205 Ga0501037_0081205_50_424 124
381 3300049574 Ga0501038_0066442 Ga0501038_0066442_1978_2352 124
382 3300049574 Ga0501038_0139780 Ga0501038_0139780_1461_1835 124
383 3300049574 Ga0501038_0479288 Ga0501038_0479288_13_387 124
384 3300049575 Ga0501039_0949539 Ga0501039_0949539_72_446 124
385 3300049579 Ga0501043_0054177 Ga0501043_0054177_1449_1823 124
386 3300049579 Ga0501043_0192378 Ga0501043_0192378_941_1315 124
387 3300049579 Ga0501043_0292192 Ga0501043_0292192_681_1055 124
388 3300049579 Ga0501043_0358593 Ga0501043_0358593_180_554 124
389 3300049580 Ga0501046_0518728 Ga0501046_0518728_299_673 124
390 3300049580 Ga0501046_0729312 Ga0501046_0729312_214_588 124
391 3300049581 Ga0501047_0016976 Ga0501047_0016976_2452_2826 124
392 3300049581 Ga0501047_0030355 Ga0501047_0030355_4426_4800 124
393 3300049581 Ga0501047_0063944 Ga0501047_0063944_1114_1488 124
394 3300049581 Ga0501047_0138620 Ga0501047_0138620_1676_2050 124
395 3300049581 Ga0501047_0527954 Ga0501047_0527954_559_933 124
396 3300049582 Ga0501048_0360186 Ga0501048_0360186_593_967 124
397 3300049583 Ga0501067_0008019 Ga0501067_0008019_4958_5332 124
398 3300049583 Ga0501067_0873642 Ga0501067_0873642_110_484 124
399 3300049585 Ga0501069_0048488 Ga0501069_0048488_70_444 124
400 3300049585 Ga0501069_0145115 Ga0501069_0145115_856_1230 124
401 3300049586 Ga0501070_0054403 Ga0501070_0054403_1271_1645 124
402 3300049586 Ga0501070_0097895 Ga0501070_0097895_596_970 124
403 3300049586 Ga0501070_0146838 Ga0501070_0146838_139_513 124
404 3300049586 Ga0501070_0148387 Ga0501070_0148387_813_1187 124
405 3300049586 Ga0501070_0160366 Ga0501070_0160366_705_1079 124
406 3300049588 Ga0501072_0239075 Ga0501072_0239075_952_1326 124
407 3300049588 Ga0501072_0917579 Ga0501072_0917579_53_427 124
408 3300049589 Ga0501073_0024093 Ga0501073_0024093_3585_3959 124
409 3300049589 Ga0501073_0037517 Ga0501073_0037517_2878_3252 124
410 3300049589 Ga0501073_0315066 Ga0501073_0315066_43_417 124
411 3300049589 Ga0501073_0464128 Ga0501073_0464128_483_857 124
412 3300049589 Ga0501073_0546339 Ga0501073_0546339_332_706 124
413 3300049589 Ga0501073_0911146 Ga0501073_0911146_49_423 124
414 3300049590 Ga0501074_0261439 Ga0501074_0261439_792_1166 124
415 3300049590 Ga0501074_0534590 Ga0501074_0534590_20_394 124
416 3300049593 Ga0501077_0634198 Ga0501077_0634198_278_652 124
417 3300049741 Ga0501079_0328970 Ga0501079_0328970_407_781 124
418 3300049741 Ga0501079_1331169 Ga0501079_1331169_134_508 124
419 3300049742 Ga0501080_0016495 Ga0501080_0016495_3442_3816 124
420 3300049742 Ga0501080_0091018 Ga0501080_0091018_326_700 124
421 3300049742 Ga0501080_0109688 Ga0501080_0109688_428_802 124
422 3300049742 Ga0501080_0696167 Ga0501080_0696167_351_725 124
423 3300049742 Ga0501080_0709197 Ga0501080_0709197_276_650 124
424 3300049742 Ga0501080_1338100 Ga0501080_1338100_149_523 124
425 3300049744 Ga0501083_0007860 Ga0501083_0007860_4050_4424 124
426 3300049744 Ga0501083_0061997 Ga0501083_0061997_646_1101 124
427 3300049822 Ga0501035_0001116 Ga0501035_0001116_2146_2520 124
428 3300049822 Ga0501035_0168444 Ga0501035_0168444_780_1154 124
429 3300049822 Ga0501035_0351623 Ga0501035_0351623_337_711 124
430 3300049822 Ga0501035_0390304 Ga0501035_0390304_343_717 124
431 3300049822 Ga0501035_0975551 Ga0501035_0975551_129_503 124
432 3300049823 Ga0501044_0061315 Ga0501044_0061315_49_423 124
433 3300049823 Ga0501044_0182883 Ga0501044_0182883_423_797 124
434 3300049823 Ga0501044_0272626 Ga0501044_0272626_423_797 124
435 3300049823 Ga0501044_0685084 Ga0501044_0685084_525_899 124
436 3300049823 Ga0501044_0809778 Ga0501044_0809778_189_563 124
437 3300050489 nmdc:mga03683_175413_c1 nmdc:mga03683_175413_c1_346_720 124
438 3300050489 nmdc:mga03683_58457_c1 nmdc:mga03683_58457_c1_1123_1497 124
439 3300050491 nmdc:mga00v17_424560_c1 nmdc:mga00v17_424560_c1_58_432 124
440 3300050493 nmdc:mga0k408_2835_c1 nmdc:mga0k408_2835_c1_6727_7101 124
441 3300050493 nmdc:mga0k408_449502_c1 nmdc:mga0k408_449502_c1_245_619 124
442 3300050493 nmdc:mga0k408_7859_c1 nmdc:mga0k408_7859_c1_4154_4528 124
443 3300050496 nmdc:mga07m45_47271_c1 nmdc:mga07m45_47271_c1_1475_1849 124
444 3300050496 nmdc:mga07m45_561051_c1 nmdc:mga07m45_561051_c1_151_525 124
445 3300050507 nmdc:mga05p37_14706_c1 nmdc:mga05p37_14706_c1_2286_2666 124
446 3300050507 nmdc:mga05p37_265187_c1 nmdc:mga05p37_265187_c1_149_523 124
447 3300050508 nmdc:mga09592_1108952_c1 nmdc:mga09592_1108952_c1_173_547 124
448 3300050508 nmdc:mga09592_285401_c1 nmdc:mga09592_285401_c1_1027_1401 124
449 3300050510 nmdc:mga06r32_87514_c1 nmdc:mga06r32_87514_c1_2209_2589 124
450 3300050512 nmdc:mga0n895_124497_c1 nmdc:mga0n895_124497_c1_1188_1562 124
451 3300050513 nmdc:mga0rr50_616040_c1 nmdc:mga0rr50_616040_c1_542_916 124
452 3300050514 nmdc:mga08x19_82647_c1 nmdc:mga08x19_82647_c1_1365_1739 124
453 3300050515 nmdc:mga0a205_27812_c1 nmdc:mga0a205_27812_c1_2804_3178 124
454 3300053077 Ga0495601_1083712 Ga0495601_1083712_75_449 124
455 3300053084 Ga0495595_0325298 Ga0495595_0325298_283_657 124
456 3300053085 Ga0495619_0364946 Ga0495619_0364946_341_715 124
457 3300053087 Ga0500643_001596 Ga0500643_001596_1419_1793 124
458 3300053087 Ga0500643_112762 Ga0500643_112762_199_663 124
459 3300053088 Ga0500644_0007015 Ga0500644_0007015_1070_1444 124
460 3300053093 Ga0500651_0047561 Ga0500651_0047561_1232_1606 124
461 3300053094 Ga0500566_0086112 Ga0500566_0086112_951_1325 124
462 3300053104 Ga0500556_0190192 Ga0500556_0190192_184_558 124
463 3300053119 Ga0500595_000016 Ga0500595_000016_144928_145302 124
464 3300053130 Ga0500642_0043920 Ga0500642_0043920_864_1238 124
465 3300053131 Ga0500652_132321 Ga0500652_132321_563_937 124
466 3300053131 Ga0500652_240738 Ga0500652_240738_59_433 124
467 3300053139 Ga0500568_0212978 Ga0500568_0212978_275_649 124
468 3300053140 Ga0500573_0139542 Ga0500573_0139542_873_1247 124
469 3300053140 Ga0500573_0434933 Ga0500573_0434933_101_475 124
470 3300053142 Ga0500577_0082986 Ga0500577_0082986_152_526 124
471 3300053153 Ga0500616_0000006 Ga0500616_0000006_575754_576128 124
472 3300053730 Ga0500645_021076 Ga0500645_021076_83_457 124
473 3300054114 Ga0501084_0636089 Ga0501084_0636089_104_478 124
474 3300054114 Ga0501084_0673691 Ga0501084_0673691_230_604 124
475 3300054114 Ga0501084_0835028 Ga0501084_0835028_233_607 124
476 3300054114 Ga0501084_0867267 Ga0501084_0867267_195_569 124
477 3300059641 Ga0587068_153057 Ga0587068_153057_41_415 124
478 3300059647 Ga0587079_226678 Ga0587079_226678_126_500 124
479 3300060344 Ga0587071_045962 Ga0587071_045962_285_659 124
480 3300060353 Ga0501082_0508045 Ga0501082_0508045_591_965 124
481 3300060353 Ga0501082_1219068 Ga0501082_1219068_261_635 124
482 3300060353 Ga0501082_1244332 Ga0501082_1244332_59_433 124
483 3300061719 Ga0466962_0127681 Ga0466962_0127681_459_833 124
484 3300061719 Ga0466962_0273108 Ga0466962_0273108_254_628 124
485 3300003215 JGI25153J46596_10000830 JGI25153J46596_100008309 125
486 3300005341 Ga0070691_10000386 Ga0070691_100003866 125
487 3300005344 Ga0070661_100318049 Ga0070661_1003180492 125
488 3300005354 Ga0070675_100074637 Ga0070675_1000746373 125
489 3300005356 Ga0070674_100114332 Ga0070674_1001143322 125
490 3300005364 Ga0070673_100147687 Ga0070673_1001476872 125
491 3300005434 Ga0070709_10053838 Ga0070709_100538383 125
492 3300005434 Ga0070709_10131938 Ga0070709_101319381 125
493 3300005435 Ga0070714_101006647 Ga0070714_1010066472 125
494 3300005436 Ga0070713_100178759 Ga0070713_1001787592 125
495 3300005437 Ga0070710_10163657 Ga0070710_101636573 125
496 3300005439 Ga0070711_100491404 Ga0070711_1004914041 125
497 3300005441 Ga0070700_100194781 Ga0070700_1001947812 125
498 3300005458 Ga0070681_10676177 Ga0070681_106761772 125
499 3300005518 Ga0070699_100260514 Ga0070699_1002605143 125
500 3300005539 Ga0068853_100002660 Ga0068853_1000026601 125
501 3300005544 Ga0070686_100426219 Ga0070686_1004262192 125
502 3300005545 Ga0070695_100009518 Ga0070695_1000095183 125
503 3300005547 Ga0070693_100236837 Ga0070693_1002368372 125
504 3300005548 Ga0070665_100391897 Ga0070665_1003918972 125
505 3300005563 Ga0068855_100023189 Ga0068855_1000231893 125
506 3300005577 Ga0068857_100038829 Ga0068857_1000388293 125
507 3300005577 Ga0068857_100700986 Ga0068857_1007009862 125
508 3300005578 Ga0068854_100851709 Ga0068854_1008517092 125
509 3300005614 Ga0068856_100002049 Ga0068856_10000204921 125
510 3300005614 Ga0068856_100307468 Ga0068856_1003074683 125
511 3300005616 Ga0068852_100278911 Ga0068852_1002789113 125
512 3300005618 Ga0068864_100888443 Ga0068864_1008884432 125
513 3300005842 Ga0068858_100875977 Ga0068858_1008759772 125
514 3300006028 Ga0070717_10044826 Ga0070717_100448263 125
515 3300006038 Ga0075365_10187528 Ga0075365_101875283 125
516 3300006038 Ga0075365_10649278 Ga0075365_106492782 125
517 3300006042 Ga0075368_10162971 Ga0075368_101629712 125
518 3300006051 Ga0075364_10214500 Ga0075364_102145002 125
519 3300006178 Ga0075367_10156657 Ga0075367_101566572 125
520 3300006178 Ga0075367_10260480 Ga0075367_102604802 125
521 3300006914 Ga0075436_100067120 Ga0075436_1000671203 125
522 3300009093 Ga0105240_10029762 Ga0105240_100297623 125
523 3300009094 Ga0111539_10619937 Ga0111539_106199372 125
524 3300009174 Ga0105241_10019842 Ga0105241_100198428 125
525 3300009545 Ga0105237_10003253 Ga0105237_1000325315 125
526 3300009551 Ga0105238_10001939 Ga0105238_1000193925 125
527 3300010375 Ga0105239_10024925 Ga0105239_100249254 125
528 3300010375 Ga0105239_11672828 Ga0105239_116728281 125
529 3300010375 Ga0105239_12004665 Ga0105239_120046652 125
530 3300013100 Ga0157373_10000820 Ga0157373_1000082014 125
531 3300013104 Ga0157370_10003448 Ga0157370_100034488 125
532 3300013105 Ga0157369_10001535 Ga0157369_1000153525 125
533 3300013296 Ga0157374_10066829 Ga0157374_100668295 125
534 3300013296 Ga0157374_11962262 Ga0157374_119622622 125
535 3300013297 Ga0157378_11067825 Ga0157378_110678251 125
536 3300013306 Ga0163162_10464185 Ga0163162_104641852 125
537 3300013307 Ga0157372_10008268 Ga0157372_100082689 125
538 3300014325 Ga0163163_10382703 Ga0163163_103827032 125
539 3300014325 Ga0163163_10542471 Ga0163163_105424712 125
540 3300014968 Ga0157379_10007681 Ga0157379_1000768115 125
541 3300014969 Ga0157376_12201688 Ga0157376_122016882 125
542 3300015262 Ga0182007_10293798 Ga0182007_102937981 125
543 3300020070 Ga0206356_10699909 Ga0206356_106999091 125
544 3300020070 Ga0206356_11379387 Ga0206356_113793871 125
545 3300020078 Ga0206352_10038065 Ga0206352_100380651 125
546 3300020078 Ga0206352_10824787 Ga0206352_108247873 125
547 3300020081 Ga0206354_10362155 Ga0206354_103621552 125
548 3300020082 Ga0206353_10245002 Ga0206353_102450021 125
549 3300021361 Ga0213872_10110389 Ga0213872_101103892 125
550 3300021377 Ga0213874_10101088 Ga0213874_101010882 125
551 3300021384 Ga0213876_10000421 Ga0213876_1000042135 125
552 3300022467 Ga0224712_10200510 Ga0224712_102005101 125
553 3300025297 Ga0209758_1000013 Ga0209758_1000013888 125
554 3300025898 Ga0207692_10679238 Ga0207692_106792382 125
555 3300025899 Ga0207642_10112122 Ga0207642_101121222 125
556 3300025901 Ga0207688_10230680 Ga0207688_102306803 125
557 3300025905 Ga0207685_10170302 Ga0207685_101703023 125
558 3300025905 Ga0207685_10191194 Ga0207685_101911941 125
559 3300025906 Ga0207699_10048706 Ga0207699_100487063 125
560 3300025906 Ga0207699_10125854 Ga0207699_101258543 125
561 3300025908 Ga0207643_10732483 Ga0207643_107324832 125
562 3300025912 Ga0207707_10267476 Ga0207707_102674762 125
563 3300025912 Ga0207707_11109240 Ga0207707_111092402 125
564 3300025913 Ga0207695_10120619 Ga0207695_101206192 125
565 3300025913 Ga0207695_10161789 Ga0207695_101617893 125
566 3300025914 Ga0207671_10041568 Ga0207671_100415681 125
567 3300025928 Ga0207700_10694273 Ga0207700_106942731 125
568 3300025928 Ga0207700_11079816 Ga0207700_110798161 125
569 3300025929 Ga0207664_10286647 Ga0207664_102866473 125
570 3300025929 Ga0207664_10456449 Ga0207664_104564492 125
571 3300025933 Ga0207706_11321384 Ga0207706_113213842 125
572 3300025937 Ga0207669_10078273 Ga0207669_100782732 125
573 3300025938 Ga0207704_10204288 Ga0207704_102042882 125
574 3300025939 Ga0207665_10196776 Ga0207665_101967763 125
575 3300025949 Ga0207667_10012207 Ga0207667_1001220711 125
576 3300025949 Ga0207667_11524714 Ga0207667_115247141 125
577 3300025981 Ga0207640_11040293 Ga0207640_110402931 125
578 3300026035 Ga0207703_11572392 Ga0207703_115723921 125
579 3300026041 Ga0207639_10017714 Ga0207639_100177146 125
580 3300026075 Ga0207708_10481178 Ga0207708_104811781 125
581 3300026078 Ga0207702_10011946 Ga0207702_100119467 125
582 3300026095 Ga0207676_10420265 Ga0207676_104202652 125
583 3300026116 Ga0207674_10001605 Ga0207674_1000160516 125
584 3300026142 Ga0207698_11214340 Ga0207698_112143402 125
585 3300027512 Ga0209179_1000116 Ga0209179_10001164 125
586 3300027866 Ga0209813_10101548 Ga0209813_101015482 125
587 3300027866 Ga0209813_10170364 Ga0209813_101703642 125
588 3300028556 Ga0265337_1198661 Ga0265337_11986612 125
589 3300028573 Ga0265334_10129897 Ga0265334_101298971 125
590 3300031238 Ga0265332_10121255 Ga0265332_101212552 125
591 3300031241 Ga0265325_10243580 Ga0265325_102435802 125
592 3300031247 Ga0265340_10010231 Ga0265340_100102315 125
593 3300031247 Ga0265340_10023130 Ga0265340_100231303 125
594 3300031595 Ga0265313_10003687 Ga0265313_100036877 125
595 3300031595 Ga0265313_10005420 Ga0265313_100054205 125
596 3300031595 Ga0265313_10036516 Ga0265313_100365162 125
597 3300031595 Ga0265313_10183845 Ga0265313_101838451 125
598 3300031711 Ga0265314_10004990 Ga0265314_1000499017 125
599 3300031712 Ga0265342_10080105 Ga0265342_100801053 125
600 3300031731 Ga0307405_11571364 Ga0307405_115713641 125
601 3300031824 Ga0307413_10463563 Ga0307413_104635632 125
602 3300031852 Ga0307410_10599571 Ga0307410_105995711 125
603 3300031901 Ga0307406_11517626 Ga0307406_115176261 125
604 3300031901 Ga0307406_11805906 Ga0307406_118059061 125
605 3300031903 Ga0307407_10216363 Ga0307407_102163633 125
606 3300031911 Ga0307412_11650853 Ga0307412_116508531 125
607 3300031995 Ga0307409_100297855 Ga0307409_1002978553 125
608 3300031995 Ga0307409_101818529 Ga0307409_1018185292 125
609 3300034816 Ga0373930_0170420 Ga0373930_0170420_46_423 125
610 3300034957 Ga0373938_0145369 Ga0373938_0145369_229_606 125
611 3300035083 Ga0373926_0261108 Ga0373926_0261108_16_399 125
612 3300035113 Ga0373936_0015784 Ga0373936_0015784_699_1082 125
613 3300035115 Ga0373941_0091707 Ga0373941_0091707_23_400 125
614 3300035115 Ga0373941_0100106 Ga0373941_0100106_259_636 125
615 3300035116 Ga0373945_0035220 Ga0373945_0035220_1155_1538 125
616 3300035117 Ga0373953_0035794 Ga0373953_0035794_1029_1412 125
617 3300035118 Ga0373954_0002715 Ga0373954_0002715_6766_7149 125
618 3300035120 Ga0373957_0057994 Ga0373957_0057994_236_619 125
619 3300035170 Ga0373943_0013145 Ga0373943_0013145_1020_1403 125
620 3300035171 Ga0373946_0010959 Ga0373946_0010959_2401_2784 125
621 3300035172 Ga0373955_0001002 Ga0373955_0001002_6857_7240 125
622 3300035410 Ga0373924_0045870 Ga0373924_0045870_332_715 125
623 3300035691 Ga0373931_0103890 Ga0373931_0103890_157_534 125
624 3300035691 Ga0373931_0460339 Ga0373931_0460339_186_569 125
625 3300035691 Ga0373931_0563181 Ga0373931_0563181_281_658 125
626 3300035692 Ga0373935_0000768 Ga0373935_0000768_4077_4460 125
627 3300035692 Ga0373935_0060054 Ga0373935_0060054_1932_2309 125
628 3300035695 Ga0373927_0017738 Ga0373927_0017738_3906_4289 125
629 3300035725 Ga0373947_0005394 Ga0373947_0005394_4964_5347 125
630 3300036401 Ga0373937_0000057 Ga0373937_0000057_4016_4399 125
631 3300037068 Ga0373925_0000435 Ga0373925_0000435_32155_32538 125
632 3300037068 Ga0373925_0034339 Ga0373925_0034339_85_462 125
633 3300037312 Ga0395899_0628217 Ga0395899_0628217_271_648 125
634 3300037418 Ga0395900_1372975 Ga0395900_1372975_223_600 125
635 3300037853 Ga0436364_0275541 Ga0436364_0275541_423_800 125
636 3300038443 Ga0395901_0286280 Ga0395901_0286280_542_919 125
637 3300039062 Ga0400483_057660 Ga0400483_057660_607_984 125
638 3300039062 Ga0400483_114523 Ga0400483_114523_1907_2284 125
639 3300039062 Ga0400483_151905 Ga0400483_151905_549_926 125
640 3300039062 Ga0400483_217885 Ga0400483_217885_4060_4437 125
641 3300039437 Ga0436365_0682766 Ga0436365_0682766_39_416 125
642 3300039437 Ga0436365_1078722 Ga0436365_1078722_422_799 125
643 3300039437 Ga0436365_1131499 Ga0436365_1131499_70_447 125
644 3300039447 Ga0436361_0097962 Ga0436361_0097962_875_1252 125
645 3300039450 Ga0436363_0063809 Ga0436363_0063809_203_580 125
646 3300039450 Ga0436363_1200183 Ga0436363_1200183_257_634 125
647 3300039450 Ga0436363_1679896 Ga0436363_1679896_112_489 125
648 3300041413 Ga0439465_0047897 Ga0439465_0047897_815_1192 125
649 3300042122 Ga0450920_139308 Ga0450920_139308_58_435 125
650 3300046459 Ga0495629_0003401 Ga0495629_0003401_1306_1689 125
651 3300046462 Ga0495651_0000205 Ga0495651_0000205_8560_8943 125
652 3300046463 Ga0495653_0000120 Ga0495653_0000120_12616_12999 125
653 3300046473 Ga0495582_0533630 Ga0495582_0533630_77_460 125
654 3300046476 Ga0495662_0001020 Ga0495662_0001020_5734_6117 125
655 3300046477 Ga0495664_0000023 Ga0495664_0000023_113809_114192 125
656 3300046511 Ga0495608_0000030 Ga0495608_0000030_113254_113637 125
657 3300046514 Ga0495618_0000042 Ga0495618_0000042_12616_12999 125
658 3300046516 Ga0495628_0000027 Ga0495628_0000027_12593_12976 125
659 3300046529 Ga0495652_0000041 Ga0495652_0000041_113521_113904 125
660 3300046531 Ga0495665_0088078 Ga0495665_0088078_965_1348 125
661 3300046533 Ga0495640_0000047 Ga0495640_0000047_12616_12999 125
662 3300046536 Ga0495587_0000025 Ga0495587_0000025_32193_32576 125
663 3300046543 Ga0495645_0000001 Ga0495645_0000001_544032_544415 125
664 3300046559 Ga0495667_0000001 Ga0495667_0000001_821309_821692 125
665 3300046642 Ga0495634_0002681 Ga0495634_0002681_1658_2041 125
666 3300046663 Ga0495635_0000061 Ga0495635_0000061_12616_12999 125
667 3300046675 Ga0495657_0000204 Ga0495657_0000204_52568_52951 125
668 3300046675 Ga0495657_0056504 Ga0495657_0056504_1965_2342 125
669 3300046678 Ga0495599_0000021 Ga0495599_0000021_13140_13523 125
670 3300046679 Ga0495623_0001713 Ga0495623_0001713_609_992 125
671 3300046680 Ga0495646_0000043 Ga0495646_0000043_13140_13523 125
672 3300046689 Ga0495613_0152619 Ga0495613_0152619_673_1056 125
673 3300046690 Ga0495624_0027753 Ga0495624_0027753_2491_2874 125
674 3300046809 Ga0495600_0000082 Ga0495600_0000082_39100_39483 125
675 3300047315 Ga0495581_0041004 Ga0495581_0041004_148_531 125
676 3300047317 Ga0495604_0000036 Ga0495604_0000036_12611_12994 125
677 3300047319 Ga0495674_0000085 Ga0495674_0000085_52391_52774 125
678 3300047321 Ga0495676_0338761 Ga0495676_0338761_312_695 125
679 3300047322 Ga0495680_0000201 Ga0495680_0000201_51688_52071 125
680 3300047444 Ga0495675_0000203 Ga0495675_0000203_12589_12972 125
681 3300047471 Ga0495684_0000025 Ga0495684_0000025_114039_114422 125
682 3300047673 Ga0495593_0005893 Ga0495593_0005893_1125_1508 125
683 3300048088 Ga0495602_0000097 Ga0495602_0000097_68587_68970 125
684 3300048911 Ga0496108_0626557 Ga0496108_0626557_407_784 125
685 3300048912 Ga0496109_0742846 Ga0496109_0742846_186_563 125
686 3300048924 Ga0496121_0006108 Ga0496121_0006108_1673_2050 125
687 3300048929 Ga0496126_0031566 Ga0496126_0031566_498_875 125
688 3300048929 Ga0496126_0355209 Ga0496126_0355209_459_836 125
689 3300049162 Ga0501307_067962 Ga0501307_067962_40_417 125
690 3300049571 Ga0501034_0313065 Ga0501034_0313065_557_934 125
691 3300049572 Ga0501036_0296427 Ga0501036_0296427_756_1133 125
692 3300049583 Ga0501067_0046517 Ga0501067_0046517_895_1272 125
693 3300049584 Ga0501068_0115513 Ga0501068_0115513_264_641 125
694 3300049586 Ga0501070_0120589 Ga0501070_0120589_135_512 125
695 3300049586 Ga0501070_1238427 Ga0501070_1238427_78_455 125
696 3300049587 Ga0501071_0209635 Ga0501071_0209635_439_816 125
697 3300049589 Ga0501073_0041475 Ga0501073_0041475_1060_1437 125
698 3300049589 Ga0501073_0274520 Ga0501073_0274520_14_463 125
699 3300049590 Ga0501074_0299330 Ga0501074_0299330_116_493 125
700 3300049741 Ga0501079_0086061 Ga0501079_0086061_851_1228 125
701 3300049742 Ga0501080_0067975 Ga0501080_0067975_112_489 125
702 3300049744 Ga0501083_0090565 Ga0501083_0090565_1286_1663 125
703 3300049823 Ga0501044_0074615 Ga0501044_0074615_2208_2585 125
704 3300050491 nmdc:mga00v17_384310_c1 nmdc:mga00v17_384310_c1_308_685 125
705 3300050514 nmdc:mga08x19_120860_c1 nmdc:mga08x19_120860_c1_482_859 125
706 3300053077 Ga0495601_0000025 Ga0495601_0000025_12594_12977 125
707 3300053078 Ga0495612_0000570 Ga0495612_0000570_869_1252 125
708 3300053083 Ga0495655_0069626 Ga0495655_0069626_306_683 125
709 3300053084 Ga0495595_0000041 Ga0495595_0000041_53874_54257 125
710 3300053084 Ga0495595_0283763 Ga0495595_0283763_417_794 125
711 3300053085 Ga0495619_0000035 Ga0495619_0000035_12616_12999 125
712 3300053098 Ga0500650_0233840 Ga0500650_0233840_277_654 125
713 3300053119 Ga0500595_071208 Ga0500595_071208_169_546 125
714 3300054114 Ga0501084_0290907 Ga0501084_0290907_419_796 125
715 3300060353 Ga0501082_1664670 Ga0501082_1664670_150_527 125
716 3300005329 Ga0070683_100287619 Ga0070683_1002876193 126
717 3300005336 Ga0070680_100082555 Ga0070680_1000825552 126
718 3300005434 Ga0070709_10038757 Ga0070709_100387573 126
719 3300005434 Ga0070709_10645083 Ga0070709_106450831 126
720 3300005435 Ga0070714_100020676 Ga0070714_1000206764 126
721 3300005435 Ga0070714_100222884 Ga0070714_1002228841 126
722 3300005436 Ga0070713_100001694 Ga0070713_10000169419 126
723 3300005436 Ga0070713_100352058 Ga0070713_1003520583 126
724 3300005437 Ga0070710_10015917 Ga0070710_100159174 126
725 3300005437 Ga0070710_10066577 Ga0070710_100665773 126
726 3300005439 Ga0070711_100027936 Ga0070711_1000279361 126
727 3300005458 Ga0070681_10210732 Ga0070681_102107323 126
728 3300005530 Ga0070679_100142711 Ga0070679_1001427112 126
729 3300005535 Ga0070684_100220453 Ga0070684_1002204533 126
730 3300005539 Ga0068853_100108708 Ga0068853_1001087082 126
731 3300005547 Ga0070693_100454253 Ga0070693_1004542532 126
732 3300005547 Ga0070693_100765753 Ga0070693_1007657531 126
733 3300005563 Ga0068855_100076351 Ga0068855_1000763516 126
734 3300005563 Ga0068855_100111493 Ga0068855_1001114933 126
735 3300005578 Ga0068854_100530192 Ga0068854_1005301922 126
736 3300005614 Ga0068856_100264284 Ga0068856_1002642841 126
737 3300005616 Ga0068852_100336671 Ga0068852_1003366713 126
738 3300005617 Ga0068859_100151443 Ga0068859_1001514433 126
739 3300005618 Ga0068864_100801079 Ga0068864_1008010792 126
740 3300005843 Ga0068860_100070125 Ga0068860_1000701253 126
741 3300005844 Ga0068862_100030534 Ga0068862_1000305347 126
742 3300005937 Ga0081455_10079670 Ga0081455_100796704 126
743 3300006028 Ga0070717_10123210 Ga0070717_101232102 126
744 3300006175 Ga0070712_100188090 Ga0070712_1001880902 126
745 3300006175 Ga0070712_100332996 Ga0070712_1003329963 126
746 3300006175 Ga0070712_100421841 Ga0070712_1004218412 126
747 3300006914 Ga0075436_100050481 Ga0075436_1000504813 126
748 3300006931 Ga0097620_100151443 Ga0097620_1001514434 126
749 3300009093 Ga0105240_10001231 Ga0105240_1000123129 126
750 3300009093 Ga0105240_10322237 Ga0105240_103222372 126
751 3300009101 Ga0105247_10672767 Ga0105247_106727672 126
752 3300009148 Ga0105243_11548818 Ga0105243_115488182 126
753 3300009174 Ga0105241_10619995 Ga0105241_106199951 126
754 3300009176 Ga0105242_10105043 Ga0105242_101050433 126
755 3300009551 Ga0105238_10311988 Ga0105238_103119883 126
756 3300013100 Ga0157373_10087904 Ga0157373_100879043 126
757 3300013102 Ga0157371_10567848 Ga0157371_105678482 126
758 3300013104 Ga0157370_10335875 Ga0157370_103358751 126
759 3300013105 Ga0157369_10202540 Ga0157369_102025402 126
760 3300013306 Ga0163162_10267056 Ga0163162_102670562 126
761 3300013307 Ga0157372_10210305 Ga0157372_102103052 126
762 3300020069 Ga0197907_10450514 Ga0197907_104505141 126
763 3300020078 Ga0206352_10652386 Ga0206352_106523862 126
764 3300020078 Ga0206352_11021523 Ga0206352_110215231 126
765 3300020080 Ga0206350_11469831 Ga0206350_114698312 126
766 3300020082 Ga0206353_10402798 Ga0206353_104027981 126
767 3300020610 Ga0154015_1621370 Ga0154015_16213701 126
768 3300025898 Ga0207692_10047506 Ga0207692_100475063 126
769 3300025906 Ga0207699_10442126 Ga0207699_104421261 126
770 3300025906 Ga0207699_10640397 Ga0207699_106403972 126
771 3300025906 Ga0207699_11106439 Ga0207699_111064392 126
772 3300025912 Ga0207707_11101696 Ga0207707_111016961 126
773 3300025913 Ga0207695_10001037 Ga0207695_1000103747 126
774 3300025913 Ga0207695_10497021 Ga0207695_104970211 126
775 3300025915 Ga0207693_10074737 Ga0207693_100747373 126
776 3300025915 Ga0207693_10346813 Ga0207693_103468132 126
777 3300025915 Ga0207693_10817221 Ga0207693_108172212 126
778 3300025916 Ga0207663_10121328 Ga0207663_101213282 126
779 3300025921 Ga0207652_10440775 Ga0207652_104407753 126
780 3300025924 Ga0207694_10151947 Ga0207694_101519473 126
781 3300025924 Ga0207694_10969752 Ga0207694_109697522 126
782 3300025928 Ga0207700_10071813 Ga0207700_100718133 126
783 3300025928 Ga0207700_10256038 Ga0207700_102560383 126
784 3300025929 Ga0207664_10006275 Ga0207664_100062753 126
785 3300025929 Ga0207664_10197031 Ga0207664_101970313 126
786 3300025934 Ga0207686_10595939 Ga0207686_105959391 126
787 3300025939 Ga0207665_10052174 Ga0207665_100521743 126
788 3300025939 Ga0207665_10065544 Ga0207665_100655442 126
789 3300025941 Ga0207711_10857677 Ga0207711_108576772 126
790 3300025949 Ga0207667_10062790 Ga0207667_100627906 126
791 3300025949 Ga0207667_10255836 Ga0207667_102558362 126
792 3300025981 Ga0207640_10521555 Ga0207640_105215551 126
793 3300026035 Ga0207703_10420806 Ga0207703_104208062 126
794 3300026041 Ga0207639_10913062 Ga0207639_109130621 126
795 3300026089 Ga0207648_10505893 Ga0207648_105058932 126
796 3300026142 Ga0207698_11025287 Ga0207698_110252872 126
797 3300026142 Ga0207698_11732545 Ga0207698_117325451 126
798 3300026142 Ga0207698_12697065 Ga0207698_126970652 126
799 3300028380 Ga0268265_10031542 Ga0268265_100315424 126
800 3300028380 Ga0268265_12419870 Ga0268265_124198701 126
801 3300028381 Ga0268264_10029317 Ga0268264_100293178 126
802 3300028381 Ga0268264_10437869 Ga0268264_104378693 126
803 3300028573 Ga0265334_10279855 Ga0265334_102798551 126
804 3300031241 Ga0265325_10001071 Ga0265325_1000107125 126
805 3300031241 Ga0265325_10009381 Ga0265325_100093815 126
806 3300031247 Ga0265340_10268243 Ga0265340_102682431 126
807 3300031249 Ga0265339_10001408 Ga0265339_1000140823 126
808 3300031249 Ga0265339_10094870 Ga0265339_100948703 126
809 3300031249 Ga0265339_10552650 Ga0265339_105526501 126
810 3300031250 Ga0265331_10014022 Ga0265331_100140226 126
811 3300031344 Ga0265316_10170001 Ga0265316_101700012 126
812 3300031548 Ga0307408_100910917 Ga0307408_1009109172 126
813 3300031595 Ga0265313_10003967 Ga0265313_100039672 126
814 3300031595 Ga0265313_10004533 Ga0265313_100045336 126
815 3300031595 Ga0265313_10063677 Ga0265313_100636773 126
816 3300031712 Ga0265342_10230327 Ga0265342_102303272 126
817 3300031731 Ga0307405_10541041 Ga0307405_105410412 126
818 3300032002 Ga0307416_100350392 Ga0307416_1003503922 126
819 3300035086 Ga0373934_0095854 Ga0373934_0095854_627_1007 126
820 3300035111 Ga0373923_0037057 Ga0373923_0037057_365_745 126
821 3300035114 Ga0373939_0011288 Ga0373939_0011288_299_679 126
822 3300035116 Ga0373945_0036416 Ga0373945_0036416_406_786 126
823 3300035117 Ga0373953_0015314 Ga0373953_0015314_1538_1918 126
824 3300035118 Ga0373954_0052172 Ga0373954_0052172_613_993 126
825 3300035118 Ga0373954_0226256 Ga0373954_0226256_54_434 126
826 3300035119 Ga0373956_0008190 Ga0373956_0008190_246_626 126
827 3300035119 Ga0373956_0012364 Ga0373956_0012364_1316_1696 126
828 3300035120 Ga0373957_0017927 Ga0373957_0017927_928_1308 126
829 3300035120 Ga0373957_0019472 Ga0373957_0019472_914_1294 126
830 3300035170 Ga0373943_0007567 Ga0373943_0007567_3621_4001 126
831 3300035171 Ga0373946_0211283 Ga0373946_0211283_432_812 126
832 3300035172 Ga0373955_0003246 Ga0373955_0003246_5672_6052 126
833 3300035172 Ga0373955_0041789 Ga0373955_0041789_1549_1929 126
834 3300035242 Ga0373962_0006987 Ga0373962_0006987_1110_1490 126
835 3300035410 Ga0373924_0166202 Ga0373924_0166202_148_528 126
836 3300035691 Ga0373931_0119175 Ga0373931_0119175_395_775 126
837 3300035692 Ga0373935_0033271 Ga0373935_0033271_2584_2964 126
838 3300035692 Ga0373935_0198900 Ga0373935_0198900_265_645 126
839 3300035724 Ga0373933_0012124 Ga0373933_0012124_4149_4529 126
840 3300035724 Ga0373933_0032980 Ga0373933_0032980_2402_2782 126
841 3300036401 Ga0373937_0021076 Ga0373937_0021076_2798_3178 126
842 3300036401 Ga0373937_0544377 Ga0373937_0544377_54_434 126
843 3300037068 Ga0373925_0039839 Ga0373925_0039839_2492_2872 126
844 3300044658 Ga0466972_0457002 Ga0466972_0457002_207_587 126
845 3300044735 Ga0466968_0046854 Ga0466968_0046854_1198_1578 126
846 3300044901 Ga0466960_0068146 Ga0466960_0068146_1149_1529 126
847 3300046454 Ga0495592_0014401 Ga0495592_0014401_4105_4485 126
848 3300046462 Ga0495651_0003040 Ga0495651_0003040_1993_2373 126
849 3300046462 Ga0495651_0251434 Ga0495651_0251434_487_867 126
850 3300046477 Ga0495664_0247869 Ga0495664_0247869_581_961 126
851 3300046511 Ga0495608_0079829 Ga0495608_0079829_679_1059 126
852 3300046516 Ga0495628_0088235 Ga0495628_0088235_1830_2210 126
853 3300046517 Ga0495630_0707189 Ga0495630_0707189_358_738 126
854 3300046522 Ga0495643_0311123 Ga0495643_0311123_114_494 126
855 3300046529 Ga0495652_0008048 Ga0495652_0008048_2436_2816 126
856 3300046533 Ga0495640_0276973 Ga0495640_0276973_86_466 126
857 3300046536 Ga0495587_0021132 Ga0495587_0021132_1672_2052 126
858 3300046536 Ga0495587_0039777 Ga0495587_0039777_1287_1667 126
859 3300046543 Ga0495645_0002505 Ga0495645_0002505_5633_6013 126
860 3300046559 Ga0495667_0004699 Ga0495667_0004699_43_423 126
861 3300046559 Ga0495667_0036143 Ga0495667_0036143_376_756 126
862 3300046663 Ga0495635_0157796 Ga0495635_0157796_768_1148 126
863 3300046675 Ga0495657_0009621 Ga0495657_0009621_5238_5618 126
864 3300046675 Ga0495657_0051550 Ga0495657_0051550_405_785 126
865 3300046678 Ga0495599_0002367 Ga0495599_0002367_2428_2808 126
866 3300046679 Ga0495623_0061441 Ga0495623_0061441_1451_1831 126
867 3300046680 Ga0495646_0193260 Ga0495646_0193260_329_709 126
868 3300046680 Ga0495646_0562693 Ga0495646_0562693_164_544 126
869 3300046809 Ga0495600_0071319 Ga0495600_0071319_782_1162 126
870 3300047317 Ga0495604_0003635 Ga0495604_0003635_9444_9824 126
871 3300047317 Ga0495604_0149828 Ga0495604_0149828_88_468 126
872 3300047320 Ga0495672_0000511 Ga0495672_0000511_28561_28941 126
873 3300047322 Ga0495680_0012190 Ga0495680_0012190_5182_5562 126
874 3300047322 Ga0495680_0503811 Ga0495680_0503811_327_707 126
875 3300047444 Ga0495675_0219460 Ga0495675_0219460_596_976 126
876 3300048088 Ga0495602_0069117 Ga0495602_0069117_393_773 126
877 3300048907 Ga0496104_0000399 Ga0496104_0000399_25119_25499 126
878 3300048908 Ga0496105_0002417 Ga0496105_0002417_1041_1421 126
879 3300048915 Ga0496112_1017178 Ga0496112_1017178_170_550 126
880 3300048917 Ga0496114_0409099 Ga0496114_0409099_426_806 126
881 3300049583 Ga0501067_0167333 Ga0501067_0167333_599_979 126
882 3300049588 Ga0501072_0235428 Ga0501072_0235428_628_1008 126
883 3300049589 Ga0501073_0044209 Ga0501073_0044209_582_962 126
884 3300049590 Ga0501074_0066499 Ga0501074_0066499_685_1065 126
885 3300049591 Ga0501075_1133616 Ga0501075_1133616_103_483 126
886 3300049593 Ga0501077_0230131 Ga0501077_0230131_476_856 126
887 3300049742 Ga0501080_0443378 Ga0501080_0443378_272_652 126
888 3300049744 Ga0501083_0024413 Ga0501083_0024413_3752_4132 126
889 3300049744 Ga0501083_0455955 Ga0501083_0455955_103_540 126
890 3300053077 Ga0495601_0002429 Ga0495601_0002429_5624_6004 126
891 3300053077 Ga0495601_0031396 Ga0495601_0031396_22_402 126
892 3300053078 Ga0495612_0018791 Ga0495612_0018791_589_969 126
893 3300053084 Ga0495595_0003026 Ga0495595_0003026_3498_3878 126
894 3300053084 Ga0495595_0131510 Ga0495595_0131510_703_1083 126
895 3300053085 Ga0495619_0000430 Ga0495619_0000430_27691_28071 126
896 3300054114 Ga0501084_0396959 Ga0501084_0396959_482_862 126
897 3300060353 Ga0501082_0024485 Ga0501082_0024485_3446_3826 126
898 2209111006 2214828544 2213866903 127
899 3300000042 ARSoilYngRDRAFT_c00061 ARSoilYngRDRAFT_000617 127
900 3300000043 ARcpr5yngRDRAFT_c000075 ARcpr5yngRDRAFT_00007520 127
901 3300000044 ARSoilOldRDRAFT_c000053 ARSoilOldRDRAFT_00005320 127
902 3300000045 ARCol0oldRDRAFT_c00087 ARCol0oldRDRAFT_0008710 127
903 3300000652 ARCol0yngRDRAFT_1000025 ARCol0yngRDRAFT_100002524 127
904 3300001430 JGI24032J14994_100056 JGI24032J14994_1000563 127
905 3300001915 JGI24741J21665_1021617 JGI24741J21665_10216172 127
906 3300001977 JGI24746J21847_1002046 JGI24746J21847_10020462 127
907 3300001978 JGI24747J21853_1011054 JGI24747J21853_10110542 127
908 3300001989 JGI24739J22299_10019550 JGI24739J22299_100195502 127
909 3300001990 JGI24737J22298_10019784 JGI24737J22298_100197843 127
910 3300001990 JGI24737J22298_10034285 JGI24737J22298_100342852 127
911 3300001991 JGI24743J22301_10018255 JGI24743J22301_100182552 127
912 3300001991 JGI24743J22301_10048881 JGI24743J22301_100488811 127
913 3300002067 JGI24735J21928_10183634 JGI24735J21928_101836342 127
914 3300002070 JGI24750J21931_1000316 JGI24750J21931_10003163 127
915 3300002070 JGI24750J21931_1039382 JGI24750J21931_10393821 127
916 3300002073 JGI24745J21846_1000643 JGI24745J21846_10006432 127
917 3300002074 JGI24748J21848_1006811 JGI24748J21848_10068112 127
918 3300002074 JGI24748J21848_1016126 JGI24748J21848_10161261 127
919 3300002075 JGI24738J21930_10002068 JGI24738J21930_100020686 127
920 3300002076 JGI24749J21850_1001860 JGI24749J21850_10018604 127
921 3300002076 JGI24749J21850_1007303 JGI24749J21850_10073032 127
922 3300002076 JGI24749J21850_1016726 JGI24749J21850_10167262 127
923 3300002126 JGI24035J26624_1000222 JGI24035J26624_10002223 127
924 3300002155 JGI24033J26618_1006577 JGI24033J26618_10065772 127
925 3300002239 JGI24034J26672_10000885 JGI24034J26672_100008855 127
926 3300002244 JGI24742J22300_10001777 JGI24742J22300_100017773 127
927 3300003349 JGI26129J50193_1004460 JGI26129J50193_10044601 127
928 3300005277 Ga0065716_1001548 Ga0065716_10015482 127
929 3300005289 Ga0065704_10136765 Ga0065704_101367653 127
930 3300005290 Ga0065712_10097334 Ga0065712_100973342 127
931 3300005290 Ga0065712_10154053 Ga0065712_101540532 127
932 3300005290 Ga0065712_10481422 Ga0065712_104814221 127
933 3300005293 Ga0065715_10002477 Ga0065715_100024772 127
934 3300005293 Ga0065715_10137215 Ga0065715_101372152 127
935 3300005295 Ga0065707_10221977 Ga0065707_102219772 127
936 3300005328 Ga0070676_10002419 Ga0070676_100024196 127
937 3300005328 Ga0070676_10069041 Ga0070676_100690411 127
938 3300005328 Ga0070676_10426446 Ga0070676_104264462 127
939 3300005329 Ga0070683_100001083 Ga0070683_10000108320 127
940 3300005329 Ga0070683_100016861 Ga0070683_1000168613 127
941 3300005330 Ga0070690_100018877 Ga0070690_1000188775 127
942 3300005330 Ga0070690_100101714 Ga0070690_1001017142 127
943 3300005330 Ga0070690_100193783 Ga0070690_1001937831 127
944 3300005331 Ga0070670_100016356 Ga0070670_1000163567 127
945 3300005331 Ga0070670_100620526 Ga0070670_1006205262 127
946 3300005333 Ga0070677_10000959 Ga0070677_100009596 127
947 3300005334 Ga0068869_100000755 Ga0068869_10000075528 127
948 3300005334 Ga0068869_100772730 Ga0068869_1007727302 127
949 3300005335 Ga0070666_10127070 Ga0070666_101270702 127
950 3300005336 Ga0070680_100006856 Ga0070680_1000068563 127
951 3300005336 Ga0070680_100262774 Ga0070680_1002627742 127
952 3300005336 Ga0070680_100460180 Ga0070680_1004601802 127
953 3300005336 Ga0070680_101004180 Ga0070680_1010041801 127
954 3300005337 Ga0070682_100001636 Ga0070682_1000016363 127
955 3300005337 Ga0070682_100038516 Ga0070682_1000385163 127
956 3300005337 Ga0070682_100057704 Ga0070682_1000577041 127
957 3300005337 Ga0070682_100721536 Ga0070682_1007215361 127
958 3300005338 Ga0068868_100006260 Ga0068868_10000626015 127
959 3300005338 Ga0068868_100109693 Ga0068868_1001096931 127
960 3300005338 Ga0068868_100134916 Ga0068868_1001349162 127
961 3300005339 Ga0070660_100000245 Ga0070660_10000024537 127
962 3300005339 Ga0070660_100015793 Ga0070660_1000157935 127
963 3300005339 Ga0070660_100341261 Ga0070660_1003412611 127
964 3300005340 Ga0070689_100005690 Ga0070689_1000056907 127
965 3300005340 Ga0070689_100011434 Ga0070689_1000114346 127
966 3300005340 Ga0070689_100258407 Ga0070689_1002584072 127
967 3300005341 Ga0070691_10002710 Ga0070691_100027102 127
968 3300005341 Ga0070691_10047921 Ga0070691_100479212 127
969 3300005341 Ga0070691_10496796 Ga0070691_104967961 127
970 3300005343 Ga0070687_100000348 Ga0070687_1000003483 127
971 3300005343 Ga0070687_100104754 Ga0070687_1001047542 127
972 3300005343 Ga0070687_100928955 Ga0070687_1009289551 127
973 3300005344 Ga0070661_100000017 Ga0070661_100000017166 127
974 3300005344 Ga0070661_100028862 Ga0070661_1000288623 127
975 3300005344 Ga0070661_100252395 Ga0070661_1002523952 127
976 3300005344 Ga0070661_100353327 Ga0070661_1003533271 127
977 3300005345 Ga0070692_10000101 Ga0070692_100001013 127
978 3300005347 Ga0070668_100054011 Ga0070668_1000540112 127
979 3300005347 Ga0070668_100060030 Ga0070668_1000600303 127
980 3300005347 Ga0070668_100078969 Ga0070668_1000789692 127
981 3300005353 Ga0070669_100000314 Ga0070669_10000031440 127
982 3300005353 Ga0070669_100349101 Ga0070669_1003491011 127
983 3300005354 Ga0070675_100000161 Ga0070675_10000016140 127
984 3300005354 Ga0070675_100134504 Ga0070675_1001345043 127
985 3300005355 Ga0070671_100012885 Ga0070671_1000128858 127
986 3300005355 Ga0070671_100259246 Ga0070671_1002592462 127
987 3300005356 Ga0070674_100428072 Ga0070674_1004280721 127
988 3300005364 Ga0070673_100049760 Ga0070673_1000497603 127
989 3300005364 Ga0070673_100060499 Ga0070673_1000604993 127
990 3300005364 Ga0070673_100076967 Ga0070673_1000769673 127
991 3300005364 Ga0070673_100301046 Ga0070673_1003010461 127
992 3300005365 Ga0070688_100000991 Ga0070688_10000099113 127
993 3300005365 Ga0070688_100004219 Ga0070688_1000042194 127
994 3300005365 Ga0070688_100140355 Ga0070688_1001403552 127
995 3300005365 Ga0070688_100152668 Ga0070688_1001526682 127
996 3300005366 Ga0070659_100087845 Ga0070659_1000878453 127
997 3300005366 Ga0070659_100173698 Ga0070659_1001736982 127
998 3300005366 Ga0070659_100224119 Ga0070659_1002241192 127
999 3300005366 Ga0070659_100680564 Ga0070659_1006805642 127
1000 3300005367 Ga0070667_100006114 Ga0070667_10000611411 127
1001 3300005367 Ga0070667_100026201 Ga0070667_1000262012 127
1002 3300005367 Ga0070667_100085289 Ga0070667_1000852893 127
1003 3300005367 Ga0070667_100281389 Ga0070667_1002813891 127
1004 3300005406 Ga0070703_10033785 Ga0070703_100337852 127
1005 3300005406 Ga0070703_10339604 Ga0070703_103396041 127
1006 3300005434 Ga0070709_10003934 Ga0070709_100039347 127
1007 3300005434 Ga0070709_10061805 Ga0070709_100618053 127
1008 3300005435 Ga0070714_100488848 Ga0070714_1004888481 127
1009 3300005436 Ga0070713_100015926 Ga0070713_1000159269 127
1010 3300005436 Ga0070713_100160468 Ga0070713_1001604682 127
1011 3300005437 Ga0070710_10034381 Ga0070710_100343813 127
1012 3300005437 Ga0070710_10394949 Ga0070710_103949491 127
1013 3300005438 Ga0070701_10000204 Ga0070701_1000020410 127
1014 3300005438 Ga0070701_10012407 Ga0070701_100124074 127
1015 3300005438 Ga0070701_10466967 Ga0070701_104669671 127
1016 3300005439 Ga0070711_100007210 Ga0070711_1000072106 127
1017 3300005439 Ga0070711_100056777 Ga0070711_1000567773 127
1018 3300005439 Ga0070711_100065901 Ga0070711_1000659013 127
1019 3300005440 Ga0070705_100004847 Ga0070705_1000048476 127
1020 3300005440 Ga0070705_100049688 Ga0070705_1000496883 127
1021 3300005440 Ga0070705_100396479 Ga0070705_1003964792 127
1022 3300005441 Ga0070700_100000856 Ga0070700_1000008563 127
1023 3300005441 Ga0070700_100309989 Ga0070700_1003099891 127
1024 3300005444 Ga0070694_100021165 Ga0070694_1000211656 127
1025 3300005445 Ga0070708_100050068 Ga0070708_1000500683 127
1026 3300005455 Ga0070663_100000945 Ga0070663_1000009453 127
1027 3300005455 Ga0070663_100017856 Ga0070663_1000178566 127
1028 3300005455 Ga0070663_100048584 Ga0070663_1000485843 127
1029 3300005455 Ga0070663_100185939 Ga0070663_1001859391 127
1030 3300005455 Ga0070663_100775360 Ga0070663_1007753601 127
1031 3300005456 Ga0070678_100007929 Ga0070678_1000079298 127
1032 3300005456 Ga0070678_100028978 Ga0070678_1000289781 127
1033 3300005456 Ga0070678_100132698 Ga0070678_1001326983 127
1034 3300005456 Ga0070678_100495806 Ga0070678_1004958062 127
1035 3300005457 Ga0070662_100026862 Ga0070662_1000268623 127
1036 3300005457 Ga0070662_100042156 Ga0070662_1000421562 127
1037 3300005457 Ga0070662_100506425 Ga0070662_1005064251 127
1038 3300005458 Ga0070681_10005192 Ga0070681_1000519213 127
1039 3300005458 Ga0070681_10019257 Ga0070681_100192577 127
1040 3300005458 Ga0070681_10045790 Ga0070681_100457904 127
1041 3300005459 Ga0068867_100002227 Ga0068867_1000022273 127
1042 3300005459 Ga0068867_100104555 Ga0068867_1001045552 127
1043 3300005466 Ga0070685_10019677 Ga0070685_100196774 127
1044 3300005466 Ga0070685_10088882 Ga0070685_100888823 127
1045 3300005466 Ga0070685_10284367 Ga0070685_102843672 127
1046 3300005466 Ga0070685_10504412 Ga0070685_105044121 127
1047 3300005518 Ga0070699_101395070 Ga0070699_1013950702 127
1048 3300005518 Ga0070699_101775677 Ga0070699_1017756771 127
1049 3300005530 Ga0070679_100075114 Ga0070679_1000751143 127
1050 3300005530 Ga0070679_100104463 Ga0070679_1001044633 127
1051 3300005530 Ga0070679_100358533 Ga0070679_1003585332 127
1052 3300005535 Ga0070684_100000365 Ga0070684_10000036533 127
1053 3300005535 Ga0070684_100113259 Ga0070684_1001132593 127
1054 3300005535 Ga0070684_100150473 Ga0070684_1001504731 127
1055 3300005536 Ga0070697_100654122 Ga0070697_1006541221 127
1056 3300005539 Ga0068853_100002095 Ga0068853_1000020959 127
1057 3300005539 Ga0068853_100098304 Ga0068853_1000983041 127
1058 3300005539 Ga0068853_100337036 Ga0068853_1003370362 127
1059 3300005543 Ga0070672_100049173 Ga0070672_1000491732 127
1060 3300005543 Ga0070672_100289492 Ga0070672_1002894922 127
1061 3300005543 Ga0070672_100799995 Ga0070672_1007999952 127
1062 3300005544 Ga0070686_100002828 Ga0070686_1000028288 127
1063 3300005544 Ga0070686_100078063 Ga0070686_1000780632 127
1064 3300005544 Ga0070686_100445279 Ga0070686_1004452792 127
1065 3300005545 Ga0070695_100012934 Ga0070695_1000129345 127
1066 3300005545 Ga0070695_100048370 Ga0070695_1000483702 127
1067 3300005545 Ga0070695_100090371 Ga0070695_1000903711 127
1068 3300005546 Ga0070696_100023478 Ga0070696_1000234783 127
1069 3300005546 Ga0070696_100152460 Ga0070696_1001524602 127
1070 3300005546 Ga0070696_101281157 Ga0070696_1012811572 127
1071 3300005546 Ga0070696_101349775 Ga0070696_1013497751 127
1072 3300005547 Ga0070693_100000905 Ga0070693_10000090515 127
1073 3300005547 Ga0070693_100025605 Ga0070693_1000256053 127
1074 3300005547 Ga0070693_100119332 Ga0070693_1001193322 127
1075 3300005547 Ga0070693_100319006 Ga0070693_1003190062 127
1076 3300005548 Ga0070665_100165224 Ga0070665_1001652243 127
1077 3300005548 Ga0070665_101154306 Ga0070665_1011543061 127
1078 3300005548 Ga0070665_101655400 Ga0070665_1016554002 127
1079 3300005548 Ga0070665_102072235 Ga0070665_1020722351 127
1080 3300005549 Ga0070704_100001366 Ga0070704_10000136613 127
1081 3300005549 Ga0070704_100021937 Ga0070704_1000219373 127
1082 3300005549 Ga0070704_101391183 Ga0070704_1013911831 127
1083 3300005563 Ga0068855_100053934 Ga0068855_1000539342 127
1084 3300005564 Ga0070664_100002074 Ga0070664_1000020746 127
1085 3300005564 Ga0070664_100051635 Ga0070664_1000516354 127
1086 3300005577 Ga0068857_100003594 Ga0068857_10000359413 127
1087 3300005577 Ga0068857_100079337 Ga0068857_1000793372 127
1088 3300005578 Ga0068854_100000749 Ga0068854_1000007493 127
1089 3300005578 Ga0068854_100149360 Ga0068854_1001493602 127
1090 3300005578 Ga0068854_100280698 Ga0068854_1002806982 127
1091 3300005614 Ga0068856_100000902 Ga0068856_10000090230 127
1092 3300005614 Ga0068856_100109437 Ga0068856_1001094373 127
1093 3300005614 Ga0068856_100426777 Ga0068856_1004267772 127
1094 3300005614 Ga0068856_100826939 Ga0068856_1008269392 127
1095 3300005615 Ga0070702_100007363 Ga0070702_1000073636 127
1096 3300005615 Ga0070702_100115751 Ga0070702_1001157511 127
1097 3300005615 Ga0070702_100302148 Ga0070702_1003021482 127
1098 3300005615 Ga0070702_101456277 Ga0070702_1014562771 127
1099 3300005616 Ga0068852_100004111 Ga0068852_1000041114 127
1100 3300005617 Ga0068859_100006839 Ga0068859_1000068392 127
1101 3300005617 Ga0068859_100188199 Ga0068859_1001881992 127
1102 3300005618 Ga0068864_100000595 Ga0068864_10000059514 127
1103 3300005618 Ga0068864_101062893 Ga0068864_1010628931 127
1104 3300005618 Ga0068864_101502968 Ga0068864_1015029682 127
1105 3300005718 Ga0068866_10000834 Ga0068866_100008344 127
1106 3300005718 Ga0068866_10673148 Ga0068866_106731482 127
1107 3300005719 Ga0068861_100000825 Ga0068861_1000008253 127
1108 3300005719 Ga0068861_100102398 Ga0068861_1001023983 127
1109 3300005719 Ga0068861_100224439 Ga0068861_1002244393 127
1110 3300005834 Ga0068851_10294186 Ga0068851_102941861 127
1111 3300005840 Ga0068870_10000112 Ga0068870_1000011226 127
1112 3300005841 Ga0068863_100012849 Ga0068863_1000128493 127
1113 3300005841 Ga0068863_101669683 Ga0068863_1016696832 127
1114 3300005842 Ga0068858_100025610 Ga0068858_1000256108 127
1115 3300005842 Ga0068858_100042730 Ga0068858_1000427302 127
1116 3300005842 Ga0068858_100064539 Ga0068858_1000645394 127
1117 3300005842 Ga0068858_100112861 Ga0068858_1001128613 127
1118 3300005842 Ga0068858_100521962 Ga0068858_1005219622 127
1119 3300005843 Ga0068860_100103943 Ga0068860_1001039433 127
1120 3300005843 Ga0068860_100121365 Ga0068860_1001213652 127
1121 3300005843 Ga0068860_100121893 Ga0068860_1001218932 127
1122 3300005844 Ga0068862_100004649 Ga0068862_1000046497 127
1123 3300005937 Ga0081455_10000048 Ga0081455_1000004861 127
1124 3300006028 Ga0070717_10007139 Ga0070717_100071393 127
1125 3300006028 Ga0070717_10369763 Ga0070717_103697633 127
1126 3300006058 Ga0075432_10070274 Ga0075432_100702742 127
1127 3300006163 Ga0070715_10002476 Ga0070715_100024769 127
1128 3300006163 Ga0070715_10051947 Ga0070715_100519471 127
1129 3300006173 Ga0070716_100000346 Ga0070716_10000034621 127
1130 3300006175 Ga0070712_100305744 Ga0070712_1003057442 127
1131 3300006194 Ga0075427_10003839 Ga0075427_100038393 127
1132 3300006237 Ga0097621_100000600 Ga0097621_1000006008 127
1133 3300006237 Ga0097621_100008260 Ga0097621_1000082607 127
1134 3300006237 Ga0097621_100083524 Ga0097621_1000835242 127
1135 3300006358 Ga0068871_100000118 Ga0068871_10000011824 127
1136 3300006358 Ga0068871_100003511 Ga0068871_1000035116 127
1137 3300006358 Ga0068871_100068572 Ga0068871_1000685722 127
1138 3300006844 Ga0075428_100006364 Ga0075428_10000636416 127
1139 3300006846 Ga0075430_100000196 Ga0075430_10000019624 127
1140 3300006847 Ga0075431_100001183 Ga0075431_10000118316 127
1141 3300006852 Ga0075433_10000991 Ga0075433_1000099115 127
1142 3300006852 Ga0075433_10058749 Ga0075433_100587493 127
1143 3300006871 Ga0075434_100006955 Ga0075434_10000695519 127
1144 3300006871 Ga0075434_100080382 Ga0075434_1000803825 127
1145 3300006871 Ga0075434_100622169 Ga0075434_1006221691 127
1146 3300006871 Ga0075434_100876859 Ga0075434_1008768592 127
1147 3300006871 Ga0075434_101523690 Ga0075434_1015236901 127
1148 3300006880 Ga0075429_100000573 Ga0075429_1000005732 127
1149 3300006881 Ga0068865_100002402 Ga0068865_1000024023 127
1150 3300006881 Ga0068865_100205807 Ga0068865_1002058072 127
1151 3300006914 Ga0075436_100248187 Ga0075436_1002481871 127
1152 3300006914 Ga0075436_100746364 Ga0075436_1007463642 127
1153 3300006931 Ga0097620_100006838 Ga0097620_10000683813 127
1154 3300006931 Ga0097620_100188203 Ga0097620_1001882032 127
1155 3300007076 Ga0075435_100026184 Ga0075435_1000261842 127
1156 3300007076 Ga0075435_100065161 Ga0075435_1000651613 127
1157 3300007076 Ga0075435_101349340 Ga0075435_1013493402 127
1158 3300009011 Ga0105251_10049977 Ga0105251_100499772 127
1159 3300009093 Ga0105240_10189209 Ga0105240_101892091 127
1160 3300009094 Ga0111539_10000683 Ga0111539_1000068330 127
1161 3300009094 Ga0111539_10004804 Ga0111539_1000480415 127
1162 3300009094 Ga0111539_10106813 Ga0111539_101068133 127
1163 3300009094 Ga0111539_12069171 Ga0111539_120691711 127
1164 3300009098 Ga0105245_10001982 Ga0105245_1000198215 127
1165 3300009098 Ga0105245_10032623 Ga0105245_100326232 127
1166 3300009098 Ga0105245_10064026 Ga0105245_100640264 127
1167 3300009098 Ga0105245_10833457 Ga0105245_108334571 127
1168 3300009101 Ga0105247_10024545 Ga0105247_100245453 127
1169 3300009101 Ga0105247_10405179 Ga0105247_104051792 127
1170 3300009101 Ga0105247_11052898 Ga0105247_110528981 127
1171 3300009147 Ga0114129_10008352 Ga0114129_100083522 127
1172 3300009147 Ga0114129_10519926 Ga0114129_105199262 127
1173 3300009148 Ga0105243_10002278 Ga0105243_100022783 127
1174 3300009148 Ga0105243_10107190 Ga0105243_101071902 127
1175 3300009148 Ga0105243_11864334 Ga0105243_118643342 127
1176 3300009174 Ga0105241_10015281 Ga0105241_100152816 127
1177 3300009174 Ga0105241_10060378 Ga0105241_100603782 127
1178 3300009174 Ga0105241_10116351 Ga0105241_101163513 127
1179 3300009176 Ga0105242_10009023 Ga0105242_100090232 127
1180 3300009176 Ga0105242_10033184 Ga0105242_100331843 127
1181 3300009176 Ga0105242_10434627 Ga0105242_104346271 127
1182 3300009177 Ga0105248_10078593 Ga0105248_100785933 127
1183 3300009177 Ga0105248_10118525 Ga0105248_101185254 127
1184 3300009177 Ga0105248_10311914 Ga0105248_103119143 127
1185 3300009177 Ga0105248_10974446 Ga0105248_109744461 127
1186 3300009177 Ga0105248_12079175 Ga0105248_120791751 127
1187 3300009545 Ga0105237_10199230 Ga0105237_101992302 127
1188 3300009545 Ga0105237_11107575 Ga0105237_111075751 127
1189 3300009551 Ga0105238_10125323 Ga0105238_101253233 127
1190 3300009553 Ga0105249_10001021 Ga0105249_1000102123 127
1191 3300009553 Ga0105249_10097100 Ga0105249_100971001 127
1192 3300009553 Ga0105249_10399539 Ga0105249_103995392 127
1193 3300009553 Ga0105249_11874339 Ga0105249_118743392 127
1194 3300010375 Ga0105239_10053067 Ga0105239_100530674 127
1195 3300010375 Ga0105239_10071533 Ga0105239_100715333 127
1196 3300010375 Ga0105239_10918552 Ga0105239_109185522 127
1197 3300010375 Ga0105239_11100845 Ga0105239_111008452 127
1198 3300011119 Ga0105246_10007532 Ga0105246_100075323 127
1199 3300011119 Ga0105246_10034231 Ga0105246_100342311 127
1200 3300011119 Ga0105246_10133537 Ga0105246_101335372 127
1201 3300011119 Ga0105246_10533487 Ga0105246_105334872 127
1202 3300012473 Ga0157340_1002355 Ga0157340_10023552 127
1203 3300012473 Ga0157340_1005064 Ga0157340_10050642 127
1204 3300012483 Ga0157337_1001743 Ga0157337_10017432 127
1205 3300012492 Ga0157335_1001290 Ga0157335_10012902 127
1206 3300012497 Ga0157319_1000744 Ga0157319_10007443 127
1207 3300012500 Ga0157314_1004810 Ga0157314_10048102 127
1208 3300012502 Ga0157347_1033880 Ga0157347_10338802 127
1209 3300012510 Ga0157316_1009216 Ga0157316_10092161 127
1210 3300012513 Ga0157326_1014555 Ga0157326_10145551 127
1211 3300013100 Ga0157373_10038612 Ga0157373_100386125 127
1212 3300013100 Ga0157373_10230947 Ga0157373_102309472 127
1213 3300013100 Ga0157373_10290017 Ga0157373_102900171 127
1214 3300013100 Ga0157373_11315958 Ga0157373_113159581 127
1215 3300013102 Ga0157371_10056689 Ga0157371_100566893 127
1216 3300013104 Ga0157370_10697307 Ga0157370_106973072 127
1217 3300013105 Ga0157369_11317466 Ga0157369_113174661 127
1218 3300013105 Ga0157369_12025311 Ga0157369_120253111 127
1219 3300013296 Ga0157374_10140434 Ga0157374_101404343 127
1220 3300013296 Ga0157374_10188020 Ga0157374_101880201 127
1221 3300013296 Ga0157374_10232705 Ga0157374_102327053 127
1222 3300013297 Ga0157378_10057104 Ga0157378_100571044 127
1223 3300013297 Ga0157378_11375064 Ga0157378_113750641 127
1224 3300013306 Ga0163162_10009279 Ga0163162_100092793 127
1225 3300013306 Ga0163162_10020735 Ga0163162_100207356 127
1226 3300013306 Ga0163162_10172801 Ga0163162_101728011 127
1227 3300013306 Ga0163162_11944940 Ga0163162_119449402 127
1228 3300013307 Ga0157372_11971534 Ga0157372_119715341 127
1229 3300013308 Ga0157375_10044270 Ga0157375_100442705 127
1230 3300014325 Ga0163163_10060628 Ga0163163_100606283 127
1231 3300014325 Ga0163163_11759736 Ga0163163_117597361 127
1232 3300014325 Ga0163163_13027782 Ga0163163_130277821 127
1233 3300014326 Ga0157380_10026178 Ga0157380_100261784 127
1234 3300014326 Ga0157380_10163009 Ga0157380_101630093 127
1235 3300014326 Ga0157380_10733136 Ga0157380_107331362 127
1236 3300014326 Ga0157380_11032515 Ga0157380_110325152 127
1237 3300014968 Ga0157379_10074738 Ga0157379_100747383 127
1238 3300014968 Ga0157379_10094699 Ga0157379_100946994 127
1239 3300014968 Ga0157379_10169891 Ga0157379_101698914 127
1240 3300014969 Ga0157376_10025272 Ga0157376_100252723 127
1241 3300014969 Ga0157376_10095317 Ga0157376_100953174 127
1242 3300014969 Ga0157376_10207521 Ga0157376_102075213 127
1243 3300017792 Ga0163161_10000415 Ga0163161_1000041519 127
1244 3300017792 Ga0163161_11575846 Ga0163161_115758462 127
1245 3300025271 Ga0207666_1000073 Ga0207666_100007316 127
1246 3300025271 Ga0207666_1011580 Ga0207666_10115802 127
1247 3300025315 Ga0207697_10024143 Ga0207697_100241433 127
1248 3300025315 Ga0207697_10024296 Ga0207697_100242962 127
1249 3300025321 Ga0207656_10051797 Ga0207656_100517972 127
1250 3300025321 Ga0207656_10503287 Ga0207656_105032871 127
1251 3300025735 Ga0207713_1112270 Ga0207713_11122702 127
1252 3300025885 Ga0207653_10002714 Ga0207653_100027143 127
1253 3300025893 Ga0207682_10000350 Ga0207682_1000035025 127
1254 3300025898 Ga0207692_10009320 Ga0207692_100093203 127
1255 3300025899 Ga0207642_10000638 Ga0207642_100006387 127
1256 3300025899 Ga0207642_10531658 Ga0207642_105316581 127
1257 3300025900 Ga0207710_10127171 Ga0207710_101271712 127
1258 3300025901 Ga0207688_10000001 Ga0207688_10000001108 127
1259 3300025901 Ga0207688_10073044 Ga0207688_100730442 127
1260 3300025903 Ga0207680_10026966 Ga0207680_100269662 127
1261 3300025903 Ga0207680_10075759 Ga0207680_100757592 127
1262 3300025904 Ga0207647_10002852 Ga0207647_1000285214 127
1263 3300025904 Ga0207647_10065304 Ga0207647_100653043 127
1264 3300025905 Ga0207685_10049007 Ga0207685_100490072 127
1265 3300025905 Ga0207685_10366055 Ga0207685_103660551 127
1266 3300025906 Ga0207699_10002264 Ga0207699_1000226411 127
1267 3300025907 Ga0207645_10000222 Ga0207645_1000022241 127
1268 3300025907 Ga0207645_10065550 Ga0207645_100655502 127
1269 3300025907 Ga0207645_10405126 Ga0207645_104051262 127
1270 3300025908 Ga0207643_10000009 Ga0207643_1000000929 127
1271 3300025911 Ga0207654_10053603 Ga0207654_100536032 127
1272 3300025911 Ga0207654_10123061 Ga0207654_101230612 127
1273 3300025911 Ga0207654_10243534 Ga0207654_102435342 127
1274 3300025912 Ga0207707_10027971 Ga0207707_100279713 127
1275 3300025912 Ga0207707_10045417 Ga0207707_100454173 127
1276 3300025912 Ga0207707_10229371 Ga0207707_102293712 127
1277 3300025914 Ga0207671_10186930 Ga0207671_101869302 127
1278 3300025915 Ga0207693_10028016 Ga0207693_100280162 127
1279 3300025915 Ga0207693_10161048 Ga0207693_101610482 127
1280 3300025916 Ga0207663_10017267 Ga0207663_100172673 127
1281 3300025916 Ga0207663_10123374 Ga0207663_101233743 127
1282 3300025917 Ga0207660_10000197 Ga0207660_1000019723 127
1283 3300025917 Ga0207660_10019663 Ga0207660_100196633 127
1284 3300025917 Ga0207660_10669287 Ga0207660_106692871 127
1285 3300025917 Ga0207660_11581187 Ga0207660_115811871 127
1286 3300025918 Ga0207662_10028451 Ga0207662_100284512 127
1287 3300025918 Ga0207662_10154682 Ga0207662_101546822 127
1288 3300025918 Ga0207662_10740236 Ga0207662_107402361 127
1289 3300025919 Ga0207657_10055996 Ga0207657_100559963 127
1290 3300025919 Ga0207657_10104175 Ga0207657_101041752 127
1291 3300025919 Ga0207657_10107088 Ga0207657_101070883 127
1292 3300025920 Ga0207649_10000052 Ga0207649_10000052101 127
1293 3300025920 Ga0207649_10091718 Ga0207649_100917181 127
1294 3300025920 Ga0207649_10104851 Ga0207649_101048512 127
1295 3300025920 Ga0207649_10383648 Ga0207649_103836482 127
1296 3300025921 Ga0207652_10001438 Ga0207652_1000143812 127
1297 3300025921 Ga0207652_10096158 Ga0207652_100961583 127
1298 3300025921 Ga0207652_11272228 Ga0207652_112722281 127
1299 3300025923 Ga0207681_10002118 Ga0207681_100021183 127
1300 3300025923 Ga0207681_10126410 Ga0207681_101264102 127
1301 3300025924 Ga0207694_10085177 Ga0207694_100851771 127
1302 3300025924 Ga0207694_10227025 Ga0207694_102270252 127
1303 3300025925 Ga0207650_10068752 Ga0207650_100687523 127
1304 3300025925 Ga0207650_10444364 Ga0207650_104443642 127
1305 3300025925 Ga0207650_10801544 Ga0207650_108015441 127
1306 3300025926 Ga0207659_10000132 Ga0207659_1000013213 127
1307 3300025927 Ga0207687_10000174 Ga0207687_1000017412 127
1308 3300025927 Ga0207687_10104768 Ga0207687_101047683 127
1309 3300025928 Ga0207700_10029101 Ga0207700_100291012 127
1310 3300025928 Ga0207700_10476709 Ga0207700_104767092 127
1311 3300025929 Ga0207664_10072425 Ga0207664_100724252 127
1312 3300025931 Ga0207644_10000212 Ga0207644_1000021223 127
1313 3300025931 Ga0207644_10451134 Ga0207644_104511341 127
1314 3300025932 Ga0207690_10001288 Ga0207690_100012882 127
1315 3300025932 Ga0207690_10302921 Ga0207690_103029212 127
1316 3300025932 Ga0207690_11858231 Ga0207690_118582311 127
1317 3300025933 Ga0207706_10063219 Ga0207706_100632193 127
1318 3300025933 Ga0207706_10101430 Ga0207706_101014303 127
1319 3300025933 Ga0207706_10162826 Ga0207706_101628262 127
1320 3300025934 Ga0207686_10001289 Ga0207686_1000128914 127
1321 3300025934 Ga0207686_10147807 Ga0207686_101478072 127
1322 3300025934 Ga0207686_10423954 Ga0207686_104239541 127
1323 3300025935 Ga0207709_10000530 Ga0207709_1000053018 127
1324 3300025935 Ga0207709_10215518 Ga0207709_102155182 127
1325 3300025936 Ga0207670_10000523 Ga0207670_1000052313 127
1326 3300025936 Ga0207670_10108831 Ga0207670_101088313 127
1327 3300025936 Ga0207670_10266778 Ga0207670_102667782 127
1328 3300025937 Ga0207669_10000235 Ga0207669_1000023529 127
1329 3300025937 Ga0207669_11208647 Ga0207669_112086472 127
1330 3300025938 Ga0207704_10000198 Ga0207704_1000019828 127
1331 3300025938 Ga0207704_10335882 Ga0207704_103358822 127
1332 3300025938 Ga0207704_10453855 Ga0207704_104538551 127
1333 3300025939 Ga0207665_10000273 Ga0207665_1000027321 127
1334 3300025939 Ga0207665_10276631 Ga0207665_102766312 127
1335 3300025940 Ga0207691_10000517 Ga0207691_100005173 127
1336 3300025940 Ga0207691_10057922 Ga0207691_100579224 127
1337 3300025940 Ga0207691_10619330 Ga0207691_106193301 127
1338 3300025941 Ga0207711_10006368 Ga0207711_1000636817 127
1339 3300025941 Ga0207711_10011248 Ga0207711_100112485 127
1340 3300025941 Ga0207711_10127471 Ga0207711_101274713 127
1341 3300025942 Ga0207689_10000031 Ga0207689_1000003187 127
1342 3300025942 Ga0207689_10388743 Ga0207689_103887432 127
1343 3300025944 Ga0207661_10001228 Ga0207661_1000122813 127
1344 3300025945 Ga0207679_10000183 Ga0207679_1000018336 127
1345 3300025945 Ga0207679_10192673 Ga0207679_101926732 127
1346 3300025949 Ga0207667_10039092 Ga0207667_100390928 127
1347 3300025960 Ga0207651_10000051 Ga0207651_1000005130 127
1348 3300025960 Ga0207651_10067548 Ga0207651_100675483 127
1349 3300025960 Ga0207651_10567714 Ga0207651_105677141 127
1350 3300025960 Ga0207651_11168551 Ga0207651_111685511 127
1351 3300025961 Ga0207712_10000738 Ga0207712_1000073823 127
1352 3300025961 Ga0207712_10048716 Ga0207712_100487162 127
1353 3300025961 Ga0207712_10206744 Ga0207712_102067442 127
1354 3300025972 Ga0207668_10000664 Ga0207668_1000066412 127
1355 3300025972 Ga0207668_10200896 Ga0207668_102008963 127
1356 3300025972 Ga0207668_10423622 Ga0207668_104236221 127
1357 3300025981 Ga0207640_10000343 Ga0207640_100003439 127
1358 3300025981 Ga0207640_10130022 Ga0207640_101300222 127
1359 3300025986 Ga0207658_10057127 Ga0207658_100571273 127
1360 3300025986 Ga0207658_10193076 Ga0207658_101930763 127
1361 3300025986 Ga0207658_10498259 Ga0207658_104982592 127
1362 3300026023 Ga0207677_10010253 Ga0207677_100102533 127
1363 3300026023 Ga0207677_10018951 Ga0207677_100189512 127
1364 3300026035 Ga0207703_10002904 Ga0207703_1000290410 127
1365 3300026035 Ga0207703_10028495 Ga0207703_100284957 127
1366 3300026035 Ga0207703_10036270 Ga0207703_100362703 127
1367 3300026035 Ga0207703_10266721 Ga0207703_102667211 127
1368 3300026041 Ga0207639_10001257 Ga0207639_1000125718 127
1369 3300026041 Ga0207639_10635906 Ga0207639_106359061 127
1370 3300026067 Ga0207678_10060468 Ga0207678_100604682 127
1371 3300026067 Ga0207678_10131444 Ga0207678_101314443 127
1372 3300026067 Ga0207678_10136346 Ga0207678_101363462 127
1373 3300026067 Ga0207678_10670144 Ga0207678_106701441 127
1374 3300026075 Ga0207708_10048142 Ga0207708_100481423 127
1375 3300026075 Ga0207708_10065374 Ga0207708_100653742 127
1376 3300026075 Ga0207708_10093062 Ga0207708_100930623 127
1377 3300026078 Ga0207702_10003284 Ga0207702_100032843 127
1378 3300026078 Ga0207702_10088550 Ga0207702_100885501 127
1379 3300026078 Ga0207702_10333595 Ga0207702_103335953 127
1380 3300026078 Ga0207702_11557403 Ga0207702_115574031 127
1381 3300026088 Ga0207641_10001831 Ga0207641_1000183125 127
1382 3300026088 Ga0207641_10041398 Ga0207641_100413982 127
1383 3300026088 Ga0207641_11175904 Ga0207641_111759041 127
1384 3300026089 Ga0207648_10000581 Ga0207648_1000058139 127
1385 3300026089 Ga0207648_10205752 Ga0207648_102057523 127
1386 3300026089 Ga0207648_10206868 Ga0207648_102068683 127
1387 3300026089 Ga0207648_10370771 Ga0207648_103707712 127
1388 3300026095 Ga0207676_10000124 Ga0207676_1000012453 127
1389 3300026095 Ga0207676_10048665 Ga0207676_100486653 127
1390 3300026095 Ga0207676_10486636 Ga0207676_104866363 127
1391 3300026116 Ga0207674_10128096 Ga0207674_101280962 127
1392 3300026116 Ga0207674_10201166 Ga0207674_102011662 127
1393 3300026118 Ga0207675_100000414 Ga0207675_10000041439 127
1394 3300026118 Ga0207675_100065029 Ga0207675_1000650293 127
1395 3300026118 Ga0207675_100141370 Ga0207675_1001413702 127
1396 3300026121 Ga0207683_10000242 Ga0207683_1000024224 127
1397 3300026121 Ga0207683_10012573 Ga0207683_100125732 127
1398 3300026121 Ga0207683_10086140 Ga0207683_100861403 127
1399 3300026121 Ga0207683_10970737 Ga0207683_109707371 127
1400 3300026142 Ga0207698_10000951 Ga0207698_1000095116 127
1401 3300026142 Ga0207698_11290832 Ga0207698_112908322 127
1402 3300027252 Ga0209973_1017621 Ga0209973_10176212 127
1403 3300027252 Ga0209973_1024243 Ga0209973_10242432 127
1404 3300027360 Ga0209969_1038746 Ga0209969_10387461 127
1405 3300027395 Ga0209996_1011196 Ga0209996_10111962 127
1406 3300027471 Ga0209995_1021592 Ga0209995_10215921 127
1407 3300027471 Ga0209995_1036100 Ga0209995_10361001 127
1408 3300027552 Ga0209982_1008297 Ga0209982_10082972 127
1409 3300027614 Ga0209970_1004927 Ga0209970_10049272 127
1410 3300027617 Ga0210002_1001458 Ga0210002_10014583 127
1411 3300027665 Ga0209983_1086438 Ga0209983_10864382 127
1412 3300027682 Ga0209971_1039672 Ga0209971_10396722 127
1413 3300027695 Ga0209966_1000641 Ga0209966_10006412 127
1414 3300027717 Ga0209998_10011991 Ga0209998_100119913 127
1415 3300027717 Ga0209998_10029104 Ga0209998_100291043 127
1416 3300027717 Ga0209998_10057600 Ga0209998_100576001 127
1417 3300027876 Ga0209974_10009862 Ga0209974_100098622 127
1418 3300027876 Ga0209974_10065145 Ga0209974_100651452 127
1419 3300027907 Ga0207428_10000037 Ga0207428_10000037202 127
1420 3300027907 Ga0207428_10001773 Ga0207428_100017733 127
1421 3300027907 Ga0207428_10002442 Ga0207428_1000244231 127
1422 3300028379 Ga0268266_10068513 Ga0268266_100685135 127
1423 3300028379 Ga0268266_10396400 Ga0268266_103964003 127
1424 3300028380 Ga0268265_10003320 Ga0268265_1000332021 127
1425 3300028380 Ga0268265_10006176 Ga0268265_100061763 127
1426 3300028381 Ga0268264_10002331 Ga0268264_1000233116 127
1427 3300028381 Ga0268264_10119996 Ga0268264_101199963 127
1428 3300028381 Ga0268264_10411466 Ga0268264_104114662 127
1429 3300028556 Ga0265337_1000827 Ga0265337_10008274 127
1430 3300031247 Ga0265340_10071131 Ga0265340_100711313 127
1431 3300034816 Ga0373930_0000352 Ga0373930_0000352_2427_2810 127
1432 3300034817 Ga0373948_0000262 Ga0373948_0000262_1054_1437 127
1433 3300034818 Ga0373950_0000155 Ga0373950_0000155_3637_4020 127
1434 3300034819 Ga0373958_0000136 Ga0373958_0000136_2381_2764 127
1435 3300034820 Ga0373959_0000508 Ga0373959_0000508_5401_5784 127
1436 3300034957 Ga0373938_0000013 Ga0373938_0000013_8703_9086 127
1437 3300034957 Ga0373938_0010938 Ga0373938_0010938_665_1048 127
1438 3300035083 Ga0373926_0001371 Ga0373926_0001371_5158_5541 127
1439 3300035083 Ga0373926_0155249 Ga0373926_0155249_460_843 127
1440 3300035084 Ga0373928_0000255 Ga0373928_0000255_2839_3222 127
1441 3300035084 Ga0373928_0034036 Ga0373928_0034036_187_570 127
1442 3300035085 Ga0373929_0002106 Ga0373929_0002106_2067_2450 127
1443 3300035085 Ga0373929_0018776 Ga0373929_0018776_530_913 127
1444 3300035088 Ga0373940_0000097 Ga0373940_0000097_2723_3106 127
1445 3300035088 Ga0373940_0096900 Ga0373940_0096900_316_699 127
1446 3300035089 Ga0373944_0007536 Ga0373944_0007536_182_565 127
1447 3300035090 Ga0373949_0002652 Ga0373949_0002652_3862_4245 127
1448 3300035090 Ga0373949_0043701 Ga0373949_0043701_670_1053 127
1449 3300035090 Ga0373949_0146973 Ga0373949_0146973_194_577 127
1450 3300035091 Ga0373951_0004343 Ga0373951_0004343_2725_3108 127
1451 3300035092 Ga0373952_0000182 Ga0373952_0000182_7544_7927 127
1452 3300035092 Ga0373952_0001880 Ga0373952_0001880_1183_1566 127
1453 3300035111 Ga0373923_0009752 Ga0373923_0009752_2652_3035 127
1454 3300035111 Ga0373923_0129868 Ga0373923_0129868_530_913 127
1455 3300035111 Ga0373923_0275670 Ga0373923_0275670_338_721 127
1456 3300035111 Ga0373923_0381990 Ga0373923_0381990_82_465 127
1457 3300035112 Ga0373932_0000252 Ga0373932_0000252_6958_7341 127
1458 3300035112 Ga0373932_0000830 Ga0373932_0000830_4682_5065 127
1459 3300035112 Ga0373932_0110613 Ga0373932_0110613_137_520 127
1460 3300035113 Ga0373936_0007704 Ga0373936_0007704_831_1214 127
1461 3300035114 Ga0373939_0001022 Ga0373939_0001022_5838_6221 127
1462 3300035114 Ga0373939_0004646 Ga0373939_0004646_1311_1694 127
1463 3300035115 Ga0373941_0000125 Ga0373941_0000125_2282_2665 127
1464 3300035115 Ga0373941_0295786 Ga0373941_0295786_51_434 127
1465 3300035116 Ga0373945_0060204 Ga0373945_0060204_320_703 127
1466 3300035117 Ga0373953_0026316 Ga0373953_0026316_413_796 127
1467 3300035118 Ga0373954_0017164 Ga0373954_0017164_2262_2645 127
1468 3300035119 Ga0373956_0002024 Ga0373956_0002024_5663_6046 127
1469 3300035120 Ga0373957_0303102 Ga0373957_0303102_104_487 127
1470 3300035121 Ga0373960_0000068 Ga0373960_0000068_3845_4228 127
1471 3300035121 Ga0373960_0005186 Ga0373960_0005186_1117_1500 127
1472 3300035121 Ga0373960_0049576 Ga0373960_0049576_699_1082 127
1473 3300035170 Ga0373943_0025295 Ga0373943_0025295_2073_2456 127
1474 3300035170 Ga0373943_0047950 Ga0373943_0047950_1109_1492 127
1475 3300035171 Ga0373946_0021880 Ga0373946_0021880_346_729 127
1476 3300035172 Ga0373955_0012262 Ga0373955_0012262_629_1012 127
1477 3300035207 Ga0373942_0001496 Ga0373942_0001496_2050_2433 127
1478 3300035207 Ga0373942_0017748 Ga0373942_0017748_655_1038 127
1479 3300035241 Ga0373961_0000638 Ga0373961_0000638_10312_10695 127
1480 3300035241 Ga0373961_0008988 Ga0373961_0008988_133_516 127
1481 3300035241 Ga0373961_0282338 Ga0373961_0282338_188_571 127
1482 3300035242 Ga0373962_0000112 Ga0373962_0000112_5183_5566 127
1483 3300035242 Ga0373962_0003469 Ga0373962_0003469_2067_2450 127
1484 3300035242 Ga0373962_0087475 Ga0373962_0087475_272_655 127
1485 3300035410 Ga0373924_0155771 Ga0373924_0155771_215_598 127
1486 3300035410 Ga0373924_0255338 Ga0373924_0255338_78_461 127
1487 3300035691 Ga0373931_0000305 Ga0373931_0000305_14785_15168 127
1488 3300035691 Ga0373931_0001634 Ga0373931_0001634_9251_9634 127
1489 3300035691 Ga0373931_0115030 Ga0373931_0115030_984_1367 127
1490 3300035692 Ga0373935_0069751 Ga0373935_0069751_1406_1789 127
1491 3300035692 Ga0373935_0729323 Ga0373935_0729323_243_626 127
1492 3300035724 Ga0373933_0002755 Ga0373933_0002755_4179_4562 127
1493 3300035724 Ga0373933_0331363 Ga0373933_0331363_417_800 127
1494 3300035724 Ga0373933_0337578 Ga0373933_0337578_372_755 127
1495 3300035725 Ga0373947_0113971 Ga0373947_0113971_809_1192 127
1496 3300036401 Ga0373937_0005145 Ga0373937_0005145_3858_4241 127
1497 3300036401 Ga0373937_0089618 Ga0373937_0089618_634_1017 127
1498 3300036401 Ga0373937_0147389 Ga0373937_0147389_1715_2098 127
1499 3300037068 Ga0373925_0026064 Ga0373925_0026064_2829_3212 127
1500 3300038996 Ga0242420_047701 Ga0242420_047701_184_567 127
1501 3300039453 Ga0436362_0103032 Ga0436362_0103032_108_497 127
1502 3300042001 Ga0439441_062304 Ga0439441_062304_230_613 127
1503 3300042005 Ga0439448_0152482 Ga0439448_0152482_294_677 127
1504 3300042008 Ga0439450_053610 Ga0439450_053610_46_429 127
1505 3300042012 Ga0439455_0005610 Ga0439455_0005610_2014_2397 127
1506 3300042439 Ga0439464_0022068 Ga0439464_0022068_1050_1433 127
1507 3300042876 Ga0451577_0102181 Ga0451577_0102181_627_1010 127
1508 3300044673 Ga0453683_0835583 Ga0453683_0835583_17_400 127
1509 3300044712 Ga0453684_1338739 Ga0453684_1338739_284_667 127
1510 3300045051 Ga0451576_0014613 Ga0451576_0014613_6873_7256 127
1511 3300046454 Ga0495592_0064894 Ga0495592_0064894_1957_2340 127
1512 3300046454 Ga0495592_0171347 Ga0495592_0171347_726_1109 127
1513 3300046455 Ga0495603_0018592 Ga0495603_0018592_2291_2674 127
1514 3300046459 Ga0495629_0210900 Ga0495629_0210900_246_629 127
1515 3300046461 Ga0495641_0018852 Ga0495641_0018852_66_449 127
1516 3300046462 Ga0495651_0001390 Ga0495651_0001390_15049_15432 127
1517 3300046462 Ga0495651_0448229 Ga0495651_0448229_339_722 127
1518 3300046463 Ga0495653_0003820 Ga0495653_0003820_2347_2730 127
1519 3300046463 Ga0495653_0069439 Ga0495653_0069439_1598_1981 127
1520 3300046472 Ga0495580_0209732 Ga0495580_0209732_525_908 127
1521 3300046472 Ga0495580_0804085 Ga0495580_0804085_215_598 127
1522 3300046473 Ga0495582_0034706 Ga0495582_0034706_425_808 127
1523 3300046475 Ga0495639_0017560 Ga0495639_0017560_313_696 127
1524 3300046476 Ga0495662_0030489 Ga0495662_0030489_1920_2303 127
1525 3300046476 Ga0495662_0118993 Ga0495662_0118993_83_466 127
1526 3300046477 Ga0495664_0003117 Ga0495664_0003117_1569_1952 127
1527 3300046491 Ga0495584_0031540 Ga0495584_0031540_759_1142 127
1528 3300046491 Ga0495584_0094008 Ga0495584_0094008_30_413 127
1529 3300046499 Ga0495594_0035688 Ga0495594_0035688_230_613 127
1530 3300046511 Ga0495608_0004695 Ga0495608_0004695_7304_7687 127
1531 3300046514 Ga0495618_0009048 Ga0495618_0009048_1401_1784 127
1532 3300046514 Ga0495618_0044604 Ga0495618_0044604_1797_2180 127
1533 3300046514 Ga0495618_0557384 Ga0495618_0557384_18_401 127
1534 3300046516 Ga0495628_0002285 Ga0495628_0002285_4950_5333 127
1535 3300046516 Ga0495628_0293242 Ga0495628_0293242_244_627 127
1536 3300046517 Ga0495630_0084001 Ga0495630_0084001_657_1040 127
1537 3300046517 Ga0495630_0282749 Ga0495630_0282749_657_1040 127
1538 3300046526 Ga0495666_0022479 Ga0495666_0022479_252_635 127
1539 3300046528 Ga0495642_0247247 Ga0495642_0247247_77_460 127
1540 3300046529 Ga0495652_0005034 Ga0495652_0005034_11107_11490 127
1541 3300046529 Ga0495652_0104450 Ga0495652_0104450_1176_1559 127
1542 3300046529 Ga0495652_0156303 Ga0495652_0156303_516_899 127
1543 3300046531 Ga0495665_0024414 Ga0495665_0024414_1111_1494 127
1544 3300046533 Ga0495640_0015836 Ga0495640_0015836_4564_4947 127
1545 3300046533 Ga0495640_0061658 Ga0495640_0061658_639_1022 127
1546 3300046535 Ga0495586_0082345 Ga0495586_0082345_916_1299 127
1547 3300046536 Ga0495587_0001073 Ga0495587_0001073_7620_8003 127
1548 3300046543 Ga0495645_0046486 Ga0495645_0046486_2340_2723 127
1549 3300046559 Ga0495667_0013645 Ga0495667_0013645_2536_2919 127
1550 3300046559 Ga0495667_0060768 Ga0495667_0060768_615_998 127
1551 3300046642 Ga0495634_0122759 Ga0495634_0122759_261_644 127
1552 3300046642 Ga0495634_0248602 Ga0495634_0248602_367_750 127
1553 3300046663 Ga0495635_0013280 Ga0495635_0013280_3729_4112 127
1554 3300046663 Ga0495635_0101199 Ga0495635_0101199_1341_1724 127
1555 3300046664 Ga0495659_0496778 Ga0495659_0496778_46_429 127
1556 3300046674 Ga0495588_0057546 Ga0495588_0057546_1176_1559 127
1557 3300046675 Ga0495657_0005935 Ga0495657_0005935_7253_7636 127
1558 3300046678 Ga0495599_0006958 Ga0495599_0006958_2213_2596 127
1559 3300046678 Ga0495599_0452307 Ga0495599_0452307_213_596 127
1560 3300046679 Ga0495623_0000858 Ga0495623_0000858_14040_14423 127
1561 3300046680 Ga0495646_0003394 Ga0495646_0003394_7563_7946 127
1562 3300046681 Ga0495647_0031601 Ga0495647_0031601_1278_1661 127
1563 3300046683 Ga0495658_0019075 Ga0495658_0019075_2880_3263 127
1564 3300046684 Ga0495669_0070805 Ga0495669_0070805_329_712 127
1565 3300046689 Ga0495613_0130268 Ga0495613_0130268_977_1360 127
1566 3300046689 Ga0495613_0242912 Ga0495613_0242912_359_742 127
1567 3300046689 Ga0495613_0792279 Ga0495613_0792279_33_416 127
1568 3300046690 Ga0495624_0582130 Ga0495624_0582130_236_619 127
1569 3300046692 Ga0495671_0295934 Ga0495671_0295934_15_398 127
1570 3300046794 Ga0495589_0268839 Ga0495589_0268839_139_522 127
1571 3300046809 Ga0495600_0025274 Ga0495600_0025274_2141_2524 127
1572 3300046809 Ga0495600_0595037 Ga0495600_0595037_107_490 127
1573 3300047315 Ga0495581_0093975 Ga0495581_0093975_1341_1724 127
1574 3300047317 Ga0495604_0016633 Ga0495604_0016633_253_636 127
1575 3300047319 Ga0495674_0064384 Ga0495674_0064384_2148_2531 127
1576 3300047319 Ga0495674_0143635 Ga0495674_0143635_965_1348 127
1577 3300047321 Ga0495676_0168077 Ga0495676_0168077_17_400 127
1578 3300047322 Ga0495680_0024378 Ga0495680_0024378_451_834 127
1579 3300047322 Ga0495680_0132942 Ga0495680_0132942_656_1039 127
1580 3300047322 Ga0495680_0522910 Ga0495680_0522910_230_613 127
1581 3300047444 Ga0495675_0004449 Ga0495675_0004449_2741_3124 127
1582 3300047445 Ga0495677_0315950 Ga0495677_0315950_25_408 127
1583 3300047471 Ga0495684_0116578 Ga0495684_0116578_1189_1572 127
1584 3300047673 Ga0495593_0026153 Ga0495593_0026153_1313_1696 127
1585 3300047673 Ga0495593_0095776 Ga0495593_0095776_182_565 127
1586 3300047673 Ga0495593_0495358 Ga0495593_0495358_128_511 127
1587 3300048088 Ga0495602_0005814 Ga0495602_0005814_2568_2951 127
1588 3300048089 Ga0495614_0210554 Ga0495614_0210554_361_744 127
1589 3300048903 Ga0496100_0000345 Ga0496100_0000345_11230_11613 127
1590 3300048903 Ga0496100_0040182 Ga0496100_0040182_2376_2759 127
1591 3300048903 Ga0496100_0196762 Ga0496100_0196762_110_493 127
1592 3300048904 Ga0496101_0000866 Ga0496101_0000866_2617_3000 127
1593 3300048904 Ga0496101_0026764 Ga0496101_0026764_1504_1887 127
1594 3300048904 Ga0496101_0031736 Ga0496101_0031736_110_493 127
1595 3300048904 Ga0496101_0754094 Ga0496101_0754094_341_724 127
1596 3300048905 Ga0496102_0001833 Ga0496102_0001833_3864_4247 127
1597 3300048905 Ga0496102_0035378 Ga0496102_0035378_2072_2455 127
1598 3300048905 Ga0496102_0713677 Ga0496102_0713677_433_816 127
1599 3300048906 Ga0496103_0001022 Ga0496103_0001022_4425_4808 127
1600 3300048906 Ga0496103_0039344 Ga0496103_0039344_110_493 127
1601 3300048906 Ga0496103_0046372 Ga0496103_0046372_1376_1759 127
1602 3300048906 Ga0496103_0159310 Ga0496103_0159310_40_423 127
1603 3300048907 Ga0496104_0041378 Ga0496104_0041378_2415_2798 127
1604 3300048907 Ga0496104_0392679 Ga0496104_0392679_155_538 127
1605 3300048907 Ga0496104_1192407 Ga0496104_1192407_253_636 127
1606 3300048908 Ga0496105_0146792 Ga0496105_0146792_157_540 127
1607 3300048908 Ga0496105_0148486 Ga0496105_0148486_677_1060 127
1608 3300048908 Ga0496105_0290849 Ga0496105_0290849_677_1060 127
1609 3300048909 Ga0496106_0002528 Ga0496106_0002528_2303_2686 127
1610 3300048909 Ga0496106_0076854 Ga0496106_0076854_1311_1694 127
1611 3300048909 Ga0496106_0115700 Ga0496106_0115700_1557_1940 127
1612 3300048909 Ga0496106_0267836 Ga0496106_0267836_514_897 127
1613 3300048910 Ga0496107_0002539 Ga0496107_0002539_3993_4376 127
1614 3300048910 Ga0496107_0033041 Ga0496107_0033041_115_498 127
1615 3300048911 Ga0496108_0003711 Ga0496108_0003711_8819_9202 127
1616 3300048911 Ga0496108_0009905 Ga0496108_0009905_6792_7175 127
1617 3300048911 Ga0496108_0081887 Ga0496108_0081887_1650_2033 127
1618 3300048911 Ga0496108_0150271 Ga0496108_0150271_173_556 127
1619 3300048912 Ga0496109_0002269 Ga0496109_0002269_13438_13821 127
1620 3300048912 Ga0496109_0010610 Ga0496109_0010610_6636_7019 127
1621 3300048912 Ga0496109_0107784 Ga0496109_0107784_1305_1688 127
1622 3300048913 Ga0496110_0124293 Ga0496110_0124293_1820_2203 127
1623 3300048913 Ga0496110_0239896 Ga0496110_0239896_1225_1608 127
1624 3300048913 Ga0496110_0275705 Ga0496110_0275705_351_734 127
1625 3300048913 Ga0496110_0850670 Ga0496110_0850670_258_641 127
1626 3300048913 Ga0496110_1800098 Ga0496110_1800098_110_493 127
1627 3300048914 Ga0496111_0008486 Ga0496111_0008486_2897_3280 127
1628 3300048914 Ga0496111_0309448 Ga0496111_0309448_52_435 127
1629 3300048914 Ga0496111_0686495 Ga0496111_0686495_220_603 127
1630 3300048915 Ga0496112_0003321 Ga0496112_0003321_8654_9037 127
1631 3300048916 Ga0496113_0049264 Ga0496113_0049264_1996_2379 127
1632 3300048916 Ga0496113_0219441 Ga0496113_0219441_779_1162 127
1633 3300048916 Ga0496113_0331385 Ga0496113_0331385_729_1112 127
1634 3300048916 Ga0496113_0459870 Ga0496113_0459870_437_820 127
1635 3300048916 Ga0496113_1606315 Ga0496113_1606315_27_410 127
1636 3300048917 Ga0496114_0007247 Ga0496114_0007247_4392_4775 127
1637 3300048917 Ga0496114_0279202 Ga0496114_0279202_811_1194 127
1638 3300048918 Ga0496115_0007162 Ga0496115_0007162_5747_6130 127
1639 3300048918 Ga0496115_0096513 Ga0496115_0096513_144_527 127
1640 3300048918 Ga0496115_0736324 Ga0496115_0736324_107_490 127
1641 3300049575 Ga0501039_0838026 Ga0501039_0838026_56_439 127
1642 3300049584 Ga0501068_0387204 Ga0501068_0387204_156_539 127
1643 3300049585 Ga0501069_0228499 Ga0501069_0228499_511_894 127
1644 3300049587 Ga0501071_0127174 Ga0501071_0127174_1200_1583 127
1645 3300049588 Ga0501072_0238200 Ga0501072_0238200_214_597 127
1646 3300049590 Ga0501074_0830985 Ga0501074_0830985_79_462 127
1647 3300049591 Ga0501075_0297766 Ga0501075_0297766_234_617 127
1648 3300049591 Ga0501075_0964004 Ga0501075_0964004_23_406 127
1649 3300049592 Ga0501076_1377480 Ga0501076_1377480_29_412 127
1650 3300049593 Ga0501077_0108309 Ga0501077_0108309_883_1266 127
1651 3300049741 Ga0501079_0110781 Ga0501079_0110781_805_1188 127
1652 3300049743 Ga0501081_0018544 Ga0501081_0018544_1954_2337 127
1653 3300050494 nmdc:mga06z11_771695_c1 nmdc:mga06z11_771695_c1_17_400 127
1654 3300050507 nmdc:mga05p37_2437_c1 nmdc:mga05p37_2437_c1_610_993 127
1655 3300050508 nmdc:mga09592_1370_c1 nmdc:mga09592_1370_c1_2859_3242 127
1656 3300050509 nmdc:mga0qj67_969_c1 nmdc:mga0qj67_969_c1_16272_16655 127
1657 3300050510 nmdc:mga06r32_638_c1 nmdc:mga06r32_638_c1_17706_18089 127
1658 3300050511 nmdc:mga08y16_3117_c1 nmdc:mga08y16_3117_c1_10436_10819 127
1659 3300050511 nmdc:mga08y16_333_c1 nmdc:mga08y16_333_c1_7164_7547 127
1660 3300050511 nmdc:mga08y16_549_c1 nmdc:mga08y16_549_c1_18102_18485 127
1661 3300050512 nmdc:mga0n895_1174_c1 nmdc:mga0n895_1174_c1_8296_8679 127
1662 3300050512 nmdc:mga0n895_857752_c1 nmdc:mga0n895_857752_c1_290_673 127
1663 3300050513 nmdc:mga0rr50_20520_c1 nmdc:mga0rr50_20520_c1_1848_2231 127
1664 3300050513 nmdc:mga0rr50_330858_c1 nmdc:mga0rr50_330858_c1_305_688 127
1665 3300050513 nmdc:mga0rr50_6776_c1 nmdc:mga0rr50_6776_c1_974_1357 127
1666 3300050514 nmdc:mga08x19_432681_c1 nmdc:mga08x19_432681_c1_316_699 127
1667 3300050514 nmdc:mga08x19_683414_c1 nmdc:mga08x19_683414_c1_168_551 127
1668 3300050514 nmdc:mga08x19_702090_c1 nmdc:mga08x19_702090_c1_262_645 127
1669 3300050514 nmdc:mga08x19_855881_c1 nmdc:mga08x19_855881_c1_51_434 127
1670 3300050515 nmdc:mga0a205_6917_c1 nmdc:mga0a205_6917_c1_1587_1970 127
1671 3300050515 nmdc:mga0a205_745_c1 nmdc:mga0a205_745_c1_22893_23276 127
1672 3300050515 nmdc:mga0a205_86774_c1 nmdc:mga0a205_86774_c1_367_750 127
1673 3300053077 Ga0495601_0000869 Ga0495601_0000869_7139_7522 127
1674 3300053077 Ga0495601_0009249 Ga0495601_0009249_3913_4296 127
1675 3300053077 Ga0495601_0044802 Ga0495601_0044802_656_1039 127
1676 3300053078 Ga0495612_0019618 Ga0495612_0019618_315_698 127
1677 3300053083 Ga0495655_0108503 Ga0495655_0108503_412_795 127
1678 3300053084 Ga0495595_0001114 Ga0495595_0001114_5766_6149 127
1679 3300053084 Ga0495595_0001865 Ga0495595_0001865_6226_6609 127
1680 3300053085 Ga0495619_0001481 Ga0495619_0001481_602_985 127
1681 3300053085 Ga0495619_0038883 Ga0495619_0038883_2065_2448 127
1682 3300053085 Ga0495619_0044333 Ga0495619_0044333_1880_2263 127
1683 3300053085 Ga0495619_0573316 Ga0495619_0573316_251_634 127
1684 3300060353 Ga0501082_0395421 Ga0501082_0395421_70_453 127
1685 3300060353 Ga0501082_0807961 Ga0501082_0807961_398_781 127
1686 3300061734 Ga0530510_0060643 Ga0530510_0060643_1256_1639 127

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00416

Ribosomal_S13

Ribosomal protein S13/S18

33

139

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
6zqf-assembly1.cif.gz_DS cryo-em structure of the 90s pre-ribosome from saccharomyces cerevisiae, state dis-b (poly-ala) 0.965 3 61
6zqg-assembly1.cif.gz_DS cryo-em structure of the 90s pre-ribosome from saccharomyces cerevisiae, state dis-c 0.9397 3 61
6rbd-assembly1.cif.gz_S state 1 of yeast tsr1-tap rps20-deltaloop pre-40s particles 0.93 3 61
1r2z-assembly1.cif.gz_A mutm (fpg) bound to 5,6-dihydrouracil (dhu) containing dna 0.921 11 58
6erq-assembly2.cif.gz_J structure of the human mitochondrial transcription initiation complex at the hsp promoter 0.9206 11 63
ID Description Score Start End Superfamily
af_Q8HCP0_1_71_1.10.8.50 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9884 4 66 1.10.8.50
af_P54019_1_77_1.10.8.50 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9814 3 61 1.10.8.50
af_A0A1D8PQQ5_1_82_1.10.8.50 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9684 3 61 1.10.8.50
af_P9WH61_1_72_1.10.8.50 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9603 1 71 1.10.8.50
1i94M01 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.954 14 64 1.10.8.50
ID Description Score Start End GO Terms
AF-A0A7C4MPL7-F1-model_v4 30S ribosomal protein S13 0.9977 1 66 GO:0003723
GO:0003735
GO:0005829
GO:0006412
GO:0015935
AF-A0A533J219-F1-model_v4 deleted 0.9899 1 58
AF-A0A436DSH1-F1-model_v4 30S ribosomal protein S13 0.9889 1 68 GO:0003723
GO:0003735
GO:0005829
GO:0006412
GO:0015935
AF-A0A7C1JM66-F1-model_v4 30S ribosomal protein S13 0.9878 1 60 GO:0003723
GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A7C2W8B0-F1-model_v4 30S ribosomal protein S13 0.9844 1 63 GO:0003723
GO:0003735
GO:0005829
GO:0006412
GO:0015935

Feature Viewer

pLDDT pTM Quality
76.08 0.52 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map