F494335
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1491 | 509 | 1491 | 179 |
Family's Representative Sequence
| Representative Sequence | 3300009093|Ga0105240_10007059|Ga0105240_100070597 |
| Length | 218 |
| Sequence | MASIEIIKSIDWPLTGPDRIILPTPQGLRGPPFTRSISTMTGIGKQFPRFELKGTVSSDLNHAFQTFTNDSFPGKWQVVFFWPKDFTFVCPTEIAAFGKLNREFQARDAQILGVSIDSEFVHLAWRQAKDELKNLPFPMLADIKRELSGSLGVLDPGEGVAQRATFIVDPQGVIRFVYVTDLNVGRSPEEVLRVLDALQTDELCPCNWKKGEETLRAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 2 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 3 | 3300003162 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 4 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 5 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 6 | 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 7 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 8 | 3300003568 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 9 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 10 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 11 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 12 | 3300003735 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 13 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 14 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 15 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 16 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 18 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 27 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 31 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 44 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 60 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 64 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 66 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 74 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 76 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 77 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 78 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 79 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 80 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 81 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 82 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 83 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 84 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 85 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 86 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 87 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 88 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 89 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 90 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 92 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 93 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 94 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 95 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 96 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 98 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 99 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 100 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 101 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 102 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 103 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 104 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 105 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 106 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 108 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 109 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009987 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG | Metagenome | Rhizosphere |
| 123 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 136 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 141 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 142 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 143 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 144 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 145 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 146 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 147 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 148 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 149 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 150 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 151 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 152 | 3300023304 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctno.R1 | Metatranscriptome | Rhizosphere |
| 153 | 3300023309 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctcc.R1 | Metatranscriptome | Rhizosphere |
| 154 | 3300023436 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.stno.R1 | Metatranscriptome | Rhizosphere |
| 155 | 3300023438 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.stcc | Metatranscriptome | Rhizosphere |
| 156 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 230 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 234 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 235 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 236 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 237 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 238 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 239 | 3300029272 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.ctno.R1 | Metatranscriptome | Rhizosphere |
| 240 | 3300029276 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.ctcc.R1 | Metatranscriptome | Rhizosphere |
| 241 | 3300029277 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1 | Metatranscriptome | Rhizosphere |
| 242 | 3300029280 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stcc.R1 | Metatranscriptome | Rhizosphere |
| 243 | 3300029283 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctno.R1 | Metatranscriptome | Rhizosphere |
| 244 | 3300029285 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 | Metatranscriptome | Rhizosphere |
| 245 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 246 | 3300030836 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 247 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 248 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 249 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 250 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 251 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 252 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 253 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 254 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 255 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 256 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 257 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 258 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 259 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 260 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 261 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 262 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 263 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 264 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 265 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 266 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 267 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 268 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 269 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 270 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 271 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 272 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 273 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 274 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 275 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 276 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 277 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 278 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 279 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 280 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 281 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 282 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 283 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 284 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 285 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 286 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 287 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 288 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 289 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 290 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 291 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 292 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 293 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 294 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 295 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 296 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 297 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 298 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 299 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 300 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 301 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 302 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 303 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 304 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 305 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 306 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 307 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 308 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 309 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 310 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 311 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 312 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 313 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 314 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 315 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 316 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 317 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 318 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 319 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 320 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 321 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 322 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 323 | 3300042132 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 | Metagenome | Rhizosphere |
| 324 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 325 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 326 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 327 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 328 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 329 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 330 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 331 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 332 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 333 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 334 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 335 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 336 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 337 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 338 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 339 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 340 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 341 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 342 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 343 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 344 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 345 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 346 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 347 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 399 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 400 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 401 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 402 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 403 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 404 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 405 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 406 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 407 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 408 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 409 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 410 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 411 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 412 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 413 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 414 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 415 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 416 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 417 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 418 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 419 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 420 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 421 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 422 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 423 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 424 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 425 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 426 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 427 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 428 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 429 | 3300049524 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control | Metagenome | Rhizosphere |
| 430 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 431 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 432 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 433 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 434 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 435 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 436 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 437 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 438 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 439 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 440 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 441 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 442 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 443 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 444 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 445 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 446 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 447 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 448 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 449 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 450 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 451 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 452 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 453 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 454 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 455 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 456 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 457 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 458 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 459 | 3300049676 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control | Metagenome | Rhizosphere |
| 460 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 461 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 462 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 463 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 464 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 465 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 466 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 467 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 468 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 469 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 470 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 471 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 472 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 473 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 474 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 475 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 476 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 477 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 478 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 479 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 480 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 481 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 482 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 483 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 484 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 485 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 486 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 487 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 488 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 489 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 490 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 491 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 492 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 493 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 494 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 495 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 496 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 497 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 498 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 499 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 500 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 501 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 502 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 503 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 504 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 505 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 506 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 507 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 508 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 509 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.63 |
| Metatranscriptomes | 6.37 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.95 |
| Nodule | 0.07 |
| Rhizoplane | 3.09 |
| Rhizosphere | 90.34 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.55 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24742J22300_10055810 | 3300002244 | Bacteria | 721 |
| 2 | JGI25162J39368_1004290 | 3300002737 | Bacteria | 3407 |
| 3 | Ga0006778J45830_1034955 | 3300003162 | Bacteria | 783 |
| 4 | Ga0006778J45830_1090249 | 3300003162 | Bacteria | 591 |
| 5 | Ga0006759J45824_1031269 | 3300003163 | Bacteria | 656 |
| 6 | Ga0006759J45824_1051790 | 3300003163 | Bacteria | 582 |
| 7 | Ga0006759J45824_1064721 | 3300003163 | Bacteria | 643 |
| 8 | Ga0006759J45824_1080555 | 3300003163 | Bacteria | 810 |
| 9 | JGI25406J46586_10010550 | 3300003203 | Bacteria | 4095 |
| 10 | JGI25406J46586_10025326 | 3300003203 | Bacteria | 2305 |
| 11 | Ga0006777J48905_1023601 | 3300003308 | Bacteria | 696 |
| 12 | Ga0006777J48905_1071737 | 3300003308 | Bacteria | 700 |
| 13 | rootL2_10052881 | 3300003322 | Bacteria | 2766 |
| 14 | Ga0006781J51513_1035968 | 3300003568 | Bacteria | 677 |
| 15 | Ga0007410J51695_1022950 | 3300003574 | Bacteria | 1143 |
| 16 | Ga0007410J51695_1053083 | 3300003574 | Bacteria | 657 |
| 17 | Ga0007416J51690_1050632 | 3300003577 | Bacteria | 697 |
| 18 | Ga0032354_1033655 | 3300003693 | Bacteria | 895 |
| 19 | Ga0032354_1036149 | 3300003693 | Bacteria | 857 |
| 20 | Ga0032354_1048806 | 3300003693 | Bacteria | 738 |
| 21 | Ga0006780_1013989 | 3300003735 | Bacteria | 602 |
| 22 | Ga0006780_1029819 | 3300003735 | Bacteria | 665 |
| 23 | Ga0058859_10026294 | 3300004798 | Bacteria | 674 |
| 24 | Ga0058861_11963726 | 3300004800 | Bacteria | 841 |
| 25 | Ga0058860_10060066 | 3300004801 | Bacteria | 620 |
| 26 | Ga0058860_10076721 | 3300004801 | Bacteria | 1026 |
| 27 | Ga0058860_10088687 | 3300004801 | Bacteria | 1415 |
| 28 | Ga0058860_12240042 | 3300004801 | Bacteria | 826 |
| 29 | Ga0065714_10044263 | 3300005288 | Bacteria | 854 |
| 30 | Ga0065712_10004198 | 3300005290 | Bacteria | 3650 |
| 31 | Ga0065712_10119918 | 3300005290 | Bacteria | 1685 |
| 32 | Ga0065712_10281568 | 3300005290 | Bacteria | 891 |
| 33 | Ga0065712_10466766 | 3300005290 | Bacteria | 626 |
| 34 | Ga0065715_10014079 | 3300005293 | Bacteria | 1793 |
| 35 | Ga0065715_10028357 | 3300005293 | Bacteria | 1302 |
| 36 | Ga0065715_10104963 | 3300005293 | Bacteria | 2924 |
| 37 | Ga0065715_10110463 | 3300005293 | Bacteria | 2619 |
| 38 | Ga0065715_10140004 | 3300005293 | Bacteria | 1868 |
| 39 | Ga0065707_10174103 | 3300005295 | Bacteria | 1463 |
| 40 | Ga0065707_10432960 | 3300005295 | Bacteria | 818 |
| 41 | Ga0070658_10873019 | 3300005327 | Bacteria | 782 |
| 42 | Ga0070676_10140118 | 3300005328 | Bacteria | 1539 |
| 43 | Ga0070676_10148617 | 3300005328 | Bacteria | 1498 |
| 44 | Ga0070683_100038614 | 3300005329 | Bacteria | 4378 |
| 45 | Ga0070683_100133601 | 3300005329 | Bacteria | 2349 |
| 46 | Ga0070683_100223074 | 3300005329 | Bacteria | 1791 |
| 47 | Ga0070683_100835648 | 3300005329 | Bacteria | 883 |
| 48 | Ga0070690_100001531 | 3300005330 | Bacteria | 12113 |
| 49 | Ga0070690_100001718 | 3300005330 | Bacteria | 11553 |
| 50 | Ga0070690_100062600 | 3300005330 | Bacteria | 2399 |
| 51 | Ga0070690_100413850 | 3300005330 | Bacteria | 993 |
| 52 | Ga0070670_100116676 | 3300005331 | Bacteria | 2302 |
| 53 | Ga0070670_100127799 | 3300005331 | Bacteria | 2193 |
| 54 | Ga0070670_100364276 | 3300005331 | Bacteria | 1271 |
| 55 | Ga0070677_10175027 | 3300005333 | Bacteria | 1018 |
| 56 | Ga0068869_100003998 | 3300005334 | Bacteria | 9119 |
| 57 | Ga0068869_100029761 | 3300005334 | Bacteria | 3829 |
| 58 | Ga0068869_100084730 | 3300005334 | Bacteria | 2373 |
| 59 | Ga0068869_101356181 | 3300005334 | Bacteria | 629 |
| 60 | Ga0070666_10004699 | 3300005335 | Bacteria | 8345 |
| 61 | Ga0070666_10013206 | 3300005335 | Bacteria | 5235 |
| 62 | Ga0070666_10055545 | 3300005335 | Bacteria | 2673 |
| 63 | Ga0070680_100009202 | 3300005336 | Bacteria | 7576 |
| 64 | Ga0070680_100018985 | 3300005336 | Bacteria | 5442 |
| 65 | Ga0070680_100075132 | 3300005336 | Bacteria | 2782 |
| 66 | Ga0070680_100110853 | 3300005336 | Bacteria | 2284 |
| 67 | Ga0070680_100129541 | 3300005336 | Bacteria | 2110 |
| 68 | Ga0070680_100140105 | 3300005336 | Bacteria | 2028 |
| 69 | Ga0070680_100276503 | 3300005336 | Bacteria | 1422 |
| 70 | Ga0070680_100390122 | 3300005336 | Bacteria | 1186 |
| 71 | Ga0070680_100429129 | 3300005336 | Bacteria | 1128 |
| 72 | Ga0070682_100005572 | 3300005337 | Bacteria | 7014 |
| 73 | Ga0070682_100030755 | 3300005337 | Bacteria | 3244 |
| 74 | Ga0070682_100252677 | 3300005337 | Bacteria | 1272 |
| 75 | Ga0070682_101014679 | 3300005337 | Bacteria | 689 |
| 76 | Ga0068868_100008181 | 3300005338 | Bacteria | 7482 |
| 77 | Ga0068868_100135724 | 3300005338 | Bacteria | 2016 |
| 78 | Ga0070660_100406918 | 3300005339 | Bacteria | 1126 |
| 79 | Ga0070689_100003814 | 3300005340 | Bacteria | 10097 |
| 80 | Ga0070689_100119758 | 3300005340 | Bacteria | 2101 |
| 81 | Ga0070689_100188925 | 3300005340 | Bacteria | 1677 |
| 82 | Ga0070689_100748014 | 3300005340 | Bacteria | 857 |
| 83 | Ga0070691_10031657 | 3300005341 | Bacteria | 2482 |
| 84 | Ga0070691_10234599 | 3300005341 | Bacteria | 978 |
| 85 | Ga0070687_100002571 | 3300005343 | Bacteria | 6846 |
| 86 | Ga0070687_100195228 | 3300005343 | Bacteria | 1223 |
| 87 | Ga0070661_100002493 | 3300005344 | Bacteria | 12612 |
| 88 | Ga0070661_100165759 | 3300005344 | Bacteria | 1676 |
| 89 | Ga0070692_10019677 | 3300005345 | Bacteria | 3261 |
| 90 | Ga0070692_10027265 | 3300005345 | Bacteria | 2830 |
| 91 | Ga0070668_100053464 | 3300005347 | Bacteria | 3115 |
| 92 | Ga0070668_100092499 | 3300005347 | Bacteria | 2385 |
| 93 | Ga0070669_100024257 | 3300005353 | Bacteria | 4349 |
| 94 | Ga0070669_100053235 | 3300005353 | Bacteria | 2962 |
| 95 | Ga0070669_100273498 | 3300005353 | Bacteria | 1351 |
| 96 | Ga0070669_100494667 | 3300005353 | Bacteria | 1014 |
| 97 | Ga0070669_100834761 | 3300005353 | Bacteria | 784 |
| 98 | Ga0070669_100865487 | 3300005353 | Bacteria | 771 |
| 99 | Ga0070675_100010921 | 3300005354 | Bacteria | 7104 |
| 100 | Ga0070675_100011633 | 3300005354 | Bacteria | 6893 |
| 101 | Ga0070675_100278063 | 3300005354 | Bacteria | 1470 |
| 102 | Ga0070675_100301190 | 3300005354 | Bacteria | 1412 |
| 103 | Ga0070671_100005633 | 3300005355 | Bacteria | 9968 |
| 104 | Ga0070671_100009823 | 3300005355 | Bacteria | 7680 |
| 105 | Ga0070671_100027320 | 3300005355 | Bacteria | 4696 |
| 106 | Ga0070671_100085042 | 3300005355 | Bacteria | 2645 |
| 107 | Ga0070671_100158214 | 3300005355 | Bacteria | 1915 |
| 108 | Ga0070671_100460060 | 3300005355 | Bacteria | 1092 |
| 109 | Ga0070674_100039351 | 3300005356 | Bacteria | 3192 |
| 110 | Ga0070674_100045974 | 3300005356 | Bacteria | 2984 |
| 111 | Ga0070674_100129468 | 3300005356 | Bacteria | 1879 |
| 112 | Ga0070674_100497617 | 3300005356 | Bacteria | 1015 |
| 113 | Ga0070674_100721984 | 3300005356 | Bacteria | 854 |
| 114 | Ga0070673_100021060 | 3300005364 | Bacteria | 4717 |
| 115 | Ga0070673_100024898 | 3300005364 | Bacteria | 4395 |
| 116 | Ga0070673_100044903 | 3300005364 | Bacteria | 3424 |
| 117 | Ga0070673_100371438 | 3300005364 | Bacteria | 1273 |
| 118 | Ga0070673_100409217 | 3300005364 | Bacteria | 1214 |
| 119 | Ga0070688_100001922 | 3300005365 | Bacteria | 10439 |
| 120 | Ga0070688_100098823 | 3300005365 | Bacteria | 1921 |
| 121 | Ga0070688_100234486 | 3300005365 | Bacteria | 1300 |
| 122 | Ga0070688_100373797 | 3300005365 | Bacteria | 1049 |
| 123 | Ga0070688_100484889 | 3300005365 | Bacteria | 930 |
| 124 | Ga0070659_100161443 | 3300005366 | Bacteria | 1832 |
| 125 | Ga0070659_100300740 | 3300005366 | Bacteria | 1338 |
| 126 | Ga0070659_101144045 | 3300005366 | Bacteria | 687 |
| 127 | Ga0070667_100000011 | 3300005367 | Bacteria | 269772 |
| 128 | Ga0070667_100029415 | 3300005367 | Bacteria | 4577 |
| 129 | Ga0070667_100066033 | 3300005367 | Bacteria | 3073 |
| 130 | Ga0070667_100413023 | 3300005367 | Bacteria | 1230 |
| 131 | Ga0070667_100584150 | 3300005367 | Bacteria | 1029 |
| 132 | Ga0070667_100707215 | 3300005367 | Bacteria | 933 |
| 133 | Ga0070709_10008243 | 3300005434 | Bacteria | 5721 |
| 134 | Ga0070709_10037581 | 3300005434 | Bacteria | 2958 |
| 135 | Ga0070709_10599611 | 3300005434 | Bacteria | 848 |
| 136 | Ga0070714_100005056 | 3300005435 | Bacteria | 10031 |
| 137 | Ga0070713_100000161 | 3300005436 | Bacteria | 45444 |
| 138 | Ga0070713_100015790 | 3300005436 | Bacteria | 5658 |
| 139 | Ga0070713_100112789 | 3300005436 | Bacteria | 2373 |
| 140 | Ga0070713_100117990 | 3300005436 | Bacteria | 2323 |
| 141 | Ga0070713_100137932 | 3300005436 | Bacteria | 2157 |
| 142 | Ga0070710_10052096 | 3300005437 | Bacteria | 2301 |
| 143 | Ga0070710_10254036 | 3300005437 | Bacteria | 1131 |
| 144 | Ga0070701_10052866 | 3300005438 | Bacteria | 2112 |
| 145 | Ga0070701_10539132 | 3300005438 | Bacteria | 764 |
| 146 | Ga0070711_100175658 | 3300005439 | Bacteria | 1636 |
| 147 | Ga0070711_101472529 | 3300005439 | Bacteria | 593 |
| 148 | Ga0070705_100060432 | 3300005440 | Bacteria | 2248 |
| 149 | Ga0070700_100013887 | 3300005441 | Bacteria | 4534 |
| 150 | Ga0070700_100014864 | 3300005441 | Bacteria | 4400 |
| 151 | Ga0070700_100062509 | 3300005441 | Bacteria | 2352 |
| 152 | Ga0070700_100130090 | 3300005441 | Bacteria | 1698 |
| 153 | Ga0070700_100130486 | 3300005441 | Bacteria | 1695 |
| 154 | Ga0070708_100659527 | 3300005445 | Bacteria | 986 |
| 155 | Ga0070663_100144080 | 3300005455 | Bacteria | 1821 |
| 156 | Ga0070663_100209047 | 3300005455 | Bacteria | 1527 |
| 157 | Ga0070678_100007254 | 3300005456 | Bacteria | 6560 |
| 158 | Ga0070678_100016401 | 3300005456 | Bacteria | 4739 |
| 159 | Ga0070678_100105706 | 3300005456 | Bacteria | 2192 |
| 160 | Ga0070678_100240690 | 3300005456 | Bacteria | 1513 |
| 161 | Ga0070678_100460806 | 3300005456 | Bacteria | 1115 |
| 162 | Ga0070662_100018507 | 3300005457 | Bacteria | 4713 |
| 163 | Ga0070662_100237739 | 3300005457 | Bacteria | 1460 |
| 164 | Ga0070681_10003202 | 3300005458 | Bacteria | 15250 |
| 165 | Ga0070681_10018495 | 3300005458 | Bacteria | 6965 |
| 166 | Ga0070681_10034684 | 3300005458 | Bacteria | 5067 |
| 167 | Ga0070681_10050700 | 3300005458 | Bacteria | 4141 |
| 168 | Ga0070681_10057069 | 3300005458 | Bacteria | 3885 |
| 169 | Ga0070681_10135263 | 3300005458 | Bacteria | 2396 |
| 170 | Ga0070681_10410600 | 3300005458 | Bacteria | 1266 |
| 171 | Ga0070681_10479982 | 3300005458 | Bacteria | 1156 |
| 172 | Ga0070681_10988195 | 3300005458 | Unclassified | 761 |
| 173 | Ga0068867_100356474 | 3300005459 | Bacteria | 1222 |
| 174 | Ga0068867_100561019 | 3300005459 | Bacteria | 990 |
| 175 | Ga0068867_100601595 | 3300005459 | Bacteria | 959 |
| 176 | Ga0068867_100692053 | 3300005459 | Bacteria | 899 |
| 177 | Ga0068867_100989373 | 3300005459 | Bacteria | 762 |
| 178 | Ga0070707_100166622 | 3300005468 | Bacteria | 2147 |
| 179 | Ga0070698_100003450 | 3300005471 | Bacteria | 17393 |
| 180 | Ga0070699_100385215 | 3300005518 | Bacteria | 1266 |
| 181 | Ga0070699_101308213 | 3300005518 | Bacteria | 665 |
| 182 | Ga0070679_100029331 | 3300005530 | Bacteria | 5428 |
| 183 | Ga0070679_100120363 | 3300005530 | Bacteria | 2610 |
| 184 | Ga0070679_100121897 | 3300005530 | Bacteria | 2592 |
| 185 | Ga0070679_100135159 | 3300005530 | Bacteria | 2447 |
| 186 | Ga0070679_100204893 | 3300005530 | Bacteria | 1937 |
| 187 | Ga0070679_100458302 | 3300005530 | Bacteria | 1220 |
| 188 | Ga0070679_100848135 | 3300005530 | Bacteria | 857 |
| 189 | Ga0070679_101126297 | 3300005530 | Bacteria | 730 |
| 190 | Ga0070684_100002573 | 3300005535 | Bacteria | 13400 |
| 191 | Ga0070684_100040392 | 3300005535 | Bacteria | 4017 |
| 192 | Ga0070684_100605533 | 3300005535 | Bacteria | 1019 |
| 193 | Ga0070684_101050360 | 3300005535 | Bacteria | 765 |
| 194 | Ga0068853_100849591 | 3300005539 | Bacteria | 875 |
| 195 | Ga0068853_100921835 | 3300005539 | Bacteria | 839 |
| 196 | Ga0068853_100932233 | 3300005539 | Bacteria | 835 |
| 197 | Ga0068853_101042865 | 3300005539 | Bacteria | 788 |
| 198 | Ga0070672_100018046 | 3300005543 | Bacteria | 5092 |
| 199 | Ga0070672_100057039 | 3300005543 | Bacteria | 3065 |
| 200 | Ga0070672_100231671 | 3300005543 | Bacteria | 1552 |
| 201 | Ga0070672_100232701 | 3300005543 | Bacteria | 1548 |
| 202 | Ga0070672_100253443 | 3300005543 | Bacteria | 1483 |
| 203 | Ga0070672_100813064 | 3300005543 | Bacteria | 823 |
| 204 | Ga0070672_101346824 | 3300005543 | Bacteria | 638 |
| 205 | Ga0070686_100003317 | 3300005544 | Bacteria | 8816 |
| 206 | Ga0070686_100036607 | 3300005544 | Bacteria | 3040 |
| 207 | Ga0070686_100090483 | 3300005544 | Bacteria | 2046 |
| 208 | Ga0070686_100250400 | 3300005544 | Bacteria | 1294 |
| 209 | Ga0070686_100377995 | 3300005544 | Bacteria | 1072 |
| 210 | Ga0070686_100775245 | 3300005544 | Bacteria | 771 |
| 211 | Ga0070686_101156942 | 3300005544 | Bacteria | 641 |
| 212 | Ga0070695_100634540 | 3300005545 | Bacteria | 842 |
| 213 | Ga0070696_100090533 | 3300005546 | Bacteria | 2177 |
| 214 | Ga0070696_100250139 | 3300005546 | Bacteria | 1340 |
| 215 | Ga0070693_100244942 | 3300005547 | Bacteria | 1186 |
| 216 | Ga0070693_100580284 | 3300005547 | Bacteria | 807 |
| 217 | Ga0070665_100001687 | 3300005548 | Bacteria | 25457 |
| 218 | Ga0070665_100002827 | 3300005548 | Bacteria | 18791 |
| 219 | Ga0070665_100094327 | 3300005548 | Bacteria | 2997 |
| 220 | Ga0070665_100109779 | 3300005548 | Bacteria | 2760 |
| 221 | Ga0070665_100121768 | 3300005548 | Bacteria | 2610 |
| 222 | Ga0070665_100146654 | 3300005548 | Bacteria | 2363 |
| 223 | Ga0070665_100157767 | 3300005548 | Bacteria | 2271 |
| 224 | Ga0070665_100318697 | 3300005548 | Bacteria | 1559 |
| 225 | Ga0070665_100328961 | 3300005548 | Bacteria | 1533 |
| 226 | Ga0070704_100028868 | 3300005549 | Bacteria | 3697 |
| 227 | Ga0068855_100009392 | 3300005563 | Bacteria | 11811 |
| 228 | Ga0068855_100010992 | 3300005563 | Bacteria | 10923 |
| 229 | Ga0068855_100035062 | 3300005563 | Bacteria | 5978 |
| 230 | Ga0068855_100050765 | 3300005563 | Bacteria | 4886 |
| 231 | Ga0068855_100072666 | 3300005563 | Bacteria | 3997 |
| 232 | Ga0068855_100232277 | 3300005563 | Bacteria | 2065 |
| 233 | Ga0068855_101422622 | 3300005563 | Bacteria | 714 |
| 234 | Ga0070664_100001025 | 3300005564 | Bacteria | 21947 |
| 235 | Ga0070664_100081493 | 3300005564 | Bacteria | 2789 |
| 236 | Ga0070664_100111372 | 3300005564 | Bacteria | 2389 |
| 237 | Ga0070664_100463335 | 3300005564 | Bacteria | 1165 |
| 238 | Ga0070664_100486902 | 3300005564 | Bacteria | 1136 |
| 239 | Ga0070664_100507834 | 3300005564 | Bacteria | 1112 |
| 240 | Ga0068857_100040769 | 3300005577 | Bacteria | 4116 |
| 241 | Ga0068857_100043190 | 3300005577 | Bacteria | 3998 |
| 242 | Ga0068857_100159520 | 3300005577 | Bacteria | 2046 |
| 243 | Ga0068857_100446228 | 3300005577 | Bacteria | 1209 |
| 244 | Ga0068857_100592291 | 3300005577 | Bacteria | 1048 |
| 245 | Ga0068854_100053452 | 3300005578 | Bacteria | 2901 |
| 246 | Ga0068854_100288862 | 3300005578 | Bacteria | 1323 |
| 247 | Ga0068854_100431501 | 3300005578 | Bacteria | 1096 |
| 248 | Ga0068854_100538253 | 3300005578 | Bacteria | 989 |
| 249 | Ga0068856_100020206 | 3300005614 | Bacteria | 6469 |
| 250 | Ga0068856_100041061 | 3300005614 | Bacteria | 4546 |
| 251 | Ga0068856_100075876 | 3300005614 | Bacteria | 3330 |
| 252 | Ga0068856_100104583 | 3300005614 | Bacteria | 2825 |
| 253 | Ga0068852_100100858 | 3300005616 | Bacteria | 2605 |
| 254 | Ga0068852_101190394 | 3300005616 | Bacteria | 783 |
| 255 | Ga0068859_100000715 | 3300005617 | Bacteria | 33463 |
| 256 | Ga0068859_100016276 | 3300005617 | Bacteria | 7471 |
| 257 | Ga0068859_100024730 | 3300005617 | Bacteria | 6027 |
| 258 | Ga0068859_100086680 | 3300005617 | Bacteria | 3178 |
| 259 | Ga0068859_100107183 | 3300005617 | Bacteria | 2854 |
| 260 | Ga0068859_100339583 | 3300005617 | Bacteria | 1596 |
| 261 | Ga0068859_100411252 | 3300005617 | Bacteria | 1449 |
| 262 | Ga0068859_100638488 | 3300005617 | Bacteria | 1157 |
| 263 | Ga0068859_100779843 | 3300005617 | Bacteria | 1044 |
| 264 | Ga0068859_101135195 | 3300005617 | Bacteria | 860 |
| 265 | Ga0068864_100005754 | 3300005618 | Bacteria | 10172 |
| 266 | Ga0068864_100016171 | 3300005618 | Bacteria | 6210 |
| 267 | Ga0068864_100175244 | 3300005618 | Bacteria | 1957 |
| 268 | Ga0068864_100219989 | 3300005618 | Bacteria | 1752 |
| 269 | Ga0068864_101638907 | 3300005618 | Bacteria | 648 |
| 270 | Ga0068866_10004184 | 3300005718 | Bacteria | 5921 |
| 271 | Ga0068866_10351346 | 3300005718 | Bacteria | 937 |
| 272 | Ga0068866_10785035 | 3300005718 | Bacteria | 661 |
| 273 | Ga0068861_100013223 | 3300005719 | Bacteria | 5774 |
| 274 | Ga0068861_100021947 | 3300005719 | Bacteria | 4593 |
| 275 | Ga0068861_100086189 | 3300005719 | Bacteria | 2468 |
| 276 | Ga0068861_100090868 | 3300005719 | Bacteria | 2409 |
| 277 | Ga0068861_100124813 | 3300005719 | Bacteria | 2082 |
| 278 | Ga0068861_100154175 | 3300005719 | Bacteria | 1888 |
| 279 | Ga0068861_100608226 | 3300005719 | Bacteria | 1004 |
| 280 | Ga0068861_101333808 | 3300005719 | Bacteria | 699 |
| 281 | Ga0068870_10003073 | 3300005840 | Bacteria | 7039 |
| 282 | Ga0068870_10013288 | 3300005840 | Bacteria | 3867 |
| 283 | Ga0068870_10064795 | 3300005840 | Bacteria | 1975 |
| 284 | Ga0068870_10322056 | 3300005840 | Bacteria | 982 |
| 285 | Ga0068863_100002979 | 3300005841 | Bacteria | 16748 |
| 286 | Ga0068863_100005241 | 3300005841 | Bacteria | 12793 |
| 287 | Ga0068863_100009569 | 3300005841 | Bacteria | 9452 |
| 288 | Ga0068863_100072398 | 3300005841 | Bacteria | 3260 |
| 289 | Ga0068863_100379148 | 3300005841 | Bacteria | 1381 |
| 290 | Ga0068863_100696262 | 3300005841 | Bacteria | 1010 |
| 291 | Ga0068863_100804324 | 3300005841 | Bacteria | 938 |
| 292 | Ga0068863_100848960 | 3300005841 | Bacteria | 912 |
| 293 | Ga0068858_100005002 | 3300005842 | Bacteria | 12988 |
| 294 | Ga0068858_100012054 | 3300005842 | Bacteria | 8149 |
| 295 | Ga0068858_100014520 | 3300005842 | Bacteria | 7420 |
| 296 | Ga0068858_100061049 | 3300005842 | Bacteria | 3484 |
| 297 | Ga0068858_100174328 | 3300005842 | Bacteria | 2029 |
| 298 | Ga0068858_100551473 | 3300005842 | Bacteria | 1116 |
| 299 | Ga0068860_100003286 | 3300005843 | Bacteria | 16643 |
| 300 | Ga0068860_100024072 | 3300005843 | Bacteria | 5886 |
| 301 | Ga0068860_100064892 | 3300005843 | Bacteria | 3467 |
| 302 | Ga0068860_100065361 | 3300005843 | Bacteria | 3454 |
| 303 | Ga0068860_100108788 | 3300005843 | Bacteria | 2649 |
| 304 | Ga0068860_100146073 | 3300005843 | Bacteria | 2276 |
| 305 | Ga0068862_100001470 | 3300005844 | Bacteria | 21626 |
| 306 | Ga0068862_100002059 | 3300005844 | Bacteria | 18164 |
| 307 | Ga0068862_100004086 | 3300005844 | Bacteria | 12374 |
| 308 | Ga0068862_100058178 | 3300005844 | Bacteria | 3315 |
| 309 | Ga0068862_100200402 | 3300005844 | Bacteria | 1799 |
| 310 | Ga0068862_100875473 | 3300005844 | Bacteria | 882 |
| 311 | Ga0068862_100962035 | 3300005844 | Bacteria | 842 |
| 312 | Ga0068862_101255489 | 3300005844 | Bacteria | 741 |
| 313 | Ga0068862_101782262 | 3300005844 | Bacteria | 625 |
| 314 | Ga0081455_10001012 | 3300005937 | Bacteria | 35566 |
| 315 | Ga0081455_10057666 | 3300005937 | Bacteria | 3290 |
| 316 | Ga0081455_10600666 | 3300005937 | Bacteria | 717 |
| 317 | Ga0081539_10000055 | 3300005985 | Bacteria | 257359 |
| 318 | Ga0081539_10004424 | 3300005985 | Bacteria | 15535 |
| 319 | Ga0081539_10005465 | 3300005985 | Bacteria | 12954 |
| 320 | Ga0081539_10047289 | 3300005985 | Bacteria | 2458 |
| 321 | Ga0070717_11153218 | 3300006028 | Bacteria | 705 |
| 322 | Ga0075365_10204243 | 3300006038 | Bacteria | 1384 |
| 323 | Ga0070715_10316173 | 3300006163 | Bacteria | 841 |
| 324 | Ga0070716_100002584 | 3300006173 | Bacteria | 8362 |
| 325 | Ga0070716_100006429 | 3300006173 | Bacteria | 5739 |
| 326 | Ga0070716_100053175 | 3300006173 | Bacteria | 2308 |
| 327 | Ga0070716_100266822 | 3300006173 | Bacteria | 1174 |
| 328 | Ga0070712_100001982 | 3300006175 | Bacteria | 12540 |
| 329 | Ga0070712_100032042 | 3300006175 | Bacteria | 3547 |
| 330 | Ga0070712_100146152 | 3300006175 | Bacteria | 1810 |
| 331 | Ga0075366_10144311 | 3300006195 | Bacteria | 1440 |
| 332 | Ga0075366_10435087 | 3300006195 | Bacteria | 809 |
| 333 | Ga0097621_100004031 | 3300006237 | Bacteria | 10186 |
| 334 | Ga0097621_100004662 | 3300006237 | Bacteria | 9575 |
| 335 | Ga0097621_100075288 | 3300006237 | Bacteria | 2797 |
| 336 | Ga0097621_100096165 | 3300006237 | Bacteria | 2485 |
| 337 | Ga0097621_100131167 | 3300006237 | Bacteria | 2133 |
| 338 | Ga0097621_100171335 | 3300006237 | Bacteria | 1871 |
| 339 | Ga0097621_100207521 | 3300006237 | Bacteria | 1703 |
| 340 | Ga0097621_100210662 | 3300006237 | Bacteria | 1691 |
| 341 | Ga0097621_100251778 | 3300006237 | Bacteria | 1547 |
| 342 | Ga0097621_100416746 | 3300006237 | Bacteria | 1205 |
| 343 | Ga0068871_100015582 | 3300006358 | Bacteria | 5696 |
| 344 | Ga0068871_100017404 | 3300006358 | Bacteria | 5439 |
| 345 | Ga0068871_100082487 | 3300006358 | Bacteria | 2666 |
| 346 | Ga0068871_100097128 | 3300006358 | Bacteria | 2462 |
| 347 | Ga0068871_100254001 | 3300006358 | Bacteria | 1532 |
| 348 | Ga0068871_100342520 | 3300006358 | Bacteria | 1320 |
| 349 | Ga0068871_100359803 | 3300006358 | Bacteria | 1289 |
| 350 | Ga0068871_100383971 | 3300006358 | Bacteria | 1248 |
| 351 | Ga0068871_100437282 | 3300006358 | Bacteria | 1170 |
| 352 | Ga0068871_101339547 | 3300006358 | Bacteria | 674 |
| 353 | Ga0075428_100000991 | 3300006844 | Bacteria | 30093 |
| 354 | Ga0075428_100004128 | 3300006844 | Bacteria | 15990 |
| 355 | Ga0075428_100006037 | 3300006844 | Bacteria | 13455 |
| 356 | Ga0075430_100001603 | 3300006846 | Bacteria | 18468 |
| 357 | Ga0075430_100026158 | 3300006846 | Bacteria | 4965 |
| 358 | Ga0075430_100399433 | 3300006846 | Bacteria | 1134 |
| 359 | Ga0075430_100682693 | 3300006846 | Bacteria | 846 |
| 360 | Ga0075431_100002145 | 3300006847 | Bacteria | 18863 |
| 361 | Ga0075431_100005153 | 3300006847 | Bacteria | 12866 |
| 362 | Ga0075431_100010663 | 3300006847 | Bacteria | 9236 |
| 363 | Ga0075431_100125160 | 3300006847 | Bacteria | 2652 |
| 364 | Ga0075433_10665798 | 3300006852 | Bacteria | 912 |
| 365 | Ga0075434_100350625 | 3300006871 | Bacteria | 1497 |
| 366 | Ga0075429_100000892 | 3300006880 | Bacteria | 23610 |
| 367 | Ga0075429_100004377 | 3300006880 | Bacteria | 12121 |
| 368 | Ga0075429_100208872 | 3300006880 | Bacteria | 1710 |
| 369 | Ga0075429_100376568 | 3300006880 | Bacteria | 1243 |
| 370 | Ga0068865_100011129 | 3300006881 | Bacteria | 5619 |
| 371 | Ga0068865_100041920 | 3300006881 | Bacteria | 3117 |
| 372 | Ga0068865_100151242 | 3300006881 | Bacteria | 1761 |
| 373 | Ga0068865_100227477 | 3300006881 | Bacteria | 1461 |
| 374 | Ga0068865_100275012 | 3300006881 | Bacteria | 1338 |
| 375 | Ga0075436_100070848 | 3300006914 | Bacteria | 2410 |
| 376 | Ga0075436_100490443 | 3300006914 | Bacteria | 898 |
| 377 | Ga0097620_100000715 | 3300006931 | Bacteria | 33463 |
| 378 | Ga0097620_100016276 | 3300006931 | Bacteria | 7471 |
| 379 | Ga0097620_100024730 | 3300006931 | Bacteria | 6027 |
| 380 | Ga0097620_100086677 | 3300006931 | Bacteria | 3178 |
| 381 | Ga0097620_100107187 | 3300006931 | Bacteria | 2854 |
| 382 | Ga0097620_100339606 | 3300006931 | Bacteria | 1596 |
| 383 | Ga0097620_100411213 | 3300006931 | Bacteria | 1449 |
| 384 | Ga0097620_100638372 | 3300006931 | Bacteria | 1157 |
| 385 | Ga0097620_100780080 | 3300006931 | Bacteria | 1044 |
| 386 | Ga0097620_101135376 | 3300006931 | Bacteria | 860 |
| 387 | Ga0099826_10018619 | 3300006948 | Bacteria | 5238 |
| 388 | Ga0075435_100093833 | 3300007076 | Bacteria | 2480 |
| 389 | Ga0105250_10054875 | 3300009092 | Bacteria | 1599 |
| 390 | Ga0105250_10087463 | 3300009092 | Bacteria | 1265 |
| 391 | Ga0105240_10005273 | 3300009093 | Bacteria | 19301 |
| 392 | Ga0105240_10007059 | 3300009093 | Bacteria | 16375 |
| 393 | Ga0105240_10007550 | 3300009093 | Bacteria | 15759 |
| 394 | Ga0105240_10012718 | 3300009093 | Bacteria | 11600 |
| 395 | Ga0105240_10024084 | 3300009093 | Bacteria | 8037 |
| 396 | Ga0105240_10030802 | 3300009093 | Bacteria | 6970 |
| 397 | Ga0105240_10086562 | 3300009093 | Bacteria | 3838 |
| 398 | Ga0105240_10110534 | 3300009093 | Bacteria | 3326 |
| 399 | Ga0105240_10134635 | 3300009093 | Bacteria | 2960 |
| 400 | Ga0105240_10238722 | 3300009093 | Bacteria | 2108 |
| 401 | Ga0105240_10480810 | 3300009093 | Bacteria | 1384 |
| 402 | Ga0105240_10546096 | 3300009093 | Bacteria | 1283 |
| 403 | Ga0105240_10686700 | 3300009093 | Bacteria | 1119 |
| 404 | Ga0105240_10843405 | 3300009093 | Bacteria | 990 |
| 405 | Ga0111539_10018383 | 3300009094 | Bacteria | 8658 |
| 406 | Ga0111539_10101187 | 3300009094 | Bacteria | 3383 |
| 407 | Ga0111539_10203540 | 3300009094 | Bacteria | 2308 |
| 408 | Ga0111539_11420043 | 3300009094 | Bacteria | 805 |
| 409 | Ga0111539_11489965 | 3300009094 | Bacteria | 785 |
| 410 | Ga0111539_12179859 | 3300009094 | Bacteria | 643 |
| 411 | Ga0105245_10009918 | 3300009098 | Bacteria | 8296 |
| 412 | Ga0105245_10037278 | 3300009098 | Bacteria | 4323 |
| 413 | Ga0105245_10574927 | 3300009098 | Bacteria | 1151 |
| 414 | Ga0105245_10815366 | 3300009098 | Bacteria | 972 |
| 415 | Ga0105247_10000557 | 3300009101 | Bacteria | 30302 |
| 416 | Ga0105247_10006388 | 3300009101 | Bacteria | 7296 |
| 417 | Ga0105247_10015442 | 3300009101 | Bacteria | 4574 |
| 418 | Ga0105247_10030282 | 3300009101 | Bacteria | 3280 |
| 419 | Ga0114129_10000531 | 3300009147 | Bacteria | 46637 |
| 420 | Ga0105243_10093409 | 3300009148 | Bacteria | 2483 |
| 421 | Ga0105241_10024074 | 3300009174 | Bacteria | 4522 |
| 422 | Ga0105241_10321408 | 3300009174 | Bacteria | 1335 |
| 423 | Ga0105241_10460378 | 3300009174 | Bacteria | 1127 |
| 424 | Ga0105241_11270332 | 3300009174 | Bacteria | 700 |
| 425 | Ga0105242_10000894 | 3300009176 | Bacteria | 23159 |
| 426 | Ga0105242_10064423 | 3300009176 | Bacteria | 3022 |
| 427 | Ga0105242_10248244 | 3300009176 | Bacteria | 1603 |
| 428 | Ga0105242_11105889 | 3300009176 | Bacteria | 807 |
| 429 | Ga0105248_10009456 | 3300009177 | Bacteria | 10731 |
| 430 | Ga0105248_10012607 | 3300009177 | Bacteria | 9327 |
| 431 | Ga0105248_10013134 | 3300009177 | Bacteria | 9119 |
| 432 | Ga0105248_10141359 | 3300009177 | Bacteria | 2715 |
| 433 | Ga0105248_10325348 | 3300009177 | Bacteria | 1732 |
| 434 | Ga0105248_10382087 | 3300009177 | Bacteria | 1586 |
| 435 | Ga0105248_10674855 | 3300009177 | Bacteria | 1166 |
| 436 | Ga0105248_10678850 | 3300009177 | Bacteria | 1162 |
| 437 | Ga0105237_10009386 | 3300009545 | Bacteria | 10480 |
| 438 | Ga0105237_10018532 | 3300009545 | Bacteria | 7203 |
| 439 | Ga0105237_10183150 | 3300009545 | Bacteria | 2094 |
| 440 | Ga0105237_10560306 | 3300009545 | Bacteria | 1149 |
| 441 | Ga0105238_10004856 | 3300009551 | Bacteria | 13304 |
| 442 | Ga0105238_10010977 | 3300009551 | Bacteria | 9109 |
| 443 | Ga0105238_10028530 | 3300009551 | Bacteria | 5685 |
| 444 | Ga0105238_10058638 | 3300009551 | Bacteria | 3858 |
| 445 | Ga0105238_10100214 | 3300009551 | Bacteria | 2880 |
| 446 | Ga0105238_10139985 | 3300009551 | Bacteria | 2397 |
| 447 | Ga0105238_10294035 | 3300009551 | Bacteria | 1607 |
| 448 | Ga0105238_10316126 | 3300009551 | Bacteria | 1547 |
| 449 | Ga0105238_10399888 | 3300009551 | Bacteria | 1367 |
| 450 | Ga0105249_10005395 | 3300009553 | Bacteria | 11037 |
| 451 | Ga0105249_10016314 | 3300009553 | Bacteria | 6588 |
| 452 | Ga0105249_10125676 | 3300009553 | Bacteria | 2442 |
| 453 | Ga0105249_10288378 | 3300009553 | Bacteria | 1642 |
| 454 | Ga0105249_10508058 | 3300009553 | Bacteria | 1251 |
| 455 | Ga0105249_11443842 | 3300009553 | Bacteria | 760 |
| 456 | Ga0105030_102515 | 3300009987 | Bacteria | 1595 |
| 457 | Ga0105239_10013750 | 3300010375 | Bacteria | 8984 |
| 458 | Ga0105239_10016193 | 3300010375 | Bacteria | 8248 |
| 459 | Ga0105239_10027633 | 3300010375 | Bacteria | 6243 |
| 460 | Ga0105239_10091018 | 3300010375 | Bacteria | 3366 |
| 461 | Ga0105239_11058539 | 3300010375 | Bacteria | 933 |
| 462 | Ga0105246_10189467 | 3300011119 | Bacteria | 1591 |
| 463 | Ga0105246_10392668 | 3300011119 | Bacteria | 1150 |
| 464 | Ga0105246_10804113 | 3300011119 | Bacteria | 834 |
| 465 | Ga0105246_11376354 | 3300011119 | Bacteria | 657 |
| 466 | Ga0157371_11089482 | 3300013102 | Bacteria | 612 |
| 467 | Ga0157370_10022372 | 3300013104 | Bacteria | 6290 |
| 468 | Ga0157369_10011861 | 3300013105 | Bacteria | 9898 |
| 469 | Ga0157369_10031473 | 3300013105 | Bacteria | 5841 |
| 470 | Ga0157369_10040019 | 3300013105 | Bacteria | 5120 |
| 471 | Ga0157369_10472630 | 3300013105 | Bacteria | 1297 |
| 472 | Ga0157369_10493345 | 3300013105 | Bacteria | 1267 |
| 473 | Ga0157369_11268421 | 3300013105 | Bacteria | 751 |
| 474 | Ga0157374_10013136 | 3300013296 | Bacteria | 7223 |
| 475 | Ga0157374_10074346 | 3300013296 | Bacteria | 3209 |
| 476 | Ga0157374_10101969 | 3300013296 | Bacteria | 2752 |
| 477 | Ga0157374_10142442 | 3300013296 | Bacteria | 2327 |
| 478 | Ga0157374_10411530 | 3300013296 | Bacteria | 1350 |
| 479 | Ga0157374_10510983 | 3300013296 | Bacteria | 1207 |
| 480 | Ga0157374_10560903 | 3300013296 | Bacteria | 1150 |
| 481 | Ga0157374_11411107 | 3300013296 | Bacteria | 719 |
| 482 | Ga0157374_11495737 | 3300013296 | Bacteria | 698 |
| 483 | Ga0157378_10166673 | 3300013297 | Bacteria | 2064 |
| 484 | Ga0157378_10430930 | 3300013297 | Bacteria | 1305 |
| 485 | Ga0157378_10604741 | 3300013297 | Bacteria | 1108 |
| 486 | Ga0157378_10732017 | 3300013297 | Bacteria | 1011 |
| 487 | Ga0157378_10732359 | 3300013297 | Bacteria | 1010 |
| 488 | Ga0157378_10874950 | 3300013297 | Bacteria | 928 |
| 489 | Ga0157378_10995778 | 3300013297 | Bacteria | 872 |
| 490 | Ga0163162_10037985 | 3300013306 | Bacteria | 4806 |
| 491 | Ga0163162_10054126 | 3300013306 | Bacteria | 4035 |
| 492 | Ga0163162_10072548 | 3300013306 | Bacteria | 3498 |
| 493 | Ga0163162_10073471 | 3300013306 | Bacteria | 3475 |
| 494 | Ga0163162_10077666 | 3300013306 | Bacteria | 3384 |
| 495 | Ga0163162_10840573 | 3300013306 | Bacteria | 1034 |
| 496 | Ga0157372_10084867 | 3300013307 | Bacteria | 3591 |
| 497 | Ga0157372_10101471 | 3300013307 | Bacteria | 3285 |
| 498 | Ga0157372_10197671 | 3300013307 | Bacteria | 2329 |
| 499 | Ga0157372_10455049 | 3300013307 | Bacteria | 1492 |
| 500 | Ga0157372_10800718 | 3300013307 | Bacteria | 1095 |
| 501 | Ga0157372_10828932 | 3300013307 | Bacteria | 1074 |
| 502 | Ga0157375_10010672 | 3300013308 | Bacteria | 8089 |
| 503 | Ga0157375_10014363 | 3300013308 | Bacteria | 7061 |
| 504 | Ga0157375_10117846 | 3300013308 | Bacteria | 2761 |
| 505 | Ga0157375_10218727 | 3300013308 | Bacteria | 2063 |
| 506 | Ga0157375_10228711 | 3300013308 | Bacteria | 2019 |
| 507 | Ga0157375_10470359 | 3300013308 | Bacteria | 1422 |
| 508 | Ga0157375_11057754 | 3300013308 | Bacteria | 949 |
| 509 | Ga0157375_11152615 | 3300013308 | Bacteria | 908 |
| 510 | Ga0163163_10004439 | 3300014325 | Bacteria | 11966 |
| 511 | Ga0163163_10011676 | 3300014325 | Bacteria | 7977 |
| 512 | Ga0163163_10150958 | 3300014325 | Bacteria | 2367 |
| 513 | Ga0163163_10421409 | 3300014325 | Bacteria | 1394 |
| 514 | Ga0163163_10473536 | 3300014325 | Bacteria | 1313 |
| 515 | Ga0163163_10631814 | 3300014325 | Bacteria | 1134 |
| 516 | Ga0163163_10771357 | 3300014325 | Bacteria | 1025 |
| 517 | Ga0163163_12131122 | 3300014325 | Bacteria | 620 |
| 518 | Ga0157380_10004096 | 3300014326 | Bacteria | 10075 |
| 519 | Ga0157380_10006341 | 3300014326 | Bacteria | 8317 |
| 520 | Ga0157380_10028709 | 3300014326 | Bacteria | 4245 |
| 521 | Ga0157380_10038698 | 3300014326 | Bacteria | 3705 |
| 522 | Ga0157380_10050117 | 3300014326 | Bacteria | 3296 |
| 523 | Ga0157380_10515769 | 3300014326 | Bacteria | 1165 |
| 524 | Ga0157380_10636489 | 3300014326 | Bacteria | 1061 |
| 525 | Ga0157380_10729029 | 3300014326 | Bacteria | 1000 |
| 526 | Ga0157380_10991984 | 3300014326 | Bacteria | 873 |
| 527 | Ga0157380_11022243 | 3300014326 | Bacteria | 861 |
| 528 | Ga0157380_11643943 | 3300014326 | Bacteria | 699 |
| 529 | Ga0157380_11752540 | 3300014326 | Bacteria | 679 |
| 530 | Ga0182008_10124920 | 3300014497 | Bacteria | 1280 |
| 531 | Ga0157377_10012496 | 3300014745 | Bacteria | 4272 |
| 532 | Ga0157377_10094493 | 3300014745 | Bacteria | 1771 |
| 533 | Ga0157377_10131096 | 3300014745 | Bacteria | 1531 |
| 534 | Ga0157379_10076147 | 3300014968 | Bacteria | 3004 |
| 535 | Ga0157379_10110837 | 3300014968 | Bacteria | 2464 |
| 536 | Ga0157379_10172442 | 3300014968 | Bacteria | 1953 |
| 537 | Ga0157379_10184982 | 3300014968 | Bacteria | 1882 |
| 538 | Ga0157379_10207484 | 3300014968 | Bacteria | 1773 |
| 539 | Ga0157379_10255555 | 3300014968 | Bacteria | 1591 |
| 540 | Ga0157379_10262245 | 3300014968 | Bacteria | 1570 |
| 541 | Ga0157376_10063557 | 3300014969 | Bacteria | 3110 |
| 542 | Ga0157376_10120904 | 3300014969 | Bacteria | 2321 |
| 543 | Ga0157376_10200370 | 3300014969 | Bacteria | 1836 |
| 544 | Ga0157376_10324251 | 3300014969 | Bacteria | 1465 |
| 545 | Ga0157376_10373326 | 3300014969 | Bacteria | 1372 |
| 546 | Ga0157376_10868025 | 3300014969 | Bacteria | 919 |
| 547 | Ga0163161_10038470 | 3300017792 | Bacteria | 3431 |
| 548 | Ga0163161_10086608 | 3300017792 | Bacteria | 2312 |
| 549 | Ga0163161_10677238 | 3300017792 | Bacteria | 857 |
| 550 | Ga0206356_11050776 | 3300020070 | Bacteria | 781 |
| 551 | Ga0206349_1898117 | 3300020075 | Bacteria | 827 |
| 552 | Ga0206355_1087629 | 3300020076 | Bacteria | 912 |
| 553 | Ga0206355_1138380 | 3300020076 | Bacteria | 892 |
| 554 | Ga0206355_1256135 | 3300020076 | Bacteria | 1095 |
| 555 | Ga0206355_1310435 | 3300020076 | Bacteria | 1098 |
| 556 | Ga0206355_1571275 | 3300020076 | Bacteria | 1109 |
| 557 | Ga0206355_1687272 | 3300020076 | Bacteria | 1095 |
| 558 | Ga0206351_10084949 | 3300020077 | Bacteria | 785 |
| 559 | Ga0206350_10652330 | 3300020080 | Bacteria | 711 |
| 560 | Ga0206354_11591843 | 3300020081 | Bacteria | 758 |
| 561 | Ga0213873_10009552 | 3300021358 | Bacteria | 2019 |
| 562 | Ga0213872_10217700 | 3300021361 | Bacteria | 814 |
| 563 | Ga0213874_10017174 | 3300021377 | Bacteria | 1937 |
| 564 | Ga0213874_10073231 | 3300021377 | Bacteria | 1097 |
| 565 | Ga0213876_10057608 | 3300021384 | Bacteria | 2052 |
| 566 | Ga0213871_10060277 | 3300021441 | Bacteria | 1056 |
| 567 | Ga0213871_10083117 | 3300021441 | Bacteria | 920 |
| 568 | Ga0224712_10027153 | 3300022467 | Bacteria | 2033 |
| 569 | Ga0224712_10160940 | 3300022467 | Bacteria | 1001 |
| 570 | Ga0224712_10203175 | 3300022467 | Bacteria | 901 |
| 571 | Ga0224712_10374318 | 3300022467 | Bacteria | 676 |
| 572 | Ga0224712_10478910 | 3300022467 | Bacteria | 600 |
| 573 | Ga0256714_109273 | 3300023304 | Bacteria | 743 |
| 574 | Ga0256714_117914 | 3300023304 | Bacteria | 1063 |
| 575 | Ga0256714_130426 | 3300023304 | Bacteria | 1119 |
| 576 | Ga0256744_100180 | 3300023309 | Bacteria | 845 |
| 577 | Ga0256744_124239 | 3300023309 | Bacteria | 1004 |
| 578 | Ga0256743_120810 | 3300023436 | Bacteria | 719 |
| 579 | Ga0256720_106382 | 3300023438 | Bacteria | 769 |
| 580 | Ga0256720_120993 | 3300023438 | Bacteria | 938 |
| 581 | Ga0207682_10025845 | 3300025893 | Bacteria | 2330 |
| 582 | Ga0207692_10014797 | 3300025898 | Bacteria | 3416 |
| 583 | Ga0207692_10231777 | 3300025898 | Bacteria | 1099 |
| 584 | Ga0207642_10018122 | 3300025899 | Bacteria | 2695 |
| 585 | Ga0207642_10091343 | 3300025899 | Bacteria | 1504 |
| 586 | Ga0207642_10561600 | 3300025899 | Bacteria | 706 |
| 587 | Ga0207710_10016751 | 3300025900 | Bacteria | 3103 |
| 588 | Ga0207710_10017004 | 3300025900 | Bacteria | 3082 |
| 589 | Ga0207710_10072271 | 3300025900 | Bacteria | 1584 |
| 590 | Ga0207688_10033787 | 3300025901 | Bacteria | 2830 |
| 591 | Ga0207688_10567662 | 3300025901 | Bacteria | 714 |
| 592 | Ga0207680_10005980 | 3300025903 | Bacteria | 5846 |
| 593 | Ga0207680_10108040 | 3300025903 | Bacteria | 1799 |
| 594 | Ga0207680_10205517 | 3300025903 | Bacteria | 1344 |
| 595 | Ga0207647_10146697 | 3300025904 | Bacteria | 1380 |
| 596 | Ga0207699_10008193 | 3300025906 | Bacteria | 5145 |
| 597 | Ga0207699_10035696 | 3300025906 | Bacteria | 2830 |
| 598 | Ga0207645_10003653 | 3300025907 | Bacteria | 11609 |
| 599 | Ga0207645_10024776 | 3300025907 | Bacteria | 3887 |
| 600 | Ga0207645_10155569 | 3300025907 | Bacteria | 1494 |
| 601 | Ga0207643_10007300 | 3300025908 | Bacteria | 5929 |
| 602 | Ga0207643_10008594 | 3300025908 | Bacteria | 5475 |
| 603 | Ga0207643_10050955 | 3300025908 | Bacteria | 2349 |
| 604 | Ga0207643_10118712 | 3300025908 | Bacteria | 1564 |
| 605 | Ga0207654_10224380 | 3300025911 | Bacteria | 1248 |
| 606 | Ga0207654_10376454 | 3300025911 | Bacteria | 983 |
| 607 | Ga0207654_10694667 | 3300025911 | Bacteria | 731 |
| 608 | Ga0207707_10001046 | 3300025912 | Bacteria | 26538 |
| 609 | Ga0207707_10001063 | 3300025912 | Bacteria | 26333 |
| 610 | Ga0207707_10029907 | 3300025912 | Bacteria | 4763 |
| 611 | Ga0207707_10038018 | 3300025912 | Bacteria | 4205 |
| 612 | Ga0207707_10045189 | 3300025912 | Bacteria | 3838 |
| 613 | Ga0207707_10065562 | 3300025912 | Bacteria | 3163 |
| 614 | Ga0207707_10250455 | 3300025912 | Bacteria | 1539 |
| 615 | Ga0207707_10308629 | 3300025912 | Bacteria | 1367 |
| 616 | Ga0207695_10012669 | 3300025913 | Bacteria | 10102 |
| 617 | Ga0207695_10013605 | 3300025913 | Bacteria | 9691 |
| 618 | Ga0207695_10014888 | 3300025913 | Bacteria | 9179 |
| 619 | Ga0207695_10022293 | 3300025913 | Bacteria | 7197 |
| 620 | Ga0207695_10079417 | 3300025913 | Bacteria | 3326 |
| 621 | Ga0207695_10094303 | 3300025913 | Bacteria | 3000 |
| 622 | Ga0207695_10098536 | 3300025913 | Bacteria | 2922 |
| 623 | Ga0207695_10149224 | 3300025913 | Bacteria | 2278 |
| 624 | Ga0207695_10151194 | 3300025913 | Bacteria | 2260 |
| 625 | Ga0207695_10154088 | 3300025913 | Bacteria | 2234 |
| 626 | Ga0207695_10183131 | 3300025913 | Bacteria | 2015 |
| 627 | Ga0207695_10948710 | 3300025913 | Bacteria | 740 |
| 628 | Ga0207671_10062052 | 3300025914 | Bacteria | 2775 |
| 629 | Ga0207671_10238569 | 3300025914 | Bacteria | 1428 |
| 630 | Ga0207671_10336716 | 3300025914 | Bacteria | 1195 |
| 631 | Ga0207693_10000343 | 3300025915 | Bacteria | 42997 |
| 632 | Ga0207693_10038208 | 3300025915 | Bacteria | 3781 |
| 633 | Ga0207693_10143200 | 3300025915 | Bacteria | 1879 |
| 634 | Ga0207693_11131736 | 3300025915 | Bacteria | 593 |
| 635 | Ga0207663_10024971 | 3300025916 | Bacteria | 3448 |
| 636 | Ga0207663_10335859 | 3300025916 | Bacteria | 1140 |
| 637 | Ga0207663_10638706 | 3300025916 | Bacteria | 839 |
| 638 | Ga0207660_10003539 | 3300025917 | Bacteria | 10178 |
| 639 | Ga0207660_10007909 | 3300025917 | Bacteria | 6879 |
| 640 | Ga0207660_10045796 | 3300025917 | Bacteria | 3083 |
| 641 | Ga0207660_10120743 | 3300025917 | Bacteria | 1985 |
| 642 | Ga0207660_10128931 | 3300025917 | Bacteria | 1924 |
| 643 | Ga0207660_10407250 | 3300025917 | Bacteria | 1096 |
| 644 | Ga0207660_10614739 | 3300025917 | Bacteria | 885 |
| 645 | Ga0207660_10651873 | 3300025917 | Bacteria | 858 |
| 646 | Ga0207662_10086288 | 3300025918 | Bacteria | 1923 |
| 647 | Ga0207662_10111372 | 3300025918 | Bacteria | 1707 |
| 648 | Ga0207662_10217599 | 3300025918 | Bacteria | 1242 |
| 649 | Ga0207662_10280596 | 3300025918 | Bacteria | 1102 |
| 650 | Ga0207657_10133022 | 3300025919 | Bacteria | 2037 |
| 651 | Ga0207649_10033170 | 3300025920 | Bacteria | 3083 |
| 652 | Ga0207649_10186726 | 3300025920 | Bacteria | 1455 |
| 653 | Ga0207652_10006570 | 3300025921 | Bacteria | 9373 |
| 654 | Ga0207652_10018358 | 3300025921 | Bacteria | 5736 |
| 655 | Ga0207652_10101803 | 3300025921 | Bacteria | 2538 |
| 656 | Ga0207652_10137088 | 3300025921 | Bacteria | 2186 |
| 657 | Ga0207652_10410592 | 3300025921 | Bacteria | 1221 |
| 658 | Ga0207652_10659257 | 3300025921 | Bacteria | 935 |
| 659 | Ga0207652_11210495 | 3300025921 | Bacteria | 657 |
| 660 | Ga0207652_11305661 | 3300025921 | Bacteria | 628 |
| 661 | Ga0207681_10050431 | 3300025923 | Bacteria | 2816 |
| 662 | Ga0207681_10061283 | 3300025923 | Bacteria | 2585 |
| 663 | Ga0207681_10453518 | 3300025923 | Bacteria | 1044 |
| 664 | Ga0207694_10117316 | 3300025924 | Bacteria | 2122 |
| 665 | Ga0207694_10163111 | 3300025924 | Bacteria | 1801 |
| 666 | Ga0207694_10233765 | 3300025924 | Bacteria | 1501 |
| 667 | Ga0207694_10303183 | 3300025924 | Bacteria | 1316 |
| 668 | Ga0207694_10306080 | 3300025924 | Bacteria | 1309 |
| 669 | Ga0207694_10311731 | 3300025924 | Bacteria | 1297 |
| 670 | Ga0207694_10371666 | 3300025924 | Bacteria | 1186 |
| 671 | Ga0207694_10445441 | 3300025924 | Bacteria | 1081 |
| 672 | Ga0207650_10041517 | 3300025925 | Bacteria | 3371 |
| 673 | Ga0207650_10371870 | 3300025925 | Bacteria | 1179 |
| 674 | Ga0207650_10522953 | 3300025925 | Bacteria | 993 |
| 675 | Ga0207650_11052694 | 3300025925 | Bacteria | 692 |
| 676 | Ga0207659_10044341 | 3300025926 | Bacteria | 3128 |
| 677 | Ga0207659_10126075 | 3300025926 | Bacteria | 1969 |
| 678 | Ga0207659_10158256 | 3300025926 | Bacteria | 1775 |
| 679 | Ga0207659_10167622 | 3300025926 | Bacteria | 1730 |
| 680 | Ga0207659_10978200 | 3300025926 | Bacteria | 728 |
| 681 | Ga0207687_10058430 | 3300025927 | Bacteria | 2713 |
| 682 | Ga0207687_10707264 | 3300025927 | Bacteria | 855 |
| 683 | Ga0207700_10000245 | 3300025928 | Bacteria | 32472 |
| 684 | Ga0207700_10045557 | 3300025928 | Bacteria | 3237 |
| 685 | Ga0207700_10072360 | 3300025928 | Bacteria | 2658 |
| 686 | Ga0207700_10282312 | 3300025928 | Bacteria | 1428 |
| 687 | Ga0207664_10030820 | 3300025929 | Bacteria | 4099 |
| 688 | Ga0207644_10001535 | 3300025931 | Bacteria | 14873 |
| 689 | Ga0207644_10007221 | 3300025931 | Bacteria | 7229 |
| 690 | Ga0207644_10028354 | 3300025931 | Bacteria | 3875 |
| 691 | Ga0207644_10057643 | 3300025931 | Bacteria | 2805 |
| 692 | Ga0207690_10058335 | 3300025932 | Bacteria | 2611 |
| 693 | Ga0207690_10444345 | 3300025932 | Bacteria | 1041 |
| 694 | Ga0207690_11191681 | 3300025932 | Bacteria | 636 |
| 695 | Ga0207706_10002507 | 3300025933 | Bacteria | 17895 |
| 696 | Ga0207706_10006432 | 3300025933 | Bacteria | 10911 |
| 697 | Ga0207706_10054130 | 3300025933 | Bacteria | 3542 |
| 698 | Ga0207706_10691937 | 3300025933 | Bacteria | 871 |
| 699 | Ga0207686_10013112 | 3300025934 | Bacteria | 4578 |
| 700 | Ga0207709_10230668 | 3300025935 | Bacteria | 1341 |
| 701 | Ga0207670_10034476 | 3300025936 | Bacteria | 3271 |
| 702 | Ga0207670_10637647 | 3300025936 | Bacteria | 877 |
| 703 | Ga0207670_10912288 | 3300025936 | Bacteria | 736 |
| 704 | Ga0207669_10020704 | 3300025937 | Bacteria | 3455 |
| 705 | Ga0207669_10057973 | 3300025937 | Bacteria | 2361 |
| 706 | Ga0207669_10137697 | 3300025937 | Bacteria | 1689 |
| 707 | Ga0207669_10764683 | 3300025937 | Bacteria | 799 |
| 708 | Ga0207704_10034972 | 3300025938 | Bacteria | 2873 |
| 709 | Ga0207704_10237326 | 3300025938 | Bacteria | 1360 |
| 710 | Ga0207704_10322539 | 3300025938 | Bacteria | 1192 |
| 711 | Ga0207665_10011562 | 3300025939 | Bacteria | 5798 |
| 712 | Ga0207665_10081413 | 3300025939 | Bacteria | 2229 |
| 713 | Ga0207665_10138324 | 3300025939 | Bacteria | 1734 |
| 714 | Ga0207691_10002085 | 3300025940 | Bacteria | 19519 |
| 715 | Ga0207691_10011812 | 3300025940 | Bacteria | 8381 |
| 716 | Ga0207691_10012001 | 3300025940 | Bacteria | 8309 |
| 717 | Ga0207691_10067981 | 3300025940 | Bacteria | 3220 |
| 718 | Ga0207691_10399138 | 3300025940 | Bacteria | 1173 |
| 719 | Ga0207691_10399185 | 3300025940 | Bacteria | 1173 |
| 720 | Ga0207711_10031266 | 3300025941 | Bacteria | 4494 |
| 721 | Ga0207711_10183942 | 3300025941 | Bacteria | 1901 |
| 722 | Ga0207711_10281105 | 3300025941 | Bacteria | 1533 |
| 723 | Ga0207711_10334932 | 3300025941 | Bacteria | 1400 |
| 724 | Ga0207711_10738353 | 3300025941 | Bacteria | 918 |
| 725 | Ga0207711_11008204 | 3300025941 | Bacteria | 772 |
| 726 | Ga0207711_11026120 | 3300025941 | Bacteria | 765 |
| 727 | Ga0207689_10001269 | 3300025942 | Bacteria | 24346 |
| 728 | Ga0207689_10013247 | 3300025942 | Bacteria | 7034 |
| 729 | Ga0207689_10014425 | 3300025942 | Bacteria | 6721 |
| 730 | Ga0207661_10039152 | 3300025944 | Bacteria | 3720 |
| 731 | Ga0207661_10065862 | 3300025944 | Bacteria | 2942 |
| 732 | Ga0207661_10195353 | 3300025944 | Bacteria | 1776 |
| 733 | Ga0207661_10229210 | 3300025944 | Bacteria | 1644 |
| 734 | Ga0207661_10277135 | 3300025944 | Bacteria | 1498 |
| 735 | Ga0207679_10105262 | 3300025945 | Bacteria | 2215 |
| 736 | Ga0207679_10124800 | 3300025945 | Bacteria | 2056 |
| 737 | Ga0207679_10379264 | 3300025945 | Bacteria | 1239 |
| 738 | Ga0207679_10537271 | 3300025945 | Bacteria | 1047 |
| 739 | Ga0207679_10833385 | 3300025945 | Bacteria | 842 |
| 740 | Ga0207667_10001150 | 3300025949 | Bacteria | 33284 |
| 741 | Ga0207667_10003474 | 3300025949 | Bacteria | 19448 |
| 742 | Ga0207667_10012196 | 3300025949 | Bacteria | 9927 |
| 743 | Ga0207667_10205164 | 3300025949 | Bacteria | 2021 |
| 744 | Ga0207667_10244892 | 3300025949 | Bacteria | 1834 |
| 745 | Ga0207667_10363517 | 3300025949 | Bacteria | 1476 |
| 746 | Ga0207667_10873656 | 3300025949 | Bacteria | 892 |
| 747 | Ga0207667_11455956 | 3300025949 | Bacteria | 657 |
| 748 | Ga0207651_10008465 | 3300025960 | Bacteria | 5559 |
| 749 | Ga0207651_10023567 | 3300025960 | Bacteria | 3790 |
| 750 | Ga0207651_10046838 | 3300025960 | Bacteria | 2911 |
| 751 | Ga0207651_10344412 | 3300025960 | Bacteria | 1253 |
| 752 | Ga0207651_10494815 | 3300025960 | Bacteria | 1056 |
| 753 | Ga0207712_10034875 | 3300025961 | Bacteria | 3413 |
| 754 | Ga0207712_10039461 | 3300025961 | Bacteria | 3235 |
| 755 | Ga0207712_10172351 | 3300025961 | Bacteria | 1692 |
| 756 | Ga0207712_10277738 | 3300025961 | Bacteria | 1366 |
| 757 | Ga0207712_10339311 | 3300025961 | Bacteria | 1245 |
| 758 | Ga0207712_10823836 | 3300025961 | Bacteria | 817 |
| 759 | Ga0207712_11249686 | 3300025961 | Bacteria | 663 |
| 760 | Ga0207668_10005626 | 3300025972 | Bacteria | 7386 |
| 761 | Ga0207640_10146673 | 3300025981 | Bacteria | 1728 |
| 762 | Ga0207640_10731600 | 3300025981 | Bacteria | 851 |
| 763 | Ga0207658_10000046 | 3300025986 | Bacteria | 130772 |
| 764 | Ga0207658_10212687 | 3300025986 | Bacteria | 1621 |
| 765 | Ga0207658_10453940 | 3300025986 | Bacteria | 1135 |
| 766 | Ga0207658_10520633 | 3300025986 | Bacteria | 1061 |
| 767 | Ga0207677_10158353 | 3300026023 | Bacteria | 1756 |
| 768 | Ga0207677_10161352 | 3300026023 | Bacteria | 1742 |
| 769 | Ga0207677_10733929 | 3300026023 | Bacteria | 879 |
| 770 | Ga0207703_10001297 | 3300026035 | Bacteria | 23122 |
| 771 | Ga0207703_10005685 | 3300026035 | Bacteria | 10006 |
| 772 | Ga0207703_10217676 | 3300026035 | Bacteria | 1706 |
| 773 | Ga0207703_10659709 | 3300026035 | Bacteria | 993 |
| 774 | Ga0207639_10684101 | 3300026041 | Bacteria | 951 |
| 775 | Ga0207639_10688642 | 3300026041 | Bacteria | 948 |
| 776 | Ga0207639_10778989 | 3300026041 | Bacteria | 890 |
| 777 | Ga0207678_10033130 | 3300026067 | Bacteria | 4502 |
| 778 | Ga0207678_10088861 | 3300026067 | Bacteria | 2641 |
| 779 | Ga0207678_10095922 | 3300026067 | Bacteria | 2534 |
| 780 | Ga0207678_10199441 | 3300026067 | Bacteria | 1711 |
| 781 | Ga0207708_10011839 | 3300026075 | Bacteria | 6495 |
| 782 | Ga0207708_10027141 | 3300026075 | Bacteria | 4336 |
| 783 | Ga0207708_10032970 | 3300026075 | Bacteria | 3933 |
| 784 | Ga0207708_10065887 | 3300026075 | Bacteria | 2769 |
| 785 | Ga0207708_10114863 | 3300026075 | Bacteria | 2093 |
| 786 | Ga0207702_10042270 | 3300026078 | Bacteria | 3823 |
| 787 | Ga0207702_10198278 | 3300026078 | Bacteria | 1859 |
| 788 | Ga0207702_10221018 | 3300026078 | Bacteria | 1765 |
| 789 | Ga0207702_10321912 | 3300026078 | Bacteria | 1473 |
| 790 | Ga0207702_11110888 | 3300026078 | Bacteria | 785 |
| 791 | Ga0207641_10001107 | 3300026088 | Bacteria | 27070 |
| 792 | Ga0207641_10009498 | 3300026088 | Bacteria | 8017 |
| 793 | Ga0207641_10030599 | 3300026088 | Bacteria | 4460 |
| 794 | Ga0207641_10063843 | 3300026088 | Bacteria | 3146 |
| 795 | Ga0207641_10166310 | 3300026088 | Bacteria | 2009 |
| 796 | Ga0207641_10179304 | 3300026088 | Bacteria | 1939 |
| 797 | Ga0207648_10006603 | 3300026089 | Bacteria | 11518 |
| 798 | Ga0207648_10015775 | 3300026089 | Bacteria | 6929 |
| 799 | Ga0207648_10034879 | 3300026089 | Bacteria | 4435 |
| 800 | Ga0207648_10074835 | 3300026089 | Bacteria | 2952 |
| 801 | Ga0207648_10118417 | 3300026089 | Bacteria | 2328 |
| 802 | Ga0207648_10427841 | 3300026089 | Bacteria | 1203 |
| 803 | Ga0207676_10005142 | 3300026095 | Bacteria | 9260 |
| 804 | Ga0207676_10135564 | 3300026095 | Bacteria | 2100 |
| 805 | Ga0207676_10387442 | 3300026095 | Bacteria | 1303 |
| 806 | Ga0207676_10399366 | 3300026095 | Bacteria | 1284 |
| 807 | Ga0207676_10570977 | 3300026095 | Bacteria | 1083 |
| 808 | Ga0207674_10021269 | 3300026116 | Bacteria | 6992 |
| 809 | Ga0207674_10175259 | 3300026116 | Bacteria | 2097 |
| 810 | Ga0207674_10511360 | 3300026116 | Bacteria | 1160 |
| 811 | Ga0207674_11018346 | 3300026116 | Bacteria | 797 |
| 812 | Ga0207675_100002246 | 3300026118 | Bacteria | 19216 |
| 813 | Ga0207675_100019823 | 3300026118 | Bacteria | 6276 |
| 814 | Ga0207675_100022386 | 3300026118 | Bacteria | 5886 |
| 815 | Ga0207675_100032167 | 3300026118 | Bacteria | 4887 |
| 816 | Ga0207675_100088034 | 3300026118 | Bacteria | 2917 |
| 817 | Ga0207675_100099065 | 3300026118 | Bacteria | 2745 |
| 818 | Ga0207675_100607503 | 3300026118 | Bacteria | 1097 |
| 819 | Ga0207675_100840914 | 3300026118 | Bacteria | 932 |
| 820 | Ga0207675_100973492 | 3300026118 | Bacteria | 866 |
| 821 | Ga0207683_10001586 | 3300026121 | Bacteria | 20511 |
| 822 | Ga0207683_10012593 | 3300026121 | Bacteria | 7214 |
| 823 | Ga0207683_10131880 | 3300026121 | Bacteria | 2248 |
| 824 | Ga0207683_10181853 | 3300026121 | Bacteria | 1906 |
| 825 | Ga0207683_10279247 | 3300026121 | Bacteria | 1526 |
| 826 | Ga0207683_10844886 | 3300026121 | Bacteria | 850 |
| 827 | Ga0207698_10188454 | 3300026142 | Bacteria | 1834 |
| 828 | Ga0209973_1006807 | 3300027252 | Bacteria | 1259 |
| 829 | Ga0209981_1012113 | 3300027378 | Bacteria | 1192 |
| 830 | Ga0209996_1016230 | 3300027395 | Bacteria | 1021 |
| 831 | Ga0210000_1014497 | 3300027462 | Bacteria | 1181 |
| 832 | Ga0209995_1021879 | 3300027471 | Bacteria | 1060 |
| 833 | Ga0209982_1000647 | 3300027552 | Bacteria | 4398 |
| 834 | Ga0209970_1001806 | 3300027614 | Bacteria | 3704 |
| 835 | Ga0209970_1022312 | 3300027614 | Bacteria | 1074 |
| 836 | Ga0210002_1003967 | 3300027617 | Bacteria | 2197 |
| 837 | Ga0210002_1012379 | 3300027617 | Bacteria | 1325 |
| 838 | Ga0209983_1000958 | 3300027665 | Bacteria | 6363 |
| 839 | Ga0209971_1002508 | 3300027682 | Bacteria | 4407 |
| 840 | Ga0209971_1006403 | 3300027682 | Bacteria | 2784 |
| 841 | Ga0209998_10001105 | 3300027717 | Bacteria | 6738 |
| 842 | Ga0209974_10007834 | 3300027876 | Bacteria | 3668 |
| 843 | Ga0209974_10053724 | 3300027876 | Bacteria | 1357 |
| 844 | Ga0207428_10013272 | 3300027907 | Bacteria | 7203 |
| 845 | Ga0207428_10013404 | 3300027907 | Bacteria | 7162 |
| 846 | Ga0207428_10125257 | 3300027907 | Bacteria | 1968 |
| 847 | Ga0268266_10000546 | 3300028379 | Bacteria | 52540 |
| 848 | Ga0268266_10000702 | 3300028379 | Bacteria | 45182 |
| 849 | Ga0268266_10008608 | 3300028379 | Bacteria | 9061 |
| 850 | Ga0268266_10018660 | 3300028379 | Bacteria | 5910 |
| 851 | Ga0268266_10138460 | 3300028379 | Bacteria | 2182 |
| 852 | Ga0268266_10254761 | 3300028379 | Bacteria | 1624 |
| 853 | Ga0268266_10384367 | 3300028379 | Bacteria | 1324 |
| 854 | Ga0268266_10439947 | 3300028379 | Bacteria | 1238 |
| 855 | Ga0268266_10773979 | 3300028379 | Bacteria | 927 |
| 856 | Ga0268265_10001988 | 3300028380 | Bacteria | 16181 |
| 857 | Ga0268265_10008712 | 3300028380 | Bacteria | 6860 |
| 858 | Ga0268265_10041644 | 3300028380 | Bacteria | 3402 |
| 859 | Ga0268265_10080847 | 3300028380 | Bacteria | 2564 |
| 860 | Ga0268265_10103451 | 3300028380 | Bacteria | 2306 |
| 861 | Ga0268265_10274988 | 3300028380 | Bacteria | 1504 |
| 862 | Ga0268265_10473251 | 3300028380 | Bacteria | 1175 |
| 863 | Ga0268265_10574507 | 3300028380 | Bacteria | 1073 |
| 864 | Ga0268265_10815739 | 3300028380 | Bacteria | 910 |
| 865 | Ga0268265_11430080 | 3300028380 | Bacteria | 694 |
| 866 | Ga0268265_11490719 | 3300028380 | Bacteria | 680 |
| 867 | Ga0268265_11686333 | 3300028380 | Bacteria | 639 |
| 868 | Ga0268264_10000085 | 3300028381 | Bacteria | 240739 |
| 869 | Ga0268264_10050877 | 3300028381 | Bacteria | 3451 |
| 870 | Ga0268264_10054438 | 3300028381 | Bacteria | 3341 |
| 871 | Ga0268264_10299807 | 3300028381 | Bacteria | 1512 |
| 872 | Ga0268264_10301998 | 3300028381 | Bacteria | 1507 |
| 873 | Ga0268264_10354146 | 3300028381 | Bacteria | 1398 |
| 874 | Ga0268264_11435067 | 3300028381 | Bacteria | 701 |
| 875 | Ga0265334_10047476 | 3300028573 | Bacteria | 1656 |
| 876 | Ga0265318_10077258 | 3300028577 | Bacteria | 1231 |
| 877 | Ga0265323_10000510 | 3300028653 | Bacteria | 21714 |
| 878 | Ga0307517_10264337 | 3300028786 | Bacteria | 996 |
| 879 | Ga0307515_10345458 | 3300028794 | Bacteria | 1138 |
| 880 | Ga0265338_10002924 | 3300028800 | Bacteria | 24790 |
| 881 | Ga0265338_10021907 | 3300028800 | Bacteria | 6640 |
| 882 | Ga0265338_10039065 | 3300028800 | Bacteria | 4485 |
| 883 | Ga0265338_10784389 | 3300028800 | Bacteria | 654 |
| 884 | Ga0311000_120665 | 3300029272 | Bacteria | 932 |
| 885 | Ga0311004_108406 | 3300029276 | Bacteria | 880 |
| 886 | Ga0311004_142814 | 3300029276 | Bacteria | 935 |
| 887 | Ga0311001_1017080 | 3300029277 | Bacteria | 971 |
| 888 | Ga0311001_1026809 | 3300029277 | Bacteria | 772 |
| 889 | Ga0311001_1027304 | 3300029277 | Bacteria | 639 |
| 890 | Ga0311001_1051811 | 3300029277 | Bacteria | 1383 |
| 891 | Ga0311001_1102328 | 3300029277 | Bacteria | 695 |
| 892 | Ga0311011_111105 | 3300029280 | Bacteria | 643 |
| 893 | Ga0311011_113820 | 3300029280 | Bacteria | 852 |
| 894 | Ga0311011_129310 | 3300029280 | Bacteria | 942 |
| 895 | Ga0311011_141075 | 3300029280 | Bacteria | 1191 |
| 896 | Ga0310982_100635 | 3300029283 | Bacteria | 765 |
| 897 | Ga0310981_1017140 | 3300029285 | Bacteria | 864 |
| 898 | Ga0310981_1047544 | 3300029285 | Bacteria | 881 |
| 899 | Ga0310981_1079241 | 3300029285 | Bacteria | 1494 |
| 900 | Ga0307511_10001897 | 3300030521 | Bacteria | 21953 |
| 901 | Ga0307511_10028879 | 3300030521 | Bacteria | 5022 |
| 902 | Ga0265767_107209 | 3300030836 | Bacteria | 704 |
| 903 | Ga0265765_1033012 | 3300030879 | Bacteria | 667 |
| 904 | Ga0265330_10092997 | 3300031235 | Bacteria | 1293 |
| 905 | Ga0265332_10178208 | 3300031238 | Bacteria | 886 |
| 906 | Ga0265325_10222495 | 3300031241 | Bacteria | 863 |
| 907 | Ga0265329_10070872 | 3300031242 | Bacteria | 1103 |
| 908 | Ga0265340_10015902 | 3300031247 | Bacteria | 3903 |
| 909 | Ga0265340_10078805 | 3300031247 | Bacteria | 1553 |
| 910 | Ga0265340_10129929 | 3300031247 | Bacteria | 1156 |
| 911 | Ga0265339_10018466 | 3300031249 | Bacteria | 4109 |
| 912 | Ga0265331_10021357 | 3300031250 | Bacteria | 3313 |
| 913 | Ga0265316_10001714 | 3300031344 | Bacteria | 23275 |
| 914 | Ga0265316_10003861 | 3300031344 | Bacteria | 15027 |
| 915 | Ga0265316_10022943 | 3300031344 | Bacteria | 5250 |
| 916 | Ga0265316_10027184 | 3300031344 | Bacteria | 4743 |
| 917 | Ga0265316_10028987 | 3300031344 | Bacteria | 4558 |
| 918 | Ga0265316_10067284 | 3300031344 | Bacteria | 2770 |
| 919 | Ga0265316_10125236 | 3300031344 | Bacteria | 1938 |
| 920 | Ga0265316_10262611 | 3300031344 | Bacteria | 1266 |
| 921 | Ga0265316_10488995 | 3300031344 | Bacteria | 880 |
| 922 | Ga0307513_10007959 | 3300031456 | Bacteria | 13638 |
| 923 | Ga0307513_10014058 | 3300031456 | Bacteria | 9801 |
| 924 | Ga0307513_10062517 | 3300031456 | Bacteria | 3934 |
| 925 | Ga0307513_10067032 | 3300031456 | Bacteria | 3769 |
| 926 | Ga0307509_10000008 | 3300031507 | Bacteria | 354271 |
| 927 | Ga0307509_10000543 | 3300031507 | Bacteria | 64572 |
| 928 | Ga0307509_10056828 | 3300031507 | Bacteria | 4152 |
| 929 | Ga0307509_10247988 | 3300031507 | Bacteria | 1567 |
| 930 | Ga0307509_10554218 | 3300031507 | Bacteria | 827 |
| 931 | Ga0307408_100015686 | 3300031548 | Bacteria | 5048 |
| 932 | Ga0307408_100092155 | 3300031548 | Bacteria | 2290 |
| 933 | Ga0307408_100196219 | 3300031548 | Bacteria | 1630 |
| 934 | Ga0307408_100248021 | 3300031548 | Bacteria | 1467 |
| 935 | Ga0307408_100352082 | 3300031548 | Bacteria | 1250 |
| 936 | Ga0307408_100403171 | 3300031548 | Bacteria | 1175 |
| 937 | Ga0307408_100418191 | 3300031548 | Bacteria | 1155 |
| 938 | Ga0307408_100434223 | 3300031548 | Bacteria | 1135 |
| 939 | Ga0307408_100860005 | 3300031548 | Bacteria | 827 |
| 940 | Ga0307408_101682761 | 3300031548 | Bacteria | 604 |
| 941 | Ga0265313_10181118 | 3300031595 | Bacteria | 885 |
| 942 | Ga0307514_10175360 | 3300031649 | Bacteria | 1392 |
| 943 | Ga0265314_10002511 | 3300031711 | Bacteria | 18722 |
| 944 | Ga0265314_10019885 | 3300031711 | Bacteria | 5192 |
| 945 | Ga0265314_10074062 | 3300031711 | Bacteria | 2269 |
| 946 | Ga0265342_10426291 | 3300031712 | Bacteria | 683 |
| 947 | Ga0316576_10385501 | 3300031727 | Bacteria | 1040 |
| 948 | Ga0307516_10015867 | 3300031730 | Bacteria | 7905 |
| 949 | Ga0307405_10383450 | 3300031731 | Bacteria | 1095 |
| 950 | Ga0307405_11614700 | 3300031731 | Bacteria | 572 |
| 951 | Ga0307413_10004678 | 3300031824 | Bacteria | 5999 |
| 952 | Ga0307413_10015242 | 3300031824 | Bacteria | 3933 |
| 953 | Ga0307413_10062574 | 3300031824 | Bacteria | 2303 |
| 954 | Ga0307413_10081954 | 3300031824 | Bacteria | 2070 |
| 955 | Ga0307413_10107591 | 3300031824 | Bacteria | 1859 |
| 956 | Ga0307410_10052893 | 3300031852 | Bacteria | 2745 |
| 957 | Ga0307410_10199293 | 3300031852 | Bacteria | 1527 |
| 958 | Ga0307410_10637665 | 3300031852 | Bacteria | 892 |
| 959 | Ga0307410_11055972 | 3300031852 | Bacteria | 702 |
| 960 | Ga0307410_11177151 | 3300031852 | Bacteria | 667 |
| 961 | Ga0307406_10015666 | 3300031901 | Bacteria | 4393 |
| 962 | Ga0307406_10046703 | 3300031901 | Bacteria | 2726 |
| 963 | Ga0307406_10648840 | 3300031901 | Bacteria | 876 |
| 964 | Ga0307407_10027659 | 3300031903 | Bacteria | 3021 |
| 965 | Ga0307407_10073748 | 3300031903 | Bacteria | 2040 |
| 966 | Ga0307407_10245456 | 3300031903 | Bacteria | 1224 |
| 967 | Ga0307412_10107311 | 3300031911 | Bacteria | 1987 |
| 968 | Ga0307412_10504024 | 3300031911 | Bacteria | 1008 |
| 969 | Ga0307409_100002005 | 3300031995 | Bacteria | 10449 |
| 970 | Ga0307409_100023646 | 3300031995 | Bacteria | 4265 |
| 971 | Ga0307409_100078147 | 3300031995 | Bacteria | 2661 |
| 972 | Ga0307409_100104142 | 3300031995 | Bacteria | 2362 |
| 973 | Ga0307416_100068965 | 3300032002 | Bacteria | 2924 |
| 974 | Ga0307416_100138160 | 3300032002 | Bacteria | 2209 |
| 975 | Ga0307416_100521631 | 3300032002 | Bacteria | 1256 |
| 976 | Ga0307416_100543535 | 3300032002 | Bacteria | 1234 |
| 977 | Ga0307416_101011562 | 3300032002 | Bacteria | 934 |
| 978 | Ga0307414_10172460 | 3300032004 | Bacteria | 1731 |
| 979 | Ga0307414_10246925 | 3300032004 | Bacteria | 1481 |
| 980 | Ga0307411_10003950 | 3300032005 | Bacteria | 7002 |
| 981 | Ga0307411_10009926 | 3300032005 | Bacteria | 5041 |
| 982 | Ga0307411_10133722 | 3300032005 | Bacteria | 1817 |
| 983 | Ga0307411_10169381 | 3300032005 | Bacteria | 1645 |
| 984 | Ga0307411_10280736 | 3300032005 | Bacteria | 1325 |
| 985 | Ga0307415_100410634 | 3300032126 | Bacteria | 1159 |
| 986 | Ga0307415_100585933 | 3300032126 | Bacteria | 990 |
| 987 | Ga0307415_100772332 | 3300032126 | Bacteria | 874 |
| 988 | Ga0307415_101028462 | 3300032126 | Bacteria | 767 |
| 989 | Ga0316593_10003322 | 3300032168 | Bacteria | 3973 |
| 990 | Ga0316593_10296580 | 3300032168 | Bacteria | 611 |
| 991 | Ga0307510_10000004 | 3300033180 | Bacteria | 654130 |
| 992 | Ga0307510_10032882 | 3300033180 | Bacteria | 5838 |
| 993 | Ga0316592_1006133 | 3300033524 | Bacteria | 2304 |
| 994 | Ga0316596_1014010 | 3300033541 | Bacteria | 1983 |
| 995 | Ga0373944_0095602 | 3300035089 | Bacteria | 998 |
| 996 | Ga0373944_0322012 | 3300035089 | Bacteria | 584 |
| 997 | Ga0373952_0215414 | 3300035092 | Bacteria | 568 |
| 998 | Ga0373923_0161962 | 3300035111 | Bacteria | 1021 |
| 999 | Ga0373936_0085248 | 3300035113 | Bacteria | 1319 |
| 1000 | Ga0373936_0170493 | 3300035113 | Bacteria | 951 |
| 1001 | Ga0373954_0006608 | 3300035118 | Bacteria | 5061 |
| 1002 | Ga0373956_0016639 | 3300035119 | Bacteria | 3090 |
| 1003 | Ga0373957_0182967 | 3300035120 | Bacteria | 869 |
| 1004 | Ga0373943_0126625 | 3300035170 | Bacteria | 1363 |
| 1005 | Ga0373943_0194643 | 3300035170 | Bacteria | 1120 |
| 1006 | Ga0373955_0020250 | 3300035172 | Bacteria | 3341 |
| 1007 | Ga0373955_0168064 | 3300035172 | Bacteria | 1297 |
| 1008 | Ga0373955_0317653 | 3300035172 | Bacteria | 941 |
| 1009 | Ga0373935_0214934 | 3300035692 | Bacteria | 1334 |
| 1010 | Ga0373927_0007466 | 3300035695 | Bacteria | 7394 |
| 1011 | Ga0373933_0246802 | 3300035724 | Bacteria | 1149 |
| 1012 | Ga0373947_0278398 | 3300035725 | Bacteria | 1112 |
| 1013 | Ga0373937_0008505 | 3300036401 | Bacteria | 8917 |
| 1014 | Ga0373937_0040899 | 3300036401 | Bacteria | 4227 |
| 1015 | Ga0316582_0431586 | 3300036647 | Bacteria | 908 |
| 1016 | Ga0373925_0073075 | 3300037068 | Bacteria | 2595 |
| 1017 | Ga0373925_1106045 | 3300037068 | Bacteria | 652 |
| 1018 | Ga0395899_0084351 | 3300037312 | Bacteria | 2309 |
| 1019 | Ga0395899_0180376 | 3300037312 | Bacteria | 1483 |
| 1020 | Ga0395899_0283956 | 3300037312 | Bacteria | 1125 |
| 1021 | Ga0395900_0003285 | 3300037418 | Bacteria | 17503 |
| 1022 | Ga0395900_0005953 | 3300037418 | Bacteria | 12733 |
| 1023 | Ga0395900_0091805 | 3300037418 | Bacteria | 3120 |
| 1024 | Ga0395900_0858429 | 3300037418 | Bacteria | 833 |
| 1025 | Ga0395898_0017560 | 3300037466 | Bacteria | 7303 |
| 1026 | Ga0395898_0020160 | 3300037466 | Bacteria | 6774 |
| 1027 | Ga0395898_0065073 | 3300037466 | Bacteria | 3535 |
| 1028 | Ga0395898_0421995 | 3300037466 | Bacteria | 1271 |
| 1029 | Ga0395898_0823690 | 3300037466 | Bacteria | 868 |
| 1030 | Ga0395901_0001587 | 3300038443 | Bacteria | 23512 |
| 1031 | Ga0395901_0004093 | 3300038443 | Bacteria | 14696 |
| 1032 | Ga0395901_0239630 | 3300038443 | Bacteria | 1892 |
| 1033 | Ga0395901_0679514 | 3300038443 | Bacteria | 1029 |
| 1034 | Ga0436365_1290806 | 3300039437 | Bacteria | 2210 |
| 1035 | Ga0436365_1372101 | 3300039437 | Bacteria | 636 |
| 1036 | Ga0436365_1560949 | 3300039437 | Bacteria | 2308 |
| 1037 | Ga0436360_0075183 | 3300039438 | Bacteria | 4551 |
| 1038 | Ga0436360_0107738 | 3300039438 | Bacteria | 854 |
| 1039 | Ga0436360_0389718 | 3300039438 | Bacteria | 1471 |
| 1040 | Ga0436360_0454473 | 3300039438 | Bacteria | 1109 |
| 1041 | Ga0436361_0186433 | 3300039447 | Bacteria | 6300 |
| 1042 | Ga0436361_0362369 | 3300039447 | Bacteria | 4918 |
| 1043 | Ga0436361_0440847 | 3300039447 | Bacteria | 923 |
| 1044 | Ga0436361_0740004 | 3300039447 | Bacteria | 837 |
| 1045 | Ga0436363_0255678 | 3300039450 | Bacteria | 593 |
| 1046 | Ga0436363_0277534 | 3300039450 | Bacteria | 7632 |
| 1047 | Ga0436363_0857817 | 3300039450 | Bacteria | 2371 |
| 1048 | Ga0436363_1704374 | 3300039450 | Bacteria | 1389 |
| 1049 | Ga0436362_0042252 | 3300039453 | Bacteria | 4200 |
| 1050 | Ga0436362_0149361 | 3300039453 | Bacteria | 838 |
| 1051 | Ga0439447_107427 | 3300041407 | Bacteria | 641 |
| 1052 | Ga0439453_0023200 | 3300041408 | Bacteria | 1131 |
| 1053 | Ga0439461_0078449 | 3300041410 | Bacteria | 776 |
| 1054 | Ga0439465_0119002 | 3300041413 | Bacteria | 925 |
| 1055 | Ga0451789_0864192 | 3300041443 | Bacteria | 2767 |
| 1056 | Ga0451797_1238842 | 3300041453 | Bacteria | 1477 |
| 1057 | Ga0451807_0380208 | 3300041486 | Bacteria | 4595 |
| 1058 | Ga0451807_1529842 | 3300041486 | Bacteria | 1883 |
| 1059 | Ga0451833_0736883 | 3300041491 | Bacteria | 2024 |
| 1060 | Ga0451843_1719082 | 3300041509 | Bacteria | 636 |
| 1061 | Ga0439431_0009590 | 3300041997 | Bacteria | 2187 |
| 1062 | Ga0439442_031446 | 3300042002 | Bacteria | 1109 |
| 1063 | Ga0439432_112283 | 3300042006 | Bacteria | 810 |
| 1064 | Ga0439449_0068730 | 3300042007 | Bacteria | 1306 |
| 1065 | Ga0439449_0206013 | 3300042007 | Bacteria | 736 |
| 1066 | Ga0439451_028521 | 3300042009 | Bacteria | 1125 |
| 1067 | Ga0439463_097766 | 3300042016 | Bacteria | 757 |
| 1068 | Ga0450912_012088 | 3300042116 | Bacteria | 758 |
| 1069 | Ga0450912_012522 | 3300042116 | Bacteria | 750 |
| 1070 | Ga0450920_001538 | 3300042122 | Bacteria | 3833 |
| 1071 | Ga0450922_019419 | 3300042124 | Bacteria | 695 |
| 1072 | Ga0450895_000379 | 3300042132 | Bacteria | 2462 |
| 1073 | Ga0450896_007026 | 3300042133 | Bacteria | 1549 |
| 1074 | Ga0450896_013064 | 3300042133 | Bacteria | 1179 |
| 1075 | Ga0450906_032460 | 3300042145 | Bacteria | 923 |
| 1076 | Ga0450910_011124 | 3300042147 | Bacteria | 1289 |
| 1077 | Ga0450910_044514 | 3300042147 | Bacteria | 723 |
| 1078 | Ga0450908_000146 | 3300042184 | Bacteria | 14592 |
| 1079 | Ga0439434_0000736 | 3300042435 | Bacteria | 9388 |
| 1080 | Ga0439435_0005858 | 3300042436 | Bacteria | 2728 |
| 1081 | Ga0439435_0114065 | 3300042436 | Bacteria | 841 |
| 1082 | Ga0439444_0002019 | 3300042437 | Bacteria | 2717 |
| 1083 | Ga0439444_0038206 | 3300042437 | Bacteria | 932 |
| 1084 | Ga0439460_0003891 | 3300042461 | Bacteria | 3625 |
| 1085 | Ga0450893_0048887 | 3300042532 | Bacteria | 789 |
| 1086 | Ga0451577_0721082 | 3300042876 | Bacteria | 903 |
| 1087 | Ga0466969_0009963 | 3300044656 | Bacteria | 5039 |
| 1088 | Ga0466972_0097642 | 3300044658 | Bacteria | 1391 |
| 1089 | Ga0466966_0055175 | 3300044684 | Bacteria | 2516 |
| 1090 | Ga0466961_0147137 | 3300044693 | Bacteria | 1472 |
| 1091 | Ga0466963_0138844 | 3300044694 | Bacteria | 1683 |
| 1092 | Ga0453684_0001552 | 3300044712 | Bacteria | 64199 |
| 1093 | Ga0453684_1633594 | 3300044712 | Bacteria | 660 |
| 1094 | Ga0466970_0036817 | 3300044765 | Bacteria | 2593 |
| 1095 | Ga0466957_0473453 | 3300044842 | Bacteria | 865 |
| 1096 | Ga0466957_0611298 | 3300044842 | Bacteria | 764 |
| 1097 | Ga0466957_0634167 | 3300044842 | Bacteria | 750 |
| 1098 | Ga0466960_0154987 | 3300044901 | Bacteria | 1226 |
| 1099 | Ga0466960_0204969 | 3300044901 | Bacteria | 1079 |
| 1100 | Ga0466959_0006281 | 3300045049 | Bacteria | 8211 |
| 1101 | Ga0466959_0069118 | 3300045049 | Bacteria | 2559 |
| 1102 | Ga0451576_0000042 | 3300045051 | Bacteria | 342102 |
| 1103 | Ga0451576_0012094 | 3300045051 | Bacteria | 9737 |
| 1104 | Ga0451576_0122196 | 3300045051 | Bacteria | 2711 |
| 1105 | Ga0451576_0199114 | 3300045051 | Bacteria | 2092 |
| 1106 | Ga0451576_0623124 | 3300045051 | Bacteria | 1134 |
| 1107 | Ga0466958_0222977 | 3300045836 | Bacteria | 1203 |
| 1108 | Ga0466967_0061247 | 3300045976 | Bacteria | 3338 |
| 1109 | Ga0466967_0346217 | 3300045976 | Bacteria | 1438 |
| 1110 | Ga0466967_0350728 | 3300045976 | Bacteria | 1428 |
| 1111 | Ga0495590_0147342 | 3300046457 | Bacteria | 852 |
| 1112 | Ga0495629_0514239 | 3300046459 | Bacteria | 806 |
| 1113 | Ga0495638_0002587 | 3300046460 | Bacteria | 14624 |
| 1114 | Ga0495638_0003316 | 3300046460 | Bacteria | 12697 |
| 1115 | Ga0495638_0053209 | 3300046460 | Bacteria | 2520 |
| 1116 | Ga0495638_0062992 | 3300046460 | Bacteria | 2288 |
| 1117 | Ga0495651_0239527 | 3300046462 | Bacteria | 1245 |
| 1118 | Ga0495651_0421007 | 3300046462 | Bacteria | 868 |
| 1119 | Ga0495650_0013417 | 3300046471 | Bacteria | 4333 |
| 1120 | Ga0495580_0015700 | 3300046472 | Bacteria | 5706 |
| 1121 | Ga0495580_0017539 | 3300046472 | Bacteria | 5352 |
| 1122 | Ga0495580_0020241 | 3300046472 | Bacteria | 4929 |
| 1123 | Ga0495582_0437309 | 3300046473 | Bacteria | 755 |
| 1124 | Ga0495662_0049903 | 3300046476 | Bacteria | 2019 |
| 1125 | Ga0495662_0245503 | 3300046476 | Bacteria | 882 |
| 1126 | Ga0495664_0149650 | 3300046477 | Bacteria | 1416 |
| 1127 | Ga0495664_0186262 | 3300046477 | Bacteria | 1258 |
| 1128 | Ga0495584_0181099 | 3300046491 | Bacteria | 1071 |
| 1129 | Ga0495585_0060131 | 3300046492 | Bacteria | 2092 |
| 1130 | Ga0495583_0056737 | 3300046506 | Bacteria | 1764 |
| 1131 | Ga0495606_0209596 | 3300046507 | Bacteria | 1104 |
| 1132 | Ga0495616_0049419 | 3300046513 | Bacteria | 2108 |
| 1133 | Ga0495618_0116095 | 3300046514 | Bacteria | 1714 |
| 1134 | Ga0495618_0149890 | 3300046514 | Bacteria | 1490 |
| 1135 | Ga0495620_0070396 | 3300046515 | Bacteria | 1433 |
| 1136 | Ga0495628_0030797 | 3300046516 | Bacteria | 4343 |
| 1137 | Ga0495628_0065042 | 3300046516 | Bacteria | 2854 |
| 1138 | Ga0495630_0076512 | 3300046517 | Bacteria | 2522 |
| 1139 | Ga0495630_1001622 | 3300046517 | Bacteria | 635 |
| 1140 | Ga0495630_1083785 | 3300046517 | Bacteria | 607 |
| 1141 | Ga0495632_0043486 | 3300046519 | Bacteria | 2245 |
| 1142 | Ga0495632_0084959 | 3300046519 | Bacteria | 1506 |
| 1143 | Ga0495637_0277425 | 3300046520 | Bacteria | 599 |
| 1144 | Ga0495648_0055833 | 3300046524 | Bacteria | 2379 |
| 1145 | Ga0495652_0131980 | 3300046529 | Bacteria | 1976 |
| 1146 | Ga0495665_0124948 | 3300046531 | Bacteria | 1347 |
| 1147 | Ga0495665_0148044 | 3300046531 | Unclassified | 1226 |
| 1148 | Ga0495640_0151957 | 3300046533 | Bacteria | 1487 |
| 1149 | Ga0495586_0049635 | 3300046535 | Bacteria | 2269 |
| 1150 | Ga0495587_0029626 | 3300046536 | Bacteria | 3323 |
| 1151 | Ga0495621_0023719 | 3300046539 | Bacteria | 2043 |
| 1152 | Ga0495645_0029760 | 3300046543 | Bacteria | 3974 |
| 1153 | Ga0495645_0042697 | 3300046543 | Bacteria | 3306 |
| 1154 | Ga0495645_0257218 | 3300046543 | Bacteria | 1158 |
| 1155 | Ga0495645_0689925 | 3300046543 | Bacteria | 621 |
| 1156 | Ga0495667_0016573 | 3300046559 | Bacteria | 4975 |
| 1157 | Ga0495667_0051369 | 3300046559 | Bacteria | 2720 |
| 1158 | Ga0495667_0102578 | 3300046559 | Bacteria | 1850 |
| 1159 | Ga0495667_0115263 | 3300046559 | Bacteria | 1736 |
| 1160 | Ga0495667_0416063 | 3300046559 | Bacteria | 846 |
| 1161 | Ga0495667_0488916 | 3300046559 | Bacteria | 771 |
| 1162 | Ga0495656_0186767 | 3300046615 | Bacteria | 1022 |
| 1163 | Ga0495668_0032582 | 3300046616 | Bacteria | 2931 |
| 1164 | Ga0495668_0371900 | 3300046616 | Bacteria | 785 |
| 1165 | Ga0495625_0017237 | 3300046660 | Bacteria | 5656 |
| 1166 | Ga0495625_0036484 | 3300046660 | Bacteria | 3613 |
| 1167 | Ga0495625_0069652 | 3300046660 | Bacteria | 2471 |
| 1168 | Ga0495625_0166820 | 3300046660 | Bacteria | 1472 |
| 1169 | Ga0495625_0274337 | 3300046660 | Bacteria | 1087 |
| 1170 | Ga0495625_0365070 | 3300046660 | Bacteria | 909 |
| 1171 | Ga0495625_0506002 | 3300046660 | Bacteria | 738 |
| 1172 | Ga0495635_0194035 | 3300046663 | Bacteria | 1378 |
| 1173 | Ga0495657_0014443 | 3300046675 | Bacteria | 5798 |
| 1174 | Ga0495657_0159093 | 3300046675 | Bacteria | 1398 |
| 1175 | Ga0495599_0481032 | 3300046678 | Bacteria | 733 |
| 1176 | Ga0495623_0055711 | 3300046679 | Bacteria | 2491 |
| 1177 | Ga0495623_0119360 | 3300046679 | Bacteria | 1589 |
| 1178 | Ga0495646_0131359 | 3300046680 | Bacteria | 1409 |
| 1179 | Ga0495669_0129497 | 3300046684 | Bacteria | 1187 |
| 1180 | Ga0495613_0173610 | 3300046689 | Bacteria | 1529 |
| 1181 | Ga0495671_0004294 | 3300046692 | Bacteria | 8563 |
| 1182 | Ga0495649_0046588 | 3300046694 | Bacteria | 2361 |
| 1183 | Ga0495600_0108839 | 3300046809 | Bacteria | 1805 |
| 1184 | Ga0495600_0365439 | 3300046809 | Bacteria | 902 |
| 1185 | Ga0495604_0069026 | 3300047317 | Bacteria | 2680 |
| 1186 | Ga0495604_0188600 | 3300047317 | Bacteria | 1438 |
| 1187 | Ga0495604_0189099 | 3300047317 | Bacteria | 1436 |
| 1188 | Ga0495604_0324931 | 3300047317 | Bacteria | 1027 |
| 1189 | Ga0495674_0002309 | 3300047319 | Bacteria | 18707 |
| 1190 | Ga0495674_0023603 | 3300047319 | Bacteria | 5665 |
| 1191 | Ga0495674_0140585 | 3300047319 | Bacteria | 2030 |
| 1192 | Ga0495674_0142196 | 3300047319 | Bacteria | 2016 |
| 1193 | Ga0495674_0242921 | 3300047319 | Bacteria | 1483 |
| 1194 | Ga0495674_1192591 | 3300047319 | Bacteria | 576 |
| 1195 | Ga0495680_0300157 | 3300047322 | Bacteria | 1128 |
| 1196 | Ga0495680_0310694 | 3300047322 | Bacteria | 1105 |
| 1197 | Ga0495687_044475 | 3300047443 | Bacteria | 1930 |
| 1198 | Ga0495675_0028415 | 3300047444 | Bacteria | 3565 |
| 1199 | Ga0495675_0033838 | 3300047444 | Bacteria | 3262 |
| 1200 | Ga0495675_0053461 | 3300047444 | Bacteria | 2564 |
| 1201 | Ga0495673_0124530 | 3300047469 | Bacteria | 1018 |
| 1202 | Ga0495684_0003346 | 3300047471 | Bacteria | 12586 |
| 1203 | Ga0495684_0065386 | 3300047471 | Bacteria | 2764 |
| 1204 | Ga0495684_0402254 | 3300047471 | Bacteria | 961 |
| 1205 | Ga0495684_0545704 | 3300047471 | Bacteria | 790 |
| 1206 | Ga0495686_0097341 | 3300047472 | Bacteria | 1779 |
| 1207 | Ga0495686_0099908 | 3300047472 | Bacteria | 1751 |
| 1208 | Ga0495686_0415088 | 3300047472 | Bacteria | 720 |
| 1209 | Ga0495602_0010228 | 3300048088 | Bacteria | 9735 |
| 1210 | Ga0495602_0019635 | 3300048088 | Bacteria | 6702 |
| 1211 | Ga0495602_0146056 | 3300048088 | Bacteria | 1866 |
| 1212 | Ga0495602_0229158 | 3300048088 | Bacteria | 1397 |
| 1213 | Ga0496100_0077980 | 3300048903 | Bacteria | 2229 |
| 1214 | Ga0496100_0117038 | 3300048903 | Bacteria | 1860 |
| 1215 | Ga0496100_0219368 | 3300048903 | Bacteria | 1395 |
| 1216 | Ga0496100_0530475 | 3300048903 | Bacteria | 909 |
| 1217 | Ga0496101_0011003 | 3300048904 | Bacteria | 5994 |
| 1218 | Ga0496101_0170831 | 3300048904 | Bacteria | 1671 |
| 1219 | Ga0496101_0912541 | 3300048904 | Bacteria | 692 |
| 1220 | Ga0496101_1238537 | 3300048904 | Bacteria | 584 |
| 1221 | Ga0496102_0011185 | 3300048905 | Bacteria | 7728 |
| 1222 | Ga0496102_0017816 | 3300048905 | Bacteria | 6227 |
| 1223 | Ga0496102_0069765 | 3300048905 | Bacteria | 3226 |
| 1224 | Ga0496103_0038246 | 3300048906 | Bacteria | 2943 |
| 1225 | Ga0496103_0060675 | 3300048906 | Bacteria | 2351 |
| 1226 | Ga0496103_0258452 | 3300048906 | Bacteria | 1121 |
| 1227 | Ga0496103_0344059 | 3300048906 | Bacteria | 959 |
| 1228 | Ga0496104_0010127 | 3300048907 | Bacteria | 8418 |
| 1229 | Ga0496104_0097439 | 3300048907 | Bacteria | 2815 |
| 1230 | Ga0496104_0992751 | 3300048907 | Bacteria | 744 |
| 1231 | Ga0496105_0061592 | 3300048908 | Bacteria | 3096 |
| 1232 | Ga0496105_1073248 | 3300048908 | Bacteria | 599 |
| 1233 | Ga0496106_0028021 | 3300048909 | Bacteria | 4194 |
| 1234 | Ga0496106_0060453 | 3300048909 | Bacteria | 2872 |
| 1235 | Ga0496106_0184015 | 3300048909 | Bacteria | 1659 |
| 1236 | Ga0496107_0224972 | 3300048910 | Bacteria | 1396 |
| 1237 | Ga0496108_0067338 | 3300048911 | Bacteria | 3020 |
| 1238 | Ga0496108_0552979 | 3300048911 | Bacteria | 1004 |
| 1239 | Ga0496109_0059265 | 3300048912 | Bacteria | 3497 |
| 1240 | Ga0496109_0800491 | 3300048912 | Bacteria | 880 |
| 1241 | Ga0496110_0183292 | 3300048913 | Bacteria | 1901 |
| 1242 | Ga0496110_0202342 | 3300048913 | Bacteria | 1804 |
| 1243 | Ga0496111_0007055 | 3300048914 | Bacteria | 7339 |
| 1244 | Ga0496112_0006250 | 3300048915 | Bacteria | 10439 |
| 1245 | Ga0496112_0040816 | 3300048915 | Bacteria | 4538 |
| 1246 | Ga0496112_0428100 | 3300048915 | Bacteria | 1262 |
| 1247 | Ga0496113_0160546 | 3300048916 | Bacteria | 1777 |
| 1248 | Ga0496113_0166256 | 3300048916 | Bacteria | 1745 |
| 1249 | Ga0496114_0001283 | 3300048917 | Bacteria | 18982 |
| 1250 | Ga0496114_0077219 | 3300048917 | Bacteria | 2807 |
| 1251 | Ga0496114_0389571 | 3300048917 | Bacteria | 1234 |
| 1252 | Ga0496115_0007516 | 3300048918 | Bacteria | 8023 |
| 1253 | Ga0496115_0015044 | 3300048918 | Bacteria | 5865 |
| 1254 | Ga0496115_0383387 | 3300048918 | Bacteria | 1143 |
| 1255 | Ga0496116_0017845 | 3300048919 | Bacteria | 5494 |
| 1256 | Ga0496117_0000251 | 3300048920 | Bacteria | 101431 |
| 1257 | Ga0496118_0000611 | 3300048921 | Bacteria | 58835 |
| 1258 | Ga0496118_0038221 | 3300048921 | Bacteria | 3850 |
| 1259 | Ga0496119_0000879 | 3300048922 | Bacteria | 39410 |
| 1260 | Ga0496119_0005071 | 3300048922 | Bacteria | 12787 |
| 1261 | Ga0496120_0000025 | 3300048923 | Bacteria | 235805 |
| 1262 | Ga0496120_0034271 | 3300048923 | Bacteria | 3043 |
| 1263 | Ga0496121_0006243 | 3300048924 | Bacteria | 14925 |
| 1264 | Ga0496121_0026956 | 3300048924 | Bacteria | 5393 |
| 1265 | Ga0496121_0027248 | 3300048924 | Bacteria | 5352 |
| 1266 | Ga0496125_0004822 | 3300048928 | Bacteria | 15327 |
| 1267 | Ga0496125_0043041 | 3300048928 | Bacteria | 3839 |
| 1268 | Ga0496125_0072600 | 3300048928 | Bacteria | 2680 |
| 1269 | Ga0496126_0003192 | 3300048929 | Bacteria | 21047 |
| 1270 | Ga0496126_0147414 | 3300048929 | Bacteria | 2020 |
| 1271 | Ga0496126_0218636 | 3300048929 | Bacteria | 1601 |
| 1272 | Ga0496126_0633166 | 3300048929 | Bacteria | 839 |
| 1273 | Ga0501306_010628 | 3300049127 | Bacteria | 1162 |
| 1274 | Ga0501306_026832 | 3300049127 | Bacteria | 836 |
| 1275 | Ga0501306_068218 | 3300049127 | Bacteria | 596 |
| 1276 | Ga0501308_049651 | 3300049128 | Bacteria | 611 |
| 1277 | Ga0501309_058481 | 3300049129 | Bacteria | 617 |
| 1278 | Ga0501309_067139 | 3300049129 | Bacteria | 585 |
| 1279 | Ga0501310_034440 | 3300049130 | Bacteria | 684 |
| 1280 | Ga0501310_045712 | 3300049130 | Bacteria | 621 |
| 1281 | Ga0501304_017027 | 3300049160 | Bacteria | 692 |
| 1282 | Ga0501305_030731 | 3300049161 | Bacteria | 836 |
| 1283 | Ga0501305_063456 | 3300049161 | Bacteria | 639 |
| 1284 | Ga0501305_070299 | 3300049161 | Bacteria | 615 |
| 1285 | Ga0501307_022402 | 3300049162 | Bacteria | 830 |
| 1286 | Ga0501307_029475 | 3300049162 | Bacteria | 755 |
| 1287 | Ga0501307_054780 | 3300049162 | Bacteria | 607 |
| 1288 | Ga0501301_001136 | 3300049524 | Bacteria | 1674 |
| 1289 | Ga0501312_019893 | 3300049528 | Bacteria | 989 |
| 1290 | Ga0501312_079272 | 3300049528 | Bacteria | 592 |
| 1291 | Ga0501313_037800 | 3300049529 | Bacteria | 642 |
| 1292 | Ga0501313_045962 | 3300049529 | Bacteria | 595 |
| 1293 | Ga0501315_037936 | 3300049531 | Bacteria | 719 |
| 1294 | Ga0501318_036805 | 3300049534 | Bacteria | 686 |
| 1295 | Ga0501321_062584 | 3300049537 | Bacteria | 565 |
| 1296 | Ga0501031_0035899 | 3300049568 | Bacteria | 3234 |
| 1297 | Ga0501033_0009908 | 3300049570 | Bacteria | 7317 |
| 1298 | Ga0501033_0261557 | 3300049570 | Bacteria | 1224 |
| 1299 | Ga0501034_0061967 | 3300049571 | Bacteria | 3756 |
| 1300 | Ga0501034_0464389 | 3300049571 | Bacteria | 1182 |
| 1301 | Ga0501036_0047299 | 3300049572 | Bacteria | 3644 |
| 1302 | Ga0501036_0233278 | 3300049572 | Bacteria | 1544 |
| 1303 | Ga0501037_0059406 | 3300049573 | Bacteria | 2789 |
| 1304 | Ga0501038_0005329 | 3300049574 | Bacteria | 11949 |
| 1305 | Ga0501038_0065115 | 3300049574 | Bacteria | 3106 |
| 1306 | Ga0501038_0085887 | 3300049574 | Bacteria | 2645 |
| 1307 | Ga0501038_0125098 | 3300049574 | Bacteria | 2117 |
| 1308 | Ga0501039_0005494 | 3300049575 | Bacteria | 9591 |
| 1309 | Ga0501039_0011760 | 3300049575 | Bacteria | 6666 |
| 1310 | Ga0501039_0135483 | 3300049575 | Bacteria | 1934 |
| 1311 | Ga0501040_0006961 | 3300049576 | Bacteria | 7323 |
| 1312 | Ga0501040_0009344 | 3300049576 | Bacteria | 6387 |
| 1313 | Ga0501040_0073938 | 3300049576 | Bacteria | 2355 |
| 1314 | Ga0501040_0883859 | 3300049576 | Bacteria | 647 |
| 1315 | Ga0501041_0013770 | 3300049577 | Bacteria | 4796 |
| 1316 | Ga0501041_0025726 | 3300049577 | Bacteria | 3537 |
| 1317 | Ga0501042_0000915 | 3300049578 | Bacteria | 16542 |
| 1318 | Ga0501042_0051806 | 3300049578 | Bacteria | 2928 |
| 1319 | Ga0501042_0068944 | 3300049578 | Bacteria | 2529 |
| 1320 | Ga0501042_0728450 | 3300049578 | Bacteria | 721 |
| 1321 | Ga0501043_0061144 | 3300049579 | Bacteria | 2958 |
| 1322 | Ga0501043_0218544 | 3300049579 | Bacteria | 1475 |
| 1323 | Ga0501043_0500218 | 3300049579 | Bacteria | 908 |
| 1324 | Ga0501043_0711352 | 3300049579 | Bacteria | 733 |
| 1325 | Ga0501046_0008093 | 3300049580 | Bacteria | 9187 |
| 1326 | Ga0501046_0020394 | 3300049580 | Bacteria | 5483 |
| 1327 | Ga0501046_0190562 | 3300049580 | Bacteria | 1530 |
| 1328 | Ga0501047_0045003 | 3300049581 | Bacteria | 4266 |
| 1329 | Ga0501047_0062702 | 3300049581 | Bacteria | 3586 |
| 1330 | Ga0501047_0205297 | 3300049581 | Bacteria | 1830 |
| 1331 | Ga0501047_0282351 | 3300049581 | Bacteria | 1505 |
| 1332 | Ga0501047_0498530 | 3300049581 | Bacteria | 1044 |
| 1333 | Ga0501048_0006562 | 3300049582 | Bacteria | 8845 |
| 1334 | Ga0501048_0976963 | 3300049582 | Bacteria | 609 |
| 1335 | Ga0501067_0014051 | 3300049583 | Bacteria | 4436 |
| 1336 | Ga0501067_0125647 | 3300049583 | Bacteria | 1427 |
| 1337 | Ga0501067_0169797 | 3300049583 | Bacteria | 1215 |
| 1338 | Ga0501068_0000867 | 3300049584 | Bacteria | 15748 |
| 1339 | Ga0501068_0059666 | 3300049584 | Bacteria | 2316 |
| 1340 | Ga0501068_0243459 | 3300049584 | Bacteria | 1145 |
| 1341 | Ga0501070_0060130 | 3300049586 | Bacteria | 3150 |
| 1342 | Ga0501071_0004440 | 3300049587 | Bacteria | 8900 |
| 1343 | Ga0501071_0021226 | 3300049587 | Bacteria | 4520 |
| 1344 | Ga0501071_0392235 | 3300049587 | Bacteria | 1059 |
| 1345 | Ga0501071_1011006 | 3300049587 | Bacteria | 642 |
| 1346 | Ga0501072_0004135 | 3300049588 | Bacteria | 10986 |
| 1347 | Ga0501072_0033552 | 3300049588 | Bacteria | 4022 |
| 1348 | Ga0501072_0228299 | 3300049588 | Bacteria | 1483 |
| 1349 | Ga0501072_0242447 | 3300049588 | Bacteria | 1436 |
| 1350 | Ga0501073_0004134 | 3300049589 | Bacteria | 10899 |
| 1351 | Ga0501073_0011609 | 3300049589 | Bacteria | 6437 |
| 1352 | Ga0501073_0025289 | 3300049589 | Bacteria | 4260 |
| 1353 | Ga0501073_0026538 | 3300049589 | Bacteria | 4149 |
| 1354 | Ga0501073_0034466 | 3300049589 | Bacteria | 3603 |
| 1355 | Ga0501073_0059015 | 3300049589 | Bacteria | 2681 |
| 1356 | Ga0501074_0099931 | 3300049590 | Bacteria | 2076 |
| 1357 | Ga0501074_0120613 | 3300049590 | Bacteria | 1875 |
| 1358 | Ga0501074_0242113 | 3300049590 | Bacteria | 1283 |
| 1359 | Ga0501075_0005108 | 3300049591 | Bacteria | 8969 |
| 1360 | Ga0501075_0172471 | 3300049591 | Bacteria | 1651 |
| 1361 | Ga0501075_0424194 | 3300049591 | Bacteria | 1014 |
| 1362 | Ga0501076_0010445 | 3300049592 | Bacteria | 6893 |
| 1363 | Ga0501076_0011218 | 3300049592 | Bacteria | 6671 |
| 1364 | Ga0501076_0049580 | 3300049592 | Bacteria | 3321 |
| 1365 | Ga0501076_0218696 | 3300049592 | Bacteria | 1557 |
| 1366 | Ga0501077_0006169 | 3300049593 | Bacteria | 7320 |
| 1367 | Ga0501077_0019420 | 3300049593 | Bacteria | 4299 |
| 1368 | Ga0501077_0036799 | 3300049593 | Bacteria | 3118 |
| 1369 | Ga0501077_0106262 | 3300049593 | Bacteria | 1779 |
| 1370 | Ga0501246_029409 | 3300049676 | Bacteria | 610 |
| 1371 | Ga0501249_023042 | 3300049679 | Bacteria | 1365 |
| 1372 | Ga0501079_0000565 | 3300049741 | Bacteria | 24354 |
| 1373 | Ga0501079_0001159 | 3300049741 | Bacteria | 18450 |
| 1374 | Ga0501079_0003223 | 3300049741 | Bacteria | 11949 |
| 1375 | Ga0501079_0100737 | 3300049741 | Bacteria | 2240 |
| 1376 | Ga0501080_0000453 | 3300049742 | Bacteria | 31773 |
| 1377 | Ga0501080_0001345 | 3300049742 | Bacteria | 20524 |
| 1378 | Ga0501080_0143961 | 3300049742 | Bacteria | 2203 |
| 1379 | Ga0501080_0479591 | 3300049742 | Bacteria | 1113 |
| 1380 | Ga0501080_0523078 | 3300049742 | Bacteria | 1058 |
| 1381 | Ga0501080_0628044 | 3300049742 | Bacteria | 952 |
| 1382 | Ga0501080_0876561 | 3300049742 | Bacteria | 783 |
| 1383 | Ga0501081_0000381 | 3300049743 | Bacteria | 24386 |
| 1384 | Ga0501081_0008007 | 3300049743 | Bacteria | 6858 |
| 1385 | Ga0501083_0001296 | 3300049744 | Bacteria | 16903 |
| 1386 | Ga0501083_0026643 | 3300049744 | Bacteria | 3994 |
| 1387 | Ga0501083_0073024 | 3300049744 | Bacteria | 2280 |
| 1388 | Ga0501083_0080694 | 3300049744 | Bacteria | 2157 |
| 1389 | Ga0501083_0122963 | 3300049744 | Bacteria | 1702 |
| 1390 | Ga0501083_0153116 | 3300049744 | Bacteria | 1510 |
| 1391 | Ga0501035_0004435 | 3300049822 | Bacteria | 13321 |
| 1392 | Ga0501035_0007033 | 3300049822 | Bacteria | 10515 |
| 1393 | Ga0501035_0019306 | 3300049822 | Bacteria | 6273 |
| 1394 | Ga0501035_0226203 | 3300049822 | Bacteria | 1596 |
| 1395 | Ga0501035_0871967 | 3300049822 | Bacteria | 715 |
| 1396 | Ga0501044_0000794 | 3300049823 | Bacteria | 38183 |
| 1397 | Ga0501044_0001257 | 3300049823 | Bacteria | 29993 |
| 1398 | Ga0501044_0062939 | 3300049823 | Bacteria | 3791 |
| 1399 | Ga0501045_0009394 | 3300049824 | Bacteria | 6839 |
| 1400 | Ga0501045_0014470 | 3300049824 | Bacteria | 5591 |
| 1401 | Ga0501045_0073028 | 3300049824 | Bacteria | 2526 |
| 1402 | Ga0501045_0512433 | 3300049824 | Bacteria | 891 |
| 1403 | Ga0501045_0668872 | 3300049824 | Bacteria | 767 |
| 1404 | nmdc:mga0yw44_41471_c1 | 3300050492 | Bacteria | 2740 |
| 1405 | nmdc:mga0yw44_816867_c1 | 3300050492 | Bacteria | 633 |
| 1406 | nmdc:mga0k408_61132_c1 | 3300050493 | Bacteria | 2189 |
| 1407 | nmdc:mga05p37_333657_c1 | 3300050507 | Bacteria | 1790 |
| 1408 | nmdc:mga05p37_3957_c1 | 3300050507 | Bacteria | 17352 |
| 1409 | nmdc:mga05p37_617083_c1 | 3300050507 | Bacteria | 1221 |
| 1410 | nmdc:mga05p37_7207_c1 | 3300050507 | Bacteria | 13120 |
| 1411 | nmdc:mga05p37_987277_c1 | 3300050507 | Bacteria | 896 |
| 1412 | nmdc:mga09592_128537_c1 | 3300050508 | Bacteria | 2179 |
| 1413 | nmdc:mga09592_267633_c1 | 3300050508 | Bacteria | 1482 |
| 1414 | nmdc:mga09592_6699_c1 | 3300050508 | Bacteria | 9381 |
| 1415 | nmdc:mga09592_780_c1 | 3300050508 | Bacteria | 24615 |
| 1416 | nmdc:mga0qj67_13394_c1 | 3300050509 | Bacteria | 6186 |
| 1417 | nmdc:mga0qj67_218813_c1 | 3300050509 | Bacteria | 1546 |
| 1418 | nmdc:mga0qj67_259927_c1 | 3300050509 | Bacteria | 1408 |
| 1419 | nmdc:mga0qj67_76540_c1 | 3300050509 | Bacteria | 2676 |
| 1420 | nmdc:mga0qj67_8518_c1 | 3300050509 | Bacteria | 7611 |
| 1421 | nmdc:mga06r32_1571_c1 | 3300050510 | Bacteria | 20567 |
| 1422 | nmdc:mga06r32_3176_c1 | 3300050510 | Bacteria | 14718 |
| 1423 | nmdc:mga06r32_5339_c1 | 3300050510 | Bacteria | 11568 |
| 1424 | nmdc:mga08y16_1280306_c1 | 3300050511 | Bacteria | 701 |
| 1425 | nmdc:mga08y16_138691_c1 | 3300050511 | Bacteria | 2528 |
| 1426 | nmdc:mga08y16_164730_c1 | 3300050511 | Bacteria | 2303 |
| 1427 | nmdc:mga08y16_87881_c1 | 3300050511 | Bacteria | 3239 |
| 1428 | nmdc:mga08y16_961855_c1 | 3300050511 | Bacteria | 836 |
| 1429 | nmdc:mga0n895_1690896_c1 | 3300050512 | Bacteria | 595 |
| 1430 | nmdc:mga0n895_337372_c1 | 3300050512 | Bacteria | 1527 |
| 1431 | nmdc:mga0rr50_60574_c1 | 3300050513 | Bacteria | 2848 |
| 1432 | nmdc:mga08x19_102123_c1 | 3300050514 | Bacteria | 1904 |
| 1433 | nmdc:mga08x19_122209_c1 | 3300050514 | Bacteria | 1746 |
| 1434 | nmdc:mga0a205_163676_c1 | 3300050515 | Bacteria | 2120 |
| 1435 | Ga0500578_0309779 | 3300053086 | Bacteria | 934 |
| 1436 | Ga0500644_0166923 | 3300053088 | Bacteria | 893 |
| 1437 | Ga0500647_0040234 | 3300053091 | Bacteria | 2243 |
| 1438 | Ga0500583_0008778 | 3300053092 | Bacteria | 3653 |
| 1439 | Ga0500583_0039233 | 3300053092 | Bacteria | 2137 |
| 1440 | Ga0500566_0014529 | 3300053094 | Bacteria | 4627 |
| 1441 | Ga0500640_002285 | 3300053095 | Bacteria | 6274 |
| 1442 | Ga0500641_0018886 | 3300053096 | Bacteria | 2599 |
| 1443 | Ga0500641_0155084 | 3300053096 | Bacteria | 988 |
| 1444 | Ga0500650_0066976 | 3300053098 | Bacteria | 1678 |
| 1445 | Ga0500554_002327 | 3300053102 | Bacteria | 3725 |
| 1446 | Ga0500556_0000646 | 3300053104 | Bacteria | 21836 |
| 1447 | Ga0500556_0015792 | 3300053104 | Bacteria | 2337 |
| 1448 | Ga0500591_164512 | 3300053115 | Bacteria | 832 |
| 1449 | Ga0500595_001726 | 3300053119 | Bacteria | 11403 |
| 1450 | Ga0500595_006081 | 3300053119 | Bacteria | 5175 |
| 1451 | Ga0500607_229752 | 3300053121 | Bacteria | 762 |
| 1452 | Ga0500614_003262 | 3300053123 | Bacteria | 3510 |
| 1453 | Ga0500617_019473 | 3300053124 | Bacteria | 2966 |
| 1454 | Ga0500655_042194 | 3300053133 | Bacteria | 897 |
| 1455 | Ga0500658_0165539 | 3300053134 | Bacteria | 1003 |
| 1456 | Ga0500559_0009784 | 3300053136 | Bacteria | 4136 |
| 1457 | Ga0500559_0291341 | 3300053136 | Bacteria | 767 |
| 1458 | Ga0500577_0232857 | 3300053142 | Bacteria | 799 |
| 1459 | Ga0500588_0000279 | 3300053146 | Bacteria | 7531 |
| 1460 | Ga0500588_0007867 | 3300053146 | Bacteria | 2470 |
| 1461 | Ga0500588_0102187 | 3300053146 | Bacteria | 989 |
| 1462 | Ga0500588_0130033 | 3300053146 | Bacteria | 896 |
| 1463 | Ga0500616_0000096 | 3300053153 | Bacteria | 179125 |
| 1464 | Ga0500616_0009124 | 3300053153 | Bacteria | 6063 |
| 1465 | Ga0500622_0002975 | 3300053156 | Bacteria | 11744 |
| 1466 | Ga0500622_0056851 | 3300053156 | Bacteria | 2002 |
| 1467 | Ga0500627_0092343 | 3300053158 | Bacteria | 1355 |
| 1468 | Ga0500637_0045803 | 3300053178 | Bacteria | 2482 |
| 1469 | Ga0500637_0069933 | 3300053178 | Bacteria | 2018 |
| 1470 | Ga0500637_0123352 | 3300053178 | Bacteria | 1503 |
| 1471 | Ga0500645_027276 | 3300053730 | Bacteria | 1732 |
| 1472 | Ga0501084_0000703 | 3300054114 | Bacteria | 25621 |
| 1473 | Ga0501084_0027449 | 3300054114 | Bacteria | 4756 |
| 1474 | Ga0501084_0054651 | 3300054114 | Bacteria | 3340 |
| 1475 | Ga0501084_0342056 | 3300054114 | Bacteria | 1264 |
| 1476 | Ga0501084_1020956 | 3300054114 | Bacteria | 695 |
| 1477 | Ga0587093_037946 | 3300059478 | Bacteria | 720 |
| 1478 | Ga0587080_011658 | 3300059503 | Bacteria | 1318 |
| 1479 | Ga0587083_0170672 | 3300059505 | Bacteria | 602 |
| 1480 | Ga0587083_0180621 | 3300059505 | Bacteria | 590 |
| 1481 | Ga0501082_0001073 | 3300060353 | Bacteria | 24204 |
| 1482 | Ga0501082_0002270 | 3300060353 | Bacteria | 16842 |
| 1483 | Ga0501082_0018634 | 3300060353 | Bacteria | 5982 |
| 1484 | Ga0501082_0022513 | 3300060353 | Bacteria | 5427 |
| 1485 | Ga0501082_0082649 | 3300060353 | Bacteria | 2771 |
| 1486 | Ga0501082_0165930 | 3300060353 | Bacteria | 1919 |
| 1487 | Ga0501082_0315578 | 3300060353 | Bacteria | 1361 |
| 1488 | Ga0501082_1244283 | 3300060353 | Bacteria | 650 |
| 1489 | Ga0530510_0005434 | 3300061734 | Bacteria | 8816 |
| 1490 | Ga0530510_0015910 | 3300061734 | Bacteria | 5318 |
| 1491 | Ga0530510_0701196 | 3300061734 | Bacteria | 771 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013296 | Ga0157374_11411107 | Ga0157374_114111071 | 175 |
| 2 | 3300005436 | Ga0070713_100000161 | Ga0070713_10000016139 | 176 |
| 3 | 3300025928 | Ga0207700_10000245 | Ga0207700_100002459 | 176 |
| 4 | 3300025914 | Ga0207671_10336716 | Ga0207671_103367162 | 177 |
| 5 | 3300002737 | JGI25162J39368_1004290 | JGI25162J39368_10042904 | 178 |
| 6 | 3300005288 | Ga0065714_10044263 | Ga0065714_100442632 | 178 |
| 7 | 3300005293 | Ga0065715_10014079 | Ga0065715_100140791 | 178 |
| 8 | 3300005293 | Ga0065715_10028357 | Ga0065715_100283571 | 178 |
| 9 | 3300005293 | Ga0065715_10110463 | Ga0065715_101104633 | 178 |
| 10 | 3300005293 | Ga0065715_10140004 | Ga0065715_101400041 | 178 |
| 11 | 3300005329 | Ga0070683_100835648 | Ga0070683_1008356481 | 178 |
| 12 | 3300005364 | Ga0070673_100409217 | Ga0070673_1004092172 | 178 |
| 13 | 3300005366 | Ga0070659_101144045 | Ga0070659_1011440451 | 178 |
| 14 | 3300005455 | Ga0070663_100209047 | Ga0070663_1002090472 | 178 |
| 15 | 3300005456 | Ga0070678_100460806 | Ga0070678_1004608062 | 178 |
| 16 | 3300005458 | Ga0070681_10479982 | Ga0070681_104799822 | 178 |
| 17 | 3300005458 | Ga0070681_10988195 | Ga0070681_109881952 | 178 |
| 18 | 3300005530 | Ga0070679_100204893 | Ga0070679_1002048932 | 178 |
| 19 | 3300005548 | Ga0070665_100328961 | Ga0070665_1003289613 | 178 |
| 20 | 3300005563 | Ga0068855_101422622 | Ga0068855_1014226222 | 178 |
| 21 | 3300005985 | Ga0081539_10047289 | Ga0081539_100472893 | 178 |
| 22 | 3300009093 | Ga0105240_10012718 | Ga0105240_100127189 | 178 |
| 23 | 3300010375 | Ga0105239_10091018 | Ga0105239_100910184 | 178 |
| 24 | 3300013102 | Ga0157371_11089482 | Ga0157371_110894821 | 178 |
| 25 | 3300013307 | Ga0157372_10455049 | Ga0157372_104550492 | 178 |
| 26 | 3300013307 | Ga0157372_10800718 | Ga0157372_108007182 | 178 |
| 27 | 3300014326 | Ga0157380_11022243 | Ga0157380_110222432 | 178 |
| 28 | 3300020075 | Ga0206349_1898117 | Ga0206349_18981171 | 178 |
| 29 | 3300020076 | Ga0206355_1138380 | Ga0206355_11383802 | 178 |
| 30 | 3300020080 | Ga0206350_10652330 | Ga0206350_106523301 | 178 |
| 31 | 3300022467 | Ga0224712_10027153 | Ga0224712_100271532 | 178 |
| 32 | 3300025913 | Ga0207695_10013605 | Ga0207695_100136053 | 178 |
| 33 | 3300025921 | Ga0207652_10659257 | Ga0207652_106592571 | 178 |
| 34 | 3300025923 | Ga0207681_10453518 | Ga0207681_104535182 | 178 |
| 35 | 3300025933 | Ga0207706_10691937 | Ga0207706_106919372 | 178 |
| 36 | 3300025945 | Ga0207679_10833385 | Ga0207679_108333852 | 178 |
| 37 | 3300025949 | Ga0207667_11455956 | Ga0207667_114559561 | 178 |
| 38 | 3300025960 | Ga0207651_10344412 | Ga0207651_103444122 | 178 |
| 39 | 3300026067 | Ga0207678_10199441 | Ga0207678_101994411 | 178 |
| 40 | 3300026116 | Ga0207674_10511360 | Ga0207674_105113601 | 178 |
| 41 | 3300027876 | Ga0209974_10053724 | Ga0209974_100537242 | 178 |
| 42 | 3300031247 | Ga0265340_10015902 | Ga0265340_100159022 | 178 |
| 43 | 3300031344 | Ga0265316_10001714 | Ga0265316_100017147 | 178 |
| 44 | 3300031344 | Ga0265316_10003861 | Ga0265316_100038619 | 178 |
| 45 | 3300031344 | Ga0265316_10028987 | Ga0265316_100289874 | 178 |
| 46 | 3300031344 | Ga0265316_10125236 | Ga0265316_101252362 | 178 |
| 47 | 3300031344 | Ga0265316_10262611 | Ga0265316_102626112 | 178 |
| 48 | 3300031344 | Ga0265316_10488995 | Ga0265316_104889951 | 178 |
| 49 | 3300031595 | Ga0265313_10181118 | Ga0265313_101811181 | 178 |
| 50 | 3300031711 | Ga0265314_10002511 | Ga0265314_1000251112 | 178 |
| 51 | 3300031711 | Ga0265314_10019885 | Ga0265314_100198852 | 178 |
| 52 | 3300031911 | Ga0307412_10107311 | Ga0307412_101073113 | 178 |
| 53 | 3300037312 | Ga0395899_0180376 | Ga0395899_0180376_594_1130 | 178 |
| 54 | 3300037418 | Ga0395900_0858429 | Ga0395900_0858429_18_554 | 178 |
| 55 | 3300037466 | Ga0395898_0823690 | Ga0395898_0823690_206_742 | 178 |
| 56 | 3300039450 | Ga0436363_0255678 | Ga0436363_0255678_19_555 | 178 |
| 57 | 3300041413 | Ga0439465_0119002 | Ga0439465_0119002_289_825 | 178 |
| 58 | 3300042006 | Ga0439432_112283 | Ga0439432_112283_54_590 | 178 |
| 59 | 3300042007 | Ga0439449_0206013 | Ga0439449_0206013_125_661 | 178 |
| 60 | 3300044901 | Ga0466960_0204969 | Ga0466960_0204969_217_753 | 178 |
| 61 | 3300045051 | Ga0451576_0623124 | Ga0451576_0623124_187_729 | 178 |
| 62 | 3300046476 | Ga0495662_0245503 | Ga0495662_0245503_262_798 | 178 |
| 63 | 3300046531 | Ga0495665_0148044 | Ga0495665_0148044_11_547 | 178 |
| 64 | 3300046535 | Ga0495586_0049635 | Ga0495586_0049635_1099_1635 | 178 |
| 65 | 3300046543 | Ga0495645_0042697 | Ga0495645_0042697_2045_2581 | 178 |
| 66 | 3300046543 | Ga0495645_0689925 | Ga0495645_0689925_29_565 | 178 |
| 67 | 3300046559 | Ga0495667_0102578 | Ga0495667_0102578_822_1358 | 178 |
| 68 | 3300046663 | Ga0495635_0194035 | Ga0495635_0194035_151_687 | 178 |
| 69 | 3300046675 | Ga0495657_0014443 | Ga0495657_0014443_1404_1940 | 178 |
| 70 | 3300046679 | Ga0495623_0119360 | Ga0495623_0119360_660_1196 | 178 |
| 71 | 3300046684 | Ga0495669_0129497 | Ga0495669_0129497_43_579 | 178 |
| 72 | 3300046689 | Ga0495613_0173610 | Ga0495613_0173610_722_1258 | 178 |
| 73 | 3300046809 | Ga0495600_0365439 | Ga0495600_0365439_194_730 | 178 |
| 74 | 3300047317 | Ga0495604_0324931 | Ga0495604_0324931_459_995 | 178 |
| 75 | 3300047444 | Ga0495675_0028415 | Ga0495675_0028415_2161_2697 | 178 |
| 76 | 3300047471 | Ga0495684_0545704 | Ga0495684_0545704_46_582 | 178 |
| 77 | 3300048088 | Ga0495602_0146056 | Ga0495602_0146056_1141_1677 | 178 |
| 78 | 3300048918 | Ga0496115_0383387 | Ga0496115_0383387_389_925 | 178 |
| 79 | 3300048929 | Ga0496126_0633166 | Ga0496126_0633166_149_685 | 178 |
| 80 | 3300049570 | Ga0501033_0261557 | Ga0501033_0261557_146_682 | 178 |
| 81 | 3300049571 | Ga0501034_0464389 | Ga0501034_0464389_156_692 | 178 |
| 82 | 3300049574 | Ga0501038_0085887 | Ga0501038_0085887_386_922 | 178 |
| 83 | 3300049581 | Ga0501047_0045003 | Ga0501047_0045003_2376_2912 | 178 |
| 84 | 3300049581 | Ga0501047_0062702 | Ga0501047_0062702_13_549 | 178 |
| 85 | 3300049581 | Ga0501047_0498530 | Ga0501047_0498530_433_969 | 178 |
| 86 | 3300049589 | Ga0501073_0025289 | Ga0501073_0025289_383_919 | 178 |
| 87 | 3300049742 | Ga0501080_0628044 | Ga0501080_0628044_230_766 | 178 |
| 88 | 3300049744 | Ga0501083_0122963 | Ga0501083_0122963_440_976 | 178 |
| 89 | 3300049744 | Ga0501083_0153116 | Ga0501083_0153116_230_766 | 178 |
| 90 | 3300049822 | Ga0501035_0007033 | Ga0501035_0007033_6856_7392 | 178 |
| 91 | 3300049822 | Ga0501035_0226203 | Ga0501035_0226203_547_1083 | 178 |
| 92 | 3300049823 | Ga0501044_0000794 | Ga0501044_0000794_19907_20443 | 178 |
| 93 | 3300049823 | Ga0501044_0001257 | Ga0501044_0001257_19956_20492 | 178 |
| 94 | 3300049823 | Ga0501044_0062939 | Ga0501044_0062939_658_1194 | 178 |
| 95 | 3300053136 | Ga0500559_0291341 | Ga0500559_0291341_117_656 | 178 |
| 96 | 3300054114 | Ga0501084_1020956 | Ga0501084_1020956_56_592 | 178 |
| 97 | 3300059505 | Ga0587083_0180621 | Ga0587083_0180621_30_566 | 178 |
| 98 | 3300002244 | JGI24742J22300_10055810 | JGI24742J22300_100558101 | 179 |
| 99 | 3300003162 | Ga0006778J45830_1034955 | Ga0006778J45830_10349551 | 179 |
| 100 | 3300003162 | Ga0006778J45830_1090249 | Ga0006778J45830_10902491 | 179 |
| 101 | 3300003163 | Ga0006759J45824_1031269 | Ga0006759J45824_10312691 | 179 |
| 102 | 3300003163 | Ga0006759J45824_1051790 | Ga0006759J45824_10517901 | 179 |
| 103 | 3300003163 | Ga0006759J45824_1064721 | Ga0006759J45824_10647211 | 179 |
| 104 | 3300003163 | Ga0006759J45824_1080555 | Ga0006759J45824_10805551 | 179 |
| 105 | 3300003203 | JGI25406J46586_10010550 | JGI25406J46586_100105504 | 179 |
| 106 | 3300003203 | JGI25406J46586_10025326 | JGI25406J46586_100253263 | 179 |
| 107 | 3300003308 | Ga0006777J48905_1023601 | Ga0006777J48905_10236011 | 179 |
| 108 | 3300003308 | Ga0006777J48905_1071737 | Ga0006777J48905_10717371 | 179 |
| 109 | 3300003322 | rootL2_10052881 | rootL2_100528813 | 179 |
| 110 | 3300003568 | Ga0006781J51513_1035968 | Ga0006781J51513_10359681 | 179 |
| 111 | 3300003574 | Ga0007410J51695_1022950 | Ga0007410J51695_10229501 | 179 |
| 112 | 3300003574 | Ga0007410J51695_1053083 | Ga0007410J51695_10530831 | 179 |
| 113 | 3300003577 | Ga0007416J51690_1050632 | Ga0007416J51690_10506321 | 179 |
| 114 | 3300003693 | Ga0032354_1033655 | Ga0032354_10336551 | 179 |
| 115 | 3300003693 | Ga0032354_1036149 | Ga0032354_10361491 | 179 |
| 116 | 3300003693 | Ga0032354_1048806 | Ga0032354_10488061 | 179 |
| 117 | 3300003735 | Ga0006780_1013989 | Ga0006780_10139891 | 179 |
| 118 | 3300003735 | Ga0006780_1029819 | Ga0006780_10298191 | 179 |
| 119 | 3300004798 | Ga0058859_10026294 | Ga0058859_100262941 | 179 |
| 120 | 3300004800 | Ga0058861_11963726 | Ga0058861_119637261 | 179 |
| 121 | 3300004801 | Ga0058860_10060066 | Ga0058860_100600661 | 179 |
| 122 | 3300004801 | Ga0058860_10076721 | Ga0058860_100767212 | 179 |
| 123 | 3300004801 | Ga0058860_10088687 | Ga0058860_100886871 | 179 |
| 124 | 3300004801 | Ga0058860_12240042 | Ga0058860_122400421 | 179 |
| 125 | 3300005290 | Ga0065712_10004198 | Ga0065712_100041983 | 179 |
| 126 | 3300005290 | Ga0065712_10119918 | Ga0065712_101199182 | 179 |
| 127 | 3300005290 | Ga0065712_10281568 | Ga0065712_102815681 | 179 |
| 128 | 3300005290 | Ga0065712_10466766 | Ga0065712_104667661 | 179 |
| 129 | 3300005293 | Ga0065715_10104963 | Ga0065715_101049633 | 179 |
| 130 | 3300005295 | Ga0065707_10174103 | Ga0065707_101741032 | 179 |
| 131 | 3300005295 | Ga0065707_10432960 | Ga0065707_104329601 | 179 |
| 132 | 3300005327 | Ga0070658_10873019 | Ga0070658_108730191 | 179 |
| 133 | 3300005328 | Ga0070676_10140118 | Ga0070676_101401183 | 179 |
| 134 | 3300005328 | Ga0070676_10148617 | Ga0070676_101486173 | 179 |
| 135 | 3300005329 | Ga0070683_100038614 | Ga0070683_1000386144 | 179 |
| 136 | 3300005329 | Ga0070683_100133601 | Ga0070683_1001336013 | 179 |
| 137 | 3300005329 | Ga0070683_100223074 | Ga0070683_1002230742 | 179 |
| 138 | 3300005330 | Ga0070690_100001531 | Ga0070690_1000015315 | 179 |
| 139 | 3300005330 | Ga0070690_100001718 | Ga0070690_1000017186 | 179 |
| 140 | 3300005330 | Ga0070690_100062600 | Ga0070690_1000626003 | 179 |
| 141 | 3300005330 | Ga0070690_100413850 | Ga0070690_1004138502 | 179 |
| 142 | 3300005331 | Ga0070670_100116676 | Ga0070670_1001166762 | 179 |
| 143 | 3300005331 | Ga0070670_100127799 | Ga0070670_1001277993 | 179 |
| 144 | 3300005331 | Ga0070670_100364276 | Ga0070670_1003642761 | 179 |
| 145 | 3300005333 | Ga0070677_10175027 | Ga0070677_101750271 | 179 |
| 146 | 3300005334 | Ga0068869_100003998 | Ga0068869_1000039985 | 179 |
| 147 | 3300005334 | Ga0068869_100029761 | Ga0068869_1000297615 | 179 |
| 148 | 3300005334 | Ga0068869_100084730 | Ga0068869_1000847303 | 179 |
| 149 | 3300005334 | Ga0068869_101356181 | Ga0068869_1013561811 | 179 |
| 150 | 3300005335 | Ga0070666_10004699 | Ga0070666_100046993 | 179 |
| 151 | 3300005335 | Ga0070666_10013206 | Ga0070666_100132066 | 179 |
| 152 | 3300005335 | Ga0070666_10055545 | Ga0070666_100555453 | 179 |
| 153 | 3300005336 | Ga0070680_100009202 | Ga0070680_1000092025 | 179 |
| 154 | 3300005336 | Ga0070680_100018985 | Ga0070680_1000189856 | 179 |
| 155 | 3300005336 | Ga0070680_100075132 | Ga0070680_1000751323 | 179 |
| 156 | 3300005336 | Ga0070680_100110853 | Ga0070680_1001108531 | 179 |
| 157 | 3300005336 | Ga0070680_100129541 | Ga0070680_1001295413 | 179 |
| 158 | 3300005336 | Ga0070680_100140105 | Ga0070680_1001401051 | 179 |
| 159 | 3300005336 | Ga0070680_100276503 | Ga0070680_1002765032 | 179 |
| 160 | 3300005336 | Ga0070680_100390122 | Ga0070680_1003901222 | 179 |
| 161 | 3300005336 | Ga0070680_100429129 | Ga0070680_1004291291 | 179 |
| 162 | 3300005337 | Ga0070682_100005572 | Ga0070682_1000055722 | 179 |
| 163 | 3300005337 | Ga0070682_100030755 | Ga0070682_1000307552 | 179 |
| 164 | 3300005337 | Ga0070682_100252677 | Ga0070682_1002526771 | 179 |
| 165 | 3300005337 | Ga0070682_101014679 | Ga0070682_1010146791 | 179 |
| 166 | 3300005338 | Ga0068868_100008181 | Ga0068868_1000081818 | 179 |
| 167 | 3300005338 | Ga0068868_100135724 | Ga0068868_1001357242 | 179 |
| 168 | 3300005339 | Ga0070660_100406918 | Ga0070660_1004069182 | 179 |
| 169 | 3300005340 | Ga0070689_100003814 | Ga0070689_1000038145 | 179 |
| 170 | 3300005340 | Ga0070689_100119758 | Ga0070689_1001197583 | 179 |
| 171 | 3300005340 | Ga0070689_100188925 | Ga0070689_1001889252 | 179 |
| 172 | 3300005340 | Ga0070689_100748014 | Ga0070689_1007480141 | 179 |
| 173 | 3300005341 | Ga0070691_10031657 | Ga0070691_100316572 | 179 |
| 174 | 3300005341 | Ga0070691_10234599 | Ga0070691_102345992 | 179 |
| 175 | 3300005343 | Ga0070687_100002571 | Ga0070687_1000025719 | 179 |
| 176 | 3300005343 | Ga0070687_100195228 | Ga0070687_1001952282 | 179 |
| 177 | 3300005344 | Ga0070661_100002493 | Ga0070661_10000249312 | 179 |
| 178 | 3300005344 | Ga0070661_100165759 | Ga0070661_1001657591 | 179 |
| 179 | 3300005345 | Ga0070692_10019677 | Ga0070692_100196774 | 179 |
| 180 | 3300005345 | Ga0070692_10027265 | Ga0070692_100272655 | 179 |
| 181 | 3300005347 | Ga0070668_100053464 | Ga0070668_1000534642 | 179 |
| 182 | 3300005347 | Ga0070668_100092499 | Ga0070668_1000924994 | 179 |
| 183 | 3300005353 | Ga0070669_100024257 | Ga0070669_1000242572 | 179 |
| 184 | 3300005353 | Ga0070669_100053235 | Ga0070669_1000532354 | 179 |
| 185 | 3300005353 | Ga0070669_100273498 | Ga0070669_1002734982 | 179 |
| 186 | 3300005353 | Ga0070669_100494667 | Ga0070669_1004946672 | 179 |
| 187 | 3300005353 | Ga0070669_100834761 | Ga0070669_1008347611 | 179 |
| 188 | 3300005353 | Ga0070669_100865487 | Ga0070669_1008654871 | 179 |
| 189 | 3300005354 | Ga0070675_100010921 | Ga0070675_1000109215 | 179 |
| 190 | 3300005354 | Ga0070675_100011633 | Ga0070675_1000116332 | 179 |
| 191 | 3300005354 | Ga0070675_100278063 | Ga0070675_1002780632 | 179 |
| 192 | 3300005354 | Ga0070675_100301190 | Ga0070675_1003011902 | 179 |
| 193 | 3300005355 | Ga0070671_100005633 | Ga0070671_1000056332 | 179 |
| 194 | 3300005355 | Ga0070671_100009823 | Ga0070671_1000098235 | 179 |
| 195 | 3300005355 | Ga0070671_100027320 | Ga0070671_1000273203 | 179 |
| 196 | 3300005355 | Ga0070671_100085042 | Ga0070671_1000850421 | 179 |
| 197 | 3300005355 | Ga0070671_100158214 | Ga0070671_1001582142 | 179 |
| 198 | 3300005355 | Ga0070671_100460060 | Ga0070671_1004600601 | 179 |
| 199 | 3300005356 | Ga0070674_100039351 | Ga0070674_1000393512 | 179 |
| 200 | 3300005356 | Ga0070674_100045974 | Ga0070674_1000459744 | 179 |
| 201 | 3300005356 | Ga0070674_100129468 | Ga0070674_1001294682 | 179 |
| 202 | 3300005356 | Ga0070674_100497617 | Ga0070674_1004976172 | 179 |
| 203 | 3300005356 | Ga0070674_100721984 | Ga0070674_1007219841 | 179 |
| 204 | 3300005364 | Ga0070673_100021060 | Ga0070673_1000210602 | 179 |
| 205 | 3300005364 | Ga0070673_100024898 | Ga0070673_1000248983 | 179 |
| 206 | 3300005364 | Ga0070673_100044903 | Ga0070673_1000449033 | 179 |
| 207 | 3300005364 | Ga0070673_100371438 | Ga0070673_1003714382 | 179 |
| 208 | 3300005365 | Ga0070688_100001922 | Ga0070688_1000019228 | 179 |
| 209 | 3300005365 | Ga0070688_100098823 | Ga0070688_1000988231 | 179 |
| 210 | 3300005365 | Ga0070688_100234486 | Ga0070688_1002344862 | 179 |
| 211 | 3300005365 | Ga0070688_100373797 | Ga0070688_1003737972 | 179 |
| 212 | 3300005365 | Ga0070688_100484889 | Ga0070688_1004848891 | 179 |
| 213 | 3300005366 | Ga0070659_100161443 | Ga0070659_1001614432 | 179 |
| 214 | 3300005366 | Ga0070659_100300740 | Ga0070659_1003007401 | 179 |
| 215 | 3300005367 | Ga0070667_100000011 | Ga0070667_100000011200 | 179 |
| 216 | 3300005367 | Ga0070667_100029415 | Ga0070667_1000294153 | 179 |
| 217 | 3300005367 | Ga0070667_100066033 | Ga0070667_1000660332 | 179 |
| 218 | 3300005367 | Ga0070667_100413023 | Ga0070667_1004130232 | 179 |
| 219 | 3300005367 | Ga0070667_100584150 | Ga0070667_1005841502 | 179 |
| 220 | 3300005367 | Ga0070667_100707215 | Ga0070667_1007072151 | 179 |
| 221 | 3300005434 | Ga0070709_10008243 | Ga0070709_100082433 | 179 |
| 222 | 3300005434 | Ga0070709_10037581 | Ga0070709_100375813 | 179 |
| 223 | 3300005434 | Ga0070709_10599611 | Ga0070709_105996112 | 179 |
| 224 | 3300005435 | Ga0070714_100005056 | Ga0070714_1000050566 | 179 |
| 225 | 3300005436 | Ga0070713_100015790 | Ga0070713_1000157902 | 179 |
| 226 | 3300005436 | Ga0070713_100112789 | Ga0070713_1001127894 | 179 |
| 227 | 3300005436 | Ga0070713_100117990 | Ga0070713_1001179901 | 179 |
| 228 | 3300005436 | Ga0070713_100137932 | Ga0070713_1001379322 | 179 |
| 229 | 3300005437 | Ga0070710_10052096 | Ga0070710_100520962 | 179 |
| 230 | 3300005437 | Ga0070710_10254036 | Ga0070710_102540362 | 179 |
| 231 | 3300005438 | Ga0070701_10052866 | Ga0070701_100528662 | 179 |
| 232 | 3300005438 | Ga0070701_10539132 | Ga0070701_105391321 | 179 |
| 233 | 3300005439 | Ga0070711_100175658 | Ga0070711_1001756582 | 179 |
| 234 | 3300005439 | Ga0070711_101472529 | Ga0070711_1014725291 | 179 |
| 235 | 3300005440 | Ga0070705_100060432 | Ga0070705_1000604323 | 179 |
| 236 | 3300005441 | Ga0070700_100013887 | Ga0070700_1000138875 | 179 |
| 237 | 3300005441 | Ga0070700_100014864 | Ga0070700_1000148644 | 179 |
| 238 | 3300005441 | Ga0070700_100062509 | Ga0070700_1000625092 | 179 |
| 239 | 3300005441 | Ga0070700_100130090 | Ga0070700_1001300902 | 179 |
| 240 | 3300005441 | Ga0070700_100130486 | Ga0070700_1001304862 | 179 |
| 241 | 3300005445 | Ga0070708_100659527 | Ga0070708_1006595272 | 179 |
| 242 | 3300005455 | Ga0070663_100144080 | Ga0070663_1001440802 | 179 |
| 243 | 3300005456 | Ga0070678_100007254 | Ga0070678_1000072546 | 179 |
| 244 | 3300005456 | Ga0070678_100016401 | Ga0070678_1000164017 | 179 |
| 245 | 3300005456 | Ga0070678_100105706 | Ga0070678_1001057062 | 179 |
| 246 | 3300005456 | Ga0070678_100240690 | Ga0070678_1002406903 | 179 |
| 247 | 3300005457 | Ga0070662_100018507 | Ga0070662_1000185074 | 179 |
| 248 | 3300005457 | Ga0070662_100237739 | Ga0070662_1002377392 | 179 |
| 249 | 3300005458 | Ga0070681_10003202 | Ga0070681_1000320212 | 179 |
| 250 | 3300005458 | Ga0070681_10018495 | Ga0070681_100184953 | 179 |
| 251 | 3300005458 | Ga0070681_10034684 | Ga0070681_100346845 | 179 |
| 252 | 3300005458 | Ga0070681_10050700 | Ga0070681_100507002 | 179 |
| 253 | 3300005458 | Ga0070681_10057069 | Ga0070681_100570695 | 179 |
| 254 | 3300005458 | Ga0070681_10135263 | Ga0070681_101352633 | 179 |
| 255 | 3300005458 | Ga0070681_10410600 | Ga0070681_104106002 | 179 |
| 256 | 3300005459 | Ga0068867_100356474 | Ga0068867_1003564742 | 179 |
| 257 | 3300005459 | Ga0068867_100561019 | Ga0068867_1005610192 | 179 |
| 258 | 3300005459 | Ga0068867_100601595 | Ga0068867_1006015952 | 179 |
| 259 | 3300005459 | Ga0068867_100692053 | Ga0068867_1006920531 | 179 |
| 260 | 3300005459 | Ga0068867_100989373 | Ga0068867_1009893731 | 179 |
| 261 | 3300005468 | Ga0070707_100166622 | Ga0070707_1001666223 | 179 |
| 262 | 3300005471 | Ga0070698_100003450 | Ga0070698_1000034502 | 179 |
| 263 | 3300005518 | Ga0070699_100385215 | Ga0070699_1003852152 | 179 |
| 264 | 3300005518 | Ga0070699_101308213 | Ga0070699_1013082131 | 179 |
| 265 | 3300005530 | Ga0070679_100029331 | Ga0070679_1000293313 | 179 |
| 266 | 3300005530 | Ga0070679_100120363 | Ga0070679_1001203633 | 179 |
| 267 | 3300005530 | Ga0070679_100121897 | Ga0070679_1001218974 | 179 |
| 268 | 3300005530 | Ga0070679_100135159 | Ga0070679_1001351593 | 179 |
| 269 | 3300005530 | Ga0070679_100458302 | Ga0070679_1004583022 | 179 |
| 270 | 3300005530 | Ga0070679_100848135 | Ga0070679_1008481351 | 179 |
| 271 | 3300005530 | Ga0070679_101126297 | Ga0070679_1011262971 | 179 |
| 272 | 3300005535 | Ga0070684_100002573 | Ga0070684_10000257313 | 179 |
| 273 | 3300005535 | Ga0070684_100040392 | Ga0070684_1000403923 | 179 |
| 274 | 3300005535 | Ga0070684_100605533 | Ga0070684_1006055331 | 179 |
| 275 | 3300005535 | Ga0070684_101050360 | Ga0070684_1010503602 | 179 |
| 276 | 3300005539 | Ga0068853_100849591 | Ga0068853_1008495912 | 179 |
| 277 | 3300005539 | Ga0068853_100921835 | Ga0068853_1009218351 | 179 |
| 278 | 3300005539 | Ga0068853_100932233 | Ga0068853_1009322331 | 179 |
| 279 | 3300005539 | Ga0068853_101042865 | Ga0068853_1010428651 | 179 |
| 280 | 3300005543 | Ga0070672_100018046 | Ga0070672_1000180465 | 179 |
| 281 | 3300005543 | Ga0070672_100057039 | Ga0070672_1000570393 | 179 |
| 282 | 3300005543 | Ga0070672_100231671 | Ga0070672_1002316712 | 179 |
| 283 | 3300005543 | Ga0070672_100232701 | Ga0070672_1002327012 | 179 |
| 284 | 3300005543 | Ga0070672_100253443 | Ga0070672_1002534431 | 179 |
| 285 | 3300005543 | Ga0070672_100813064 | Ga0070672_1008130641 | 179 |
| 286 | 3300005543 | Ga0070672_101346824 | Ga0070672_1013468241 | 179 |
| 287 | 3300005544 | Ga0070686_100003317 | Ga0070686_1000033176 | 179 |
| 288 | 3300005544 | Ga0070686_100036607 | Ga0070686_1000366075 | 179 |
| 289 | 3300005544 | Ga0070686_100090483 | Ga0070686_1000904832 | 179 |
| 290 | 3300005544 | Ga0070686_100250400 | Ga0070686_1002504002 | 179 |
| 291 | 3300005544 | Ga0070686_100377995 | Ga0070686_1003779951 | 179 |
| 292 | 3300005544 | Ga0070686_100775245 | Ga0070686_1007752452 | 179 |
| 293 | 3300005544 | Ga0070686_101156942 | Ga0070686_1011569421 | 179 |
| 294 | 3300005545 | Ga0070695_100634540 | Ga0070695_1006345401 | 179 |
| 295 | 3300005546 | Ga0070696_100090533 | Ga0070696_1000905332 | 179 |
| 296 | 3300005546 | Ga0070696_100250139 | Ga0070696_1002501392 | 179 |
| 297 | 3300005547 | Ga0070693_100244942 | Ga0070693_1002449422 | 179 |
| 298 | 3300005547 | Ga0070693_100580284 | Ga0070693_1005802841 | 179 |
| 299 | 3300005548 | Ga0070665_100001687 | Ga0070665_1000016875 | 179 |
| 300 | 3300005548 | Ga0070665_100002827 | Ga0070665_10000282710 | 179 |
| 301 | 3300005548 | Ga0070665_100094327 | Ga0070665_1000943274 | 179 |
| 302 | 3300005548 | Ga0070665_100109779 | Ga0070665_1001097794 | 179 |
| 303 | 3300005548 | Ga0070665_100121768 | Ga0070665_1001217682 | 179 |
| 304 | 3300005548 | Ga0070665_100146654 | Ga0070665_1001466545 | 179 |
| 305 | 3300005548 | Ga0070665_100157767 | Ga0070665_1001577673 | 179 |
| 306 | 3300005548 | Ga0070665_100318697 | Ga0070665_1003186973 | 179 |
| 307 | 3300005549 | Ga0070704_100028868 | Ga0070704_1000288684 | 179 |
| 308 | 3300005563 | Ga0068855_100009392 | Ga0068855_1000093924 | 179 |
| 309 | 3300005563 | Ga0068855_100010992 | Ga0068855_1000109922 | 179 |
| 310 | 3300005563 | Ga0068855_100035062 | Ga0068855_1000350621 | 179 |
| 311 | 3300005563 | Ga0068855_100050765 | Ga0068855_1000507655 | 179 |
| 312 | 3300005563 | Ga0068855_100072666 | Ga0068855_1000726664 | 179 |
| 313 | 3300005563 | Ga0068855_100232277 | Ga0068855_1002322773 | 179 |
| 314 | 3300005564 | Ga0070664_100001025 | Ga0070664_10000102519 | 179 |
| 315 | 3300005564 | Ga0070664_100081493 | Ga0070664_1000814932 | 179 |
| 316 | 3300005564 | Ga0070664_100111372 | Ga0070664_1001113723 | 179 |
| 317 | 3300005564 | Ga0070664_100463335 | Ga0070664_1004633352 | 179 |
| 318 | 3300005564 | Ga0070664_100486902 | Ga0070664_1004869022 | 179 |
| 319 | 3300005564 | Ga0070664_100507834 | Ga0070664_1005078342 | 179 |
| 320 | 3300005577 | Ga0068857_100040769 | Ga0068857_1000407693 | 179 |
| 321 | 3300005577 | Ga0068857_100043190 | Ga0068857_1000431906 | 179 |
| 322 | 3300005577 | Ga0068857_100159520 | Ga0068857_1001595202 | 179 |
| 323 | 3300005577 | Ga0068857_100446228 | Ga0068857_1004462282 | 179 |
| 324 | 3300005577 | Ga0068857_100592291 | Ga0068857_1005922912 | 179 |
| 325 | 3300005578 | Ga0068854_100053452 | Ga0068854_1000534523 | 179 |
| 326 | 3300005578 | Ga0068854_100288862 | Ga0068854_1002888622 | 179 |
| 327 | 3300005578 | Ga0068854_100431501 | Ga0068854_1004315011 | 179 |
| 328 | 3300005578 | Ga0068854_100538253 | Ga0068854_1005382531 | 179 |
| 329 | 3300005614 | Ga0068856_100020206 | Ga0068856_1000202064 | 179 |
| 330 | 3300005614 | Ga0068856_100041061 | Ga0068856_1000410611 | 179 |
| 331 | 3300005614 | Ga0068856_100075876 | Ga0068856_1000758763 | 179 |
| 332 | 3300005614 | Ga0068856_100104583 | Ga0068856_1001045832 | 179 |
| 333 | 3300005616 | Ga0068852_100100858 | Ga0068852_1001008585 | 179 |
| 334 | 3300005616 | Ga0068852_101190394 | Ga0068852_1011903942 | 179 |
| 335 | 3300005617 | Ga0068859_100000715 | Ga0068859_10000071524 | 179 |
| 336 | 3300005617 | Ga0068859_100016276 | Ga0068859_1000162766 | 179 |
| 337 | 3300005617 | Ga0068859_100024730 | Ga0068859_1000247303 | 179 |
| 338 | 3300005617 | Ga0068859_100086680 | Ga0068859_1000866806 | 179 |
| 339 | 3300005617 | Ga0068859_100107183 | Ga0068859_1001071835 | 179 |
| 340 | 3300005617 | Ga0068859_100339583 | Ga0068859_1003395832 | 179 |
| 341 | 3300005617 | Ga0068859_100411252 | Ga0068859_1004112522 | 179 |
| 342 | 3300005617 | Ga0068859_100638488 | Ga0068859_1006384882 | 179 |
| 343 | 3300005617 | Ga0068859_100779843 | Ga0068859_1007798431 | 179 |
| 344 | 3300005617 | Ga0068859_101135195 | Ga0068859_1011351951 | 179 |
| 345 | 3300005618 | Ga0068864_100005754 | Ga0068864_1000057542 | 179 |
| 346 | 3300005618 | Ga0068864_100016171 | Ga0068864_1000161713 | 179 |
| 347 | 3300005618 | Ga0068864_100175244 | Ga0068864_1001752442 | 179 |
| 348 | 3300005618 | Ga0068864_100219989 | Ga0068864_1002199892 | 179 |
| 349 | 3300005618 | Ga0068864_101638907 | Ga0068864_1016389071 | 179 |
| 350 | 3300005718 | Ga0068866_10004184 | Ga0068866_100041845 | 179 |
| 351 | 3300005718 | Ga0068866_10351346 | Ga0068866_103513461 | 179 |
| 352 | 3300005718 | Ga0068866_10785035 | Ga0068866_107850351 | 179 |
| 353 | 3300005719 | Ga0068861_100013223 | Ga0068861_1000132233 | 179 |
| 354 | 3300005719 | Ga0068861_100021947 | Ga0068861_1000219473 | 179 |
| 355 | 3300005719 | Ga0068861_100086189 | Ga0068861_1000861892 | 179 |
| 356 | 3300005719 | Ga0068861_100090868 | Ga0068861_1000908684 | 179 |
| 357 | 3300005719 | Ga0068861_100124813 | Ga0068861_1001248133 | 179 |
| 358 | 3300005719 | Ga0068861_100154175 | Ga0068861_1001541753 | 179 |
| 359 | 3300005719 | Ga0068861_100608226 | Ga0068861_1006082262 | 179 |
| 360 | 3300005719 | Ga0068861_101333808 | Ga0068861_1013338081 | 179 |
| 361 | 3300005840 | Ga0068870_10003073 | Ga0068870_100030735 | 179 |
| 362 | 3300005840 | Ga0068870_10013288 | Ga0068870_100132885 | 179 |
| 363 | 3300005840 | Ga0068870_10064795 | Ga0068870_100647953 | 179 |
| 364 | 3300005840 | Ga0068870_10322056 | Ga0068870_103220561 | 179 |
| 365 | 3300005841 | Ga0068863_100002979 | Ga0068863_1000029796 | 179 |
| 366 | 3300005841 | Ga0068863_100005241 | Ga0068863_1000052413 | 179 |
| 367 | 3300005841 | Ga0068863_100009569 | Ga0068863_1000095699 | 179 |
| 368 | 3300005841 | Ga0068863_100072398 | Ga0068863_1000723981 | 179 |
| 369 | 3300005841 | Ga0068863_100379148 | Ga0068863_1003791482 | 179 |
| 370 | 3300005841 | Ga0068863_100696262 | Ga0068863_1006962622 | 179 |
| 371 | 3300005841 | Ga0068863_100804324 | Ga0068863_1008043241 | 179 |
| 372 | 3300005841 | Ga0068863_100848960 | Ga0068863_1008489602 | 179 |
| 373 | 3300005842 | Ga0068858_100005002 | Ga0068858_10000500213 | 179 |
| 374 | 3300005842 | Ga0068858_100012054 | Ga0068858_1000120546 | 179 |
| 375 | 3300005842 | Ga0068858_100014520 | Ga0068858_1000145203 | 179 |
| 376 | 3300005842 | Ga0068858_100061049 | Ga0068858_1000610491 | 179 |
| 377 | 3300005842 | Ga0068858_100174328 | Ga0068858_1001743282 | 179 |
| 378 | 3300005842 | Ga0068858_100551473 | Ga0068858_1005514731 | 179 |
| 379 | 3300005843 | Ga0068860_100003286 | Ga0068860_1000032864 | 179 |
| 380 | 3300005843 | Ga0068860_100024072 | Ga0068860_1000240728 | 179 |
| 381 | 3300005843 | Ga0068860_100064892 | Ga0068860_1000648924 | 179 |
| 382 | 3300005843 | Ga0068860_100065361 | Ga0068860_1000653612 | 179 |
| 383 | 3300005843 | Ga0068860_100108788 | Ga0068860_1001087884 | 179 |
| 384 | 3300005843 | Ga0068860_100146073 | Ga0068860_1001460734 | 179 |
| 385 | 3300005844 | Ga0068862_100001470 | Ga0068862_1000014708 | 179 |
| 386 | 3300005844 | Ga0068862_100002059 | Ga0068862_1000020596 | 179 |
| 387 | 3300005844 | Ga0068862_100004086 | Ga0068862_10000408611 | 179 |
| 388 | 3300005844 | Ga0068862_100058178 | Ga0068862_1000581781 | 179 |
| 389 | 3300005844 | Ga0068862_100200402 | Ga0068862_1002004022 | 179 |
| 390 | 3300005844 | Ga0068862_100875473 | Ga0068862_1008754732 | 179 |
| 391 | 3300005844 | Ga0068862_100962035 | Ga0068862_1009620351 | 179 |
| 392 | 3300005844 | Ga0068862_101255489 | Ga0068862_1012554892 | 179 |
| 393 | 3300005844 | Ga0068862_101782262 | Ga0068862_1017822621 | 179 |
| 394 | 3300005937 | Ga0081455_10001012 | Ga0081455_1000101217 | 179 |
| 395 | 3300005937 | Ga0081455_10057666 | Ga0081455_100576664 | 179 |
| 396 | 3300005937 | Ga0081455_10600666 | Ga0081455_106006662 | 179 |
| 397 | 3300005985 | Ga0081539_10000055 | Ga0081539_1000005510 | 179 |
| 398 | 3300005985 | Ga0081539_10004424 | Ga0081539_100044243 | 179 |
| 399 | 3300005985 | Ga0081539_10005465 | Ga0081539_100054656 | 179 |
| 400 | 3300006028 | Ga0070717_11153218 | Ga0070717_111532182 | 179 |
| 401 | 3300006038 | Ga0075365_10204243 | Ga0075365_102042433 | 179 |
| 402 | 3300006163 | Ga0070715_10316173 | Ga0070715_103161732 | 179 |
| 403 | 3300006173 | Ga0070716_100002584 | Ga0070716_1000025847 | 179 |
| 404 | 3300006173 | Ga0070716_100006429 | Ga0070716_1000064296 | 179 |
| 405 | 3300006173 | Ga0070716_100053175 | Ga0070716_1000531752 | 179 |
| 406 | 3300006173 | Ga0070716_100266822 | Ga0070716_1002668222 | 179 |
| 407 | 3300006175 | Ga0070712_100001982 | Ga0070712_1000019829 | 179 |
| 408 | 3300006175 | Ga0070712_100032042 | Ga0070712_1000320421 | 179 |
| 409 | 3300006175 | Ga0070712_100146152 | Ga0070712_1001461521 | 179 |
| 410 | 3300006195 | Ga0075366_10144311 | Ga0075366_101443111 | 179 |
| 411 | 3300006195 | Ga0075366_10435087 | Ga0075366_104350871 | 179 |
| 412 | 3300006237 | Ga0097621_100004031 | Ga0097621_1000040318 | 179 |
| 413 | 3300006237 | Ga0097621_100004662 | Ga0097621_1000046626 | 179 |
| 414 | 3300006237 | Ga0097621_100075288 | Ga0097621_1000752884 | 179 |
| 415 | 3300006237 | Ga0097621_100096165 | Ga0097621_1000961652 | 179 |
| 416 | 3300006237 | Ga0097621_100131167 | Ga0097621_1001311671 | 179 |
| 417 | 3300006237 | Ga0097621_100171335 | Ga0097621_1001713353 | 179 |
| 418 | 3300006237 | Ga0097621_100207521 | Ga0097621_1002075212 | 179 |
| 419 | 3300006237 | Ga0097621_100210662 | Ga0097621_1002106622 | 179 |
| 420 | 3300006237 | Ga0097621_100251778 | Ga0097621_1002517782 | 179 |
| 421 | 3300006237 | Ga0097621_100416746 | Ga0097621_1004167462 | 179 |
| 422 | 3300006358 | Ga0068871_100015582 | Ga0068871_1000155825 | 179 |
| 423 | 3300006358 | Ga0068871_100017404 | Ga0068871_1000174043 | 179 |
| 424 | 3300006358 | Ga0068871_100082487 | Ga0068871_1000824872 | 179 |
| 425 | 3300006358 | Ga0068871_100097128 | Ga0068871_1000971281 | 179 |
| 426 | 3300006358 | Ga0068871_100254001 | Ga0068871_1002540013 | 179 |
| 427 | 3300006358 | Ga0068871_100342520 | Ga0068871_1003425202 | 179 |
| 428 | 3300006358 | Ga0068871_100359803 | Ga0068871_1003598031 | 179 |
| 429 | 3300006358 | Ga0068871_100383971 | Ga0068871_1003839712 | 179 |
| 430 | 3300006358 | Ga0068871_100437282 | Ga0068871_1004372821 | 179 |
| 431 | 3300006358 | Ga0068871_101339547 | Ga0068871_1013395471 | 179 |
| 432 | 3300006844 | Ga0075428_100000991 | Ga0075428_10000099120 | 179 |
| 433 | 3300006844 | Ga0075428_100004128 | Ga0075428_1000041288 | 179 |
| 434 | 3300006844 | Ga0075428_100006037 | Ga0075428_10000603716 | 179 |
| 435 | 3300006846 | Ga0075430_100001603 | Ga0075430_10000160310 | 179 |
| 436 | 3300006846 | Ga0075430_100026158 | Ga0075430_1000261587 | 179 |
| 437 | 3300006846 | Ga0075430_100399433 | Ga0075430_1003994332 | 179 |
| 438 | 3300006846 | Ga0075430_100682693 | Ga0075430_1006826931 | 179 |
| 439 | 3300006847 | Ga0075431_100002145 | Ga0075431_10000214512 | 179 |
| 440 | 3300006847 | Ga0075431_100005153 | Ga0075431_1000051536 | 179 |
| 441 | 3300006847 | Ga0075431_100010663 | Ga0075431_1000106635 | 179 |
| 442 | 3300006847 | Ga0075431_100125160 | Ga0075431_1001251603 | 179 |
| 443 | 3300006852 | Ga0075433_10665798 | Ga0075433_106657981 | 179 |
| 444 | 3300006871 | Ga0075434_100350625 | Ga0075434_1003506252 | 179 |
| 445 | 3300006880 | Ga0075429_100000892 | Ga0075429_10000089210 | 179 |
| 446 | 3300006880 | Ga0075429_100004377 | Ga0075429_1000043774 | 179 |
| 447 | 3300006880 | Ga0075429_100208872 | Ga0075429_1002088722 | 179 |
| 448 | 3300006880 | Ga0075429_100376568 | Ga0075429_1003765682 | 179 |
| 449 | 3300006881 | Ga0068865_100011129 | Ga0068865_1000111295 | 179 |
| 450 | 3300006881 | Ga0068865_100041920 | Ga0068865_1000419201 | 179 |
| 451 | 3300006881 | Ga0068865_100151242 | Ga0068865_1001512422 | 179 |
| 452 | 3300006881 | Ga0068865_100227477 | Ga0068865_1002274771 | 179 |
| 453 | 3300006881 | Ga0068865_100275012 | Ga0068865_1002750122 | 179 |
| 454 | 3300006914 | Ga0075436_100070848 | Ga0075436_1000708483 | 179 |
| 455 | 3300006914 | Ga0075436_100490443 | Ga0075436_1004904432 | 179 |
| 456 | 3300006931 | Ga0097620_100000715 | Ga0097620_10000071524 | 179 |
| 457 | 3300006931 | Ga0097620_100016276 | Ga0097620_1000162766 | 179 |
| 458 | 3300006931 | Ga0097620_100024730 | Ga0097620_1000247303 | 179 |
| 459 | 3300006931 | Ga0097620_100086677 | Ga0097620_1000866776 | 179 |
| 460 | 3300006931 | Ga0097620_100107187 | Ga0097620_1001071875 | 179 |
| 461 | 3300006931 | Ga0097620_100339606 | Ga0097620_1003396062 | 179 |
| 462 | 3300006931 | Ga0097620_100411213 | Ga0097620_1004112132 | 179 |
| 463 | 3300006931 | Ga0097620_100638372 | Ga0097620_1006383722 | 179 |
| 464 | 3300006931 | Ga0097620_100780080 | Ga0097620_1007800801 | 179 |
| 465 | 3300006931 | Ga0097620_101135376 | Ga0097620_1011353761 | 179 |
| 466 | 3300006948 | Ga0099826_10018619 | Ga0099826_100186195 | 179 |
| 467 | 3300007076 | Ga0075435_100093833 | Ga0075435_1000938333 | 179 |
| 468 | 3300009092 | Ga0105250_10054875 | Ga0105250_100548752 | 179 |
| 469 | 3300009092 | Ga0105250_10087463 | Ga0105250_100874632 | 179 |
| 470 | 3300009093 | Ga0105240_10005273 | Ga0105240_1000527315 | 179 |
| 471 | 3300009093 | Ga0105240_10007059 | Ga0105240_100070597 | 179 |
| 472 | 3300009093 | Ga0105240_10007550 | Ga0105240_1000755011 | 179 |
| 473 | 3300009093 | Ga0105240_10024084 | Ga0105240_1002408410 | 179 |
| 474 | 3300009093 | Ga0105240_10030802 | Ga0105240_100308022 | 179 |
| 475 | 3300009093 | Ga0105240_10086562 | Ga0105240_100865624 | 179 |
| 476 | 3300009093 | Ga0105240_10110534 | Ga0105240_101105345 | 179 |
| 477 | 3300009093 | Ga0105240_10134635 | Ga0105240_101346353 | 179 |
| 478 | 3300009093 | Ga0105240_10238722 | Ga0105240_102387221 | 179 |
| 479 | 3300009093 | Ga0105240_10480810 | Ga0105240_104808101 | 179 |
| 480 | 3300009093 | Ga0105240_10546096 | Ga0105240_105460962 | 179 |
| 481 | 3300009093 | Ga0105240_10686700 | Ga0105240_106867002 | 179 |
| 482 | 3300009093 | Ga0105240_10843405 | Ga0105240_108434052 | 179 |
| 483 | 3300009094 | Ga0111539_10018383 | Ga0111539_100183839 | 179 |
| 484 | 3300009094 | Ga0111539_10101187 | Ga0111539_101011873 | 179 |
| 485 | 3300009094 | Ga0111539_10203540 | Ga0111539_102035404 | 179 |
| 486 | 3300009094 | Ga0111539_11420043 | Ga0111539_114200432 | 179 |
| 487 | 3300009094 | Ga0111539_11489965 | Ga0111539_114899651 | 179 |
| 488 | 3300009094 | Ga0111539_12179859 | Ga0111539_121798591 | 179 |
| 489 | 3300009098 | Ga0105245_10009918 | Ga0105245_100099188 | 179 |
| 490 | 3300009098 | Ga0105245_10037278 | Ga0105245_100372783 | 179 |
| 491 | 3300009098 | Ga0105245_10574927 | Ga0105245_105749272 | 179 |
| 492 | 3300009098 | Ga0105245_10815366 | Ga0105245_108153662 | 179 |
| 493 | 3300009101 | Ga0105247_10000557 | Ga0105247_100005578 | 179 |
| 494 | 3300009101 | Ga0105247_10006388 | Ga0105247_100063888 | 179 |
| 495 | 3300009101 | Ga0105247_10015442 | Ga0105247_100154425 | 179 |
| 496 | 3300009101 | Ga0105247_10030282 | Ga0105247_100302825 | 179 |
| 497 | 3300009147 | Ga0114129_10000531 | Ga0114129_1000053110 | 179 |
| 498 | 3300009148 | Ga0105243_10093409 | Ga0105243_100934092 | 179 |
| 499 | 3300009174 | Ga0105241_10024074 | Ga0105241_100240742 | 179 |
| 500 | 3300009174 | Ga0105241_10321408 | Ga0105241_103214082 | 179 |
| 501 | 3300009174 | Ga0105241_10460378 | Ga0105241_104603782 | 179 |
| 502 | 3300009174 | Ga0105241_11270332 | Ga0105241_112703321 | 179 |
| 503 | 3300009176 | Ga0105242_10000894 | Ga0105242_1000089417 | 179 |
| 504 | 3300009176 | Ga0105242_10064423 | Ga0105242_100644231 | 179 |
| 505 | 3300009176 | Ga0105242_10248244 | Ga0105242_102482442 | 179 |
| 506 | 3300009176 | Ga0105242_11105889 | Ga0105242_111058892 | 179 |
| 507 | 3300009177 | Ga0105248_10009456 | Ga0105248_100094567 | 179 |
| 508 | 3300009177 | Ga0105248_10012607 | Ga0105248_100126074 | 179 |
| 509 | 3300009177 | Ga0105248_10013134 | Ga0105248_100131345 | 179 |
| 510 | 3300009177 | Ga0105248_10141359 | Ga0105248_101413592 | 179 |
| 511 | 3300009177 | Ga0105248_10325348 | Ga0105248_103253482 | 179 |
| 512 | 3300009177 | Ga0105248_10382087 | Ga0105248_103820873 | 179 |
| 513 | 3300009177 | Ga0105248_10674855 | Ga0105248_106748552 | 179 |
| 514 | 3300009177 | Ga0105248_10678850 | Ga0105248_106788501 | 179 |
| 515 | 3300009545 | Ga0105237_10009386 | Ga0105237_100093862 | 179 |
| 516 | 3300009545 | Ga0105237_10018532 | Ga0105237_100185328 | 179 |
| 517 | 3300009545 | Ga0105237_10183150 | Ga0105237_101831503 | 179 |
| 518 | 3300009545 | Ga0105237_10560306 | Ga0105237_105603061 | 179 |
| 519 | 3300009551 | Ga0105238_10004856 | Ga0105238_100048567 | 179 |
| 520 | 3300009551 | Ga0105238_10010977 | Ga0105238_100109778 | 179 |
| 521 | 3300009551 | Ga0105238_10028530 | Ga0105238_100285305 | 179 |
| 522 | 3300009551 | Ga0105238_10058638 | Ga0105238_100586383 | 179 |
| 523 | 3300009551 | Ga0105238_10100214 | Ga0105238_101002142 | 179 |
| 524 | 3300009551 | Ga0105238_10139985 | Ga0105238_101399853 | 179 |
| 525 | 3300009551 | Ga0105238_10294035 | Ga0105238_102940352 | 179 |
| 526 | 3300009551 | Ga0105238_10316126 | Ga0105238_103161262 | 179 |
| 527 | 3300009551 | Ga0105238_10399888 | Ga0105238_103998882 | 179 |
| 528 | 3300009553 | Ga0105249_10005395 | Ga0105249_100053955 | 179 |
| 529 | 3300009553 | Ga0105249_10016314 | Ga0105249_100163148 | 179 |
| 530 | 3300009553 | Ga0105249_10125676 | Ga0105249_101256763 | 179 |
| 531 | 3300009553 | Ga0105249_10288378 | Ga0105249_102883782 | 179 |
| 532 | 3300009553 | Ga0105249_10508058 | Ga0105249_105080582 | 179 |
| 533 | 3300009553 | Ga0105249_11443842 | Ga0105249_114438421 | 179 |
| 534 | 3300009987 | Ga0105030_102515 | Ga0105030_1025151 | 179 |
| 535 | 3300010375 | Ga0105239_10013750 | Ga0105239_100137504 | 179 |
| 536 | 3300010375 | Ga0105239_10016193 | Ga0105239_100161935 | 179 |
| 537 | 3300010375 | Ga0105239_10027633 | Ga0105239_100276332 | 179 |
| 538 | 3300010375 | Ga0105239_11058539 | Ga0105239_110585391 | 179 |
| 539 | 3300011119 | Ga0105246_10189467 | Ga0105246_101894672 | 179 |
| 540 | 3300011119 | Ga0105246_10392668 | Ga0105246_103926683 | 179 |
| 541 | 3300011119 | Ga0105246_10804113 | Ga0105246_108041132 | 179 |
| 542 | 3300011119 | Ga0105246_11376354 | Ga0105246_113763541 | 179 |
| 543 | 3300013104 | Ga0157370_10022372 | Ga0157370_100223722 | 179 |
| 544 | 3300013105 | Ga0157369_10011861 | Ga0157369_100118614 | 179 |
| 545 | 3300013105 | Ga0157369_10031473 | Ga0157369_100314733 | 179 |
| 546 | 3300013105 | Ga0157369_10040019 | Ga0157369_100400194 | 179 |
| 547 | 3300013105 | Ga0157369_10472630 | Ga0157369_104726302 | 179 |
| 548 | 3300013105 | Ga0157369_10493345 | Ga0157369_104933452 | 179 |
| 549 | 3300013105 | Ga0157369_11268421 | Ga0157369_112684211 | 179 |
| 550 | 3300013296 | Ga0157374_10013136 | Ga0157374_100131367 | 179 |
| 551 | 3300013296 | Ga0157374_10074346 | Ga0157374_100743463 | 179 |
| 552 | 3300013296 | Ga0157374_10101969 | Ga0157374_101019692 | 179 |
| 553 | 3300013296 | Ga0157374_10142442 | Ga0157374_101424422 | 179 |
| 554 | 3300013296 | Ga0157374_10411530 | Ga0157374_104115302 | 179 |
| 555 | 3300013296 | Ga0157374_10510983 | Ga0157374_105109831 | 179 |
| 556 | 3300013296 | Ga0157374_10560903 | Ga0157374_105609032 | 179 |
| 557 | 3300013296 | Ga0157374_11495737 | Ga0157374_114957371 | 179 |
| 558 | 3300013297 | Ga0157378_10166673 | Ga0157378_101666733 | 179 |
| 559 | 3300013297 | Ga0157378_10430930 | Ga0157378_104309301 | 179 |
| 560 | 3300013297 | Ga0157378_10604741 | Ga0157378_106047412 | 179 |
| 561 | 3300013297 | Ga0157378_10732017 | Ga0157378_107320172 | 179 |
| 562 | 3300013297 | Ga0157378_10732359 | Ga0157378_107323592 | 179 |
| 563 | 3300013297 | Ga0157378_10874950 | Ga0157378_108749502 | 179 |
| 564 | 3300013297 | Ga0157378_10995778 | Ga0157378_109957781 | 179 |
| 565 | 3300013306 | Ga0163162_10037985 | Ga0163162_100379857 | 179 |
| 566 | 3300013306 | Ga0163162_10054126 | Ga0163162_100541263 | 179 |
| 567 | 3300013306 | Ga0163162_10072548 | Ga0163162_100725483 | 179 |
| 568 | 3300013306 | Ga0163162_10073471 | Ga0163162_100734713 | 179 |
| 569 | 3300013306 | Ga0163162_10077666 | Ga0163162_100776664 | 179 |
| 570 | 3300013306 | Ga0163162_10840573 | Ga0163162_108405732 | 179 |
| 571 | 3300013307 | Ga0157372_10084867 | Ga0157372_100848674 | 179 |
| 572 | 3300013307 | Ga0157372_10101471 | Ga0157372_101014714 | 179 |
| 573 | 3300013307 | Ga0157372_10197671 | Ga0157372_101976713 | 179 |
| 574 | 3300013307 | Ga0157372_10828932 | Ga0157372_108289322 | 179 |
| 575 | 3300013308 | Ga0157375_10010672 | Ga0157375_100106721 | 179 |
| 576 | 3300013308 | Ga0157375_10014363 | Ga0157375_100143636 | 179 |
| 577 | 3300013308 | Ga0157375_10117846 | Ga0157375_101178462 | 179 |
| 578 | 3300013308 | Ga0157375_10218727 | Ga0157375_102187272 | 179 |
| 579 | 3300013308 | Ga0157375_10228711 | Ga0157375_102287114 | 179 |
| 580 | 3300013308 | Ga0157375_10470359 | Ga0157375_104703591 | 179 |
| 581 | 3300013308 | Ga0157375_11057754 | Ga0157375_110577541 | 179 |
| 582 | 3300013308 | Ga0157375_11152615 | Ga0157375_111526152 | 179 |
| 583 | 3300014325 | Ga0163163_10004439 | Ga0163163_100044392 | 179 |
| 584 | 3300014325 | Ga0163163_10011676 | Ga0163163_100116765 | 179 |
| 585 | 3300014325 | Ga0163163_10150958 | Ga0163163_101509584 | 179 |
| 586 | 3300014325 | Ga0163163_10421409 | Ga0163163_104214091 | 179 |
| 587 | 3300014325 | Ga0163163_10473536 | Ga0163163_104735362 | 179 |
| 588 | 3300014325 | Ga0163163_10631814 | Ga0163163_106318142 | 179 |
| 589 | 3300014325 | Ga0163163_10771357 | Ga0163163_107713572 | 179 |
| 590 | 3300014325 | Ga0163163_12131122 | Ga0163163_121311221 | 179 |
| 591 | 3300014326 | Ga0157380_10004096 | Ga0157380_100040962 | 179 |
| 592 | 3300014326 | Ga0157380_10006341 | Ga0157380_100063411 | 179 |
| 593 | 3300014326 | Ga0157380_10028709 | Ga0157380_100287094 | 179 |
| 594 | 3300014326 | Ga0157380_10038698 | Ga0157380_100386983 | 179 |
| 595 | 3300014326 | Ga0157380_10050117 | Ga0157380_100501176 | 179 |
| 596 | 3300014326 | Ga0157380_10515769 | Ga0157380_105157691 | 179 |
| 597 | 3300014326 | Ga0157380_10636489 | Ga0157380_106364892 | 179 |
| 598 | 3300014326 | Ga0157380_10729029 | Ga0157380_107290292 | 179 |
| 599 | 3300014326 | Ga0157380_10991984 | Ga0157380_109919841 | 179 |
| 600 | 3300014326 | Ga0157380_11643943 | Ga0157380_116439431 | 179 |
| 601 | 3300014326 | Ga0157380_11752540 | Ga0157380_117525401 | 179 |
| 602 | 3300014497 | Ga0182008_10124920 | Ga0182008_101249202 | 179 |
| 603 | 3300014745 | Ga0157377_10012496 | Ga0157377_100124963 | 179 |
| 604 | 3300014745 | Ga0157377_10094493 | Ga0157377_100944932 | 179 |
| 605 | 3300014745 | Ga0157377_10131096 | Ga0157377_101310961 | 179 |
| 606 | 3300014968 | Ga0157379_10076147 | Ga0157379_100761474 | 179 |
| 607 | 3300014968 | Ga0157379_10110837 | Ga0157379_101108374 | 179 |
| 608 | 3300014968 | Ga0157379_10172442 | Ga0157379_101724422 | 179 |
| 609 | 3300014968 | Ga0157379_10184982 | Ga0157379_101849822 | 179 |
| 610 | 3300014968 | Ga0157379_10207484 | Ga0157379_102074842 | 179 |
| 611 | 3300014968 | Ga0157379_10255555 | Ga0157379_102555552 | 179 |
| 612 | 3300014968 | Ga0157379_10262245 | Ga0157379_102622452 | 179 |
| 613 | 3300014969 | Ga0157376_10063557 | Ga0157376_100635572 | 179 |
| 614 | 3300014969 | Ga0157376_10120904 | Ga0157376_101209043 | 179 |
| 615 | 3300014969 | Ga0157376_10200370 | Ga0157376_102003702 | 179 |
| 616 | 3300014969 | Ga0157376_10324251 | Ga0157376_103242513 | 179 |
| 617 | 3300014969 | Ga0157376_10373326 | Ga0157376_103733262 | 179 |
| 618 | 3300014969 | Ga0157376_10868025 | Ga0157376_108680251 | 179 |
| 619 | 3300017792 | Ga0163161_10038470 | Ga0163161_100384704 | 179 |
| 620 | 3300017792 | Ga0163161_10086608 | Ga0163161_100866082 | 179 |
| 621 | 3300017792 | Ga0163161_10677238 | Ga0163161_106772382 | 179 |
| 622 | 3300020070 | Ga0206356_11050776 | Ga0206356_110507761 | 179 |
| 623 | 3300020076 | Ga0206355_1087629 | Ga0206355_10876291 | 179 |
| 624 | 3300020076 | Ga0206355_1256135 | Ga0206355_12561352 | 179 |
| 625 | 3300020076 | Ga0206355_1310435 | Ga0206355_13104351 | 179 |
| 626 | 3300020076 | Ga0206355_1571275 | Ga0206355_15712751 | 179 |
| 627 | 3300020076 | Ga0206355_1687272 | Ga0206355_16872721 | 179 |
| 628 | 3300020077 | Ga0206351_10084949 | Ga0206351_100849491 | 179 |
| 629 | 3300020081 | Ga0206354_11591843 | Ga0206354_115918431 | 179 |
| 630 | 3300021358 | Ga0213873_10009552 | Ga0213873_100095523 | 179 |
| 631 | 3300021361 | Ga0213872_10217700 | Ga0213872_102177001 | 179 |
| 632 | 3300021377 | Ga0213874_10017174 | Ga0213874_100171742 | 179 |
| 633 | 3300021377 | Ga0213874_10073231 | Ga0213874_100732311 | 179 |
| 634 | 3300021384 | Ga0213876_10057608 | Ga0213876_100576082 | 179 |
| 635 | 3300021441 | Ga0213871_10060277 | Ga0213871_100602771 | 179 |
| 636 | 3300021441 | Ga0213871_10083117 | Ga0213871_100831172 | 179 |
| 637 | 3300022467 | Ga0224712_10160940 | Ga0224712_101609402 | 179 |
| 638 | 3300022467 | Ga0224712_10203175 | Ga0224712_102031752 | 179 |
| 639 | 3300022467 | Ga0224712_10374318 | Ga0224712_103743182 | 179 |
| 640 | 3300022467 | Ga0224712_10478910 | Ga0224712_104789101 | 179 |
| 641 | 3300023304 | Ga0256714_109273 | Ga0256714_1092731 | 179 |
| 642 | 3300023304 | Ga0256714_117914 | Ga0256714_1179141 | 179 |
| 643 | 3300023304 | Ga0256714_130426 | Ga0256714_1304262 | 179 |
| 644 | 3300023309 | Ga0256744_100180 | Ga0256744_1001802 | 179 |
| 645 | 3300023309 | Ga0256744_124239 | Ga0256744_1242391 | 179 |
| 646 | 3300023436 | Ga0256743_120810 | Ga0256743_1208101 | 179 |
| 647 | 3300023438 | Ga0256720_106382 | Ga0256720_1063821 | 179 |
| 648 | 3300023438 | Ga0256720_120993 | Ga0256720_1209931 | 179 |
| 649 | 3300025893 | Ga0207682_10025845 | Ga0207682_100258453 | 179 |
| 650 | 3300025898 | Ga0207692_10014797 | Ga0207692_100147975 | 179 |
| 651 | 3300025898 | Ga0207692_10231777 | Ga0207692_102317772 | 179 |
| 652 | 3300025899 | Ga0207642_10018122 | Ga0207642_100181224 | 179 |
| 653 | 3300025899 | Ga0207642_10091343 | Ga0207642_100913431 | 179 |
| 654 | 3300025899 | Ga0207642_10561600 | Ga0207642_105616001 | 179 |
| 655 | 3300025900 | Ga0207710_10016751 | Ga0207710_100167514 | 179 |
| 656 | 3300025900 | Ga0207710_10017004 | Ga0207710_100170043 | 179 |
| 657 | 3300025900 | Ga0207710_10072271 | Ga0207710_100722711 | 179 |
| 658 | 3300025901 | Ga0207688_10033787 | Ga0207688_100337874 | 179 |
| 659 | 3300025901 | Ga0207688_10567662 | Ga0207688_105676621 | 179 |
| 660 | 3300025903 | Ga0207680_10005980 | Ga0207680_100059805 | 179 |
| 661 | 3300025903 | Ga0207680_10108040 | Ga0207680_101080402 | 179 |
| 662 | 3300025903 | Ga0207680_10205517 | Ga0207680_102055171 | 179 |
| 663 | 3300025904 | Ga0207647_10146697 | Ga0207647_101466972 | 179 |
| 664 | 3300025906 | Ga0207699_10008193 | Ga0207699_100081936 | 179 |
| 665 | 3300025906 | Ga0207699_10035696 | Ga0207699_100356963 | 179 |
| 666 | 3300025907 | Ga0207645_10003653 | Ga0207645_100036533 | 179 |
| 667 | 3300025907 | Ga0207645_10024776 | Ga0207645_100247764 | 179 |
| 668 | 3300025907 | Ga0207645_10155569 | Ga0207645_101555692 | 179 |
| 669 | 3300025908 | Ga0207643_10007300 | Ga0207643_100073002 | 179 |
| 670 | 3300025908 | Ga0207643_10008594 | Ga0207643_100085944 | 179 |
| 671 | 3300025908 | Ga0207643_10050955 | Ga0207643_100509553 | 179 |
| 672 | 3300025908 | Ga0207643_10118712 | Ga0207643_101187122 | 179 |
| 673 | 3300025911 | Ga0207654_10224380 | Ga0207654_102243802 | 179 |
| 674 | 3300025911 | Ga0207654_10376454 | Ga0207654_103764541 | 179 |
| 675 | 3300025911 | Ga0207654_10694667 | Ga0207654_106946671 | 179 |
| 676 | 3300025912 | Ga0207707_10001046 | Ga0207707_1000104624 | 179 |
| 677 | 3300025912 | Ga0207707_10001063 | Ga0207707_100010634 | 179 |
| 678 | 3300025912 | Ga0207707_10029907 | Ga0207707_100299074 | 179 |
| 679 | 3300025912 | Ga0207707_10038018 | Ga0207707_100380182 | 179 |
| 680 | 3300025912 | Ga0207707_10045189 | Ga0207707_100451894 | 179 |
| 681 | 3300025912 | Ga0207707_10065562 | Ga0207707_100655623 | 179 |
| 682 | 3300025912 | Ga0207707_10250455 | Ga0207707_102504553 | 179 |
| 683 | 3300025912 | Ga0207707_10308629 | Ga0207707_103086292 | 179 |
| 684 | 3300025913 | Ga0207695_10012669 | Ga0207695_1001266910 | 179 |
| 685 | 3300025913 | Ga0207695_10014888 | Ga0207695_100148882 | 179 |
| 686 | 3300025913 | Ga0207695_10022293 | Ga0207695_100222937 | 179 |
| 687 | 3300025913 | Ga0207695_10079417 | Ga0207695_100794173 | 179 |
| 688 | 3300025913 | Ga0207695_10094303 | Ga0207695_100943034 | 179 |
| 689 | 3300025913 | Ga0207695_10098536 | Ga0207695_100985363 | 179 |
| 690 | 3300025913 | Ga0207695_10149224 | Ga0207695_101492242 | 179 |
| 691 | 3300025913 | Ga0207695_10151194 | Ga0207695_101511944 | 179 |
| 692 | 3300025913 | Ga0207695_10154088 | Ga0207695_101540881 | 179 |
| 693 | 3300025913 | Ga0207695_10183131 | Ga0207695_101831312 | 179 |
| 694 | 3300025913 | Ga0207695_10948710 | Ga0207695_109487102 | 179 |
| 695 | 3300025914 | Ga0207671_10062052 | Ga0207671_100620524 | 179 |
| 696 | 3300025914 | Ga0207671_10238569 | Ga0207671_102385692 | 179 |
| 697 | 3300025915 | Ga0207693_10000343 | Ga0207693_1000034322 | 179 |
| 698 | 3300025915 | Ga0207693_10038208 | Ga0207693_100382083 | 179 |
| 699 | 3300025915 | Ga0207693_10143200 | Ga0207693_101432001 | 179 |
| 700 | 3300025915 | Ga0207693_11131736 | Ga0207693_111317361 | 179 |
| 701 | 3300025916 | Ga0207663_10024971 | Ga0207663_100249712 | 179 |
| 702 | 3300025916 | Ga0207663_10335859 | Ga0207663_103358592 | 179 |
| 703 | 3300025916 | Ga0207663_10638706 | Ga0207663_106387062 | 179 |
| 704 | 3300025917 | Ga0207660_10003539 | Ga0207660_100035393 | 179 |
| 705 | 3300025917 | Ga0207660_10007909 | Ga0207660_100079093 | 179 |
| 706 | 3300025917 | Ga0207660_10045796 | Ga0207660_100457964 | 179 |
| 707 | 3300025917 | Ga0207660_10120743 | Ga0207660_101207433 | 179 |
| 708 | 3300025917 | Ga0207660_10128931 | Ga0207660_101289311 | 179 |
| 709 | 3300025917 | Ga0207660_10407250 | Ga0207660_104072501 | 179 |
| 710 | 3300025917 | Ga0207660_10614739 | Ga0207660_106147391 | 179 |
| 711 | 3300025917 | Ga0207660_10651873 | Ga0207660_106518731 | 179 |
| 712 | 3300025918 | Ga0207662_10086288 | Ga0207662_100862882 | 179 |
| 713 | 3300025918 | Ga0207662_10111372 | Ga0207662_101113722 | 179 |
| 714 | 3300025918 | Ga0207662_10217599 | Ga0207662_102175992 | 179 |
| 715 | 3300025918 | Ga0207662_10280596 | Ga0207662_102805962 | 179 |
| 716 | 3300025919 | Ga0207657_10133022 | Ga0207657_101330222 | 179 |
| 717 | 3300025920 | Ga0207649_10033170 | Ga0207649_100331704 | 179 |
| 718 | 3300025920 | Ga0207649_10186726 | Ga0207649_101867262 | 179 |
| 719 | 3300025921 | Ga0207652_10006570 | Ga0207652_100065702 | 179 |
| 720 | 3300025921 | Ga0207652_10018358 | Ga0207652_100183584 | 179 |
| 721 | 3300025921 | Ga0207652_10101803 | Ga0207652_101018032 | 179 |
| 722 | 3300025921 | Ga0207652_10137088 | Ga0207652_101370881 | 179 |
| 723 | 3300025921 | Ga0207652_10410592 | Ga0207652_104105922 | 179 |
| 724 | 3300025921 | Ga0207652_11210495 | Ga0207652_112104951 | 179 |
| 725 | 3300025921 | Ga0207652_11305661 | Ga0207652_113056611 | 179 |
| 726 | 3300025923 | Ga0207681_10050431 | Ga0207681_100504313 | 179 |
| 727 | 3300025923 | Ga0207681_10061283 | Ga0207681_100612831 | 179 |
| 728 | 3300025924 | Ga0207694_10117316 | Ga0207694_101173161 | 179 |
| 729 | 3300025924 | Ga0207694_10163111 | Ga0207694_101631113 | 179 |
| 730 | 3300025924 | Ga0207694_10233765 | Ga0207694_102337652 | 179 |
| 731 | 3300025924 | Ga0207694_10303183 | Ga0207694_103031832 | 179 |
| 732 | 3300025924 | Ga0207694_10306080 | Ga0207694_103060802 | 179 |
| 733 | 3300025924 | Ga0207694_10311731 | Ga0207694_103117313 | 179 |
| 734 | 3300025924 | Ga0207694_10371666 | Ga0207694_103716661 | 179 |
| 735 | 3300025924 | Ga0207694_10445441 | Ga0207694_104454411 | 179 |
| 736 | 3300025925 | Ga0207650_10041517 | Ga0207650_100415172 | 179 |
| 737 | 3300025925 | Ga0207650_10371870 | Ga0207650_103718702 | 179 |
| 738 | 3300025925 | Ga0207650_10522953 | Ga0207650_105229531 | 179 |
| 739 | 3300025925 | Ga0207650_11052694 | Ga0207650_110526941 | 179 |
| 740 | 3300025926 | Ga0207659_10044341 | Ga0207659_100443412 | 179 |
| 741 | 3300025926 | Ga0207659_10126075 | Ga0207659_101260753 | 179 |
| 742 | 3300025926 | Ga0207659_10158256 | Ga0207659_101582562 | 179 |
| 743 | 3300025926 | Ga0207659_10167622 | Ga0207659_101676222 | 179 |
| 744 | 3300025926 | Ga0207659_10978200 | Ga0207659_109782001 | 179 |
| 745 | 3300025927 | Ga0207687_10058430 | Ga0207687_100584303 | 179 |
| 746 | 3300025927 | Ga0207687_10707264 | Ga0207687_107072642 | 179 |
| 747 | 3300025928 | Ga0207700_10045557 | Ga0207700_100455573 | 179 |
| 748 | 3300025928 | Ga0207700_10072360 | Ga0207700_100723604 | 179 |
| 749 | 3300025928 | Ga0207700_10282312 | Ga0207700_102823123 | 179 |
| 750 | 3300025929 | Ga0207664_10030820 | Ga0207664_100308203 | 179 |
| 751 | 3300025931 | Ga0207644_10001535 | Ga0207644_1000153510 | 179 |
| 752 | 3300025931 | Ga0207644_10007221 | Ga0207644_100072218 | 179 |
| 753 | 3300025931 | Ga0207644_10028354 | Ga0207644_100283545 | 179 |
| 754 | 3300025931 | Ga0207644_10057643 | Ga0207644_100576432 | 179 |
| 755 | 3300025932 | Ga0207690_10058335 | Ga0207690_100583354 | 179 |
| 756 | 3300025932 | Ga0207690_10444345 | Ga0207690_104443452 | 179 |
| 757 | 3300025932 | Ga0207690_11191681 | Ga0207690_111916811 | 179 |
| 758 | 3300025933 | Ga0207706_10002507 | Ga0207706_100025078 | 179 |
| 759 | 3300025933 | Ga0207706_10006432 | Ga0207706_100064322 | 179 |
| 760 | 3300025933 | Ga0207706_10054130 | Ga0207706_100541303 | 179 |
| 761 | 3300025934 | Ga0207686_10013112 | Ga0207686_100131123 | 179 |
| 762 | 3300025935 | Ga0207709_10230668 | Ga0207709_102306682 | 179 |
| 763 | 3300025936 | Ga0207670_10034476 | Ga0207670_100344762 | 179 |
| 764 | 3300025936 | Ga0207670_10637647 | Ga0207670_106376471 | 179 |
| 765 | 3300025936 | Ga0207670_10912288 | Ga0207670_109122881 | 179 |
| 766 | 3300025937 | Ga0207669_10020704 | Ga0207669_100207044 | 179 |
| 767 | 3300025937 | Ga0207669_10057973 | Ga0207669_100579733 | 179 |
| 768 | 3300025937 | Ga0207669_10137697 | Ga0207669_101376973 | 179 |
| 769 | 3300025937 | Ga0207669_10764683 | Ga0207669_107646831 | 179 |
| 770 | 3300025938 | Ga0207704_10034972 | Ga0207704_100349722 | 179 |
| 771 | 3300025938 | Ga0207704_10237326 | Ga0207704_102373262 | 179 |
| 772 | 3300025938 | Ga0207704_10322539 | Ga0207704_103225392 | 179 |
| 773 | 3300025939 | Ga0207665_10011562 | Ga0207665_100115622 | 179 |
| 774 | 3300025939 | Ga0207665_10081413 | Ga0207665_100814132 | 179 |
| 775 | 3300025939 | Ga0207665_10138324 | Ga0207665_101383242 | 179 |
| 776 | 3300025940 | Ga0207691_10002085 | Ga0207691_1000208512 | 179 |
| 777 | 3300025940 | Ga0207691_10011812 | Ga0207691_1001181211 | 179 |
| 778 | 3300025940 | Ga0207691_10012001 | Ga0207691_100120015 | 179 |
| 779 | 3300025940 | Ga0207691_10067981 | Ga0207691_100679813 | 179 |
| 780 | 3300025940 | Ga0207691_10399138 | Ga0207691_103991382 | 179 |
| 781 | 3300025940 | Ga0207691_10399185 | Ga0207691_103991852 | 179 |
| 782 | 3300025941 | Ga0207711_10031266 | Ga0207711_100312664 | 179 |
| 783 | 3300025941 | Ga0207711_10183942 | Ga0207711_101839421 | 179 |
| 784 | 3300025941 | Ga0207711_10281105 | Ga0207711_102811052 | 179 |
| 785 | 3300025941 | Ga0207711_10334932 | Ga0207711_103349322 | 179 |
| 786 | 3300025941 | Ga0207711_10738353 | Ga0207711_107383531 | 179 |
| 787 | 3300025941 | Ga0207711_11008204 | Ga0207711_110082041 | 179 |
| 788 | 3300025941 | Ga0207711_11026120 | Ga0207711_110261201 | 179 |
| 789 | 3300025942 | Ga0207689_10001269 | Ga0207689_1000126910 | 179 |
| 790 | 3300025942 | Ga0207689_10013247 | Ga0207689_100132476 | 179 |
| 791 | 3300025942 | Ga0207689_10014425 | Ga0207689_100144256 | 179 |
| 792 | 3300025944 | Ga0207661_10039152 | Ga0207661_100391524 | 179 |
| 793 | 3300025944 | Ga0207661_10065862 | Ga0207661_100658622 | 179 |
| 794 | 3300025944 | Ga0207661_10195353 | Ga0207661_101953531 | 179 |
| 795 | 3300025944 | Ga0207661_10229210 | Ga0207661_102292102 | 179 |
| 796 | 3300025944 | Ga0207661_10277135 | Ga0207661_102771352 | 179 |
| 797 | 3300025945 | Ga0207679_10105262 | Ga0207679_101052622 | 179 |
| 798 | 3300025945 | Ga0207679_10124800 | Ga0207679_101248004 | 179 |
| 799 | 3300025945 | Ga0207679_10379264 | Ga0207679_103792642 | 179 |
| 800 | 3300025945 | Ga0207679_10537271 | Ga0207679_105372712 | 179 |
| 801 | 3300025949 | Ga0207667_10001150 | Ga0207667_1000115035 | 179 |
| 802 | 3300025949 | Ga0207667_10003474 | Ga0207667_100034746 | 179 |
| 803 | 3300025949 | Ga0207667_10012196 | Ga0207667_100121963 | 179 |
| 804 | 3300025949 | Ga0207667_10205164 | Ga0207667_102051641 | 179 |
| 805 | 3300025949 | Ga0207667_10244892 | Ga0207667_102448922 | 179 |
| 806 | 3300025949 | Ga0207667_10363517 | Ga0207667_103635172 | 179 |
| 807 | 3300025949 | Ga0207667_10873656 | Ga0207667_108736562 | 179 |
| 808 | 3300025960 | Ga0207651_10008465 | Ga0207651_100084654 | 179 |
| 809 | 3300025960 | Ga0207651_10023567 | Ga0207651_100235675 | 179 |
| 810 | 3300025960 | Ga0207651_10046838 | Ga0207651_100468382 | 179 |
| 811 | 3300025960 | Ga0207651_10494815 | Ga0207651_104948151 | 179 |
| 812 | 3300025961 | Ga0207712_10034875 | Ga0207712_100348752 | 179 |
| 813 | 3300025961 | Ga0207712_10039461 | Ga0207712_100394613 | 179 |
| 814 | 3300025961 | Ga0207712_10172351 | Ga0207712_101723512 | 179 |
| 815 | 3300025961 | Ga0207712_10277738 | Ga0207712_102777382 | 179 |
| 816 | 3300025961 | Ga0207712_10339311 | Ga0207712_103393112 | 179 |
| 817 | 3300025961 | Ga0207712_10823836 | Ga0207712_108238362 | 179 |
| 818 | 3300025961 | Ga0207712_11249686 | Ga0207712_112496861 | 179 |
| 819 | 3300025972 | Ga0207668_10005626 | Ga0207668_100056265 | 179 |
| 820 | 3300025981 | Ga0207640_10146673 | Ga0207640_101466731 | 179 |
| 821 | 3300025981 | Ga0207640_10731600 | Ga0207640_107316002 | 179 |
| 822 | 3300025986 | Ga0207658_10000046 | Ga0207658_1000004658 | 179 |
| 823 | 3300025986 | Ga0207658_10212687 | Ga0207658_102126872 | 179 |
| 824 | 3300025986 | Ga0207658_10453940 | Ga0207658_104539401 | 179 |
| 825 | 3300025986 | Ga0207658_10520633 | Ga0207658_105206332 | 179 |
| 826 | 3300026023 | Ga0207677_10158353 | Ga0207677_101583532 | 179 |
| 827 | 3300026023 | Ga0207677_10161352 | Ga0207677_101613522 | 179 |
| 828 | 3300026023 | Ga0207677_10733929 | Ga0207677_107339291 | 179 |
| 829 | 3300026035 | Ga0207703_10001297 | Ga0207703_1000129722 | 179 |
| 830 | 3300026035 | Ga0207703_10005685 | Ga0207703_100056858 | 179 |
| 831 | 3300026035 | Ga0207703_10217676 | Ga0207703_102176762 | 179 |
| 832 | 3300026035 | Ga0207703_10659709 | Ga0207703_106597092 | 179 |
| 833 | 3300026041 | Ga0207639_10684101 | Ga0207639_106841011 | 179 |
| 834 | 3300026041 | Ga0207639_10688642 | Ga0207639_106886421 | 179 |
| 835 | 3300026041 | Ga0207639_10778989 | Ga0207639_107789892 | 179 |
| 836 | 3300026067 | Ga0207678_10033130 | Ga0207678_100331302 | 179 |
| 837 | 3300026067 | Ga0207678_10088861 | Ga0207678_100888612 | 179 |
| 838 | 3300026067 | Ga0207678_10095922 | Ga0207678_100959222 | 179 |
| 839 | 3300026075 | Ga0207708_10011839 | Ga0207708_100118394 | 179 |
| 840 | 3300026075 | Ga0207708_10027141 | Ga0207708_100271412 | 179 |
| 841 | 3300026075 | Ga0207708_10032970 | Ga0207708_100329703 | 179 |
| 842 | 3300026075 | Ga0207708_10065887 | Ga0207708_100658874 | 179 |
| 843 | 3300026075 | Ga0207708_10114863 | Ga0207708_101148632 | 179 |
| 844 | 3300026078 | Ga0207702_10042270 | Ga0207702_100422702 | 179 |
| 845 | 3300026078 | Ga0207702_10198278 | Ga0207702_101982782 | 179 |
| 846 | 3300026078 | Ga0207702_10221018 | Ga0207702_102210182 | 179 |
| 847 | 3300026078 | Ga0207702_10321912 | Ga0207702_103219123 | 179 |
| 848 | 3300026078 | Ga0207702_11110888 | Ga0207702_111108882 | 179 |
| 849 | 3300026088 | Ga0207641_10001107 | Ga0207641_1000110710 | 179 |
| 850 | 3300026088 | Ga0207641_10009498 | Ga0207641_100094984 | 179 |
| 851 | 3300026088 | Ga0207641_10030599 | Ga0207641_100305993 | 179 |
| 852 | 3300026088 | Ga0207641_10063843 | Ga0207641_100638432 | 179 |
| 853 | 3300026088 | Ga0207641_10166310 | Ga0207641_101663102 | 179 |
| 854 | 3300026088 | Ga0207641_10179304 | Ga0207641_101793043 | 179 |
| 855 | 3300026089 | Ga0207648_10006603 | Ga0207648_100066033 | 179 |
| 856 | 3300026089 | Ga0207648_10015775 | Ga0207648_100157755 | 179 |
| 857 | 3300026089 | Ga0207648_10034879 | Ga0207648_100348794 | 179 |
| 858 | 3300026089 | Ga0207648_10074835 | Ga0207648_100748352 | 179 |
| 859 | 3300026089 | Ga0207648_10118417 | Ga0207648_101184175 | 179 |
| 860 | 3300026089 | Ga0207648_10427841 | Ga0207648_104278412 | 179 |
| 861 | 3300026095 | Ga0207676_10005142 | Ga0207676_100051425 | 179 |
| 862 | 3300026095 | Ga0207676_10135564 | Ga0207676_101355643 | 179 |
| 863 | 3300026095 | Ga0207676_10387442 | Ga0207676_103874422 | 179 |
| 864 | 3300026095 | Ga0207676_10399366 | Ga0207676_103993662 | 179 |
| 865 | 3300026095 | Ga0207676_10570977 | Ga0207676_105709771 | 179 |
| 866 | 3300026116 | Ga0207674_10021269 | Ga0207674_100212699 | 179 |
| 867 | 3300026116 | Ga0207674_10175259 | Ga0207674_101752592 | 179 |
| 868 | 3300026116 | Ga0207674_11018346 | Ga0207674_110183461 | 179 |
| 869 | 3300026118 | Ga0207675_100002246 | Ga0207675_1000022466 | 179 |
| 870 | 3300026118 | Ga0207675_100019823 | Ga0207675_1000198236 | 179 |
| 871 | 3300026118 | Ga0207675_100022386 | Ga0207675_1000223863 | 179 |
| 872 | 3300026118 | Ga0207675_100032167 | Ga0207675_1000321675 | 179 |
| 873 | 3300026118 | Ga0207675_100088034 | Ga0207675_1000880343 | 179 |
| 874 | 3300026118 | Ga0207675_100099065 | Ga0207675_1000990653 | 179 |
| 875 | 3300026118 | Ga0207675_100607503 | Ga0207675_1006075031 | 179 |
| 876 | 3300026118 | Ga0207675_100840914 | Ga0207675_1008409141 | 179 |
| 877 | 3300026118 | Ga0207675_100973492 | Ga0207675_1009734922 | 179 |
| 878 | 3300026121 | Ga0207683_10001586 | Ga0207683_100015863 | 179 |
| 879 | 3300026121 | Ga0207683_10012593 | Ga0207683_100125933 | 179 |
| 880 | 3300026121 | Ga0207683_10131880 | Ga0207683_101318804 | 179 |
| 881 | 3300026121 | Ga0207683_10181853 | Ga0207683_101818532 | 179 |
| 882 | 3300026121 | Ga0207683_10279247 | Ga0207683_102792473 | 179 |
| 883 | 3300026121 | Ga0207683_10844886 | Ga0207683_108448862 | 179 |
| 884 | 3300026142 | Ga0207698_10188454 | Ga0207698_101884542 | 179 |
| 885 | 3300027252 | Ga0209973_1006807 | Ga0209973_10068072 | 179 |
| 886 | 3300027378 | Ga0209981_1012113 | Ga0209981_10121131 | 179 |
| 887 | 3300027395 | Ga0209996_1016230 | Ga0209996_10162302 | 179 |
| 888 | 3300027462 | Ga0210000_1014497 | Ga0210000_10144972 | 179 |
| 889 | 3300027471 | Ga0209995_1021879 | Ga0209995_10218792 | 179 |
| 890 | 3300027552 | Ga0209982_1000647 | Ga0209982_10006472 | 179 |
| 891 | 3300027614 | Ga0209970_1001806 | Ga0209970_10018063 | 179 |
| 892 | 3300027614 | Ga0209970_1022312 | Ga0209970_10223121 | 179 |
| 893 | 3300027617 | Ga0210002_1003967 | Ga0210002_10039671 | 179 |
| 894 | 3300027617 | Ga0210002_1012379 | Ga0210002_10123792 | 179 |
| 895 | 3300027665 | Ga0209983_1000958 | Ga0209983_10009583 | 179 |
| 896 | 3300027682 | Ga0209971_1002508 | Ga0209971_10025083 | 179 |
| 897 | 3300027682 | Ga0209971_1006403 | Ga0209971_10064033 | 179 |
| 898 | 3300027717 | Ga0209998_10001105 | Ga0209998_100011057 | 179 |
| 899 | 3300027876 | Ga0209974_10007834 | Ga0209974_100078347 | 179 |
| 900 | 3300027907 | Ga0207428_10013272 | Ga0207428_100132725 | 179 |
| 901 | 3300027907 | Ga0207428_10013404 | Ga0207428_100134043 | 179 |
| 902 | 3300027907 | Ga0207428_10125257 | Ga0207428_101252572 | 179 |
| 903 | 3300028379 | Ga0268266_10000546 | Ga0268266_1000054641 | 179 |
| 904 | 3300028379 | Ga0268266_10000702 | Ga0268266_1000070215 | 179 |
| 905 | 3300028379 | Ga0268266_10008608 | Ga0268266_100086082 | 179 |
| 906 | 3300028379 | Ga0268266_10018660 | Ga0268266_100186605 | 179 |
| 907 | 3300028379 | Ga0268266_10138460 | Ga0268266_101384602 | 179 |
| 908 | 3300028379 | Ga0268266_10254761 | Ga0268266_102547612 | 179 |
| 909 | 3300028379 | Ga0268266_10384367 | Ga0268266_103843672 | 179 |
| 910 | 3300028379 | Ga0268266_10439947 | Ga0268266_104399472 | 179 |
| 911 | 3300028379 | Ga0268266_10773979 | Ga0268266_107739792 | 179 |
| 912 | 3300028380 | Ga0268265_10001988 | Ga0268265_100019886 | 179 |
| 913 | 3300028380 | Ga0268265_10008712 | Ga0268265_100087123 | 179 |
| 914 | 3300028380 | Ga0268265_10041644 | Ga0268265_100416443 | 179 |
| 915 | 3300028380 | Ga0268265_10080847 | Ga0268265_100808472 | 179 |
| 916 | 3300028380 | Ga0268265_10103451 | Ga0268265_101034512 | 179 |
| 917 | 3300028380 | Ga0268265_10274988 | Ga0268265_102749882 | 179 |
| 918 | 3300028380 | Ga0268265_10473251 | Ga0268265_104732511 | 179 |
| 919 | 3300028380 | Ga0268265_10574507 | Ga0268265_105745072 | 179 |
| 920 | 3300028380 | Ga0268265_10815739 | Ga0268265_108157391 | 179 |
| 921 | 3300028380 | Ga0268265_11430080 | Ga0268265_114300801 | 179 |
| 922 | 3300028380 | Ga0268265_11490719 | Ga0268265_114907191 | 179 |
| 923 | 3300028380 | Ga0268265_11686333 | Ga0268265_116863331 | 179 |
| 924 | 3300028381 | Ga0268264_10000085 | Ga0268264_1000008531 | 179 |
| 925 | 3300028381 | Ga0268264_10050877 | Ga0268264_100508774 | 179 |
| 926 | 3300028381 | Ga0268264_10054438 | Ga0268264_100544386 | 179 |
| 927 | 3300028381 | Ga0268264_10299807 | Ga0268264_102998072 | 179 |
| 928 | 3300028381 | Ga0268264_10301998 | Ga0268264_103019982 | 179 |
| 929 | 3300028381 | Ga0268264_10354146 | Ga0268264_103541461 | 179 |
| 930 | 3300028381 | Ga0268264_11435067 | Ga0268264_114350671 | 179 |
| 931 | 3300028573 | Ga0265334_10047476 | Ga0265334_100474763 | 179 |
| 932 | 3300028577 | Ga0265318_10077258 | Ga0265318_100772582 | 179 |
| 933 | 3300028653 | Ga0265323_10000510 | Ga0265323_100005104 | 179 |
| 934 | 3300028786 | Ga0307517_10264337 | Ga0307517_102643372 | 179 |
| 935 | 3300028794 | Ga0307515_10345458 | Ga0307515_103454582 | 179 |
| 936 | 3300028800 | Ga0265338_10002924 | Ga0265338_100029247 | 179 |
| 937 | 3300028800 | Ga0265338_10021907 | Ga0265338_100219074 | 179 |
| 938 | 3300028800 | Ga0265338_10039065 | Ga0265338_100390652 | 179 |
| 939 | 3300028800 | Ga0265338_10784389 | Ga0265338_107843891 | 179 |
| 940 | 3300029272 | Ga0311000_120665 | Ga0311000_1206652 | 179 |
| 941 | 3300029276 | Ga0311004_108406 | Ga0311004_1084062 | 179 |
| 942 | 3300029276 | Ga0311004_142814 | Ga0311004_1428142 | 179 |
| 943 | 3300029277 | Ga0311001_1017080 | Ga0311001_10170801 | 179 |
| 944 | 3300029277 | Ga0311001_1026809 | Ga0311001_10268091 | 179 |
| 945 | 3300029277 | Ga0311001_1027304 | Ga0311001_10273041 | 179 |
| 946 | 3300029277 | Ga0311001_1051811 | Ga0311001_10518112 | 179 |
| 947 | 3300029277 | Ga0311001_1102328 | Ga0311001_11023281 | 179 |
| 948 | 3300029280 | Ga0311011_111105 | Ga0311011_1111051 | 179 |
| 949 | 3300029280 | Ga0311011_113820 | Ga0311011_1138201 | 179 |
| 950 | 3300029280 | Ga0311011_129310 | Ga0311011_1293102 | 179 |
| 951 | 3300029280 | Ga0311011_141075 | Ga0311011_1410752 | 179 |
| 952 | 3300029283 | Ga0310982_100635 | Ga0310982_1006351 | 179 |
| 953 | 3300029285 | Ga0310981_1017140 | Ga0310981_10171402 | 179 |
| 954 | 3300029285 | Ga0310981_1047544 | Ga0310981_10475442 | 179 |
| 955 | 3300029285 | Ga0310981_1079241 | Ga0310981_10792411 | 179 |
| 956 | 3300030521 | Ga0307511_10001897 | Ga0307511_100018972 | 179 |
| 957 | 3300030521 | Ga0307511_10028879 | Ga0307511_100288792 | 179 |
| 958 | 3300030836 | Ga0265767_107209 | Ga0265767_1072091 | 179 |
| 959 | 3300030879 | Ga0265765_1033012 | Ga0265765_10330121 | 179 |
| 960 | 3300031235 | Ga0265330_10092997 | Ga0265330_100929972 | 179 |
| 961 | 3300031238 | Ga0265332_10178208 | Ga0265332_101782081 | 179 |
| 962 | 3300031241 | Ga0265325_10222495 | Ga0265325_102224951 | 179 |
| 963 | 3300031242 | Ga0265329_10070872 | Ga0265329_100708722 | 179 |
| 964 | 3300031247 | Ga0265340_10078805 | Ga0265340_100788052 | 179 |
| 965 | 3300031247 | Ga0265340_10129929 | Ga0265340_101299292 | 179 |
| 966 | 3300031249 | Ga0265339_10018466 | Ga0265339_100184665 | 179 |
| 967 | 3300031250 | Ga0265331_10021357 | Ga0265331_100213572 | 179 |
| 968 | 3300031344 | Ga0265316_10022943 | Ga0265316_100229431 | 179 |
| 969 | 3300031344 | Ga0265316_10027184 | Ga0265316_100271842 | 179 |
| 970 | 3300031344 | Ga0265316_10067284 | Ga0265316_100672843 | 179 |
| 971 | 3300031456 | Ga0307513_10007959 | Ga0307513_1000795910 | 179 |
| 972 | 3300031456 | Ga0307513_10014058 | Ga0307513_100140584 | 179 |
| 973 | 3300031456 | Ga0307513_10062517 | Ga0307513_100625173 | 179 |
| 974 | 3300031456 | Ga0307513_10067032 | Ga0307513_100670324 | 179 |
| 975 | 3300031507 | Ga0307509_10000008 | Ga0307509_10000008177 | 179 |
| 976 | 3300031507 | Ga0307509_10000543 | Ga0307509_1000054314 | 179 |
| 977 | 3300031507 | Ga0307509_10056828 | Ga0307509_100568286 | 179 |
| 978 | 3300031507 | Ga0307509_10247988 | Ga0307509_102479882 | 179 |
| 979 | 3300031507 | Ga0307509_10554218 | Ga0307509_105542181 | 179 |
| 980 | 3300031548 | Ga0307408_100015686 | Ga0307408_1000156863 | 179 |
| 981 | 3300031548 | Ga0307408_100092155 | Ga0307408_1000921553 | 179 |
| 982 | 3300031548 | Ga0307408_100196219 | Ga0307408_1001962191 | 179 |
| 983 | 3300031548 | Ga0307408_100248021 | Ga0307408_1002480212 | 179 |
| 984 | 3300031548 | Ga0307408_100352082 | Ga0307408_1003520821 | 179 |
| 985 | 3300031548 | Ga0307408_100403171 | Ga0307408_1004031712 | 179 |
| 986 | 3300031548 | Ga0307408_100418191 | Ga0307408_1004181912 | 179 |
| 987 | 3300031548 | Ga0307408_100434223 | Ga0307408_1004342232 | 179 |
| 988 | 3300031548 | Ga0307408_100860005 | Ga0307408_1008600051 | 179 |
| 989 | 3300031548 | Ga0307408_101682761 | Ga0307408_1016827611 | 179 |
| 990 | 3300031649 | Ga0307514_10175360 | Ga0307514_101753602 | 179 |
| 991 | 3300031711 | Ga0265314_10074062 | Ga0265314_100740622 | 179 |
| 992 | 3300031712 | Ga0265342_10426291 | Ga0265342_104262911 | 179 |
| 993 | 3300031727 | Ga0316576_10385501 | Ga0316576_103855012 | 179 |
| 994 | 3300031730 | Ga0307516_10015867 | Ga0307516_100158672 | 179 |
| 995 | 3300031731 | Ga0307405_10383450 | Ga0307405_103834502 | 179 |
| 996 | 3300031731 | Ga0307405_11614700 | Ga0307405_116147001 | 179 |
| 997 | 3300031824 | Ga0307413_10004678 | Ga0307413_100046785 | 179 |
| 998 | 3300031824 | Ga0307413_10015242 | Ga0307413_100152424 | 179 |
| 999 | 3300031824 | Ga0307413_10062574 | Ga0307413_100625743 | 179 |
| 1000 | 3300031824 | Ga0307413_10081954 | Ga0307413_100819543 | 179 |
| 1001 | 3300031824 | Ga0307413_10107591 | Ga0307413_101075912 | 179 |
| 1002 | 3300031852 | Ga0307410_10052893 | Ga0307410_100528932 | 179 |
| 1003 | 3300031852 | Ga0307410_10199293 | Ga0307410_101992932 | 179 |
| 1004 | 3300031852 | Ga0307410_10637665 | Ga0307410_106376651 | 179 |
| 1005 | 3300031852 | Ga0307410_11055972 | Ga0307410_110559721 | 179 |
| 1006 | 3300031852 | Ga0307410_11177151 | Ga0307410_111771511 | 179 |
| 1007 | 3300031901 | Ga0307406_10015666 | Ga0307406_100156664 | 179 |
| 1008 | 3300031901 | Ga0307406_10046703 | Ga0307406_100467034 | 179 |
| 1009 | 3300031901 | Ga0307406_10648840 | Ga0307406_106488402 | 179 |
| 1010 | 3300031903 | Ga0307407_10027659 | Ga0307407_100276594 | 179 |
| 1011 | 3300031903 | Ga0307407_10073748 | Ga0307407_100737482 | 179 |
| 1012 | 3300031903 | Ga0307407_10245456 | Ga0307407_102454562 | 179 |
| 1013 | 3300031911 | Ga0307412_10504024 | Ga0307412_105040242 | 179 |
| 1014 | 3300031995 | Ga0307409_100002005 | Ga0307409_1000020054 | 179 |
| 1015 | 3300031995 | Ga0307409_100023646 | Ga0307409_1000236464 | 179 |
| 1016 | 3300031995 | Ga0307409_100078147 | Ga0307409_1000781472 | 179 |
| 1017 | 3300031995 | Ga0307409_100104142 | Ga0307409_1001041421 | 179 |
| 1018 | 3300032002 | Ga0307416_100068965 | Ga0307416_1000689654 | 179 |
| 1019 | 3300032002 | Ga0307416_100138160 | Ga0307416_1001381602 | 179 |
| 1020 | 3300032002 | Ga0307416_100521631 | Ga0307416_1005216312 | 179 |
| 1021 | 3300032002 | Ga0307416_100543535 | Ga0307416_1005435351 | 179 |
| 1022 | 3300032002 | Ga0307416_101011562 | Ga0307416_1010115622 | 179 |
| 1023 | 3300032004 | Ga0307414_10172460 | Ga0307414_101724601 | 179 |
| 1024 | 3300032004 | Ga0307414_10246925 | Ga0307414_102469251 | 179 |
| 1025 | 3300032005 | Ga0307411_10003950 | Ga0307411_100039505 | 179 |
| 1026 | 3300032005 | Ga0307411_10009926 | Ga0307411_100099264 | 179 |
| 1027 | 3300032005 | Ga0307411_10133722 | Ga0307411_101337222 | 179 |
| 1028 | 3300032005 | Ga0307411_10169381 | Ga0307411_101693813 | 179 |
| 1029 | 3300032005 | Ga0307411_10280736 | Ga0307411_102807362 | 179 |
| 1030 | 3300032126 | Ga0307415_100410634 | Ga0307415_1004106342 | 179 |
| 1031 | 3300032126 | Ga0307415_100585933 | Ga0307415_1005859332 | 179 |
| 1032 | 3300032126 | Ga0307415_100772332 | Ga0307415_1007723322 | 179 |
| 1033 | 3300032126 | Ga0307415_101028462 | Ga0307415_1010284622 | 179 |
| 1034 | 3300032168 | Ga0316593_10003322 | Ga0316593_100033224 | 179 |
| 1035 | 3300032168 | Ga0316593_10296580 | Ga0316593_102965801 | 179 |
| 1036 | 3300033180 | Ga0307510_10000004 | Ga0307510_10000004218 | 179 |
| 1037 | 3300033180 | Ga0307510_10032882 | Ga0307510_100328823 | 179 |
| 1038 | 3300033524 | Ga0316592_1006133 | Ga0316592_10061333 | 179 |
| 1039 | 3300033541 | Ga0316596_1014010 | Ga0316596_10140103 | 179 |
| 1040 | 3300035089 | Ga0373944_0095602 | Ga0373944_0095602_311_850 | 179 |
| 1041 | 3300035089 | Ga0373944_0322012 | Ga0373944_0322012_30_572 | 179 |
| 1042 | 3300035092 | Ga0373952_0215414 | Ga0373952_0215414_11_550 | 179 |
| 1043 | 3300035111 | Ga0373923_0161962 | Ga0373923_0161962_28_567 | 179 |
| 1044 | 3300035113 | Ga0373936_0085248 | Ga0373936_0085248_658_1197 | 179 |
| 1045 | 3300035113 | Ga0373936_0170493 | Ga0373936_0170493_74_613 | 179 |
| 1046 | 3300035118 | Ga0373954_0006608 | Ga0373954_0006608_498_1037 | 179 |
| 1047 | 3300035119 | Ga0373956_0016639 | Ga0373956_0016639_1422_1961 | 179 |
| 1048 | 3300035120 | Ga0373957_0182967 | Ga0373957_0182967_304_843 | 179 |
| 1049 | 3300035170 | Ga0373943_0126625 | Ga0373943_0126625_363_902 | 179 |
| 1050 | 3300035170 | Ga0373943_0194643 | Ga0373943_0194643_392_931 | 179 |
| 1051 | 3300035172 | Ga0373955_0020250 | Ga0373955_0020250_2140_2679 | 179 |
| 1052 | 3300035172 | Ga0373955_0168064 | Ga0373955_0168064_481_1020 | 179 |
| 1053 | 3300035172 | Ga0373955_0317653 | Ga0373955_0317653_156_698 | 179 |
| 1054 | 3300035692 | Ga0373935_0214934 | Ga0373935_0214934_564_1106 | 179 |
| 1055 | 3300035695 | Ga0373927_0007466 | Ga0373927_0007466_5751_6290 | 179 |
| 1056 | 3300035724 | Ga0373933_0246802 | Ga0373933_0246802_129_668 | 179 |
| 1057 | 3300035725 | Ga0373947_0278398 | Ga0373947_0278398_85_624 | 179 |
| 1058 | 3300036401 | Ga0373937_0008505 | Ga0373937_0008505_2801_3340 | 179 |
| 1059 | 3300036401 | Ga0373937_0040899 | Ga0373937_0040899_94_633 | 179 |
| 1060 | 3300036647 | Ga0316582_0431586 | Ga0316582_0431586_37_576 | 179 |
| 1061 | 3300037068 | Ga0373925_0073075 | Ga0373925_0073075_25_564 | 179 |
| 1062 | 3300037068 | Ga0373925_1106045 | Ga0373925_1106045_98_637 | 179 |
| 1063 | 3300037312 | Ga0395899_0084351 | Ga0395899_0084351_1287_1826 | 179 |
| 1064 | 3300037312 | Ga0395899_0283956 | Ga0395899_0283956_475_1014 | 179 |
| 1065 | 3300037418 | Ga0395900_0003285 | Ga0395900_0003285_9618_10157 | 179 |
| 1066 | 3300037418 | Ga0395900_0005953 | Ga0395900_0005953_2054_2593 | 179 |
| 1067 | 3300037418 | Ga0395900_0091805 | Ga0395900_0091805_2048_2587 | 179 |
| 1068 | 3300037466 | Ga0395898_0017560 | Ga0395898_0017560_2005_2544 | 179 |
| 1069 | 3300037466 | Ga0395898_0020160 | Ga0395898_0020160_3773_4312 | 179 |
| 1070 | 3300037466 | Ga0395898_0065073 | Ga0395898_0065073_2378_2917 | 179 |
| 1071 | 3300037466 | Ga0395898_0421995 | Ga0395898_0421995_553_1092 | 179 |
| 1072 | 3300038443 | Ga0395901_0001587 | Ga0395901_0001587_22056_22595 | 179 |
| 1073 | 3300038443 | Ga0395901_0004093 | Ga0395901_0004093_5290_5829 | 179 |
| 1074 | 3300038443 | Ga0395901_0239630 | Ga0395901_0239630_951_1496 | 179 |
| 1075 | 3300038443 | Ga0395901_0679514 | Ga0395901_0679514_61_600 | 179 |
| 1076 | 3300039437 | Ga0436365_1290806 | Ga0436365_1290806_78_617 | 179 |
| 1077 | 3300039437 | Ga0436365_1372101 | Ga0436365_1372101_45_584 | 179 |
| 1078 | 3300039437 | Ga0436365_1560949 | Ga0436365_1560949_105_644 | 179 |
| 1079 | 3300039438 | Ga0436360_0075183 | Ga0436360_0075183_1399_1938 | 179 |
| 1080 | 3300039438 | Ga0436360_0107738 | Ga0436360_0107738_248_787 | 179 |
| 1081 | 3300039438 | Ga0436360_0389718 | Ga0436360_0389718_796_1335 | 179 |
| 1082 | 3300039438 | Ga0436360_0454473 | Ga0436360_0454473_81_620 | 179 |
| 1083 | 3300039447 | Ga0436361_0186433 | Ga0436361_0186433_5694_6233 | 179 |
| 1084 | 3300039447 | Ga0436361_0362369 | Ga0436361_0362369_2283_2822 | 179 |
| 1085 | 3300039447 | Ga0436361_0440847 | Ga0436361_0440847_237_776 | 179 |
| 1086 | 3300039447 | Ga0436361_0740004 | Ga0436361_0740004_267_806 | 179 |
| 1087 | 3300039450 | Ga0436363_0277534 | Ga0436363_0277534_6888_7427 | 179 |
| 1088 | 3300039450 | Ga0436363_0857817 | Ga0436363_0857817_1508_2131 | 179 |
| 1089 | 3300039450 | Ga0436363_1704374 | Ga0436363_1704374_327_866 | 179 |
| 1090 | 3300039453 | Ga0436362_0042252 | Ga0436362_0042252_3109_3648 | 179 |
| 1091 | 3300039453 | Ga0436362_0149361 | Ga0436362_0149361_30_569 | 179 |
| 1092 | 3300041407 | Ga0439447_107427 | Ga0439447_107427_92_631 | 179 |
| 1093 | 3300041408 | Ga0439453_0023200 | Ga0439453_0023200_50_592 | 179 |
| 1094 | 3300041410 | Ga0439461_0078449 | Ga0439461_0078449_43_582 | 179 |
| 1095 | 3300041443 | Ga0451789_0864192 | Ga0451789_0864192_88_627 | 179 |
| 1096 | 3300041453 | Ga0451797_1238842 | Ga0451797_1238842_257_796 | 179 |
| 1097 | 3300041486 | Ga0451807_0380208 | Ga0451807_0380208_2176_2715 | 179 |
| 1098 | 3300041486 | Ga0451807_1529842 | Ga0451807_1529842_893_1432 | 179 |
| 1099 | 3300041491 | Ga0451833_0736883 | Ga0451833_0736883_393_932 | 179 |
| 1100 | 3300041509 | Ga0451843_1719082 | Ga0451843_1719082_16_573 | 179 |
| 1101 | 3300041997 | Ga0439431_0009590 | Ga0439431_0009590_1315_1854 | 179 |
| 1102 | 3300042002 | Ga0439442_031446 | Ga0439442_031446_492_1031 | 179 |
| 1103 | 3300042007 | Ga0439449_0068730 | Ga0439449_0068730_343_882 | 179 |
| 1104 | 3300042009 | Ga0439451_028521 | Ga0439451_028521_101_640 | 179 |
| 1105 | 3300042016 | Ga0439463_097766 | Ga0439463_097766_204_746 | 179 |
| 1106 | 3300042116 | Ga0450912_012088 | Ga0450912_012088_180_719 | 179 |
| 1107 | 3300042116 | Ga0450912_012522 | Ga0450912_012522_102_641 | 179 |
| 1108 | 3300042122 | Ga0450920_001538 | Ga0450920_001538_2537_3076 | 179 |
| 1109 | 3300042124 | Ga0450922_019419 | Ga0450922_019419_79_618 | 179 |
| 1110 | 3300042132 | Ga0450895_000379 | Ga0450895_000379_283_822 | 179 |
| 1111 | 3300042133 | Ga0450896_007026 | Ga0450896_007026_914_1453 | 179 |
| 1112 | 3300042133 | Ga0450896_013064 | Ga0450896_013064_530_1069 | 179 |
| 1113 | 3300042145 | Ga0450906_032460 | Ga0450906_032460_57_596 | 179 |
| 1114 | 3300042147 | Ga0450910_011124 | Ga0450910_011124_83_622 | 179 |
| 1115 | 3300042147 | Ga0450910_044514 | Ga0450910_044514_94_633 | 179 |
| 1116 | 3300042184 | Ga0450908_000146 | Ga0450908_000146_4913_5452 | 179 |
| 1117 | 3300042435 | Ga0439434_0000736 | Ga0439434_0000736_441_980 | 179 |
| 1118 | 3300042436 | Ga0439435_0005858 | Ga0439435_0005858_1335_1874 | 179 |
| 1119 | 3300042436 | Ga0439435_0114065 | Ga0439435_0114065_185_724 | 179 |
| 1120 | 3300042437 | Ga0439444_0002019 | Ga0439444_0002019_1169_1708 | 179 |
| 1121 | 3300042437 | Ga0439444_0038206 | Ga0439444_0038206_77_619 | 179 |
| 1122 | 3300042461 | Ga0439460_0003891 | Ga0439460_0003891_582_1121 | 179 |
| 1123 | 3300042532 | Ga0450893_0048887 | Ga0450893_0048887_52_591 | 179 |
| 1124 | 3300042876 | Ga0451577_0721082 | Ga0451577_0721082_22_561 | 179 |
| 1125 | 3300044656 | Ga0466969_0009963 | Ga0466969_0009963_4164_4727 | 179 |
| 1126 | 3300044658 | Ga0466972_0097642 | Ga0466972_0097642_270_809 | 179 |
| 1127 | 3300044684 | Ga0466966_0055175 | Ga0466966_0055175_369_908 | 179 |
| 1128 | 3300044693 | Ga0466961_0147137 | Ga0466961_0147137_159_698 | 179 |
| 1129 | 3300044694 | Ga0466963_0138844 | Ga0466963_0138844_241_780 | 179 |
| 1130 | 3300044712 | Ga0453684_0001552 | Ga0453684_0001552_50391_50930 | 179 |
| 1131 | 3300044712 | Ga0453684_1633594 | Ga0453684_1633594_57_605 | 179 |
| 1132 | 3300044765 | Ga0466970_0036817 | Ga0466970_0036817_1269_1832 | 179 |
| 1133 | 3300044842 | Ga0466957_0473453 | Ga0466957_0473453_127_666 | 179 |
| 1134 | 3300044842 | Ga0466957_0611298 | Ga0466957_0611298_94_633 | 179 |
| 1135 | 3300044842 | Ga0466957_0634167 | Ga0466957_0634167_183_725 | 179 |
| 1136 | 3300044901 | Ga0466960_0154987 | Ga0466960_0154987_58_597 | 179 |
| 1137 | 3300045049 | Ga0466959_0006281 | Ga0466959_0006281_6347_6886 | 179 |
| 1138 | 3300045049 | Ga0466959_0069118 | Ga0466959_0069118_206_745 | 179 |
| 1139 | 3300045051 | Ga0451576_0000042 | Ga0451576_0000042_244147_244686 | 179 |
| 1140 | 3300045051 | Ga0451576_0012094 | Ga0451576_0012094_5358_5897 | 179 |
| 1141 | 3300045051 | Ga0451576_0122196 | Ga0451576_0122196_311_850 | 179 |
| 1142 | 3300045051 | Ga0451576_0199114 | Ga0451576_0199114_1424_1963 | 179 |
| 1143 | 3300045836 | Ga0466958_0222977 | Ga0466958_0222977_81_629 | 179 |
| 1144 | 3300045976 | Ga0466967_0061247 | Ga0466967_0061247_2651_3205 | 179 |
| 1145 | 3300045976 | Ga0466967_0346217 | Ga0466967_0346217_534_1073 | 179 |
| 1146 | 3300045976 | Ga0466967_0350728 | Ga0466967_0350728_843_1382 | 179 |
| 1147 | 3300046457 | Ga0495590_0147342 | Ga0495590_0147342_256_801 | 179 |
| 1148 | 3300046459 | Ga0495629_0514239 | Ga0495629_0514239_51_602 | 179 |
| 1149 | 3300046460 | Ga0495638_0002587 | Ga0495638_0002587_977_1516 | 179 |
| 1150 | 3300046460 | Ga0495638_0003316 | Ga0495638_0003316_905_1444 | 179 |
| 1151 | 3300046460 | Ga0495638_0053209 | Ga0495638_0053209_258_797 | 179 |
| 1152 | 3300046460 | Ga0495638_0062992 | Ga0495638_0062992_1738_2277 | 179 |
| 1153 | 3300046462 | Ga0495651_0239527 | Ga0495651_0239527_217_756 | 179 |
| 1154 | 3300046462 | Ga0495651_0421007 | Ga0495651_0421007_135_677 | 179 |
| 1155 | 3300046471 | Ga0495650_0013417 | Ga0495650_0013417_2354_2893 | 179 |
| 1156 | 3300046472 | Ga0495580_0015700 | Ga0495580_0015700_3181_3723 | 179 |
| 1157 | 3300046472 | Ga0495580_0017539 | Ga0495580_0017539_444_983 | 179 |
| 1158 | 3300046472 | Ga0495580_0020241 | Ga0495580_0020241_1010_1549 | 179 |
| 1159 | 3300046473 | Ga0495582_0437309 | Ga0495582_0437309_70_609 | 179 |
| 1160 | 3300046476 | Ga0495662_0049903 | Ga0495662_0049903_863_1405 | 179 |
| 1161 | 3300046477 | Ga0495664_0149650 | Ga0495664_0149650_30_572 | 179 |
| 1162 | 3300046477 | Ga0495664_0186262 | Ga0495664_0186262_632_1174 | 179 |
| 1163 | 3300046491 | Ga0495584_0181099 | Ga0495584_0181099_381_920 | 179 |
| 1164 | 3300046492 | Ga0495585_0060131 | Ga0495585_0060131_1009_1548 | 179 |
| 1165 | 3300046506 | Ga0495583_0056737 | Ga0495583_0056737_467_1030 | 179 |
| 1166 | 3300046507 | Ga0495606_0209596 | Ga0495606_0209596_217_756 | 179 |
| 1167 | 3300046513 | Ga0495616_0049419 | Ga0495616_0049419_1295_1834 | 179 |
| 1168 | 3300046514 | Ga0495618_0116095 | Ga0495618_0116095_510_1052 | 179 |
| 1169 | 3300046514 | Ga0495618_0149890 | Ga0495618_0149890_826_1377 | 179 |
| 1170 | 3300046515 | Ga0495620_0070396 | Ga0495620_0070396_656_1195 | 179 |
| 1171 | 3300046516 | Ga0495628_0030797 | Ga0495628_0030797_1074_1616 | 179 |
| 1172 | 3300046516 | Ga0495628_0065042 | Ga0495628_0065042_1125_1667 | 179 |
| 1173 | 3300046517 | Ga0495630_0076512 | Ga0495630_0076512_700_1239 | 179 |
| 1174 | 3300046517 | Ga0495630_1001622 | Ga0495630_1001622_76_615 | 179 |
| 1175 | 3300046517 | Ga0495630_1083785 | Ga0495630_1083785_38_580 | 179 |
| 1176 | 3300046519 | Ga0495632_0043486 | Ga0495632_0043486_1567_2106 | 179 |
| 1177 | 3300046519 | Ga0495632_0084959 | Ga0495632_0084959_545_1084 | 179 |
| 1178 | 3300046520 | Ga0495637_0277425 | Ga0495637_0277425_22_561 | 179 |
| 1179 | 3300046524 | Ga0495648_0055833 | Ga0495648_0055833_1454_1993 | 179 |
| 1180 | 3300046529 | Ga0495652_0131980 | Ga0495652_0131980_871_1413 | 179 |
| 1181 | 3300046531 | Ga0495665_0124948 | Ga0495665_0124948_544_1086 | 179 |
| 1182 | 3300046533 | Ga0495640_0151957 | Ga0495640_0151957_795_1337 | 179 |
| 1183 | 3300046536 | Ga0495587_0029626 | Ga0495587_0029626_931_1473 | 179 |
| 1184 | 3300046539 | Ga0495621_0023719 | Ga0495621_0023719_752_1291 | 179 |
| 1185 | 3300046543 | Ga0495645_0029760 | Ga0495645_0029760_1716_2258 | 179 |
| 1186 | 3300046543 | Ga0495645_0257218 | Ga0495645_0257218_360_902 | 179 |
| 1187 | 3300046559 | Ga0495667_0016573 | Ga0495667_0016573_1128_1670 | 179 |
| 1188 | 3300046559 | Ga0495667_0051369 | Ga0495667_0051369_894_1436 | 179 |
| 1189 | 3300046559 | Ga0495667_0115263 | Ga0495667_0115263_1122_1664 | 179 |
| 1190 | 3300046559 | Ga0495667_0416063 | Ga0495667_0416063_63_605 | 179 |
| 1191 | 3300046559 | Ga0495667_0488916 | Ga0495667_0488916_209_748 | 179 |
| 1192 | 3300046615 | Ga0495656_0186767 | Ga0495656_0186767_380_919 | 179 |
| 1193 | 3300046616 | Ga0495668_0032582 | Ga0495668_0032582_1933_2472 | 179 |
| 1194 | 3300046616 | Ga0495668_0371900 | Ga0495668_0371900_147_686 | 179 |
| 1195 | 3300046660 | Ga0495625_0017237 | Ga0495625_0017237_1126_1665 | 179 |
| 1196 | 3300046660 | Ga0495625_0036484 | Ga0495625_0036484_119_658 | 179 |
| 1197 | 3300046660 | Ga0495625_0069652 | Ga0495625_0069652_1294_1833 | 179 |
| 1198 | 3300046660 | Ga0495625_0166820 | Ga0495625_0166820_862_1443 | 179 |
| 1199 | 3300046660 | Ga0495625_0274337 | Ga0495625_0274337_435_974 | 179 |
| 1200 | 3300046660 | Ga0495625_0365070 | Ga0495625_0365070_213_752 | 179 |
| 1201 | 3300046660 | Ga0495625_0506002 | Ga0495625_0506002_25_564 | 179 |
| 1202 | 3300046675 | Ga0495657_0159093 | Ga0495657_0159093_330_869 | 179 |
| 1203 | 3300046678 | Ga0495599_0481032 | Ga0495599_0481032_107_649 | 179 |
| 1204 | 3300046679 | Ga0495623_0055711 | Ga0495623_0055711_1478_2020 | 179 |
| 1205 | 3300046680 | Ga0495646_0131359 | Ga0495646_0131359_842_1384 | 179 |
| 1206 | 3300046692 | Ga0495671_0004294 | Ga0495671_0004294_8012_8551 | 179 |
| 1207 | 3300046694 | Ga0495649_0046588 | Ga0495649_0046588_1466_2005 | 179 |
| 1208 | 3300046809 | Ga0495600_0108839 | Ga0495600_0108839_598_1140 | 179 |
| 1209 | 3300047317 | Ga0495604_0069026 | Ga0495604_0069026_807_1349 | 179 |
| 1210 | 3300047317 | Ga0495604_0188600 | Ga0495604_0188600_758_1300 | 179 |
| 1211 | 3300047317 | Ga0495604_0189099 | Ga0495604_0189099_625_1164 | 179 |
| 1212 | 3300047319 | Ga0495674_0002309 | Ga0495674_0002309_8808_9350 | 179 |
| 1213 | 3300047319 | Ga0495674_0023603 | Ga0495674_0023603_1309_1851 | 179 |
| 1214 | 3300047319 | Ga0495674_0140585 | Ga0495674_0140585_460_999 | 179 |
| 1215 | 3300047319 | Ga0495674_0142196 | Ga0495674_0142196_1014_1556 | 179 |
| 1216 | 3300047319 | Ga0495674_0242921 | Ga0495674_0242921_807_1349 | 179 |
| 1217 | 3300047319 | Ga0495674_1192591 | Ga0495674_1192591_27_566 | 179 |
| 1218 | 3300047322 | Ga0495680_0300157 | Ga0495680_0300157_238_777 | 179 |
| 1219 | 3300047322 | Ga0495680_0310694 | Ga0495680_0310694_512_1054 | 179 |
| 1220 | 3300047443 | Ga0495687_044475 | Ga0495687_044475_529_1068 | 179 |
| 1221 | 3300047444 | Ga0495675_0033838 | Ga0495675_0033838_622_1164 | 179 |
| 1222 | 3300047444 | Ga0495675_0053461 | Ga0495675_0053461_1942_2484 | 179 |
| 1223 | 3300047469 | Ga0495673_0124530 | Ga0495673_0124530_322_861 | 179 |
| 1224 | 3300047471 | Ga0495684_0003346 | Ga0495684_0003346_9283_9825 | 179 |
| 1225 | 3300047471 | Ga0495684_0065386 | Ga0495684_0065386_1381_1923 | 179 |
| 1226 | 3300047471 | Ga0495684_0402254 | Ga0495684_0402254_376_918 | 179 |
| 1227 | 3300047472 | Ga0495686_0097341 | Ga0495686_0097341_1056_1595 | 179 |
| 1228 | 3300047472 | Ga0495686_0099908 | Ga0495686_0099908_406_945 | 179 |
| 1229 | 3300047472 | Ga0495686_0415088 | Ga0495686_0415088_39_578 | 179 |
| 1230 | 3300048088 | Ga0495602_0010228 | Ga0495602_0010228_53_595 | 179 |
| 1231 | 3300048088 | Ga0495602_0019635 | Ga0495602_0019635_2909_3448 | 179 |
| 1232 | 3300048088 | Ga0495602_0229158 | Ga0495602_0229158_330_869 | 179 |
| 1233 | 3300048903 | Ga0496100_0077980 | Ga0496100_0077980_600_1139 | 179 |
| 1234 | 3300048903 | Ga0496100_0117038 | Ga0496100_0117038_114_653 | 179 |
| 1235 | 3300048903 | Ga0496100_0219368 | Ga0496100_0219368_90_629 | 179 |
| 1236 | 3300048903 | Ga0496100_0530475 | Ga0496100_0530475_39_578 | 179 |
| 1237 | 3300048904 | Ga0496101_0011003 | Ga0496101_0011003_4430_4969 | 179 |
| 1238 | 3300048904 | Ga0496101_0170831 | Ga0496101_0170831_697_1236 | 179 |
| 1239 | 3300048904 | Ga0496101_0912541 | Ga0496101_0912541_127_666 | 179 |
| 1240 | 3300048904 | Ga0496101_1238537 | Ga0496101_1238537_34_573 | 179 |
| 1241 | 3300048905 | Ga0496102_0011185 | Ga0496102_0011185_1826_2365 | 179 |
| 1242 | 3300048905 | Ga0496102_0017816 | Ga0496102_0017816_666_1205 | 179 |
| 1243 | 3300048905 | Ga0496102_0069765 | Ga0496102_0069765_863_1402 | 179 |
| 1244 | 3300048906 | Ga0496103_0038246 | Ga0496103_0038246_15_554 | 179 |
| 1245 | 3300048906 | Ga0496103_0060675 | Ga0496103_0060675_1248_1787 | 179 |
| 1246 | 3300048906 | Ga0496103_0258452 | Ga0496103_0258452_247_855 | 179 |
| 1247 | 3300048906 | Ga0496103_0344059 | Ga0496103_0344059_68_607 | 179 |
| 1248 | 3300048907 | Ga0496104_0010127 | Ga0496104_0010127_1104_1643 | 179 |
| 1249 | 3300048907 | Ga0496104_0097439 | Ga0496104_0097439_160_699 | 179 |
| 1250 | 3300048907 | Ga0496104_0992751 | Ga0496104_0992751_104_643 | 179 |
| 1251 | 3300048908 | Ga0496105_0061592 | Ga0496105_0061592_2526_3065 | 179 |
| 1252 | 3300048908 | Ga0496105_1073248 | Ga0496105_1073248_44_583 | 179 |
| 1253 | 3300048909 | Ga0496106_0028021 | Ga0496106_0028021_2354_2893 | 179 |
| 1254 | 3300048909 | Ga0496106_0060453 | Ga0496106_0060453_166_705 | 179 |
| 1255 | 3300048909 | Ga0496106_0184015 | Ga0496106_0184015_985_1524 | 179 |
| 1256 | 3300048910 | Ga0496107_0224972 | Ga0496107_0224972_334_873 | 179 |
| 1257 | 3300048911 | Ga0496108_0067338 | Ga0496108_0067338_177_716 | 179 |
| 1258 | 3300048911 | Ga0496108_0552979 | Ga0496108_0552979_433_972 | 179 |
| 1259 | 3300048912 | Ga0496109_0059265 | Ga0496109_0059265_2871_3410 | 179 |
| 1260 | 3300048912 | Ga0496109_0800491 | Ga0496109_0800491_309_848 | 179 |
| 1261 | 3300048913 | Ga0496110_0183292 | Ga0496110_0183292_240_779 | 179 |
| 1262 | 3300048913 | Ga0496110_0202342 | Ga0496110_0202342_162_701 | 179 |
| 1263 | 3300048914 | Ga0496111_0007055 | Ga0496111_0007055_1620_2159 | 179 |
| 1264 | 3300048915 | Ga0496112_0006250 | Ga0496112_0006250_4437_4976 | 179 |
| 1265 | 3300048915 | Ga0496112_0040816 | Ga0496112_0040816_2869_3477 | 179 |
| 1266 | 3300048915 | Ga0496112_0428100 | Ga0496112_0428100_527_1066 | 179 |
| 1267 | 3300048916 | Ga0496113_0160546 | Ga0496113_0160546_140_679 | 179 |
| 1268 | 3300048916 | Ga0496113_0166256 | Ga0496113_0166256_1163_1702 | 179 |
| 1269 | 3300048917 | Ga0496114_0001283 | Ga0496114_0001283_10615_11154 | 179 |
| 1270 | 3300048917 | Ga0496114_0077219 | Ga0496114_0077219_777_1316 | 179 |
| 1271 | 3300048917 | Ga0496114_0389571 | Ga0496114_0389571_235_777 | 179 |
| 1272 | 3300048918 | Ga0496115_0007516 | Ga0496115_0007516_4534_5073 | 179 |
| 1273 | 3300048918 | Ga0496115_0015044 | Ga0496115_0015044_4727_5266 | 179 |
| 1274 | 3300048919 | Ga0496116_0017845 | Ga0496116_0017845_3738_4277 | 179 |
| 1275 | 3300048920 | Ga0496117_0000251 | Ga0496117_0000251_64327_64866 | 179 |
| 1276 | 3300048921 | Ga0496118_0000611 | Ga0496118_0000611_36810_37349 | 179 |
| 1277 | 3300048921 | Ga0496118_0038221 | Ga0496118_0038221_1325_1864 | 179 |
| 1278 | 3300048922 | Ga0496119_0000879 | Ga0496119_0000879_15669_16208 | 179 |
| 1279 | 3300048922 | Ga0496119_0005071 | Ga0496119_0005071_9377_9916 | 179 |
| 1280 | 3300048923 | Ga0496120_0000025 | Ga0496120_0000025_32421_32960 | 179 |
| 1281 | 3300048923 | Ga0496120_0034271 | Ga0496120_0034271_1167_1706 | 179 |
| 1282 | 3300048924 | Ga0496121_0006243 | Ga0496121_0006243_5343_5951 | 179 |
| 1283 | 3300048924 | Ga0496121_0026956 | Ga0496121_0026956_1091_1630 | 179 |
| 1284 | 3300048924 | Ga0496121_0027248 | Ga0496121_0027248_3507_4046 | 179 |
| 1285 | 3300048928 | Ga0496125_0004822 | Ga0496125_0004822_5385_5924 | 179 |
| 1286 | 3300048928 | Ga0496125_0043041 | Ga0496125_0043041_1758_2366 | 179 |
| 1287 | 3300048928 | Ga0496125_0072600 | Ga0496125_0072600_464_1003 | 179 |
| 1288 | 3300048929 | Ga0496126_0003192 | Ga0496126_0003192_14228_14767 | 179 |
| 1289 | 3300048929 | Ga0496126_0147414 | Ga0496126_0147414_1245_1790 | 179 |
| 1290 | 3300048929 | Ga0496126_0218636 | Ga0496126_0218636_226_765 | 179 |
| 1291 | 3300049127 | Ga0501306_010628 | Ga0501306_010628_47_586 | 179 |
| 1292 | 3300049127 | Ga0501306_026832 | Ga0501306_026832_22_561 | 179 |
| 1293 | 3300049127 | Ga0501306_068218 | Ga0501306_068218_22_561 | 179 |
| 1294 | 3300049128 | Ga0501308_049651 | Ga0501308_049651_40_579 | 179 |
| 1295 | 3300049129 | Ga0501309_058481 | Ga0501309_058481_26_565 | 179 |
| 1296 | 3300049129 | Ga0501309_067139 | Ga0501309_067139_29_568 | 179 |
| 1297 | 3300049130 | Ga0501310_034440 | Ga0501310_034440_12_557 | 179 |
| 1298 | 3300049130 | Ga0501310_045712 | Ga0501310_045712_53_607 | 179 |
| 1299 | 3300049160 | Ga0501304_017027 | Ga0501304_017027_132_671 | 179 |
| 1300 | 3300049161 | Ga0501305_030731 | Ga0501305_030731_15_554 | 179 |
| 1301 | 3300049161 | Ga0501305_063456 | Ga0501305_063456_17_571 | 179 |
| 1302 | 3300049161 | Ga0501305_070299 | Ga0501305_070299_57_596 | 179 |
| 1303 | 3300049162 | Ga0501307_022402 | Ga0501307_022402_12_551 | 179 |
| 1304 | 3300049162 | Ga0501307_029475 | Ga0501307_029475_132_671 | 179 |
| 1305 | 3300049162 | Ga0501307_054780 | Ga0501307_054780_49_588 | 179 |
| 1306 | 3300049524 | Ga0501301_001136 | Ga0501301_001136_1060_1599 | 179 |
| 1307 | 3300049528 | Ga0501312_019893 | Ga0501312_019893_17_559 | 179 |
| 1308 | 3300049528 | Ga0501312_079272 | Ga0501312_079272_33_572 | 179 |
| 1309 | 3300049529 | Ga0501313_037800 | Ga0501313_037800_46_585 | 179 |
| 1310 | 3300049529 | Ga0501313_045962 | Ga0501313_045962_25_564 | 179 |
| 1311 | 3300049531 | Ga0501315_037936 | Ga0501315_037936_90_629 | 179 |
| 1312 | 3300049534 | Ga0501318_036805 | Ga0501318_036805_12_551 | 179 |
| 1313 | 3300049537 | Ga0501321_062584 | Ga0501321_062584_12_551 | 179 |
| 1314 | 3300049568 | Ga0501031_0035899 | Ga0501031_0035899_137_676 | 179 |
| 1315 | 3300049570 | Ga0501033_0009908 | Ga0501033_0009908_550_1089 | 179 |
| 1316 | 3300049571 | Ga0501034_0061967 | Ga0501034_0061967_1741_2280 | 179 |
| 1317 | 3300049572 | Ga0501036_0047299 | Ga0501036_0047299_2667_3206 | 179 |
| 1318 | 3300049572 | Ga0501036_0233278 | Ga0501036_0233278_100_639 | 179 |
| 1319 | 3300049573 | Ga0501037_0059406 | Ga0501037_0059406_1822_2361 | 179 |
| 1320 | 3300049574 | Ga0501038_0005329 | Ga0501038_0005329_6399_6938 | 179 |
| 1321 | 3300049574 | Ga0501038_0065115 | Ga0501038_0065115_33_572 | 179 |
| 1322 | 3300049574 | Ga0501038_0125098 | Ga0501038_0125098_388_927 | 179 |
| 1323 | 3300049575 | Ga0501039_0005494 | Ga0501039_0005494_6228_6767 | 179 |
| 1324 | 3300049575 | Ga0501039_0011760 | Ga0501039_0011760_2841_3380 | 179 |
| 1325 | 3300049575 | Ga0501039_0135483 | Ga0501039_0135483_1362_1901 | 179 |
| 1326 | 3300049576 | Ga0501040_0006961 | Ga0501040_0006961_1939_2478 | 179 |
| 1327 | 3300049576 | Ga0501040_0009344 | Ga0501040_0009344_3521_4060 | 179 |
| 1328 | 3300049576 | Ga0501040_0073938 | Ga0501040_0073938_87_626 | 179 |
| 1329 | 3300049576 | Ga0501040_0883859 | Ga0501040_0883859_39_578 | 179 |
| 1330 | 3300049577 | Ga0501041_0013770 | Ga0501041_0013770_2501_3040 | 179 |
| 1331 | 3300049577 | Ga0501041_0025726 | Ga0501041_0025726_1170_1709 | 179 |
| 1332 | 3300049578 | Ga0501042_0000915 | Ga0501042_0000915_10772_11311 | 179 |
| 1333 | 3300049578 | Ga0501042_0051806 | Ga0501042_0051806_398_937 | 179 |
| 1334 | 3300049578 | Ga0501042_0068944 | Ga0501042_0068944_1757_2296 | 179 |
| 1335 | 3300049578 | Ga0501042_0728450 | Ga0501042_0728450_159_698 | 179 |
| 1336 | 3300049579 | Ga0501043_0061144 | Ga0501043_0061144_596_1135 | 179 |
| 1337 | 3300049579 | Ga0501043_0218544 | Ga0501043_0218544_146_685 | 179 |
| 1338 | 3300049579 | Ga0501043_0500218 | Ga0501043_0500218_264_803 | 179 |
| 1339 | 3300049579 | Ga0501043_0711352 | Ga0501043_0711352_103_642 | 179 |
| 1340 | 3300049580 | Ga0501046_0008093 | Ga0501046_0008093_6976_7515 | 179 |
| 1341 | 3300049580 | Ga0501046_0020394 | Ga0501046_0020394_4116_4655 | 179 |
| 1342 | 3300049580 | Ga0501046_0190562 | Ga0501046_0190562_867_1406 | 179 |
| 1343 | 3300049581 | Ga0501047_0205297 | Ga0501047_0205297_345_884 | 179 |
| 1344 | 3300049581 | Ga0501047_0282351 | Ga0501047_0282351_937_1491 | 179 |
| 1345 | 3300049582 | Ga0501048_0006562 | Ga0501048_0006562_6488_7027 | 179 |
| 1346 | 3300049582 | Ga0501048_0976963 | Ga0501048_0976963_22_561 | 179 |
| 1347 | 3300049583 | Ga0501067_0014051 | Ga0501067_0014051_1433_1972 | 179 |
| 1348 | 3300049583 | Ga0501067_0125647 | Ga0501067_0125647_138_677 | 179 |
| 1349 | 3300049583 | Ga0501067_0169797 | Ga0501067_0169797_429_968 | 179 |
| 1350 | 3300049584 | Ga0501068_0000867 | Ga0501068_0000867_6109_6648 | 179 |
| 1351 | 3300049584 | Ga0501068_0059666 | Ga0501068_0059666_1048_1587 | 179 |
| 1352 | 3300049584 | Ga0501068_0243459 | Ga0501068_0243459_214_753 | 179 |
| 1353 | 3300049586 | Ga0501070_0060130 | Ga0501070_0060130_2133_2672 | 179 |
| 1354 | 3300049587 | Ga0501071_0004440 | Ga0501071_0004440_4275_4814 | 179 |
| 1355 | 3300049587 | Ga0501071_0021226 | Ga0501071_0021226_3884_4423 | 179 |
| 1356 | 3300049587 | Ga0501071_0392235 | Ga0501071_0392235_320_859 | 179 |
| 1357 | 3300049587 | Ga0501071_1011006 | Ga0501071_1011006_33_572 | 179 |
| 1358 | 3300049588 | Ga0501072_0004135 | Ga0501072_0004135_2570_3109 | 179 |
| 1359 | 3300049588 | Ga0501072_0033552 | Ga0501072_0033552_534_1073 | 179 |
| 1360 | 3300049588 | Ga0501072_0228299 | Ga0501072_0228299_233_772 | 179 |
| 1361 | 3300049588 | Ga0501072_0242447 | Ga0501072_0242447_781_1320 | 179 |
| 1362 | 3300049589 | Ga0501073_0004134 | Ga0501073_0004134_7457_7996 | 179 |
| 1363 | 3300049589 | Ga0501073_0011609 | Ga0501073_0011609_3959_4498 | 179 |
| 1364 | 3300049589 | Ga0501073_0026538 | Ga0501073_0026538_438_977 | 179 |
| 1365 | 3300049589 | Ga0501073_0034466 | Ga0501073_0034466_1055_1594 | 179 |
| 1366 | 3300049589 | Ga0501073_0059015 | Ga0501073_0059015_1816_2355 | 179 |
| 1367 | 3300049590 | Ga0501074_0099931 | Ga0501074_0099931_1248_1787 | 179 |
| 1368 | 3300049590 | Ga0501074_0120613 | Ga0501074_0120613_104_643 | 179 |
| 1369 | 3300049590 | Ga0501074_0242113 | Ga0501074_0242113_62_601 | 179 |
| 1370 | 3300049591 | Ga0501075_0005108 | Ga0501075_0005108_2593_3132 | 179 |
| 1371 | 3300049591 | Ga0501075_0172471 | Ga0501075_0172471_123_662 | 179 |
| 1372 | 3300049591 | Ga0501075_0424194 | Ga0501075_0424194_427_966 | 179 |
| 1373 | 3300049592 | Ga0501076_0010445 | Ga0501076_0010445_4214_4753 | 179 |
| 1374 | 3300049592 | Ga0501076_0011218 | Ga0501076_0011218_2253_2792 | 179 |
| 1375 | 3300049592 | Ga0501076_0049580 | Ga0501076_0049580_2450_2989 | 179 |
| 1376 | 3300049592 | Ga0501076_0218696 | Ga0501076_0218696_262_801 | 179 |
| 1377 | 3300049593 | Ga0501077_0006169 | Ga0501077_0006169_3609_4148 | 179 |
| 1378 | 3300049593 | Ga0501077_0019420 | Ga0501077_0019420_230_769 | 179 |
| 1379 | 3300049593 | Ga0501077_0036799 | Ga0501077_0036799_1023_1562 | 179 |
| 1380 | 3300049593 | Ga0501077_0106262 | Ga0501077_0106262_1138_1677 | 179 |
| 1381 | 3300049676 | Ga0501246_029409 | Ga0501246_029409_16_555 | 179 |
| 1382 | 3300049679 | Ga0501249_023042 | Ga0501249_023042_686_1225 | 179 |
| 1383 | 3300049741 | Ga0501079_0000565 | Ga0501079_0000565_5568_6107 | 179 |
| 1384 | 3300049741 | Ga0501079_0001159 | Ga0501079_0001159_4084_4623 | 179 |
| 1385 | 3300049741 | Ga0501079_0003223 | Ga0501079_0003223_3195_3734 | 179 |
| 1386 | 3300049741 | Ga0501079_0100737 | Ga0501079_0100737_1640_2179 | 179 |
| 1387 | 3300049742 | Ga0501080_0000453 | Ga0501080_0000453_7457_7996 | 179 |
| 1388 | 3300049742 | Ga0501080_0001345 | Ga0501080_0001345_141_680 | 179 |
| 1389 | 3300049742 | Ga0501080_0143961 | Ga0501080_0143961_359_898 | 179 |
| 1390 | 3300049742 | Ga0501080_0479591 | Ga0501080_0479591_32_571 | 179 |
| 1391 | 3300049742 | Ga0501080_0523078 | Ga0501080_0523078_30_569 | 179 |
| 1392 | 3300049742 | Ga0501080_0876561 | Ga0501080_0876561_128_667 | 179 |
| 1393 | 3300049743 | Ga0501081_0000381 | Ga0501081_0000381_19986_20525 | 179 |
| 1394 | 3300049743 | Ga0501081_0008007 | Ga0501081_0008007_4529_5068 | 179 |
| 1395 | 3300049744 | Ga0501083_0001296 | Ga0501083_0001296_13109_13648 | 179 |
| 1396 | 3300049744 | Ga0501083_0026643 | Ga0501083_0026643_1754_2293 | 179 |
| 1397 | 3300049744 | Ga0501083_0073024 | Ga0501083_0073024_700_1239 | 179 |
| 1398 | 3300049744 | Ga0501083_0080694 | Ga0501083_0080694_174_713 | 179 |
| 1399 | 3300049822 | Ga0501035_0004435 | Ga0501035_0004435_4110_4649 | 179 |
| 1400 | 3300049822 | Ga0501035_0019306 | Ga0501035_0019306_4252_4791 | 179 |
| 1401 | 3300049822 | Ga0501035_0871967 | Ga0501035_0871967_136_675 | 179 |
| 1402 | 3300049824 | Ga0501045_0009394 | Ga0501045_0009394_114_653 | 179 |
| 1403 | 3300049824 | Ga0501045_0014470 | Ga0501045_0014470_3084_3623 | 179 |
| 1404 | 3300049824 | Ga0501045_0073028 | Ga0501045_0073028_1926_2465 | 179 |
| 1405 | 3300049824 | Ga0501045_0512433 | Ga0501045_0512433_67_612 | 179 |
| 1406 | 3300049824 | Ga0501045_0668872 | Ga0501045_0668872_56_595 | 179 |
| 1407 | 3300050492 | nmdc:mga0yw44_41471_c1 | nmdc:mga0yw44_41471_c1_595_1134 | 179 |
| 1408 | 3300050492 | nmdc:mga0yw44_816867_c1 | nmdc:mga0yw44_816867_c1_27_566 | 179 |
| 1409 | 3300050493 | nmdc:mga0k408_61132_c1 | nmdc:mga0k408_61132_c1_1082_1621 | 179 |
| 1410 | 3300050507 | nmdc:mga05p37_333657_c1 | nmdc:mga05p37_333657_c1_457_996 | 179 |
| 1411 | 3300050507 | nmdc:mga05p37_3957_c1 | nmdc:mga05p37_3957_c1_8130_8669 | 179 |
| 1412 | 3300050507 | nmdc:mga05p37_617083_c1 | nmdc:mga05p37_617083_c1_70_609 | 179 |
| 1413 | 3300050507 | nmdc:mga05p37_7207_c1 | nmdc:mga05p37_7207_c1_9109_9651 | 179 |
| 1414 | 3300050507 | nmdc:mga05p37_987277_c1 | nmdc:mga05p37_987277_c1_29_568 | 179 |
| 1415 | 3300050508 | nmdc:mga09592_128537_c1 | nmdc:mga09592_128537_c1_1596_2135 | 179 |
| 1416 | 3300050508 | nmdc:mga09592_267633_c1 | nmdc:mga09592_267633_c1_292_831 | 179 |
| 1417 | 3300050508 | nmdc:mga09592_6699_c1 | nmdc:mga09592_6699_c1_1794_2333 | 179 |
| 1418 | 3300050508 | nmdc:mga09592_780_c1 | nmdc:mga09592_780_c1_8956_9498 | 179 |
| 1419 | 3300050509 | nmdc:mga0qj67_13394_c1 | nmdc:mga0qj67_13394_c1_4391_4930 | 179 |
| 1420 | 3300050509 | nmdc:mga0qj67_218813_c1 | nmdc:mga0qj67_218813_c1_414_953 | 179 |
| 1421 | 3300050509 | nmdc:mga0qj67_259927_c1 | nmdc:mga0qj67_259927_c1_40_582 | 179 |
| 1422 | 3300050509 | nmdc:mga0qj67_76540_c1 | nmdc:mga0qj67_76540_c1_793_1332 | 179 |
| 1423 | 3300050509 | nmdc:mga0qj67_8518_c1 | nmdc:mga0qj67_8518_c1_4923_5462 | 179 |
| 1424 | 3300050510 | nmdc:mga06r32_1571_c1 | nmdc:mga06r32_1571_c1_15744_16283 | 179 |
| 1425 | 3300050510 | nmdc:mga06r32_3176_c1 | nmdc:mga06r32_3176_c1_11352_11894 | 179 |
| 1426 | 3300050510 | nmdc:mga06r32_5339_c1 | nmdc:mga06r32_5339_c1_9113_9652 | 179 |
| 1427 | 3300050511 | nmdc:mga08y16_1280306_c1 | nmdc:mga08y16_1280306_c1_86_625 | 179 |
| 1428 | 3300050511 | nmdc:mga08y16_138691_c1 | nmdc:mga08y16_138691_c1_1256_1795 | 179 |
| 1429 | 3300050511 | nmdc:mga08y16_164730_c1 | nmdc:mga08y16_164730_c1_1428_1967 | 179 |
| 1430 | 3300050511 | nmdc:mga08y16_87881_c1 | nmdc:mga08y16_87881_c1_1100_1639 | 179 |
| 1431 | 3300050511 | nmdc:mga08y16_961855_c1 | nmdc:mga08y16_961855_c1_94_633 | 179 |
| 1432 | 3300050512 | nmdc:mga0n895_1690896_c1 | nmdc:mga0n895_1690896_c1_40_579 | 179 |
| 1433 | 3300050512 | nmdc:mga0n895_337372_c1 | nmdc:mga0n895_337372_c1_568_1107 | 179 |
| 1434 | 3300050513 | nmdc:mga0rr50_60574_c1 | nmdc:mga0rr50_60574_c1_1335_1874 | 179 |
| 1435 | 3300050514 | nmdc:mga08x19_102123_c1 | nmdc:mga08x19_102123_c1_858_1397 | 179 |
| 1436 | 3300050514 | nmdc:mga08x19_122209_c1 | nmdc:mga08x19_122209_c1_21_560 | 179 |
| 1437 | 3300050515 | nmdc:mga0a205_163676_c1 | nmdc:mga0a205_163676_c1_1469_2008 | 179 |
| 1438 | 3300053086 | Ga0500578_0309779 | Ga0500578_0309779_36_575 | 179 |
| 1439 | 3300053088 | Ga0500644_0166923 | Ga0500644_0166923_320_859 | 179 |
| 1440 | 3300053091 | Ga0500647_0040234 | Ga0500647_0040234_1313_1858 | 179 |
| 1441 | 3300053092 | Ga0500583_0008778 | Ga0500583_0008778_582_1139 | 179 |
| 1442 | 3300053092 | Ga0500583_0039233 | Ga0500583_0039233_1580_2119 | 179 |
| 1443 | 3300053094 | Ga0500566_0014529 | Ga0500566_0014529_1427_1966 | 179 |
| 1444 | 3300053095 | Ga0500640_002285 | Ga0500640_002285_5611_6150 | 179 |
| 1445 | 3300053096 | Ga0500641_0018886 | Ga0500641_0018886_440_979 | 179 |
| 1446 | 3300053096 | Ga0500641_0155084 | Ga0500641_0155084_36_581 | 179 |
| 1447 | 3300053098 | Ga0500650_0066976 | Ga0500650_0066976_192_731 | 179 |
| 1448 | 3300053102 | Ga0500554_002327 | Ga0500554_002327_1019_1558 | 179 |
| 1449 | 3300053104 | Ga0500556_0000646 | Ga0500556_0000646_20155_20694 | 179 |
| 1450 | 3300053104 | Ga0500556_0015792 | Ga0500556_0015792_120_677 | 179 |
| 1451 | 3300053115 | Ga0500591_164512 | Ga0500591_164512_30_638 | 179 |
| 1452 | 3300053119 | Ga0500595_001726 | Ga0500595_001726_2153_2692 | 179 |
| 1453 | 3300053119 | Ga0500595_006081 | Ga0500595_006081_515_1060 | 179 |
| 1454 | 3300053121 | Ga0500607_229752 | Ga0500607_229752_143_682 | 179 |
| 1455 | 3300053123 | Ga0500614_003262 | Ga0500614_003262_778_1317 | 179 |
| 1456 | 3300053124 | Ga0500617_019473 | Ga0500617_019473_1943_2500 | 179 |
| 1457 | 3300053133 | Ga0500655_042194 | Ga0500655_042194_42_596 | 179 |
| 1458 | 3300053134 | Ga0500658_0165539 | Ga0500658_0165539_145_702 | 179 |
| 1459 | 3300053136 | Ga0500559_0009784 | Ga0500559_0009784_1412_1951 | 179 |
| 1460 | 3300053142 | Ga0500577_0232857 | Ga0500577_0232857_121_660 | 179 |
| 1461 | 3300053146 | Ga0500588_0000279 | Ga0500588_0000279_1992_2537 | 179 |
| 1462 | 3300053146 | Ga0500588_0007867 | Ga0500588_0007867_198_737 | 179 |
| 1463 | 3300053146 | Ga0500588_0102187 | Ga0500588_0102187_272_829 | 179 |
| 1464 | 3300053146 | Ga0500588_0130033 | Ga0500588_0130033_194_733 | 179 |
| 1465 | 3300053153 | Ga0500616_0000096 | Ga0500616_0000096_31283_31828 | 179 |
| 1466 | 3300053153 | Ga0500616_0009124 | Ga0500616_0009124_1368_1907 | 179 |
| 1467 | 3300053156 | Ga0500622_0002975 | Ga0500622_0002975_5466_6005 | 179 |
| 1468 | 3300053156 | Ga0500622_0056851 | Ga0500622_0056851_861_1400 | 179 |
| 1469 | 3300053158 | Ga0500627_0092343 | Ga0500627_0092343_38_577 | 179 |
| 1470 | 3300053178 | Ga0500637_0045803 | Ga0500637_0045803_1825_2364 | 179 |
| 1471 | 3300053178 | Ga0500637_0069933 | Ga0500637_0069933_464_1003 | 179 |
| 1472 | 3300053178 | Ga0500637_0123352 | Ga0500637_0123352_901_1440 | 179 |
| 1473 | 3300053730 | Ga0500645_027276 | Ga0500645_027276_391_930 | 179 |
| 1474 | 3300054114 | Ga0501084_0000703 | Ga0501084_0000703_3935_4474 | 179 |
| 1475 | 3300054114 | Ga0501084_0027449 | Ga0501084_0027449_2056_2595 | 179 |
| 1476 | 3300054114 | Ga0501084_0054651 | Ga0501084_0054651_91_630 | 179 |
| 1477 | 3300054114 | Ga0501084_0342056 | Ga0501084_0342056_175_714 | 179 |
| 1478 | 3300059478 | Ga0587093_037946 | Ga0587093_037946_142_681 | 179 |
| 1479 | 3300059503 | Ga0587080_011658 | Ga0587080_011658_11_553 | 179 |
| 1480 | 3300059505 | Ga0587083_0170672 | Ga0587083_0170672_39_578 | 179 |
| 1481 | 3300060353 | Ga0501082_0001073 | Ga0501082_0001073_1011_1553 | 179 |
| 1482 | 3300060353 | Ga0501082_0002270 | Ga0501082_0002270_15485_16024 | 179 |
| 1483 | 3300060353 | Ga0501082_0018634 | Ga0501082_0018634_4756_5295 | 179 |
| 1484 | 3300060353 | Ga0501082_0022513 | Ga0501082_0022513_2421_2960 | 179 |
| 1485 | 3300060353 | Ga0501082_0082649 | Ga0501082_0082649_1157_1696 | 179 |
| 1486 | 3300060353 | Ga0501082_0165930 | Ga0501082_0165930_1153_1692 | 179 |
| 1487 | 3300060353 | Ga0501082_0315578 | Ga0501082_0315578_454_993 | 179 |
| 1488 | 3300060353 | Ga0501082_1244283 | Ga0501082_1244283_30_569 | 179 |
| 1489 | 3300061734 | Ga0530510_0005434 | Ga0530510_0005434_634_1173 | 179 |
| 1490 | 3300061734 | Ga0530510_0015910 | Ga0530510_0015910_863_1402 | 179 |
| 1491 | 3300061734 | Ga0530510_0701196 | Ga0530510_0701196_147_686 | 179 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4xs1-assembly1.cif.gz_D-2 | salmonella typhimurium ahpc t43v mutant | 0.9523 | 4 | 160 |
| 4xts-assembly2.cif.gz_T | salmonella typhimurium ahpc t43a mutant | 0.9503 | 4 | 160 |
| 4xs6-assembly1.cif.gz_E-2 | salmonella typhimurium ahpc w81f mutant | 0.9495 | 4 | 160 |
| 4ql7-assembly1.cif.gz_D-2 | crystal structure of c-terminus truncated alkylhydroperoxide reductase subunit c (ahpc1-172) from e. coli | 0.9477 | 1 | 160 |
| 3emp-assembly1.cif.gz_D-2 | crystal structure of the s-acetanilide modified form of c165s ahpc | 0.9455 | 4 | 160 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2bmxC00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9232 | 1 | 160 | 3.40.30.10 |
| 5ijtA00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9115 | 3 | 160 | 3.40.30.10 |
| af_P9WQB7_4_193_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8984 | 2 | 178 | 3.40.30.10 |
| 5id2B00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8959 | 1 | 159 | 3.40.30.10 |
| 5b8aJ00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8906 | 1 | 169 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3C2E313-F1-model_v4 | Alkyl hydroperoxide reductase C (EC 1.11.1.26) (Peroxiredoxin) | 0.9768 | 60 | 164 |
GO:0005829
GO:0006979 GO:0008379 GO:0033554 GO:0042744 GO:0045454 |
| AF-A0A4Q6CWX4-F1-model_v4 | deleted | 0.9738 | 1 | 127 |
|
| AF-A0A356KLJ1-F1-model_v4 | Thioredoxin domain-containing protein | 0.9692 | 1 | 160 |
GO:0005829
GO:0006979 GO:0008379 GO:0033554 GO:0042744 GO:0045454 |
| AF-A0A829H4Z3-F1-model_v4 | Alkyl hydroperoxide reductase subunit C | 0.9652 | 1 | 160 |
GO:0005829
GO:0006979 GO:0008379 GO:0033554 GO:0042744 GO:0045454 |
| AF-A0A846P0V0-F1-model_v4 | Redoxin domain-containing protein | 0.9642 | 2 | 154 |
GO:0005829
GO:0006979 GO:0008379 GO:0033554 GO:0042744 GO:0045454 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar