F494335

General Info

Members Datasets Scaffolds Average Seq Length
1491 509 1491 179

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10007059|Ga0105240_100070597
Length 218
Sequence MASIEIIKSIDWPLTGPDRIILPTPQGLRGPPFTRSISTMTGIGKQFPRFELKGTVSSDLNHAFQTFTNDSFPGKWQVVFFWPKDFTFVCPTEIAAFGKLNREFQARDAQILGVSIDSEFVHLAWRQAKDELKNLPFPMLADIKRELSGSLGVLDPGEGVAQRATFIVDPQGVIRFVYVTDLNVGRSPEEVLRVLDALQTDELCPCNWKKGEETLRAA

Samples

Sample ID Description Type Environment
1 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003568 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
14 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
15 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
16 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
18 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
33 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
34 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
35 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
36 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
37 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
38 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
39 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
40 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
41 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
42 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
43 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
44 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
47 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
48 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
49 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
50 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
51 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
52 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
53 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
54 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
55 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
56 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
57 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
58 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
59 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
60 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
61 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
62 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
63 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
64 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
65 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
66 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
67 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
68 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
69 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
70 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
71 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
72 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
73 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
74 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
75 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
76 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
77 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
78 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
79 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
80 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
81 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
82 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
83 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
84 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
85 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
86 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
87 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
88 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
89 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
90 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
91 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
92 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
93 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
94 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
95 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
96 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
98 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
99 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
100 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
101 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
102 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
103 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
104 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
105 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
106 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
107 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
108 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
109 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
110 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
111 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
112 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
113 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
114 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
115 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
116 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
117 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
118 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
119 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
120 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
121 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
122 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
123 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
124 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
125 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
126 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
127 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
128 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
129 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
130 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
131 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
132 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
133 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
134 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
135 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
136 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
137 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
138 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
139 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
140 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
143 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
144 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
145 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
146 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
147 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
148 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
149 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
150 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
151 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
152 3300023304 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctno.R1 Metatranscriptome Rhizosphere
153 3300023309 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctcc.R1 Metatranscriptome Rhizosphere
154 3300023436 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.stno.R1 Metatranscriptome Rhizosphere
155 3300023438 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.stcc Metatranscriptome Rhizosphere
156 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
219 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
226 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
227 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
230 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
234 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
235 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
236 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
237 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
238 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
239 3300029272 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.ctno.R1 Metatranscriptome Rhizosphere
240 3300029276 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.ctcc.R1 Metatranscriptome Rhizosphere
241 3300029277 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1 Metatranscriptome Rhizosphere
242 3300029280 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stcc.R1 Metatranscriptome Rhizosphere
243 3300029283 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctno.R1 Metatranscriptome Rhizosphere
244 3300029285 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 Metatranscriptome Rhizosphere
245 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
246 3300030836 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
247 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
248 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
249 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
250 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
251 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
252 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
253 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
254 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
255 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
256 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
257 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
258 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
259 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
260 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
261 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
262 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
263 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
264 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
265 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
266 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
267 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
268 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
269 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
270 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
271 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
272 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
273 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
274 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
275 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
276 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
277 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
278 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
279 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
280 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
281 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
282 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
283 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
284 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
285 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
286 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
287 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
288 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
289 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
290 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
291 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
292 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
293 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
294 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
295 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
296 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
297 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
298 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
299 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
300 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
301 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
302 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
303 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
304 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
305 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
306 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
307 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
308 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
309 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
310 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
311 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
312 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
313 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
314 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
315 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
316 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
317 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
318 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
319 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
320 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
321 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
322 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
323 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
324 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
325 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
326 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
327 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
328 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
329 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
330 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
331 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
332 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
333 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
334 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
335 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
336 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
337 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
338 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
339 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
340 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
341 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
342 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
343 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
344 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
345 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
346 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
347 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
348 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
349 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
350 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
351 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
352 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
353 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
354 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
355 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
356 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
357 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
358 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
359 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
360 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
361 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
362 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
363 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
364 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
365 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
366 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
367 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
368 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
369 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
370 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
371 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
372 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
373 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
374 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
375 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
376 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
377 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
378 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
379 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
380 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
381 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
382 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
383 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
384 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
385 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
386 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
387 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
388 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
389 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
390 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
391 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
392 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
393 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
394 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
395 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
396 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
397 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
398 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
399 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
400 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
401 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
402 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
403 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
404 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
405 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
406 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
407 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
408 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
409 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
410 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
411 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
412 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
413 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
414 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
415 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
416 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
417 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
418 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
419 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
420 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
421 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
422 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
423 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
424 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
425 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
426 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
427 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
428 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
429 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
430 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
431 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
432 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
433 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
434 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
435 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
436 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
437 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
438 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
439 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
440 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
441 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
442 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
443 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
444 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
445 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
446 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
447 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
448 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
449 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
450 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
451 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
452 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
453 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
454 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
455 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
456 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
457 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
458 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
459 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
460 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
461 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
462 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
463 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
464 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
465 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
466 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
467 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
468 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
469 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
470 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
471 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
472 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
473 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
474 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
475 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
476 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
477 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
478 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
479 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
480 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
481 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
482 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
483 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
484 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
485 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
486 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
487 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
488 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
489 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
490 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
491 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
492 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
493 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
494 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
495 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
496 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
497 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
498 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
499 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
500 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
501 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
502 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
503 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
504 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
505 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
506 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
507 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
508 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
509 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.63
Metatranscriptomes 6.37
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.95
Nodule 0.07
Rhizoplane 3.09
Rhizosphere 90.34
Stem 0
Stem Tuber 0
Unclassified 3.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24742J22300_10055810 3300002244 Bacteria 721
2 JGI25162J39368_1004290 3300002737 Bacteria 3407
3 Ga0006778J45830_1034955 3300003162 Bacteria 783
4 Ga0006778J45830_1090249 3300003162 Bacteria 591
5 Ga0006759J45824_1031269 3300003163 Bacteria 656
6 Ga0006759J45824_1051790 3300003163 Bacteria 582
7 Ga0006759J45824_1064721 3300003163 Bacteria 643
8 Ga0006759J45824_1080555 3300003163 Bacteria 810
9 JGI25406J46586_10010550 3300003203 Bacteria 4095
10 JGI25406J46586_10025326 3300003203 Bacteria 2305
11 Ga0006777J48905_1023601 3300003308 Bacteria 696
12 Ga0006777J48905_1071737 3300003308 Bacteria 700
13 rootL2_10052881 3300003322 Bacteria 2766
14 Ga0006781J51513_1035968 3300003568 Bacteria 677
15 Ga0007410J51695_1022950 3300003574 Bacteria 1143
16 Ga0007410J51695_1053083 3300003574 Bacteria 657
17 Ga0007416J51690_1050632 3300003577 Bacteria 697
18 Ga0032354_1033655 3300003693 Bacteria 895
19 Ga0032354_1036149 3300003693 Bacteria 857
20 Ga0032354_1048806 3300003693 Bacteria 738
21 Ga0006780_1013989 3300003735 Bacteria 602
22 Ga0006780_1029819 3300003735 Bacteria 665
23 Ga0058859_10026294 3300004798 Bacteria 674
24 Ga0058861_11963726 3300004800 Bacteria 841
25 Ga0058860_10060066 3300004801 Bacteria 620
26 Ga0058860_10076721 3300004801 Bacteria 1026
27 Ga0058860_10088687 3300004801 Bacteria 1415
28 Ga0058860_12240042 3300004801 Bacteria 826
29 Ga0065714_10044263 3300005288 Bacteria 854
30 Ga0065712_10004198 3300005290 Bacteria 3650
31 Ga0065712_10119918 3300005290 Bacteria 1685
32 Ga0065712_10281568 3300005290 Bacteria 891
33 Ga0065712_10466766 3300005290 Bacteria 626
34 Ga0065715_10014079 3300005293 Bacteria 1793
35 Ga0065715_10028357 3300005293 Bacteria 1302
36 Ga0065715_10104963 3300005293 Bacteria 2924
37 Ga0065715_10110463 3300005293 Bacteria 2619
38 Ga0065715_10140004 3300005293 Bacteria 1868
39 Ga0065707_10174103 3300005295 Bacteria 1463
40 Ga0065707_10432960 3300005295 Bacteria 818
41 Ga0070658_10873019 3300005327 Bacteria 782
42 Ga0070676_10140118 3300005328 Bacteria 1539
43 Ga0070676_10148617 3300005328 Bacteria 1498
44 Ga0070683_100038614 3300005329 Bacteria 4378
45 Ga0070683_100133601 3300005329 Bacteria 2349
46 Ga0070683_100223074 3300005329 Bacteria 1791
47 Ga0070683_100835648 3300005329 Bacteria 883
48 Ga0070690_100001531 3300005330 Bacteria 12113
49 Ga0070690_100001718 3300005330 Bacteria 11553
50 Ga0070690_100062600 3300005330 Bacteria 2399
51 Ga0070690_100413850 3300005330 Bacteria 993
52 Ga0070670_100116676 3300005331 Bacteria 2302
53 Ga0070670_100127799 3300005331 Bacteria 2193
54 Ga0070670_100364276 3300005331 Bacteria 1271
55 Ga0070677_10175027 3300005333 Bacteria 1018
56 Ga0068869_100003998 3300005334 Bacteria 9119
57 Ga0068869_100029761 3300005334 Bacteria 3829
58 Ga0068869_100084730 3300005334 Bacteria 2373
59 Ga0068869_101356181 3300005334 Bacteria 629
60 Ga0070666_10004699 3300005335 Bacteria 8345
61 Ga0070666_10013206 3300005335 Bacteria 5235
62 Ga0070666_10055545 3300005335 Bacteria 2673
63 Ga0070680_100009202 3300005336 Bacteria 7576
64 Ga0070680_100018985 3300005336 Bacteria 5442
65 Ga0070680_100075132 3300005336 Bacteria 2782
66 Ga0070680_100110853 3300005336 Bacteria 2284
67 Ga0070680_100129541 3300005336 Bacteria 2110
68 Ga0070680_100140105 3300005336 Bacteria 2028
69 Ga0070680_100276503 3300005336 Bacteria 1422
70 Ga0070680_100390122 3300005336 Bacteria 1186
71 Ga0070680_100429129 3300005336 Bacteria 1128
72 Ga0070682_100005572 3300005337 Bacteria 7014
73 Ga0070682_100030755 3300005337 Bacteria 3244
74 Ga0070682_100252677 3300005337 Bacteria 1272
75 Ga0070682_101014679 3300005337 Bacteria 689
76 Ga0068868_100008181 3300005338 Bacteria 7482
77 Ga0068868_100135724 3300005338 Bacteria 2016
78 Ga0070660_100406918 3300005339 Bacteria 1126
79 Ga0070689_100003814 3300005340 Bacteria 10097
80 Ga0070689_100119758 3300005340 Bacteria 2101
81 Ga0070689_100188925 3300005340 Bacteria 1677
82 Ga0070689_100748014 3300005340 Bacteria 857
83 Ga0070691_10031657 3300005341 Bacteria 2482
84 Ga0070691_10234599 3300005341 Bacteria 978
85 Ga0070687_100002571 3300005343 Bacteria 6846
86 Ga0070687_100195228 3300005343 Bacteria 1223
87 Ga0070661_100002493 3300005344 Bacteria 12612
88 Ga0070661_100165759 3300005344 Bacteria 1676
89 Ga0070692_10019677 3300005345 Bacteria 3261
90 Ga0070692_10027265 3300005345 Bacteria 2830
91 Ga0070668_100053464 3300005347 Bacteria 3115
92 Ga0070668_100092499 3300005347 Bacteria 2385
93 Ga0070669_100024257 3300005353 Bacteria 4349
94 Ga0070669_100053235 3300005353 Bacteria 2962
95 Ga0070669_100273498 3300005353 Bacteria 1351
96 Ga0070669_100494667 3300005353 Bacteria 1014
97 Ga0070669_100834761 3300005353 Bacteria 784
98 Ga0070669_100865487 3300005353 Bacteria 771
99 Ga0070675_100010921 3300005354 Bacteria 7104
100 Ga0070675_100011633 3300005354 Bacteria 6893
101 Ga0070675_100278063 3300005354 Bacteria 1470
102 Ga0070675_100301190 3300005354 Bacteria 1412
103 Ga0070671_100005633 3300005355 Bacteria 9968
104 Ga0070671_100009823 3300005355 Bacteria 7680
105 Ga0070671_100027320 3300005355 Bacteria 4696
106 Ga0070671_100085042 3300005355 Bacteria 2645
107 Ga0070671_100158214 3300005355 Bacteria 1915
108 Ga0070671_100460060 3300005355 Bacteria 1092
109 Ga0070674_100039351 3300005356 Bacteria 3192
110 Ga0070674_100045974 3300005356 Bacteria 2984
111 Ga0070674_100129468 3300005356 Bacteria 1879
112 Ga0070674_100497617 3300005356 Bacteria 1015
113 Ga0070674_100721984 3300005356 Bacteria 854
114 Ga0070673_100021060 3300005364 Bacteria 4717
115 Ga0070673_100024898 3300005364 Bacteria 4395
116 Ga0070673_100044903 3300005364 Bacteria 3424
117 Ga0070673_100371438 3300005364 Bacteria 1273
118 Ga0070673_100409217 3300005364 Bacteria 1214
119 Ga0070688_100001922 3300005365 Bacteria 10439
120 Ga0070688_100098823 3300005365 Bacteria 1921
121 Ga0070688_100234486 3300005365 Bacteria 1300
122 Ga0070688_100373797 3300005365 Bacteria 1049
123 Ga0070688_100484889 3300005365 Bacteria 930
124 Ga0070659_100161443 3300005366 Bacteria 1832
125 Ga0070659_100300740 3300005366 Bacteria 1338
126 Ga0070659_101144045 3300005366 Bacteria 687
127 Ga0070667_100000011 3300005367 Bacteria 269772
128 Ga0070667_100029415 3300005367 Bacteria 4577
129 Ga0070667_100066033 3300005367 Bacteria 3073
130 Ga0070667_100413023 3300005367 Bacteria 1230
131 Ga0070667_100584150 3300005367 Bacteria 1029
132 Ga0070667_100707215 3300005367 Bacteria 933
133 Ga0070709_10008243 3300005434 Bacteria 5721
134 Ga0070709_10037581 3300005434 Bacteria 2958
135 Ga0070709_10599611 3300005434 Bacteria 848
136 Ga0070714_100005056 3300005435 Bacteria 10031
137 Ga0070713_100000161 3300005436 Bacteria 45444
138 Ga0070713_100015790 3300005436 Bacteria 5658
139 Ga0070713_100112789 3300005436 Bacteria 2373
140 Ga0070713_100117990 3300005436 Bacteria 2323
141 Ga0070713_100137932 3300005436 Bacteria 2157
142 Ga0070710_10052096 3300005437 Bacteria 2301
143 Ga0070710_10254036 3300005437 Bacteria 1131
144 Ga0070701_10052866 3300005438 Bacteria 2112
145 Ga0070701_10539132 3300005438 Bacteria 764
146 Ga0070711_100175658 3300005439 Bacteria 1636
147 Ga0070711_101472529 3300005439 Bacteria 593
148 Ga0070705_100060432 3300005440 Bacteria 2248
149 Ga0070700_100013887 3300005441 Bacteria 4534
150 Ga0070700_100014864 3300005441 Bacteria 4400
151 Ga0070700_100062509 3300005441 Bacteria 2352
152 Ga0070700_100130090 3300005441 Bacteria 1698
153 Ga0070700_100130486 3300005441 Bacteria 1695
154 Ga0070708_100659527 3300005445 Bacteria 986
155 Ga0070663_100144080 3300005455 Bacteria 1821
156 Ga0070663_100209047 3300005455 Bacteria 1527
157 Ga0070678_100007254 3300005456 Bacteria 6560
158 Ga0070678_100016401 3300005456 Bacteria 4739
159 Ga0070678_100105706 3300005456 Bacteria 2192
160 Ga0070678_100240690 3300005456 Bacteria 1513
161 Ga0070678_100460806 3300005456 Bacteria 1115
162 Ga0070662_100018507 3300005457 Bacteria 4713
163 Ga0070662_100237739 3300005457 Bacteria 1460
164 Ga0070681_10003202 3300005458 Bacteria 15250
165 Ga0070681_10018495 3300005458 Bacteria 6965
166 Ga0070681_10034684 3300005458 Bacteria 5067
167 Ga0070681_10050700 3300005458 Bacteria 4141
168 Ga0070681_10057069 3300005458 Bacteria 3885
169 Ga0070681_10135263 3300005458 Bacteria 2396
170 Ga0070681_10410600 3300005458 Bacteria 1266
171 Ga0070681_10479982 3300005458 Bacteria 1156
172 Ga0070681_10988195 3300005458 Unclassified 761
173 Ga0068867_100356474 3300005459 Bacteria 1222
174 Ga0068867_100561019 3300005459 Bacteria 990
175 Ga0068867_100601595 3300005459 Bacteria 959
176 Ga0068867_100692053 3300005459 Bacteria 899
177 Ga0068867_100989373 3300005459 Bacteria 762
178 Ga0070707_100166622 3300005468 Bacteria 2147
179 Ga0070698_100003450 3300005471 Bacteria 17393
180 Ga0070699_100385215 3300005518 Bacteria 1266
181 Ga0070699_101308213 3300005518 Bacteria 665
182 Ga0070679_100029331 3300005530 Bacteria 5428
183 Ga0070679_100120363 3300005530 Bacteria 2610
184 Ga0070679_100121897 3300005530 Bacteria 2592
185 Ga0070679_100135159 3300005530 Bacteria 2447
186 Ga0070679_100204893 3300005530 Bacteria 1937
187 Ga0070679_100458302 3300005530 Bacteria 1220
188 Ga0070679_100848135 3300005530 Bacteria 857
189 Ga0070679_101126297 3300005530 Bacteria 730
190 Ga0070684_100002573 3300005535 Bacteria 13400
191 Ga0070684_100040392 3300005535 Bacteria 4017
192 Ga0070684_100605533 3300005535 Bacteria 1019
193 Ga0070684_101050360 3300005535 Bacteria 765
194 Ga0068853_100849591 3300005539 Bacteria 875
195 Ga0068853_100921835 3300005539 Bacteria 839
196 Ga0068853_100932233 3300005539 Bacteria 835
197 Ga0068853_101042865 3300005539 Bacteria 788
198 Ga0070672_100018046 3300005543 Bacteria 5092
199 Ga0070672_100057039 3300005543 Bacteria 3065
200 Ga0070672_100231671 3300005543 Bacteria 1552
201 Ga0070672_100232701 3300005543 Bacteria 1548
202 Ga0070672_100253443 3300005543 Bacteria 1483
203 Ga0070672_100813064 3300005543 Bacteria 823
204 Ga0070672_101346824 3300005543 Bacteria 638
205 Ga0070686_100003317 3300005544 Bacteria 8816
206 Ga0070686_100036607 3300005544 Bacteria 3040
207 Ga0070686_100090483 3300005544 Bacteria 2046
208 Ga0070686_100250400 3300005544 Bacteria 1294
209 Ga0070686_100377995 3300005544 Bacteria 1072
210 Ga0070686_100775245 3300005544 Bacteria 771
211 Ga0070686_101156942 3300005544 Bacteria 641
212 Ga0070695_100634540 3300005545 Bacteria 842
213 Ga0070696_100090533 3300005546 Bacteria 2177
214 Ga0070696_100250139 3300005546 Bacteria 1340
215 Ga0070693_100244942 3300005547 Bacteria 1186
216 Ga0070693_100580284 3300005547 Bacteria 807
217 Ga0070665_100001687 3300005548 Bacteria 25457
218 Ga0070665_100002827 3300005548 Bacteria 18791
219 Ga0070665_100094327 3300005548 Bacteria 2997
220 Ga0070665_100109779 3300005548 Bacteria 2760
221 Ga0070665_100121768 3300005548 Bacteria 2610
222 Ga0070665_100146654 3300005548 Bacteria 2363
223 Ga0070665_100157767 3300005548 Bacteria 2271
224 Ga0070665_100318697 3300005548 Bacteria 1559
225 Ga0070665_100328961 3300005548 Bacteria 1533
226 Ga0070704_100028868 3300005549 Bacteria 3697
227 Ga0068855_100009392 3300005563 Bacteria 11811
228 Ga0068855_100010992 3300005563 Bacteria 10923
229 Ga0068855_100035062 3300005563 Bacteria 5978
230 Ga0068855_100050765 3300005563 Bacteria 4886
231 Ga0068855_100072666 3300005563 Bacteria 3997
232 Ga0068855_100232277 3300005563 Bacteria 2065
233 Ga0068855_101422622 3300005563 Bacteria 714
234 Ga0070664_100001025 3300005564 Bacteria 21947
235 Ga0070664_100081493 3300005564 Bacteria 2789
236 Ga0070664_100111372 3300005564 Bacteria 2389
237 Ga0070664_100463335 3300005564 Bacteria 1165
238 Ga0070664_100486902 3300005564 Bacteria 1136
239 Ga0070664_100507834 3300005564 Bacteria 1112
240 Ga0068857_100040769 3300005577 Bacteria 4116
241 Ga0068857_100043190 3300005577 Bacteria 3998
242 Ga0068857_100159520 3300005577 Bacteria 2046
243 Ga0068857_100446228 3300005577 Bacteria 1209
244 Ga0068857_100592291 3300005577 Bacteria 1048
245 Ga0068854_100053452 3300005578 Bacteria 2901
246 Ga0068854_100288862 3300005578 Bacteria 1323
247 Ga0068854_100431501 3300005578 Bacteria 1096
248 Ga0068854_100538253 3300005578 Bacteria 989
249 Ga0068856_100020206 3300005614 Bacteria 6469
250 Ga0068856_100041061 3300005614 Bacteria 4546
251 Ga0068856_100075876 3300005614 Bacteria 3330
252 Ga0068856_100104583 3300005614 Bacteria 2825
253 Ga0068852_100100858 3300005616 Bacteria 2605
254 Ga0068852_101190394 3300005616 Bacteria 783
255 Ga0068859_100000715 3300005617 Bacteria 33463
256 Ga0068859_100016276 3300005617 Bacteria 7471
257 Ga0068859_100024730 3300005617 Bacteria 6027
258 Ga0068859_100086680 3300005617 Bacteria 3178
259 Ga0068859_100107183 3300005617 Bacteria 2854
260 Ga0068859_100339583 3300005617 Bacteria 1596
261 Ga0068859_100411252 3300005617 Bacteria 1449
262 Ga0068859_100638488 3300005617 Bacteria 1157
263 Ga0068859_100779843 3300005617 Bacteria 1044
264 Ga0068859_101135195 3300005617 Bacteria 860
265 Ga0068864_100005754 3300005618 Bacteria 10172
266 Ga0068864_100016171 3300005618 Bacteria 6210
267 Ga0068864_100175244 3300005618 Bacteria 1957
268 Ga0068864_100219989 3300005618 Bacteria 1752
269 Ga0068864_101638907 3300005618 Bacteria 648
270 Ga0068866_10004184 3300005718 Bacteria 5921
271 Ga0068866_10351346 3300005718 Bacteria 937
272 Ga0068866_10785035 3300005718 Bacteria 661
273 Ga0068861_100013223 3300005719 Bacteria 5774
274 Ga0068861_100021947 3300005719 Bacteria 4593
275 Ga0068861_100086189 3300005719 Bacteria 2468
276 Ga0068861_100090868 3300005719 Bacteria 2409
277 Ga0068861_100124813 3300005719 Bacteria 2082
278 Ga0068861_100154175 3300005719 Bacteria 1888
279 Ga0068861_100608226 3300005719 Bacteria 1004
280 Ga0068861_101333808 3300005719 Bacteria 699
281 Ga0068870_10003073 3300005840 Bacteria 7039
282 Ga0068870_10013288 3300005840 Bacteria 3867
283 Ga0068870_10064795 3300005840 Bacteria 1975
284 Ga0068870_10322056 3300005840 Bacteria 982
285 Ga0068863_100002979 3300005841 Bacteria 16748
286 Ga0068863_100005241 3300005841 Bacteria 12793
287 Ga0068863_100009569 3300005841 Bacteria 9452
288 Ga0068863_100072398 3300005841 Bacteria 3260
289 Ga0068863_100379148 3300005841 Bacteria 1381
290 Ga0068863_100696262 3300005841 Bacteria 1010
291 Ga0068863_100804324 3300005841 Bacteria 938
292 Ga0068863_100848960 3300005841 Bacteria 912
293 Ga0068858_100005002 3300005842 Bacteria 12988
294 Ga0068858_100012054 3300005842 Bacteria 8149
295 Ga0068858_100014520 3300005842 Bacteria 7420
296 Ga0068858_100061049 3300005842 Bacteria 3484
297 Ga0068858_100174328 3300005842 Bacteria 2029
298 Ga0068858_100551473 3300005842 Bacteria 1116
299 Ga0068860_100003286 3300005843 Bacteria 16643
300 Ga0068860_100024072 3300005843 Bacteria 5886
301 Ga0068860_100064892 3300005843 Bacteria 3467
302 Ga0068860_100065361 3300005843 Bacteria 3454
303 Ga0068860_100108788 3300005843 Bacteria 2649
304 Ga0068860_100146073 3300005843 Bacteria 2276
305 Ga0068862_100001470 3300005844 Bacteria 21626
306 Ga0068862_100002059 3300005844 Bacteria 18164
307 Ga0068862_100004086 3300005844 Bacteria 12374
308 Ga0068862_100058178 3300005844 Bacteria 3315
309 Ga0068862_100200402 3300005844 Bacteria 1799
310 Ga0068862_100875473 3300005844 Bacteria 882
311 Ga0068862_100962035 3300005844 Bacteria 842
312 Ga0068862_101255489 3300005844 Bacteria 741
313 Ga0068862_101782262 3300005844 Bacteria 625
314 Ga0081455_10001012 3300005937 Bacteria 35566
315 Ga0081455_10057666 3300005937 Bacteria 3290
316 Ga0081455_10600666 3300005937 Bacteria 717
317 Ga0081539_10000055 3300005985 Bacteria 257359
318 Ga0081539_10004424 3300005985 Bacteria 15535
319 Ga0081539_10005465 3300005985 Bacteria 12954
320 Ga0081539_10047289 3300005985 Bacteria 2458
321 Ga0070717_11153218 3300006028 Bacteria 705
322 Ga0075365_10204243 3300006038 Bacteria 1384
323 Ga0070715_10316173 3300006163 Bacteria 841
324 Ga0070716_100002584 3300006173 Bacteria 8362
325 Ga0070716_100006429 3300006173 Bacteria 5739
326 Ga0070716_100053175 3300006173 Bacteria 2308
327 Ga0070716_100266822 3300006173 Bacteria 1174
328 Ga0070712_100001982 3300006175 Bacteria 12540
329 Ga0070712_100032042 3300006175 Bacteria 3547
330 Ga0070712_100146152 3300006175 Bacteria 1810
331 Ga0075366_10144311 3300006195 Bacteria 1440
332 Ga0075366_10435087 3300006195 Bacteria 809
333 Ga0097621_100004031 3300006237 Bacteria 10186
334 Ga0097621_100004662 3300006237 Bacteria 9575
335 Ga0097621_100075288 3300006237 Bacteria 2797
336 Ga0097621_100096165 3300006237 Bacteria 2485
337 Ga0097621_100131167 3300006237 Bacteria 2133
338 Ga0097621_100171335 3300006237 Bacteria 1871
339 Ga0097621_100207521 3300006237 Bacteria 1703
340 Ga0097621_100210662 3300006237 Bacteria 1691
341 Ga0097621_100251778 3300006237 Bacteria 1547
342 Ga0097621_100416746 3300006237 Bacteria 1205
343 Ga0068871_100015582 3300006358 Bacteria 5696
344 Ga0068871_100017404 3300006358 Bacteria 5439
345 Ga0068871_100082487 3300006358 Bacteria 2666
346 Ga0068871_100097128 3300006358 Bacteria 2462
347 Ga0068871_100254001 3300006358 Bacteria 1532
348 Ga0068871_100342520 3300006358 Bacteria 1320
349 Ga0068871_100359803 3300006358 Bacteria 1289
350 Ga0068871_100383971 3300006358 Bacteria 1248
351 Ga0068871_100437282 3300006358 Bacteria 1170
352 Ga0068871_101339547 3300006358 Bacteria 674
353 Ga0075428_100000991 3300006844 Bacteria 30093
354 Ga0075428_100004128 3300006844 Bacteria 15990
355 Ga0075428_100006037 3300006844 Bacteria 13455
356 Ga0075430_100001603 3300006846 Bacteria 18468
357 Ga0075430_100026158 3300006846 Bacteria 4965
358 Ga0075430_100399433 3300006846 Bacteria 1134
359 Ga0075430_100682693 3300006846 Bacteria 846
360 Ga0075431_100002145 3300006847 Bacteria 18863
361 Ga0075431_100005153 3300006847 Bacteria 12866
362 Ga0075431_100010663 3300006847 Bacteria 9236
363 Ga0075431_100125160 3300006847 Bacteria 2652
364 Ga0075433_10665798 3300006852 Bacteria 912
365 Ga0075434_100350625 3300006871 Bacteria 1497
366 Ga0075429_100000892 3300006880 Bacteria 23610
367 Ga0075429_100004377 3300006880 Bacteria 12121
368 Ga0075429_100208872 3300006880 Bacteria 1710
369 Ga0075429_100376568 3300006880 Bacteria 1243
370 Ga0068865_100011129 3300006881 Bacteria 5619
371 Ga0068865_100041920 3300006881 Bacteria 3117
372 Ga0068865_100151242 3300006881 Bacteria 1761
373 Ga0068865_100227477 3300006881 Bacteria 1461
374 Ga0068865_100275012 3300006881 Bacteria 1338
375 Ga0075436_100070848 3300006914 Bacteria 2410
376 Ga0075436_100490443 3300006914 Bacteria 898
377 Ga0097620_100000715 3300006931 Bacteria 33463
378 Ga0097620_100016276 3300006931 Bacteria 7471
379 Ga0097620_100024730 3300006931 Bacteria 6027
380 Ga0097620_100086677 3300006931 Bacteria 3178
381 Ga0097620_100107187 3300006931 Bacteria 2854
382 Ga0097620_100339606 3300006931 Bacteria 1596
383 Ga0097620_100411213 3300006931 Bacteria 1449
384 Ga0097620_100638372 3300006931 Bacteria 1157
385 Ga0097620_100780080 3300006931 Bacteria 1044
386 Ga0097620_101135376 3300006931 Bacteria 860
387 Ga0099826_10018619 3300006948 Bacteria 5238
388 Ga0075435_100093833 3300007076 Bacteria 2480
389 Ga0105250_10054875 3300009092 Bacteria 1599
390 Ga0105250_10087463 3300009092 Bacteria 1265
391 Ga0105240_10005273 3300009093 Bacteria 19301
392 Ga0105240_10007059 3300009093 Bacteria 16375
393 Ga0105240_10007550 3300009093 Bacteria 15759
394 Ga0105240_10012718 3300009093 Bacteria 11600
395 Ga0105240_10024084 3300009093 Bacteria 8037
396 Ga0105240_10030802 3300009093 Bacteria 6970
397 Ga0105240_10086562 3300009093 Bacteria 3838
398 Ga0105240_10110534 3300009093 Bacteria 3326
399 Ga0105240_10134635 3300009093 Bacteria 2960
400 Ga0105240_10238722 3300009093 Bacteria 2108
401 Ga0105240_10480810 3300009093 Bacteria 1384
402 Ga0105240_10546096 3300009093 Bacteria 1283
403 Ga0105240_10686700 3300009093 Bacteria 1119
404 Ga0105240_10843405 3300009093 Bacteria 990
405 Ga0111539_10018383 3300009094 Bacteria 8658
406 Ga0111539_10101187 3300009094 Bacteria 3383
407 Ga0111539_10203540 3300009094 Bacteria 2308
408 Ga0111539_11420043 3300009094 Bacteria 805
409 Ga0111539_11489965 3300009094 Bacteria 785
410 Ga0111539_12179859 3300009094 Bacteria 643
411 Ga0105245_10009918 3300009098 Bacteria 8296
412 Ga0105245_10037278 3300009098 Bacteria 4323
413 Ga0105245_10574927 3300009098 Bacteria 1151
414 Ga0105245_10815366 3300009098 Bacteria 972
415 Ga0105247_10000557 3300009101 Bacteria 30302
416 Ga0105247_10006388 3300009101 Bacteria 7296
417 Ga0105247_10015442 3300009101 Bacteria 4574
418 Ga0105247_10030282 3300009101 Bacteria 3280
419 Ga0114129_10000531 3300009147 Bacteria 46637
420 Ga0105243_10093409 3300009148 Bacteria 2483
421 Ga0105241_10024074 3300009174 Bacteria 4522
422 Ga0105241_10321408 3300009174 Bacteria 1335
423 Ga0105241_10460378 3300009174 Bacteria 1127
424 Ga0105241_11270332 3300009174 Bacteria 700
425 Ga0105242_10000894 3300009176 Bacteria 23159
426 Ga0105242_10064423 3300009176 Bacteria 3022
427 Ga0105242_10248244 3300009176 Bacteria 1603
428 Ga0105242_11105889 3300009176 Bacteria 807
429 Ga0105248_10009456 3300009177 Bacteria 10731
430 Ga0105248_10012607 3300009177 Bacteria 9327
431 Ga0105248_10013134 3300009177 Bacteria 9119
432 Ga0105248_10141359 3300009177 Bacteria 2715
433 Ga0105248_10325348 3300009177 Bacteria 1732
434 Ga0105248_10382087 3300009177 Bacteria 1586
435 Ga0105248_10674855 3300009177 Bacteria 1166
436 Ga0105248_10678850 3300009177 Bacteria 1162
437 Ga0105237_10009386 3300009545 Bacteria 10480
438 Ga0105237_10018532 3300009545 Bacteria 7203
439 Ga0105237_10183150 3300009545 Bacteria 2094
440 Ga0105237_10560306 3300009545 Bacteria 1149
441 Ga0105238_10004856 3300009551 Bacteria 13304
442 Ga0105238_10010977 3300009551 Bacteria 9109
443 Ga0105238_10028530 3300009551 Bacteria 5685
444 Ga0105238_10058638 3300009551 Bacteria 3858
445 Ga0105238_10100214 3300009551 Bacteria 2880
446 Ga0105238_10139985 3300009551 Bacteria 2397
447 Ga0105238_10294035 3300009551 Bacteria 1607
448 Ga0105238_10316126 3300009551 Bacteria 1547
449 Ga0105238_10399888 3300009551 Bacteria 1367
450 Ga0105249_10005395 3300009553 Bacteria 11037
451 Ga0105249_10016314 3300009553 Bacteria 6588
452 Ga0105249_10125676 3300009553 Bacteria 2442
453 Ga0105249_10288378 3300009553 Bacteria 1642
454 Ga0105249_10508058 3300009553 Bacteria 1251
455 Ga0105249_11443842 3300009553 Bacteria 760
456 Ga0105030_102515 3300009987 Bacteria 1595
457 Ga0105239_10013750 3300010375 Bacteria 8984
458 Ga0105239_10016193 3300010375 Bacteria 8248
459 Ga0105239_10027633 3300010375 Bacteria 6243
460 Ga0105239_10091018 3300010375 Bacteria 3366
461 Ga0105239_11058539 3300010375 Bacteria 933
462 Ga0105246_10189467 3300011119 Bacteria 1591
463 Ga0105246_10392668 3300011119 Bacteria 1150
464 Ga0105246_10804113 3300011119 Bacteria 834
465 Ga0105246_11376354 3300011119 Bacteria 657
466 Ga0157371_11089482 3300013102 Bacteria 612
467 Ga0157370_10022372 3300013104 Bacteria 6290
468 Ga0157369_10011861 3300013105 Bacteria 9898
469 Ga0157369_10031473 3300013105 Bacteria 5841
470 Ga0157369_10040019 3300013105 Bacteria 5120
471 Ga0157369_10472630 3300013105 Bacteria 1297
472 Ga0157369_10493345 3300013105 Bacteria 1267
473 Ga0157369_11268421 3300013105 Bacteria 751
474 Ga0157374_10013136 3300013296 Bacteria 7223
475 Ga0157374_10074346 3300013296 Bacteria 3209
476 Ga0157374_10101969 3300013296 Bacteria 2752
477 Ga0157374_10142442 3300013296 Bacteria 2327
478 Ga0157374_10411530 3300013296 Bacteria 1350
479 Ga0157374_10510983 3300013296 Bacteria 1207
480 Ga0157374_10560903 3300013296 Bacteria 1150
481 Ga0157374_11411107 3300013296 Bacteria 719
482 Ga0157374_11495737 3300013296 Bacteria 698
483 Ga0157378_10166673 3300013297 Bacteria 2064
484 Ga0157378_10430930 3300013297 Bacteria 1305
485 Ga0157378_10604741 3300013297 Bacteria 1108
486 Ga0157378_10732017 3300013297 Bacteria 1011
487 Ga0157378_10732359 3300013297 Bacteria 1010
488 Ga0157378_10874950 3300013297 Bacteria 928
489 Ga0157378_10995778 3300013297 Bacteria 872
490 Ga0163162_10037985 3300013306 Bacteria 4806
491 Ga0163162_10054126 3300013306 Bacteria 4035
492 Ga0163162_10072548 3300013306 Bacteria 3498
493 Ga0163162_10073471 3300013306 Bacteria 3475
494 Ga0163162_10077666 3300013306 Bacteria 3384
495 Ga0163162_10840573 3300013306 Bacteria 1034
496 Ga0157372_10084867 3300013307 Bacteria 3591
497 Ga0157372_10101471 3300013307 Bacteria 3285
498 Ga0157372_10197671 3300013307 Bacteria 2329
499 Ga0157372_10455049 3300013307 Bacteria 1492
500 Ga0157372_10800718 3300013307 Bacteria 1095
501 Ga0157372_10828932 3300013307 Bacteria 1074
502 Ga0157375_10010672 3300013308 Bacteria 8089
503 Ga0157375_10014363 3300013308 Bacteria 7061
504 Ga0157375_10117846 3300013308 Bacteria 2761
505 Ga0157375_10218727 3300013308 Bacteria 2063
506 Ga0157375_10228711 3300013308 Bacteria 2019
507 Ga0157375_10470359 3300013308 Bacteria 1422
508 Ga0157375_11057754 3300013308 Bacteria 949
509 Ga0157375_11152615 3300013308 Bacteria 908
510 Ga0163163_10004439 3300014325 Bacteria 11966
511 Ga0163163_10011676 3300014325 Bacteria 7977
512 Ga0163163_10150958 3300014325 Bacteria 2367
513 Ga0163163_10421409 3300014325 Bacteria 1394
514 Ga0163163_10473536 3300014325 Bacteria 1313
515 Ga0163163_10631814 3300014325 Bacteria 1134
516 Ga0163163_10771357 3300014325 Bacteria 1025
517 Ga0163163_12131122 3300014325 Bacteria 620
518 Ga0157380_10004096 3300014326 Bacteria 10075
519 Ga0157380_10006341 3300014326 Bacteria 8317
520 Ga0157380_10028709 3300014326 Bacteria 4245
521 Ga0157380_10038698 3300014326 Bacteria 3705
522 Ga0157380_10050117 3300014326 Bacteria 3296
523 Ga0157380_10515769 3300014326 Bacteria 1165
524 Ga0157380_10636489 3300014326 Bacteria 1061
525 Ga0157380_10729029 3300014326 Bacteria 1000
526 Ga0157380_10991984 3300014326 Bacteria 873
527 Ga0157380_11022243 3300014326 Bacteria 861
528 Ga0157380_11643943 3300014326 Bacteria 699
529 Ga0157380_11752540 3300014326 Bacteria 679
530 Ga0182008_10124920 3300014497 Bacteria 1280
531 Ga0157377_10012496 3300014745 Bacteria 4272
532 Ga0157377_10094493 3300014745 Bacteria 1771
533 Ga0157377_10131096 3300014745 Bacteria 1531
534 Ga0157379_10076147 3300014968 Bacteria 3004
535 Ga0157379_10110837 3300014968 Bacteria 2464
536 Ga0157379_10172442 3300014968 Bacteria 1953
537 Ga0157379_10184982 3300014968 Bacteria 1882
538 Ga0157379_10207484 3300014968 Bacteria 1773
539 Ga0157379_10255555 3300014968 Bacteria 1591
540 Ga0157379_10262245 3300014968 Bacteria 1570
541 Ga0157376_10063557 3300014969 Bacteria 3110
542 Ga0157376_10120904 3300014969 Bacteria 2321
543 Ga0157376_10200370 3300014969 Bacteria 1836
544 Ga0157376_10324251 3300014969 Bacteria 1465
545 Ga0157376_10373326 3300014969 Bacteria 1372
546 Ga0157376_10868025 3300014969 Bacteria 919
547 Ga0163161_10038470 3300017792 Bacteria 3431
548 Ga0163161_10086608 3300017792 Bacteria 2312
549 Ga0163161_10677238 3300017792 Bacteria 857
550 Ga0206356_11050776 3300020070 Bacteria 781
551 Ga0206349_1898117 3300020075 Bacteria 827
552 Ga0206355_1087629 3300020076 Bacteria 912
553 Ga0206355_1138380 3300020076 Bacteria 892
554 Ga0206355_1256135 3300020076 Bacteria 1095
555 Ga0206355_1310435 3300020076 Bacteria 1098
556 Ga0206355_1571275 3300020076 Bacteria 1109
557 Ga0206355_1687272 3300020076 Bacteria 1095
558 Ga0206351_10084949 3300020077 Bacteria 785
559 Ga0206350_10652330 3300020080 Bacteria 711
560 Ga0206354_11591843 3300020081 Bacteria 758
561 Ga0213873_10009552 3300021358 Bacteria 2019
562 Ga0213872_10217700 3300021361 Bacteria 814
563 Ga0213874_10017174 3300021377 Bacteria 1937
564 Ga0213874_10073231 3300021377 Bacteria 1097
565 Ga0213876_10057608 3300021384 Bacteria 2052
566 Ga0213871_10060277 3300021441 Bacteria 1056
567 Ga0213871_10083117 3300021441 Bacteria 920
568 Ga0224712_10027153 3300022467 Bacteria 2033
569 Ga0224712_10160940 3300022467 Bacteria 1001
570 Ga0224712_10203175 3300022467 Bacteria 901
571 Ga0224712_10374318 3300022467 Bacteria 676
572 Ga0224712_10478910 3300022467 Bacteria 600
573 Ga0256714_109273 3300023304 Bacteria 743
574 Ga0256714_117914 3300023304 Bacteria 1063
575 Ga0256714_130426 3300023304 Bacteria 1119
576 Ga0256744_100180 3300023309 Bacteria 845
577 Ga0256744_124239 3300023309 Bacteria 1004
578 Ga0256743_120810 3300023436 Bacteria 719
579 Ga0256720_106382 3300023438 Bacteria 769
580 Ga0256720_120993 3300023438 Bacteria 938
581 Ga0207682_10025845 3300025893 Bacteria 2330
582 Ga0207692_10014797 3300025898 Bacteria 3416
583 Ga0207692_10231777 3300025898 Bacteria 1099
584 Ga0207642_10018122 3300025899 Bacteria 2695
585 Ga0207642_10091343 3300025899 Bacteria 1504
586 Ga0207642_10561600 3300025899 Bacteria 706
587 Ga0207710_10016751 3300025900 Bacteria 3103
588 Ga0207710_10017004 3300025900 Bacteria 3082
589 Ga0207710_10072271 3300025900 Bacteria 1584
590 Ga0207688_10033787 3300025901 Bacteria 2830
591 Ga0207688_10567662 3300025901 Bacteria 714
592 Ga0207680_10005980 3300025903 Bacteria 5846
593 Ga0207680_10108040 3300025903 Bacteria 1799
594 Ga0207680_10205517 3300025903 Bacteria 1344
595 Ga0207647_10146697 3300025904 Bacteria 1380
596 Ga0207699_10008193 3300025906 Bacteria 5145
597 Ga0207699_10035696 3300025906 Bacteria 2830
598 Ga0207645_10003653 3300025907 Bacteria 11609
599 Ga0207645_10024776 3300025907 Bacteria 3887
600 Ga0207645_10155569 3300025907 Bacteria 1494
601 Ga0207643_10007300 3300025908 Bacteria 5929
602 Ga0207643_10008594 3300025908 Bacteria 5475
603 Ga0207643_10050955 3300025908 Bacteria 2349
604 Ga0207643_10118712 3300025908 Bacteria 1564
605 Ga0207654_10224380 3300025911 Bacteria 1248
606 Ga0207654_10376454 3300025911 Bacteria 983
607 Ga0207654_10694667 3300025911 Bacteria 731
608 Ga0207707_10001046 3300025912 Bacteria 26538
609 Ga0207707_10001063 3300025912 Bacteria 26333
610 Ga0207707_10029907 3300025912 Bacteria 4763
611 Ga0207707_10038018 3300025912 Bacteria 4205
612 Ga0207707_10045189 3300025912 Bacteria 3838
613 Ga0207707_10065562 3300025912 Bacteria 3163
614 Ga0207707_10250455 3300025912 Bacteria 1539
615 Ga0207707_10308629 3300025912 Bacteria 1367
616 Ga0207695_10012669 3300025913 Bacteria 10102
617 Ga0207695_10013605 3300025913 Bacteria 9691
618 Ga0207695_10014888 3300025913 Bacteria 9179
619 Ga0207695_10022293 3300025913 Bacteria 7197
620 Ga0207695_10079417 3300025913 Bacteria 3326
621 Ga0207695_10094303 3300025913 Bacteria 3000
622 Ga0207695_10098536 3300025913 Bacteria 2922
623 Ga0207695_10149224 3300025913 Bacteria 2278
624 Ga0207695_10151194 3300025913 Bacteria 2260
625 Ga0207695_10154088 3300025913 Bacteria 2234
626 Ga0207695_10183131 3300025913 Bacteria 2015
627 Ga0207695_10948710 3300025913 Bacteria 740
628 Ga0207671_10062052 3300025914 Bacteria 2775
629 Ga0207671_10238569 3300025914 Bacteria 1428
630 Ga0207671_10336716 3300025914 Bacteria 1195
631 Ga0207693_10000343 3300025915 Bacteria 42997
632 Ga0207693_10038208 3300025915 Bacteria 3781
633 Ga0207693_10143200 3300025915 Bacteria 1879
634 Ga0207693_11131736 3300025915 Bacteria 593
635 Ga0207663_10024971 3300025916 Bacteria 3448
636 Ga0207663_10335859 3300025916 Bacteria 1140
637 Ga0207663_10638706 3300025916 Bacteria 839
638 Ga0207660_10003539 3300025917 Bacteria 10178
639 Ga0207660_10007909 3300025917 Bacteria 6879
640 Ga0207660_10045796 3300025917 Bacteria 3083
641 Ga0207660_10120743 3300025917 Bacteria 1985
642 Ga0207660_10128931 3300025917 Bacteria 1924
643 Ga0207660_10407250 3300025917 Bacteria 1096
644 Ga0207660_10614739 3300025917 Bacteria 885
645 Ga0207660_10651873 3300025917 Bacteria 858
646 Ga0207662_10086288 3300025918 Bacteria 1923
647 Ga0207662_10111372 3300025918 Bacteria 1707
648 Ga0207662_10217599 3300025918 Bacteria 1242
649 Ga0207662_10280596 3300025918 Bacteria 1102
650 Ga0207657_10133022 3300025919 Bacteria 2037
651 Ga0207649_10033170 3300025920 Bacteria 3083
652 Ga0207649_10186726 3300025920 Bacteria 1455
653 Ga0207652_10006570 3300025921 Bacteria 9373
654 Ga0207652_10018358 3300025921 Bacteria 5736
655 Ga0207652_10101803 3300025921 Bacteria 2538
656 Ga0207652_10137088 3300025921 Bacteria 2186
657 Ga0207652_10410592 3300025921 Bacteria 1221
658 Ga0207652_10659257 3300025921 Bacteria 935
659 Ga0207652_11210495 3300025921 Bacteria 657
660 Ga0207652_11305661 3300025921 Bacteria 628
661 Ga0207681_10050431 3300025923 Bacteria 2816
662 Ga0207681_10061283 3300025923 Bacteria 2585
663 Ga0207681_10453518 3300025923 Bacteria 1044
664 Ga0207694_10117316 3300025924 Bacteria 2122
665 Ga0207694_10163111 3300025924 Bacteria 1801
666 Ga0207694_10233765 3300025924 Bacteria 1501
667 Ga0207694_10303183 3300025924 Bacteria 1316
668 Ga0207694_10306080 3300025924 Bacteria 1309
669 Ga0207694_10311731 3300025924 Bacteria 1297
670 Ga0207694_10371666 3300025924 Bacteria 1186
671 Ga0207694_10445441 3300025924 Bacteria 1081
672 Ga0207650_10041517 3300025925 Bacteria 3371
673 Ga0207650_10371870 3300025925 Bacteria 1179
674 Ga0207650_10522953 3300025925 Bacteria 993
675 Ga0207650_11052694 3300025925 Bacteria 692
676 Ga0207659_10044341 3300025926 Bacteria 3128
677 Ga0207659_10126075 3300025926 Bacteria 1969
678 Ga0207659_10158256 3300025926 Bacteria 1775
679 Ga0207659_10167622 3300025926 Bacteria 1730
680 Ga0207659_10978200 3300025926 Bacteria 728
681 Ga0207687_10058430 3300025927 Bacteria 2713
682 Ga0207687_10707264 3300025927 Bacteria 855
683 Ga0207700_10000245 3300025928 Bacteria 32472
684 Ga0207700_10045557 3300025928 Bacteria 3237
685 Ga0207700_10072360 3300025928 Bacteria 2658
686 Ga0207700_10282312 3300025928 Bacteria 1428
687 Ga0207664_10030820 3300025929 Bacteria 4099
688 Ga0207644_10001535 3300025931 Bacteria 14873
689 Ga0207644_10007221 3300025931 Bacteria 7229
690 Ga0207644_10028354 3300025931 Bacteria 3875
691 Ga0207644_10057643 3300025931 Bacteria 2805
692 Ga0207690_10058335 3300025932 Bacteria 2611
693 Ga0207690_10444345 3300025932 Bacteria 1041
694 Ga0207690_11191681 3300025932 Bacteria 636
695 Ga0207706_10002507 3300025933 Bacteria 17895
696 Ga0207706_10006432 3300025933 Bacteria 10911
697 Ga0207706_10054130 3300025933 Bacteria 3542
698 Ga0207706_10691937 3300025933 Bacteria 871
699 Ga0207686_10013112 3300025934 Bacteria 4578
700 Ga0207709_10230668 3300025935 Bacteria 1341
701 Ga0207670_10034476 3300025936 Bacteria 3271
702 Ga0207670_10637647 3300025936 Bacteria 877
703 Ga0207670_10912288 3300025936 Bacteria 736
704 Ga0207669_10020704 3300025937 Bacteria 3455
705 Ga0207669_10057973 3300025937 Bacteria 2361
706 Ga0207669_10137697 3300025937 Bacteria 1689
707 Ga0207669_10764683 3300025937 Bacteria 799
708 Ga0207704_10034972 3300025938 Bacteria 2873
709 Ga0207704_10237326 3300025938 Bacteria 1360
710 Ga0207704_10322539 3300025938 Bacteria 1192
711 Ga0207665_10011562 3300025939 Bacteria 5798
712 Ga0207665_10081413 3300025939 Bacteria 2229
713 Ga0207665_10138324 3300025939 Bacteria 1734
714 Ga0207691_10002085 3300025940 Bacteria 19519
715 Ga0207691_10011812 3300025940 Bacteria 8381
716 Ga0207691_10012001 3300025940 Bacteria 8309
717 Ga0207691_10067981 3300025940 Bacteria 3220
718 Ga0207691_10399138 3300025940 Bacteria 1173
719 Ga0207691_10399185 3300025940 Bacteria 1173
720 Ga0207711_10031266 3300025941 Bacteria 4494
721 Ga0207711_10183942 3300025941 Bacteria 1901
722 Ga0207711_10281105 3300025941 Bacteria 1533
723 Ga0207711_10334932 3300025941 Bacteria 1400
724 Ga0207711_10738353 3300025941 Bacteria 918
725 Ga0207711_11008204 3300025941 Bacteria 772
726 Ga0207711_11026120 3300025941 Bacteria 765
727 Ga0207689_10001269 3300025942 Bacteria 24346
728 Ga0207689_10013247 3300025942 Bacteria 7034
729 Ga0207689_10014425 3300025942 Bacteria 6721
730 Ga0207661_10039152 3300025944 Bacteria 3720
731 Ga0207661_10065862 3300025944 Bacteria 2942
732 Ga0207661_10195353 3300025944 Bacteria 1776
733 Ga0207661_10229210 3300025944 Bacteria 1644
734 Ga0207661_10277135 3300025944 Bacteria 1498
735 Ga0207679_10105262 3300025945 Bacteria 2215
736 Ga0207679_10124800 3300025945 Bacteria 2056
737 Ga0207679_10379264 3300025945 Bacteria 1239
738 Ga0207679_10537271 3300025945 Bacteria 1047
739 Ga0207679_10833385 3300025945 Bacteria 842
740 Ga0207667_10001150 3300025949 Bacteria 33284
741 Ga0207667_10003474 3300025949 Bacteria 19448
742 Ga0207667_10012196 3300025949 Bacteria 9927
743 Ga0207667_10205164 3300025949 Bacteria 2021
744 Ga0207667_10244892 3300025949 Bacteria 1834
745 Ga0207667_10363517 3300025949 Bacteria 1476
746 Ga0207667_10873656 3300025949 Bacteria 892
747 Ga0207667_11455956 3300025949 Bacteria 657
748 Ga0207651_10008465 3300025960 Bacteria 5559
749 Ga0207651_10023567 3300025960 Bacteria 3790
750 Ga0207651_10046838 3300025960 Bacteria 2911
751 Ga0207651_10344412 3300025960 Bacteria 1253
752 Ga0207651_10494815 3300025960 Bacteria 1056
753 Ga0207712_10034875 3300025961 Bacteria 3413
754 Ga0207712_10039461 3300025961 Bacteria 3235
755 Ga0207712_10172351 3300025961 Bacteria 1692
756 Ga0207712_10277738 3300025961 Bacteria 1366
757 Ga0207712_10339311 3300025961 Bacteria 1245
758 Ga0207712_10823836 3300025961 Bacteria 817
759 Ga0207712_11249686 3300025961 Bacteria 663
760 Ga0207668_10005626 3300025972 Bacteria 7386
761 Ga0207640_10146673 3300025981 Bacteria 1728
762 Ga0207640_10731600 3300025981 Bacteria 851
763 Ga0207658_10000046 3300025986 Bacteria 130772
764 Ga0207658_10212687 3300025986 Bacteria 1621
765 Ga0207658_10453940 3300025986 Bacteria 1135
766 Ga0207658_10520633 3300025986 Bacteria 1061
767 Ga0207677_10158353 3300026023 Bacteria 1756
768 Ga0207677_10161352 3300026023 Bacteria 1742
769 Ga0207677_10733929 3300026023 Bacteria 879
770 Ga0207703_10001297 3300026035 Bacteria 23122
771 Ga0207703_10005685 3300026035 Bacteria 10006
772 Ga0207703_10217676 3300026035 Bacteria 1706
773 Ga0207703_10659709 3300026035 Bacteria 993
774 Ga0207639_10684101 3300026041 Bacteria 951
775 Ga0207639_10688642 3300026041 Bacteria 948
776 Ga0207639_10778989 3300026041 Bacteria 890
777 Ga0207678_10033130 3300026067 Bacteria 4502
778 Ga0207678_10088861 3300026067 Bacteria 2641
779 Ga0207678_10095922 3300026067 Bacteria 2534
780 Ga0207678_10199441 3300026067 Bacteria 1711
781 Ga0207708_10011839 3300026075 Bacteria 6495
782 Ga0207708_10027141 3300026075 Bacteria 4336
783 Ga0207708_10032970 3300026075 Bacteria 3933
784 Ga0207708_10065887 3300026075 Bacteria 2769
785 Ga0207708_10114863 3300026075 Bacteria 2093
786 Ga0207702_10042270 3300026078 Bacteria 3823
787 Ga0207702_10198278 3300026078 Bacteria 1859
788 Ga0207702_10221018 3300026078 Bacteria 1765
789 Ga0207702_10321912 3300026078 Bacteria 1473
790 Ga0207702_11110888 3300026078 Bacteria 785
791 Ga0207641_10001107 3300026088 Bacteria 27070
792 Ga0207641_10009498 3300026088 Bacteria 8017
793 Ga0207641_10030599 3300026088 Bacteria 4460
794 Ga0207641_10063843 3300026088 Bacteria 3146
795 Ga0207641_10166310 3300026088 Bacteria 2009
796 Ga0207641_10179304 3300026088 Bacteria 1939
797 Ga0207648_10006603 3300026089 Bacteria 11518
798 Ga0207648_10015775 3300026089 Bacteria 6929
799 Ga0207648_10034879 3300026089 Bacteria 4435
800 Ga0207648_10074835 3300026089 Bacteria 2952
801 Ga0207648_10118417 3300026089 Bacteria 2328
802 Ga0207648_10427841 3300026089 Bacteria 1203
803 Ga0207676_10005142 3300026095 Bacteria 9260
804 Ga0207676_10135564 3300026095 Bacteria 2100
805 Ga0207676_10387442 3300026095 Bacteria 1303
806 Ga0207676_10399366 3300026095 Bacteria 1284
807 Ga0207676_10570977 3300026095 Bacteria 1083
808 Ga0207674_10021269 3300026116 Bacteria 6992
809 Ga0207674_10175259 3300026116 Bacteria 2097
810 Ga0207674_10511360 3300026116 Bacteria 1160
811 Ga0207674_11018346 3300026116 Bacteria 797
812 Ga0207675_100002246 3300026118 Bacteria 19216
813 Ga0207675_100019823 3300026118 Bacteria 6276
814 Ga0207675_100022386 3300026118 Bacteria 5886
815 Ga0207675_100032167 3300026118 Bacteria 4887
816 Ga0207675_100088034 3300026118 Bacteria 2917
817 Ga0207675_100099065 3300026118 Bacteria 2745
818 Ga0207675_100607503 3300026118 Bacteria 1097
819 Ga0207675_100840914 3300026118 Bacteria 932
820 Ga0207675_100973492 3300026118 Bacteria 866
821 Ga0207683_10001586 3300026121 Bacteria 20511
822 Ga0207683_10012593 3300026121 Bacteria 7214
823 Ga0207683_10131880 3300026121 Bacteria 2248
824 Ga0207683_10181853 3300026121 Bacteria 1906
825 Ga0207683_10279247 3300026121 Bacteria 1526
826 Ga0207683_10844886 3300026121 Bacteria 850
827 Ga0207698_10188454 3300026142 Bacteria 1834
828 Ga0209973_1006807 3300027252 Bacteria 1259
829 Ga0209981_1012113 3300027378 Bacteria 1192
830 Ga0209996_1016230 3300027395 Bacteria 1021
831 Ga0210000_1014497 3300027462 Bacteria 1181
832 Ga0209995_1021879 3300027471 Bacteria 1060
833 Ga0209982_1000647 3300027552 Bacteria 4398
834 Ga0209970_1001806 3300027614 Bacteria 3704
835 Ga0209970_1022312 3300027614 Bacteria 1074
836 Ga0210002_1003967 3300027617 Bacteria 2197
837 Ga0210002_1012379 3300027617 Bacteria 1325
838 Ga0209983_1000958 3300027665 Bacteria 6363
839 Ga0209971_1002508 3300027682 Bacteria 4407
840 Ga0209971_1006403 3300027682 Bacteria 2784
841 Ga0209998_10001105 3300027717 Bacteria 6738
842 Ga0209974_10007834 3300027876 Bacteria 3668
843 Ga0209974_10053724 3300027876 Bacteria 1357
844 Ga0207428_10013272 3300027907 Bacteria 7203
845 Ga0207428_10013404 3300027907 Bacteria 7162
846 Ga0207428_10125257 3300027907 Bacteria 1968
847 Ga0268266_10000546 3300028379 Bacteria 52540
848 Ga0268266_10000702 3300028379 Bacteria 45182
849 Ga0268266_10008608 3300028379 Bacteria 9061
850 Ga0268266_10018660 3300028379 Bacteria 5910
851 Ga0268266_10138460 3300028379 Bacteria 2182
852 Ga0268266_10254761 3300028379 Bacteria 1624
853 Ga0268266_10384367 3300028379 Bacteria 1324
854 Ga0268266_10439947 3300028379 Bacteria 1238
855 Ga0268266_10773979 3300028379 Bacteria 927
856 Ga0268265_10001988 3300028380 Bacteria 16181
857 Ga0268265_10008712 3300028380 Bacteria 6860
858 Ga0268265_10041644 3300028380 Bacteria 3402
859 Ga0268265_10080847 3300028380 Bacteria 2564
860 Ga0268265_10103451 3300028380 Bacteria 2306
861 Ga0268265_10274988 3300028380 Bacteria 1504
862 Ga0268265_10473251 3300028380 Bacteria 1175
863 Ga0268265_10574507 3300028380 Bacteria 1073
864 Ga0268265_10815739 3300028380 Bacteria 910
865 Ga0268265_11430080 3300028380 Bacteria 694
866 Ga0268265_11490719 3300028380 Bacteria 680
867 Ga0268265_11686333 3300028380 Bacteria 639
868 Ga0268264_10000085 3300028381 Bacteria 240739
869 Ga0268264_10050877 3300028381 Bacteria 3451
870 Ga0268264_10054438 3300028381 Bacteria 3341
871 Ga0268264_10299807 3300028381 Bacteria 1512
872 Ga0268264_10301998 3300028381 Bacteria 1507
873 Ga0268264_10354146 3300028381 Bacteria 1398
874 Ga0268264_11435067 3300028381 Bacteria 701
875 Ga0265334_10047476 3300028573 Bacteria 1656
876 Ga0265318_10077258 3300028577 Bacteria 1231
877 Ga0265323_10000510 3300028653 Bacteria 21714
878 Ga0307517_10264337 3300028786 Bacteria 996
879 Ga0307515_10345458 3300028794 Bacteria 1138
880 Ga0265338_10002924 3300028800 Bacteria 24790
881 Ga0265338_10021907 3300028800 Bacteria 6640
882 Ga0265338_10039065 3300028800 Bacteria 4485
883 Ga0265338_10784389 3300028800 Bacteria 654
884 Ga0311000_120665 3300029272 Bacteria 932
885 Ga0311004_108406 3300029276 Bacteria 880
886 Ga0311004_142814 3300029276 Bacteria 935
887 Ga0311001_1017080 3300029277 Bacteria 971
888 Ga0311001_1026809 3300029277 Bacteria 772
889 Ga0311001_1027304 3300029277 Bacteria 639
890 Ga0311001_1051811 3300029277 Bacteria 1383
891 Ga0311001_1102328 3300029277 Bacteria 695
892 Ga0311011_111105 3300029280 Bacteria 643
893 Ga0311011_113820 3300029280 Bacteria 852
894 Ga0311011_129310 3300029280 Bacteria 942
895 Ga0311011_141075 3300029280 Bacteria 1191
896 Ga0310982_100635 3300029283 Bacteria 765
897 Ga0310981_1017140 3300029285 Bacteria 864
898 Ga0310981_1047544 3300029285 Bacteria 881
899 Ga0310981_1079241 3300029285 Bacteria 1494
900 Ga0307511_10001897 3300030521 Bacteria 21953
901 Ga0307511_10028879 3300030521 Bacteria 5022
902 Ga0265767_107209 3300030836 Bacteria 704
903 Ga0265765_1033012 3300030879 Bacteria 667
904 Ga0265330_10092997 3300031235 Bacteria 1293
905 Ga0265332_10178208 3300031238 Bacteria 886
906 Ga0265325_10222495 3300031241 Bacteria 863
907 Ga0265329_10070872 3300031242 Bacteria 1103
908 Ga0265340_10015902 3300031247 Bacteria 3903
909 Ga0265340_10078805 3300031247 Bacteria 1553
910 Ga0265340_10129929 3300031247 Bacteria 1156
911 Ga0265339_10018466 3300031249 Bacteria 4109
912 Ga0265331_10021357 3300031250 Bacteria 3313
913 Ga0265316_10001714 3300031344 Bacteria 23275
914 Ga0265316_10003861 3300031344 Bacteria 15027
915 Ga0265316_10022943 3300031344 Bacteria 5250
916 Ga0265316_10027184 3300031344 Bacteria 4743
917 Ga0265316_10028987 3300031344 Bacteria 4558
918 Ga0265316_10067284 3300031344 Bacteria 2770
919 Ga0265316_10125236 3300031344 Bacteria 1938
920 Ga0265316_10262611 3300031344 Bacteria 1266
921 Ga0265316_10488995 3300031344 Bacteria 880
922 Ga0307513_10007959 3300031456 Bacteria 13638
923 Ga0307513_10014058 3300031456 Bacteria 9801
924 Ga0307513_10062517 3300031456 Bacteria 3934
925 Ga0307513_10067032 3300031456 Bacteria 3769
926 Ga0307509_10000008 3300031507 Bacteria 354271
927 Ga0307509_10000543 3300031507 Bacteria 64572
928 Ga0307509_10056828 3300031507 Bacteria 4152
929 Ga0307509_10247988 3300031507 Bacteria 1567
930 Ga0307509_10554218 3300031507 Bacteria 827
931 Ga0307408_100015686 3300031548 Bacteria 5048
932 Ga0307408_100092155 3300031548 Bacteria 2290
933 Ga0307408_100196219 3300031548 Bacteria 1630
934 Ga0307408_100248021 3300031548 Bacteria 1467
935 Ga0307408_100352082 3300031548 Bacteria 1250
936 Ga0307408_100403171 3300031548 Bacteria 1175
937 Ga0307408_100418191 3300031548 Bacteria 1155
938 Ga0307408_100434223 3300031548 Bacteria 1135
939 Ga0307408_100860005 3300031548 Bacteria 827
940 Ga0307408_101682761 3300031548 Bacteria 604
941 Ga0265313_10181118 3300031595 Bacteria 885
942 Ga0307514_10175360 3300031649 Bacteria 1392
943 Ga0265314_10002511 3300031711 Bacteria 18722
944 Ga0265314_10019885 3300031711 Bacteria 5192
945 Ga0265314_10074062 3300031711 Bacteria 2269
946 Ga0265342_10426291 3300031712 Bacteria 683
947 Ga0316576_10385501 3300031727 Bacteria 1040
948 Ga0307516_10015867 3300031730 Bacteria 7905
949 Ga0307405_10383450 3300031731 Bacteria 1095
950 Ga0307405_11614700 3300031731 Bacteria 572
951 Ga0307413_10004678 3300031824 Bacteria 5999
952 Ga0307413_10015242 3300031824 Bacteria 3933
953 Ga0307413_10062574 3300031824 Bacteria 2303
954 Ga0307413_10081954 3300031824 Bacteria 2070
955 Ga0307413_10107591 3300031824 Bacteria 1859
956 Ga0307410_10052893 3300031852 Bacteria 2745
957 Ga0307410_10199293 3300031852 Bacteria 1527
958 Ga0307410_10637665 3300031852 Bacteria 892
959 Ga0307410_11055972 3300031852 Bacteria 702
960 Ga0307410_11177151 3300031852 Bacteria 667
961 Ga0307406_10015666 3300031901 Bacteria 4393
962 Ga0307406_10046703 3300031901 Bacteria 2726
963 Ga0307406_10648840 3300031901 Bacteria 876
964 Ga0307407_10027659 3300031903 Bacteria 3021
965 Ga0307407_10073748 3300031903 Bacteria 2040
966 Ga0307407_10245456 3300031903 Bacteria 1224
967 Ga0307412_10107311 3300031911 Bacteria 1987
968 Ga0307412_10504024 3300031911 Bacteria 1008
969 Ga0307409_100002005 3300031995 Bacteria 10449
970 Ga0307409_100023646 3300031995 Bacteria 4265
971 Ga0307409_100078147 3300031995 Bacteria 2661
972 Ga0307409_100104142 3300031995 Bacteria 2362
973 Ga0307416_100068965 3300032002 Bacteria 2924
974 Ga0307416_100138160 3300032002 Bacteria 2209
975 Ga0307416_100521631 3300032002 Bacteria 1256
976 Ga0307416_100543535 3300032002 Bacteria 1234
977 Ga0307416_101011562 3300032002 Bacteria 934
978 Ga0307414_10172460 3300032004 Bacteria 1731
979 Ga0307414_10246925 3300032004 Bacteria 1481
980 Ga0307411_10003950 3300032005 Bacteria 7002
981 Ga0307411_10009926 3300032005 Bacteria 5041
982 Ga0307411_10133722 3300032005 Bacteria 1817
983 Ga0307411_10169381 3300032005 Bacteria 1645
984 Ga0307411_10280736 3300032005 Bacteria 1325
985 Ga0307415_100410634 3300032126 Bacteria 1159
986 Ga0307415_100585933 3300032126 Bacteria 990
987 Ga0307415_100772332 3300032126 Bacteria 874
988 Ga0307415_101028462 3300032126 Bacteria 767
989 Ga0316593_10003322 3300032168 Bacteria 3973
990 Ga0316593_10296580 3300032168 Bacteria 611
991 Ga0307510_10000004 3300033180 Bacteria 654130
992 Ga0307510_10032882 3300033180 Bacteria 5838
993 Ga0316592_1006133 3300033524 Bacteria 2304
994 Ga0316596_1014010 3300033541 Bacteria 1983
995 Ga0373944_0095602 3300035089 Bacteria 998
996 Ga0373944_0322012 3300035089 Bacteria 584
997 Ga0373952_0215414 3300035092 Bacteria 568
998 Ga0373923_0161962 3300035111 Bacteria 1021
999 Ga0373936_0085248 3300035113 Bacteria 1319
1000 Ga0373936_0170493 3300035113 Bacteria 951
1001 Ga0373954_0006608 3300035118 Bacteria 5061
1002 Ga0373956_0016639 3300035119 Bacteria 3090
1003 Ga0373957_0182967 3300035120 Bacteria 869
1004 Ga0373943_0126625 3300035170 Bacteria 1363
1005 Ga0373943_0194643 3300035170 Bacteria 1120
1006 Ga0373955_0020250 3300035172 Bacteria 3341
1007 Ga0373955_0168064 3300035172 Bacteria 1297
1008 Ga0373955_0317653 3300035172 Bacteria 941
1009 Ga0373935_0214934 3300035692 Bacteria 1334
1010 Ga0373927_0007466 3300035695 Bacteria 7394
1011 Ga0373933_0246802 3300035724 Bacteria 1149
1012 Ga0373947_0278398 3300035725 Bacteria 1112
1013 Ga0373937_0008505 3300036401 Bacteria 8917
1014 Ga0373937_0040899 3300036401 Bacteria 4227
1015 Ga0316582_0431586 3300036647 Bacteria 908
1016 Ga0373925_0073075 3300037068 Bacteria 2595
1017 Ga0373925_1106045 3300037068 Bacteria 652
1018 Ga0395899_0084351 3300037312 Bacteria 2309
1019 Ga0395899_0180376 3300037312 Bacteria 1483
1020 Ga0395899_0283956 3300037312 Bacteria 1125
1021 Ga0395900_0003285 3300037418 Bacteria 17503
1022 Ga0395900_0005953 3300037418 Bacteria 12733
1023 Ga0395900_0091805 3300037418 Bacteria 3120
1024 Ga0395900_0858429 3300037418 Bacteria 833
1025 Ga0395898_0017560 3300037466 Bacteria 7303
1026 Ga0395898_0020160 3300037466 Bacteria 6774
1027 Ga0395898_0065073 3300037466 Bacteria 3535
1028 Ga0395898_0421995 3300037466 Bacteria 1271
1029 Ga0395898_0823690 3300037466 Bacteria 868
1030 Ga0395901_0001587 3300038443 Bacteria 23512
1031 Ga0395901_0004093 3300038443 Bacteria 14696
1032 Ga0395901_0239630 3300038443 Bacteria 1892
1033 Ga0395901_0679514 3300038443 Bacteria 1029
1034 Ga0436365_1290806 3300039437 Bacteria 2210
1035 Ga0436365_1372101 3300039437 Bacteria 636
1036 Ga0436365_1560949 3300039437 Bacteria 2308
1037 Ga0436360_0075183 3300039438 Bacteria 4551
1038 Ga0436360_0107738 3300039438 Bacteria 854
1039 Ga0436360_0389718 3300039438 Bacteria 1471
1040 Ga0436360_0454473 3300039438 Bacteria 1109
1041 Ga0436361_0186433 3300039447 Bacteria 6300
1042 Ga0436361_0362369 3300039447 Bacteria 4918
1043 Ga0436361_0440847 3300039447 Bacteria 923
1044 Ga0436361_0740004 3300039447 Bacteria 837
1045 Ga0436363_0255678 3300039450 Bacteria 593
1046 Ga0436363_0277534 3300039450 Bacteria 7632
1047 Ga0436363_0857817 3300039450 Bacteria 2371
1048 Ga0436363_1704374 3300039450 Bacteria 1389
1049 Ga0436362_0042252 3300039453 Bacteria 4200
1050 Ga0436362_0149361 3300039453 Bacteria 838
1051 Ga0439447_107427 3300041407 Bacteria 641
1052 Ga0439453_0023200 3300041408 Bacteria 1131
1053 Ga0439461_0078449 3300041410 Bacteria 776
1054 Ga0439465_0119002 3300041413 Bacteria 925
1055 Ga0451789_0864192 3300041443 Bacteria 2767
1056 Ga0451797_1238842 3300041453 Bacteria 1477
1057 Ga0451807_0380208 3300041486 Bacteria 4595
1058 Ga0451807_1529842 3300041486 Bacteria 1883
1059 Ga0451833_0736883 3300041491 Bacteria 2024
1060 Ga0451843_1719082 3300041509 Bacteria 636
1061 Ga0439431_0009590 3300041997 Bacteria 2187
1062 Ga0439442_031446 3300042002 Bacteria 1109
1063 Ga0439432_112283 3300042006 Bacteria 810
1064 Ga0439449_0068730 3300042007 Bacteria 1306
1065 Ga0439449_0206013 3300042007 Bacteria 736
1066 Ga0439451_028521 3300042009 Bacteria 1125
1067 Ga0439463_097766 3300042016 Bacteria 757
1068 Ga0450912_012088 3300042116 Bacteria 758
1069 Ga0450912_012522 3300042116 Bacteria 750
1070 Ga0450920_001538 3300042122 Bacteria 3833
1071 Ga0450922_019419 3300042124 Bacteria 695
1072 Ga0450895_000379 3300042132 Bacteria 2462
1073 Ga0450896_007026 3300042133 Bacteria 1549
1074 Ga0450896_013064 3300042133 Bacteria 1179
1075 Ga0450906_032460 3300042145 Bacteria 923
1076 Ga0450910_011124 3300042147 Bacteria 1289
1077 Ga0450910_044514 3300042147 Bacteria 723
1078 Ga0450908_000146 3300042184 Bacteria 14592
1079 Ga0439434_0000736 3300042435 Bacteria 9388
1080 Ga0439435_0005858 3300042436 Bacteria 2728
1081 Ga0439435_0114065 3300042436 Bacteria 841
1082 Ga0439444_0002019 3300042437 Bacteria 2717
1083 Ga0439444_0038206 3300042437 Bacteria 932
1084 Ga0439460_0003891 3300042461 Bacteria 3625
1085 Ga0450893_0048887 3300042532 Bacteria 789
1086 Ga0451577_0721082 3300042876 Bacteria 903
1087 Ga0466969_0009963 3300044656 Bacteria 5039
1088 Ga0466972_0097642 3300044658 Bacteria 1391
1089 Ga0466966_0055175 3300044684 Bacteria 2516
1090 Ga0466961_0147137 3300044693 Bacteria 1472
1091 Ga0466963_0138844 3300044694 Bacteria 1683
1092 Ga0453684_0001552 3300044712 Bacteria 64199
1093 Ga0453684_1633594 3300044712 Bacteria 660
1094 Ga0466970_0036817 3300044765 Bacteria 2593
1095 Ga0466957_0473453 3300044842 Bacteria 865
1096 Ga0466957_0611298 3300044842 Bacteria 764
1097 Ga0466957_0634167 3300044842 Bacteria 750
1098 Ga0466960_0154987 3300044901 Bacteria 1226
1099 Ga0466960_0204969 3300044901 Bacteria 1079
1100 Ga0466959_0006281 3300045049 Bacteria 8211
1101 Ga0466959_0069118 3300045049 Bacteria 2559
1102 Ga0451576_0000042 3300045051 Bacteria 342102
1103 Ga0451576_0012094 3300045051 Bacteria 9737
1104 Ga0451576_0122196 3300045051 Bacteria 2711
1105 Ga0451576_0199114 3300045051 Bacteria 2092
1106 Ga0451576_0623124 3300045051 Bacteria 1134
1107 Ga0466958_0222977 3300045836 Bacteria 1203
1108 Ga0466967_0061247 3300045976 Bacteria 3338
1109 Ga0466967_0346217 3300045976 Bacteria 1438
1110 Ga0466967_0350728 3300045976 Bacteria 1428
1111 Ga0495590_0147342 3300046457 Bacteria 852
1112 Ga0495629_0514239 3300046459 Bacteria 806
1113 Ga0495638_0002587 3300046460 Bacteria 14624
1114 Ga0495638_0003316 3300046460 Bacteria 12697
1115 Ga0495638_0053209 3300046460 Bacteria 2520
1116 Ga0495638_0062992 3300046460 Bacteria 2288
1117 Ga0495651_0239527 3300046462 Bacteria 1245
1118 Ga0495651_0421007 3300046462 Bacteria 868
1119 Ga0495650_0013417 3300046471 Bacteria 4333
1120 Ga0495580_0015700 3300046472 Bacteria 5706
1121 Ga0495580_0017539 3300046472 Bacteria 5352
1122 Ga0495580_0020241 3300046472 Bacteria 4929
1123 Ga0495582_0437309 3300046473 Bacteria 755
1124 Ga0495662_0049903 3300046476 Bacteria 2019
1125 Ga0495662_0245503 3300046476 Bacteria 882
1126 Ga0495664_0149650 3300046477 Bacteria 1416
1127 Ga0495664_0186262 3300046477 Bacteria 1258
1128 Ga0495584_0181099 3300046491 Bacteria 1071
1129 Ga0495585_0060131 3300046492 Bacteria 2092
1130 Ga0495583_0056737 3300046506 Bacteria 1764
1131 Ga0495606_0209596 3300046507 Bacteria 1104
1132 Ga0495616_0049419 3300046513 Bacteria 2108
1133 Ga0495618_0116095 3300046514 Bacteria 1714
1134 Ga0495618_0149890 3300046514 Bacteria 1490
1135 Ga0495620_0070396 3300046515 Bacteria 1433
1136 Ga0495628_0030797 3300046516 Bacteria 4343
1137 Ga0495628_0065042 3300046516 Bacteria 2854
1138 Ga0495630_0076512 3300046517 Bacteria 2522
1139 Ga0495630_1001622 3300046517 Bacteria 635
1140 Ga0495630_1083785 3300046517 Bacteria 607
1141 Ga0495632_0043486 3300046519 Bacteria 2245
1142 Ga0495632_0084959 3300046519 Bacteria 1506
1143 Ga0495637_0277425 3300046520 Bacteria 599
1144 Ga0495648_0055833 3300046524 Bacteria 2379
1145 Ga0495652_0131980 3300046529 Bacteria 1976
1146 Ga0495665_0124948 3300046531 Bacteria 1347
1147 Ga0495665_0148044 3300046531 Unclassified 1226
1148 Ga0495640_0151957 3300046533 Bacteria 1487
1149 Ga0495586_0049635 3300046535 Bacteria 2269
1150 Ga0495587_0029626 3300046536 Bacteria 3323
1151 Ga0495621_0023719 3300046539 Bacteria 2043
1152 Ga0495645_0029760 3300046543 Bacteria 3974
1153 Ga0495645_0042697 3300046543 Bacteria 3306
1154 Ga0495645_0257218 3300046543 Bacteria 1158
1155 Ga0495645_0689925 3300046543 Bacteria 621
1156 Ga0495667_0016573 3300046559 Bacteria 4975
1157 Ga0495667_0051369 3300046559 Bacteria 2720
1158 Ga0495667_0102578 3300046559 Bacteria 1850
1159 Ga0495667_0115263 3300046559 Bacteria 1736
1160 Ga0495667_0416063 3300046559 Bacteria 846
1161 Ga0495667_0488916 3300046559 Bacteria 771
1162 Ga0495656_0186767 3300046615 Bacteria 1022
1163 Ga0495668_0032582 3300046616 Bacteria 2931
1164 Ga0495668_0371900 3300046616 Bacteria 785
1165 Ga0495625_0017237 3300046660 Bacteria 5656
1166 Ga0495625_0036484 3300046660 Bacteria 3613
1167 Ga0495625_0069652 3300046660 Bacteria 2471
1168 Ga0495625_0166820 3300046660 Bacteria 1472
1169 Ga0495625_0274337 3300046660 Bacteria 1087
1170 Ga0495625_0365070 3300046660 Bacteria 909
1171 Ga0495625_0506002 3300046660 Bacteria 738
1172 Ga0495635_0194035 3300046663 Bacteria 1378
1173 Ga0495657_0014443 3300046675 Bacteria 5798
1174 Ga0495657_0159093 3300046675 Bacteria 1398
1175 Ga0495599_0481032 3300046678 Bacteria 733
1176 Ga0495623_0055711 3300046679 Bacteria 2491
1177 Ga0495623_0119360 3300046679 Bacteria 1589
1178 Ga0495646_0131359 3300046680 Bacteria 1409
1179 Ga0495669_0129497 3300046684 Bacteria 1187
1180 Ga0495613_0173610 3300046689 Bacteria 1529
1181 Ga0495671_0004294 3300046692 Bacteria 8563
1182 Ga0495649_0046588 3300046694 Bacteria 2361
1183 Ga0495600_0108839 3300046809 Bacteria 1805
1184 Ga0495600_0365439 3300046809 Bacteria 902
1185 Ga0495604_0069026 3300047317 Bacteria 2680
1186 Ga0495604_0188600 3300047317 Bacteria 1438
1187 Ga0495604_0189099 3300047317 Bacteria 1436
1188 Ga0495604_0324931 3300047317 Bacteria 1027
1189 Ga0495674_0002309 3300047319 Bacteria 18707
1190 Ga0495674_0023603 3300047319 Bacteria 5665
1191 Ga0495674_0140585 3300047319 Bacteria 2030
1192 Ga0495674_0142196 3300047319 Bacteria 2016
1193 Ga0495674_0242921 3300047319 Bacteria 1483
1194 Ga0495674_1192591 3300047319 Bacteria 576
1195 Ga0495680_0300157 3300047322 Bacteria 1128
1196 Ga0495680_0310694 3300047322 Bacteria 1105
1197 Ga0495687_044475 3300047443 Bacteria 1930
1198 Ga0495675_0028415 3300047444 Bacteria 3565
1199 Ga0495675_0033838 3300047444 Bacteria 3262
1200 Ga0495675_0053461 3300047444 Bacteria 2564
1201 Ga0495673_0124530 3300047469 Bacteria 1018
1202 Ga0495684_0003346 3300047471 Bacteria 12586
1203 Ga0495684_0065386 3300047471 Bacteria 2764
1204 Ga0495684_0402254 3300047471 Bacteria 961
1205 Ga0495684_0545704 3300047471 Bacteria 790
1206 Ga0495686_0097341 3300047472 Bacteria 1779
1207 Ga0495686_0099908 3300047472 Bacteria 1751
1208 Ga0495686_0415088 3300047472 Bacteria 720
1209 Ga0495602_0010228 3300048088 Bacteria 9735
1210 Ga0495602_0019635 3300048088 Bacteria 6702
1211 Ga0495602_0146056 3300048088 Bacteria 1866
1212 Ga0495602_0229158 3300048088 Bacteria 1397
1213 Ga0496100_0077980 3300048903 Bacteria 2229
1214 Ga0496100_0117038 3300048903 Bacteria 1860
1215 Ga0496100_0219368 3300048903 Bacteria 1395
1216 Ga0496100_0530475 3300048903 Bacteria 909
1217 Ga0496101_0011003 3300048904 Bacteria 5994
1218 Ga0496101_0170831 3300048904 Bacteria 1671
1219 Ga0496101_0912541 3300048904 Bacteria 692
1220 Ga0496101_1238537 3300048904 Bacteria 584
1221 Ga0496102_0011185 3300048905 Bacteria 7728
1222 Ga0496102_0017816 3300048905 Bacteria 6227
1223 Ga0496102_0069765 3300048905 Bacteria 3226
1224 Ga0496103_0038246 3300048906 Bacteria 2943
1225 Ga0496103_0060675 3300048906 Bacteria 2351
1226 Ga0496103_0258452 3300048906 Bacteria 1121
1227 Ga0496103_0344059 3300048906 Bacteria 959
1228 Ga0496104_0010127 3300048907 Bacteria 8418
1229 Ga0496104_0097439 3300048907 Bacteria 2815
1230 Ga0496104_0992751 3300048907 Bacteria 744
1231 Ga0496105_0061592 3300048908 Bacteria 3096
1232 Ga0496105_1073248 3300048908 Bacteria 599
1233 Ga0496106_0028021 3300048909 Bacteria 4194
1234 Ga0496106_0060453 3300048909 Bacteria 2872
1235 Ga0496106_0184015 3300048909 Bacteria 1659
1236 Ga0496107_0224972 3300048910 Bacteria 1396
1237 Ga0496108_0067338 3300048911 Bacteria 3020
1238 Ga0496108_0552979 3300048911 Bacteria 1004
1239 Ga0496109_0059265 3300048912 Bacteria 3497
1240 Ga0496109_0800491 3300048912 Bacteria 880
1241 Ga0496110_0183292 3300048913 Bacteria 1901
1242 Ga0496110_0202342 3300048913 Bacteria 1804
1243 Ga0496111_0007055 3300048914 Bacteria 7339
1244 Ga0496112_0006250 3300048915 Bacteria 10439
1245 Ga0496112_0040816 3300048915 Bacteria 4538
1246 Ga0496112_0428100 3300048915 Bacteria 1262
1247 Ga0496113_0160546 3300048916 Bacteria 1777
1248 Ga0496113_0166256 3300048916 Bacteria 1745
1249 Ga0496114_0001283 3300048917 Bacteria 18982
1250 Ga0496114_0077219 3300048917 Bacteria 2807
1251 Ga0496114_0389571 3300048917 Bacteria 1234
1252 Ga0496115_0007516 3300048918 Bacteria 8023
1253 Ga0496115_0015044 3300048918 Bacteria 5865
1254 Ga0496115_0383387 3300048918 Bacteria 1143
1255 Ga0496116_0017845 3300048919 Bacteria 5494
1256 Ga0496117_0000251 3300048920 Bacteria 101431
1257 Ga0496118_0000611 3300048921 Bacteria 58835
1258 Ga0496118_0038221 3300048921 Bacteria 3850
1259 Ga0496119_0000879 3300048922 Bacteria 39410
1260 Ga0496119_0005071 3300048922 Bacteria 12787
1261 Ga0496120_0000025 3300048923 Bacteria 235805
1262 Ga0496120_0034271 3300048923 Bacteria 3043
1263 Ga0496121_0006243 3300048924 Bacteria 14925
1264 Ga0496121_0026956 3300048924 Bacteria 5393
1265 Ga0496121_0027248 3300048924 Bacteria 5352
1266 Ga0496125_0004822 3300048928 Bacteria 15327
1267 Ga0496125_0043041 3300048928 Bacteria 3839
1268 Ga0496125_0072600 3300048928 Bacteria 2680
1269 Ga0496126_0003192 3300048929 Bacteria 21047
1270 Ga0496126_0147414 3300048929 Bacteria 2020
1271 Ga0496126_0218636 3300048929 Bacteria 1601
1272 Ga0496126_0633166 3300048929 Bacteria 839
1273 Ga0501306_010628 3300049127 Bacteria 1162
1274 Ga0501306_026832 3300049127 Bacteria 836
1275 Ga0501306_068218 3300049127 Bacteria 596
1276 Ga0501308_049651 3300049128 Bacteria 611
1277 Ga0501309_058481 3300049129 Bacteria 617
1278 Ga0501309_067139 3300049129 Bacteria 585
1279 Ga0501310_034440 3300049130 Bacteria 684
1280 Ga0501310_045712 3300049130 Bacteria 621
1281 Ga0501304_017027 3300049160 Bacteria 692
1282 Ga0501305_030731 3300049161 Bacteria 836
1283 Ga0501305_063456 3300049161 Bacteria 639
1284 Ga0501305_070299 3300049161 Bacteria 615
1285 Ga0501307_022402 3300049162 Bacteria 830
1286 Ga0501307_029475 3300049162 Bacteria 755
1287 Ga0501307_054780 3300049162 Bacteria 607
1288 Ga0501301_001136 3300049524 Bacteria 1674
1289 Ga0501312_019893 3300049528 Bacteria 989
1290 Ga0501312_079272 3300049528 Bacteria 592
1291 Ga0501313_037800 3300049529 Bacteria 642
1292 Ga0501313_045962 3300049529 Bacteria 595
1293 Ga0501315_037936 3300049531 Bacteria 719
1294 Ga0501318_036805 3300049534 Bacteria 686
1295 Ga0501321_062584 3300049537 Bacteria 565
1296 Ga0501031_0035899 3300049568 Bacteria 3234
1297 Ga0501033_0009908 3300049570 Bacteria 7317
1298 Ga0501033_0261557 3300049570 Bacteria 1224
1299 Ga0501034_0061967 3300049571 Bacteria 3756
1300 Ga0501034_0464389 3300049571 Bacteria 1182
1301 Ga0501036_0047299 3300049572 Bacteria 3644
1302 Ga0501036_0233278 3300049572 Bacteria 1544
1303 Ga0501037_0059406 3300049573 Bacteria 2789
1304 Ga0501038_0005329 3300049574 Bacteria 11949
1305 Ga0501038_0065115 3300049574 Bacteria 3106
1306 Ga0501038_0085887 3300049574 Bacteria 2645
1307 Ga0501038_0125098 3300049574 Bacteria 2117
1308 Ga0501039_0005494 3300049575 Bacteria 9591
1309 Ga0501039_0011760 3300049575 Bacteria 6666
1310 Ga0501039_0135483 3300049575 Bacteria 1934
1311 Ga0501040_0006961 3300049576 Bacteria 7323
1312 Ga0501040_0009344 3300049576 Bacteria 6387
1313 Ga0501040_0073938 3300049576 Bacteria 2355
1314 Ga0501040_0883859 3300049576 Bacteria 647
1315 Ga0501041_0013770 3300049577 Bacteria 4796
1316 Ga0501041_0025726 3300049577 Bacteria 3537
1317 Ga0501042_0000915 3300049578 Bacteria 16542
1318 Ga0501042_0051806 3300049578 Bacteria 2928
1319 Ga0501042_0068944 3300049578 Bacteria 2529
1320 Ga0501042_0728450 3300049578 Bacteria 721
1321 Ga0501043_0061144 3300049579 Bacteria 2958
1322 Ga0501043_0218544 3300049579 Bacteria 1475
1323 Ga0501043_0500218 3300049579 Bacteria 908
1324 Ga0501043_0711352 3300049579 Bacteria 733
1325 Ga0501046_0008093 3300049580 Bacteria 9187
1326 Ga0501046_0020394 3300049580 Bacteria 5483
1327 Ga0501046_0190562 3300049580 Bacteria 1530
1328 Ga0501047_0045003 3300049581 Bacteria 4266
1329 Ga0501047_0062702 3300049581 Bacteria 3586
1330 Ga0501047_0205297 3300049581 Bacteria 1830
1331 Ga0501047_0282351 3300049581 Bacteria 1505
1332 Ga0501047_0498530 3300049581 Bacteria 1044
1333 Ga0501048_0006562 3300049582 Bacteria 8845
1334 Ga0501048_0976963 3300049582 Bacteria 609
1335 Ga0501067_0014051 3300049583 Bacteria 4436
1336 Ga0501067_0125647 3300049583 Bacteria 1427
1337 Ga0501067_0169797 3300049583 Bacteria 1215
1338 Ga0501068_0000867 3300049584 Bacteria 15748
1339 Ga0501068_0059666 3300049584 Bacteria 2316
1340 Ga0501068_0243459 3300049584 Bacteria 1145
1341 Ga0501070_0060130 3300049586 Bacteria 3150
1342 Ga0501071_0004440 3300049587 Bacteria 8900
1343 Ga0501071_0021226 3300049587 Bacteria 4520
1344 Ga0501071_0392235 3300049587 Bacteria 1059
1345 Ga0501071_1011006 3300049587 Bacteria 642
1346 Ga0501072_0004135 3300049588 Bacteria 10986
1347 Ga0501072_0033552 3300049588 Bacteria 4022
1348 Ga0501072_0228299 3300049588 Bacteria 1483
1349 Ga0501072_0242447 3300049588 Bacteria 1436
1350 Ga0501073_0004134 3300049589 Bacteria 10899
1351 Ga0501073_0011609 3300049589 Bacteria 6437
1352 Ga0501073_0025289 3300049589 Bacteria 4260
1353 Ga0501073_0026538 3300049589 Bacteria 4149
1354 Ga0501073_0034466 3300049589 Bacteria 3603
1355 Ga0501073_0059015 3300049589 Bacteria 2681
1356 Ga0501074_0099931 3300049590 Bacteria 2076
1357 Ga0501074_0120613 3300049590 Bacteria 1875
1358 Ga0501074_0242113 3300049590 Bacteria 1283
1359 Ga0501075_0005108 3300049591 Bacteria 8969
1360 Ga0501075_0172471 3300049591 Bacteria 1651
1361 Ga0501075_0424194 3300049591 Bacteria 1014
1362 Ga0501076_0010445 3300049592 Bacteria 6893
1363 Ga0501076_0011218 3300049592 Bacteria 6671
1364 Ga0501076_0049580 3300049592 Bacteria 3321
1365 Ga0501076_0218696 3300049592 Bacteria 1557
1366 Ga0501077_0006169 3300049593 Bacteria 7320
1367 Ga0501077_0019420 3300049593 Bacteria 4299
1368 Ga0501077_0036799 3300049593 Bacteria 3118
1369 Ga0501077_0106262 3300049593 Bacteria 1779
1370 Ga0501246_029409 3300049676 Bacteria 610
1371 Ga0501249_023042 3300049679 Bacteria 1365
1372 Ga0501079_0000565 3300049741 Bacteria 24354
1373 Ga0501079_0001159 3300049741 Bacteria 18450
1374 Ga0501079_0003223 3300049741 Bacteria 11949
1375 Ga0501079_0100737 3300049741 Bacteria 2240
1376 Ga0501080_0000453 3300049742 Bacteria 31773
1377 Ga0501080_0001345 3300049742 Bacteria 20524
1378 Ga0501080_0143961 3300049742 Bacteria 2203
1379 Ga0501080_0479591 3300049742 Bacteria 1113
1380 Ga0501080_0523078 3300049742 Bacteria 1058
1381 Ga0501080_0628044 3300049742 Bacteria 952
1382 Ga0501080_0876561 3300049742 Bacteria 783
1383 Ga0501081_0000381 3300049743 Bacteria 24386
1384 Ga0501081_0008007 3300049743 Bacteria 6858
1385 Ga0501083_0001296 3300049744 Bacteria 16903
1386 Ga0501083_0026643 3300049744 Bacteria 3994
1387 Ga0501083_0073024 3300049744 Bacteria 2280
1388 Ga0501083_0080694 3300049744 Bacteria 2157
1389 Ga0501083_0122963 3300049744 Bacteria 1702
1390 Ga0501083_0153116 3300049744 Bacteria 1510
1391 Ga0501035_0004435 3300049822 Bacteria 13321
1392 Ga0501035_0007033 3300049822 Bacteria 10515
1393 Ga0501035_0019306 3300049822 Bacteria 6273
1394 Ga0501035_0226203 3300049822 Bacteria 1596
1395 Ga0501035_0871967 3300049822 Bacteria 715
1396 Ga0501044_0000794 3300049823 Bacteria 38183
1397 Ga0501044_0001257 3300049823 Bacteria 29993
1398 Ga0501044_0062939 3300049823 Bacteria 3791
1399 Ga0501045_0009394 3300049824 Bacteria 6839
1400 Ga0501045_0014470 3300049824 Bacteria 5591
1401 Ga0501045_0073028 3300049824 Bacteria 2526
1402 Ga0501045_0512433 3300049824 Bacteria 891
1403 Ga0501045_0668872 3300049824 Bacteria 767
1404 nmdc:mga0yw44_41471_c1 3300050492 Bacteria 2740
1405 nmdc:mga0yw44_816867_c1 3300050492 Bacteria 633
1406 nmdc:mga0k408_61132_c1 3300050493 Bacteria 2189
1407 nmdc:mga05p37_333657_c1 3300050507 Bacteria 1790
1408 nmdc:mga05p37_3957_c1 3300050507 Bacteria 17352
1409 nmdc:mga05p37_617083_c1 3300050507 Bacteria 1221
1410 nmdc:mga05p37_7207_c1 3300050507 Bacteria 13120
1411 nmdc:mga05p37_987277_c1 3300050507 Bacteria 896
1412 nmdc:mga09592_128537_c1 3300050508 Bacteria 2179
1413 nmdc:mga09592_267633_c1 3300050508 Bacteria 1482
1414 nmdc:mga09592_6699_c1 3300050508 Bacteria 9381
1415 nmdc:mga09592_780_c1 3300050508 Bacteria 24615
1416 nmdc:mga0qj67_13394_c1 3300050509 Bacteria 6186
1417 nmdc:mga0qj67_218813_c1 3300050509 Bacteria 1546
1418 nmdc:mga0qj67_259927_c1 3300050509 Bacteria 1408
1419 nmdc:mga0qj67_76540_c1 3300050509 Bacteria 2676
1420 nmdc:mga0qj67_8518_c1 3300050509 Bacteria 7611
1421 nmdc:mga06r32_1571_c1 3300050510 Bacteria 20567
1422 nmdc:mga06r32_3176_c1 3300050510 Bacteria 14718
1423 nmdc:mga06r32_5339_c1 3300050510 Bacteria 11568
1424 nmdc:mga08y16_1280306_c1 3300050511 Bacteria 701
1425 nmdc:mga08y16_138691_c1 3300050511 Bacteria 2528
1426 nmdc:mga08y16_164730_c1 3300050511 Bacteria 2303
1427 nmdc:mga08y16_87881_c1 3300050511 Bacteria 3239
1428 nmdc:mga08y16_961855_c1 3300050511 Bacteria 836
1429 nmdc:mga0n895_1690896_c1 3300050512 Bacteria 595
1430 nmdc:mga0n895_337372_c1 3300050512 Bacteria 1527
1431 nmdc:mga0rr50_60574_c1 3300050513 Bacteria 2848
1432 nmdc:mga08x19_102123_c1 3300050514 Bacteria 1904
1433 nmdc:mga08x19_122209_c1 3300050514 Bacteria 1746
1434 nmdc:mga0a205_163676_c1 3300050515 Bacteria 2120
1435 Ga0500578_0309779 3300053086 Bacteria 934
1436 Ga0500644_0166923 3300053088 Bacteria 893
1437 Ga0500647_0040234 3300053091 Bacteria 2243
1438 Ga0500583_0008778 3300053092 Bacteria 3653
1439 Ga0500583_0039233 3300053092 Bacteria 2137
1440 Ga0500566_0014529 3300053094 Bacteria 4627
1441 Ga0500640_002285 3300053095 Bacteria 6274
1442 Ga0500641_0018886 3300053096 Bacteria 2599
1443 Ga0500641_0155084 3300053096 Bacteria 988
1444 Ga0500650_0066976 3300053098 Bacteria 1678
1445 Ga0500554_002327 3300053102 Bacteria 3725
1446 Ga0500556_0000646 3300053104 Bacteria 21836
1447 Ga0500556_0015792 3300053104 Bacteria 2337
1448 Ga0500591_164512 3300053115 Bacteria 832
1449 Ga0500595_001726 3300053119 Bacteria 11403
1450 Ga0500595_006081 3300053119 Bacteria 5175
1451 Ga0500607_229752 3300053121 Bacteria 762
1452 Ga0500614_003262 3300053123 Bacteria 3510
1453 Ga0500617_019473 3300053124 Bacteria 2966
1454 Ga0500655_042194 3300053133 Bacteria 897
1455 Ga0500658_0165539 3300053134 Bacteria 1003
1456 Ga0500559_0009784 3300053136 Bacteria 4136
1457 Ga0500559_0291341 3300053136 Bacteria 767
1458 Ga0500577_0232857 3300053142 Bacteria 799
1459 Ga0500588_0000279 3300053146 Bacteria 7531
1460 Ga0500588_0007867 3300053146 Bacteria 2470
1461 Ga0500588_0102187 3300053146 Bacteria 989
1462 Ga0500588_0130033 3300053146 Bacteria 896
1463 Ga0500616_0000096 3300053153 Bacteria 179125
1464 Ga0500616_0009124 3300053153 Bacteria 6063
1465 Ga0500622_0002975 3300053156 Bacteria 11744
1466 Ga0500622_0056851 3300053156 Bacteria 2002
1467 Ga0500627_0092343 3300053158 Bacteria 1355
1468 Ga0500637_0045803 3300053178 Bacteria 2482
1469 Ga0500637_0069933 3300053178 Bacteria 2018
1470 Ga0500637_0123352 3300053178 Bacteria 1503
1471 Ga0500645_027276 3300053730 Bacteria 1732
1472 Ga0501084_0000703 3300054114 Bacteria 25621
1473 Ga0501084_0027449 3300054114 Bacteria 4756
1474 Ga0501084_0054651 3300054114 Bacteria 3340
1475 Ga0501084_0342056 3300054114 Bacteria 1264
1476 Ga0501084_1020956 3300054114 Bacteria 695
1477 Ga0587093_037946 3300059478 Bacteria 720
1478 Ga0587080_011658 3300059503 Bacteria 1318
1479 Ga0587083_0170672 3300059505 Bacteria 602
1480 Ga0587083_0180621 3300059505 Bacteria 590
1481 Ga0501082_0001073 3300060353 Bacteria 24204
1482 Ga0501082_0002270 3300060353 Bacteria 16842
1483 Ga0501082_0018634 3300060353 Bacteria 5982
1484 Ga0501082_0022513 3300060353 Bacteria 5427
1485 Ga0501082_0082649 3300060353 Bacteria 2771
1486 Ga0501082_0165930 3300060353 Bacteria 1919
1487 Ga0501082_0315578 3300060353 Bacteria 1361
1488 Ga0501082_1244283 3300060353 Bacteria 650
1489 Ga0530510_0005434 3300061734 Bacteria 8816
1490 Ga0530510_0015910 3300061734 Bacteria 5318
1491 Ga0530510_0701196 3300061734 Bacteria 771

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013296 Ga0157374_11411107 Ga0157374_114111071 175
2 3300005436 Ga0070713_100000161 Ga0070713_10000016139 176
3 3300025928 Ga0207700_10000245 Ga0207700_100002459 176
4 3300025914 Ga0207671_10336716 Ga0207671_103367162 177
5 3300002737 JGI25162J39368_1004290 JGI25162J39368_10042904 178
6 3300005288 Ga0065714_10044263 Ga0065714_100442632 178
7 3300005293 Ga0065715_10014079 Ga0065715_100140791 178
8 3300005293 Ga0065715_10028357 Ga0065715_100283571 178
9 3300005293 Ga0065715_10110463 Ga0065715_101104633 178
10 3300005293 Ga0065715_10140004 Ga0065715_101400041 178
11 3300005329 Ga0070683_100835648 Ga0070683_1008356481 178
12 3300005364 Ga0070673_100409217 Ga0070673_1004092172 178
13 3300005366 Ga0070659_101144045 Ga0070659_1011440451 178
14 3300005455 Ga0070663_100209047 Ga0070663_1002090472 178
15 3300005456 Ga0070678_100460806 Ga0070678_1004608062 178
16 3300005458 Ga0070681_10479982 Ga0070681_104799822 178
17 3300005458 Ga0070681_10988195 Ga0070681_109881952 178
18 3300005530 Ga0070679_100204893 Ga0070679_1002048932 178
19 3300005548 Ga0070665_100328961 Ga0070665_1003289613 178
20 3300005563 Ga0068855_101422622 Ga0068855_1014226222 178
21 3300005985 Ga0081539_10047289 Ga0081539_100472893 178
22 3300009093 Ga0105240_10012718 Ga0105240_100127189 178
23 3300010375 Ga0105239_10091018 Ga0105239_100910184 178
24 3300013102 Ga0157371_11089482 Ga0157371_110894821 178
25 3300013307 Ga0157372_10455049 Ga0157372_104550492 178
26 3300013307 Ga0157372_10800718 Ga0157372_108007182 178
27 3300014326 Ga0157380_11022243 Ga0157380_110222432 178
28 3300020075 Ga0206349_1898117 Ga0206349_18981171 178
29 3300020076 Ga0206355_1138380 Ga0206355_11383802 178
30 3300020080 Ga0206350_10652330 Ga0206350_106523301 178
31 3300022467 Ga0224712_10027153 Ga0224712_100271532 178
32 3300025913 Ga0207695_10013605 Ga0207695_100136053 178
33 3300025921 Ga0207652_10659257 Ga0207652_106592571 178
34 3300025923 Ga0207681_10453518 Ga0207681_104535182 178
35 3300025933 Ga0207706_10691937 Ga0207706_106919372 178
36 3300025945 Ga0207679_10833385 Ga0207679_108333852 178
37 3300025949 Ga0207667_11455956 Ga0207667_114559561 178
38 3300025960 Ga0207651_10344412 Ga0207651_103444122 178
39 3300026067 Ga0207678_10199441 Ga0207678_101994411 178
40 3300026116 Ga0207674_10511360 Ga0207674_105113601 178
41 3300027876 Ga0209974_10053724 Ga0209974_100537242 178
42 3300031247 Ga0265340_10015902 Ga0265340_100159022 178
43 3300031344 Ga0265316_10001714 Ga0265316_100017147 178
44 3300031344 Ga0265316_10003861 Ga0265316_100038619 178
45 3300031344 Ga0265316_10028987 Ga0265316_100289874 178
46 3300031344 Ga0265316_10125236 Ga0265316_101252362 178
47 3300031344 Ga0265316_10262611 Ga0265316_102626112 178
48 3300031344 Ga0265316_10488995 Ga0265316_104889951 178
49 3300031595 Ga0265313_10181118 Ga0265313_101811181 178
50 3300031711 Ga0265314_10002511 Ga0265314_1000251112 178
51 3300031711 Ga0265314_10019885 Ga0265314_100198852 178
52 3300031911 Ga0307412_10107311 Ga0307412_101073113 178
53 3300037312 Ga0395899_0180376 Ga0395899_0180376_594_1130 178
54 3300037418 Ga0395900_0858429 Ga0395900_0858429_18_554 178
55 3300037466 Ga0395898_0823690 Ga0395898_0823690_206_742 178
56 3300039450 Ga0436363_0255678 Ga0436363_0255678_19_555 178
57 3300041413 Ga0439465_0119002 Ga0439465_0119002_289_825 178
58 3300042006 Ga0439432_112283 Ga0439432_112283_54_590 178
59 3300042007 Ga0439449_0206013 Ga0439449_0206013_125_661 178
60 3300044901 Ga0466960_0204969 Ga0466960_0204969_217_753 178
61 3300045051 Ga0451576_0623124 Ga0451576_0623124_187_729 178
62 3300046476 Ga0495662_0245503 Ga0495662_0245503_262_798 178
63 3300046531 Ga0495665_0148044 Ga0495665_0148044_11_547 178
64 3300046535 Ga0495586_0049635 Ga0495586_0049635_1099_1635 178
65 3300046543 Ga0495645_0042697 Ga0495645_0042697_2045_2581 178
66 3300046543 Ga0495645_0689925 Ga0495645_0689925_29_565 178
67 3300046559 Ga0495667_0102578 Ga0495667_0102578_822_1358 178
68 3300046663 Ga0495635_0194035 Ga0495635_0194035_151_687 178
69 3300046675 Ga0495657_0014443 Ga0495657_0014443_1404_1940 178
70 3300046679 Ga0495623_0119360 Ga0495623_0119360_660_1196 178
71 3300046684 Ga0495669_0129497 Ga0495669_0129497_43_579 178
72 3300046689 Ga0495613_0173610 Ga0495613_0173610_722_1258 178
73 3300046809 Ga0495600_0365439 Ga0495600_0365439_194_730 178
74 3300047317 Ga0495604_0324931 Ga0495604_0324931_459_995 178
75 3300047444 Ga0495675_0028415 Ga0495675_0028415_2161_2697 178
76 3300047471 Ga0495684_0545704 Ga0495684_0545704_46_582 178
77 3300048088 Ga0495602_0146056 Ga0495602_0146056_1141_1677 178
78 3300048918 Ga0496115_0383387 Ga0496115_0383387_389_925 178
79 3300048929 Ga0496126_0633166 Ga0496126_0633166_149_685 178
80 3300049570 Ga0501033_0261557 Ga0501033_0261557_146_682 178
81 3300049571 Ga0501034_0464389 Ga0501034_0464389_156_692 178
82 3300049574 Ga0501038_0085887 Ga0501038_0085887_386_922 178
83 3300049581 Ga0501047_0045003 Ga0501047_0045003_2376_2912 178
84 3300049581 Ga0501047_0062702 Ga0501047_0062702_13_549 178
85 3300049581 Ga0501047_0498530 Ga0501047_0498530_433_969 178
86 3300049589 Ga0501073_0025289 Ga0501073_0025289_383_919 178
87 3300049742 Ga0501080_0628044 Ga0501080_0628044_230_766 178
88 3300049744 Ga0501083_0122963 Ga0501083_0122963_440_976 178
89 3300049744 Ga0501083_0153116 Ga0501083_0153116_230_766 178
90 3300049822 Ga0501035_0007033 Ga0501035_0007033_6856_7392 178
91 3300049822 Ga0501035_0226203 Ga0501035_0226203_547_1083 178
92 3300049823 Ga0501044_0000794 Ga0501044_0000794_19907_20443 178
93 3300049823 Ga0501044_0001257 Ga0501044_0001257_19956_20492 178
94 3300049823 Ga0501044_0062939 Ga0501044_0062939_658_1194 178
95 3300053136 Ga0500559_0291341 Ga0500559_0291341_117_656 178
96 3300054114 Ga0501084_1020956 Ga0501084_1020956_56_592 178
97 3300059505 Ga0587083_0180621 Ga0587083_0180621_30_566 178
98 3300002244 JGI24742J22300_10055810 JGI24742J22300_100558101 179
99 3300003162 Ga0006778J45830_1034955 Ga0006778J45830_10349551 179
100 3300003162 Ga0006778J45830_1090249 Ga0006778J45830_10902491 179
101 3300003163 Ga0006759J45824_1031269 Ga0006759J45824_10312691 179
102 3300003163 Ga0006759J45824_1051790 Ga0006759J45824_10517901 179
103 3300003163 Ga0006759J45824_1064721 Ga0006759J45824_10647211 179
104 3300003163 Ga0006759J45824_1080555 Ga0006759J45824_10805551 179
105 3300003203 JGI25406J46586_10010550 JGI25406J46586_100105504 179
106 3300003203 JGI25406J46586_10025326 JGI25406J46586_100253263 179
107 3300003308 Ga0006777J48905_1023601 Ga0006777J48905_10236011 179
108 3300003308 Ga0006777J48905_1071737 Ga0006777J48905_10717371 179
109 3300003322 rootL2_10052881 rootL2_100528813 179
110 3300003568 Ga0006781J51513_1035968 Ga0006781J51513_10359681 179
111 3300003574 Ga0007410J51695_1022950 Ga0007410J51695_10229501 179
112 3300003574 Ga0007410J51695_1053083 Ga0007410J51695_10530831 179
113 3300003577 Ga0007416J51690_1050632 Ga0007416J51690_10506321 179
114 3300003693 Ga0032354_1033655 Ga0032354_10336551 179
115 3300003693 Ga0032354_1036149 Ga0032354_10361491 179
116 3300003693 Ga0032354_1048806 Ga0032354_10488061 179
117 3300003735 Ga0006780_1013989 Ga0006780_10139891 179
118 3300003735 Ga0006780_1029819 Ga0006780_10298191 179
119 3300004798 Ga0058859_10026294 Ga0058859_100262941 179
120 3300004800 Ga0058861_11963726 Ga0058861_119637261 179
121 3300004801 Ga0058860_10060066 Ga0058860_100600661 179
122 3300004801 Ga0058860_10076721 Ga0058860_100767212 179
123 3300004801 Ga0058860_10088687 Ga0058860_100886871 179
124 3300004801 Ga0058860_12240042 Ga0058860_122400421 179
125 3300005290 Ga0065712_10004198 Ga0065712_100041983 179
126 3300005290 Ga0065712_10119918 Ga0065712_101199182 179
127 3300005290 Ga0065712_10281568 Ga0065712_102815681 179
128 3300005290 Ga0065712_10466766 Ga0065712_104667661 179
129 3300005293 Ga0065715_10104963 Ga0065715_101049633 179
130 3300005295 Ga0065707_10174103 Ga0065707_101741032 179
131 3300005295 Ga0065707_10432960 Ga0065707_104329601 179
132 3300005327 Ga0070658_10873019 Ga0070658_108730191 179
133 3300005328 Ga0070676_10140118 Ga0070676_101401183 179
134 3300005328 Ga0070676_10148617 Ga0070676_101486173 179
135 3300005329 Ga0070683_100038614 Ga0070683_1000386144 179
136 3300005329 Ga0070683_100133601 Ga0070683_1001336013 179
137 3300005329 Ga0070683_100223074 Ga0070683_1002230742 179
138 3300005330 Ga0070690_100001531 Ga0070690_1000015315 179
139 3300005330 Ga0070690_100001718 Ga0070690_1000017186 179
140 3300005330 Ga0070690_100062600 Ga0070690_1000626003 179
141 3300005330 Ga0070690_100413850 Ga0070690_1004138502 179
142 3300005331 Ga0070670_100116676 Ga0070670_1001166762 179
143 3300005331 Ga0070670_100127799 Ga0070670_1001277993 179
144 3300005331 Ga0070670_100364276 Ga0070670_1003642761 179
145 3300005333 Ga0070677_10175027 Ga0070677_101750271 179
146 3300005334 Ga0068869_100003998 Ga0068869_1000039985 179
147 3300005334 Ga0068869_100029761 Ga0068869_1000297615 179
148 3300005334 Ga0068869_100084730 Ga0068869_1000847303 179
149 3300005334 Ga0068869_101356181 Ga0068869_1013561811 179
150 3300005335 Ga0070666_10004699 Ga0070666_100046993 179
151 3300005335 Ga0070666_10013206 Ga0070666_100132066 179
152 3300005335 Ga0070666_10055545 Ga0070666_100555453 179
153 3300005336 Ga0070680_100009202 Ga0070680_1000092025 179
154 3300005336 Ga0070680_100018985 Ga0070680_1000189856 179
155 3300005336 Ga0070680_100075132 Ga0070680_1000751323 179
156 3300005336 Ga0070680_100110853 Ga0070680_1001108531 179
157 3300005336 Ga0070680_100129541 Ga0070680_1001295413 179
158 3300005336 Ga0070680_100140105 Ga0070680_1001401051 179
159 3300005336 Ga0070680_100276503 Ga0070680_1002765032 179
160 3300005336 Ga0070680_100390122 Ga0070680_1003901222 179
161 3300005336 Ga0070680_100429129 Ga0070680_1004291291 179
162 3300005337 Ga0070682_100005572 Ga0070682_1000055722 179
163 3300005337 Ga0070682_100030755 Ga0070682_1000307552 179
164 3300005337 Ga0070682_100252677 Ga0070682_1002526771 179
165 3300005337 Ga0070682_101014679 Ga0070682_1010146791 179
166 3300005338 Ga0068868_100008181 Ga0068868_1000081818 179
167 3300005338 Ga0068868_100135724 Ga0068868_1001357242 179
168 3300005339 Ga0070660_100406918 Ga0070660_1004069182 179
169 3300005340 Ga0070689_100003814 Ga0070689_1000038145 179
170 3300005340 Ga0070689_100119758 Ga0070689_1001197583 179
171 3300005340 Ga0070689_100188925 Ga0070689_1001889252 179
172 3300005340 Ga0070689_100748014 Ga0070689_1007480141 179
173 3300005341 Ga0070691_10031657 Ga0070691_100316572 179
174 3300005341 Ga0070691_10234599 Ga0070691_102345992 179
175 3300005343 Ga0070687_100002571 Ga0070687_1000025719 179
176 3300005343 Ga0070687_100195228 Ga0070687_1001952282 179
177 3300005344 Ga0070661_100002493 Ga0070661_10000249312 179
178 3300005344 Ga0070661_100165759 Ga0070661_1001657591 179
179 3300005345 Ga0070692_10019677 Ga0070692_100196774 179
180 3300005345 Ga0070692_10027265 Ga0070692_100272655 179
181 3300005347 Ga0070668_100053464 Ga0070668_1000534642 179
182 3300005347 Ga0070668_100092499 Ga0070668_1000924994 179
183 3300005353 Ga0070669_100024257 Ga0070669_1000242572 179
184 3300005353 Ga0070669_100053235 Ga0070669_1000532354 179
185 3300005353 Ga0070669_100273498 Ga0070669_1002734982 179
186 3300005353 Ga0070669_100494667 Ga0070669_1004946672 179
187 3300005353 Ga0070669_100834761 Ga0070669_1008347611 179
188 3300005353 Ga0070669_100865487 Ga0070669_1008654871 179
189 3300005354 Ga0070675_100010921 Ga0070675_1000109215 179
190 3300005354 Ga0070675_100011633 Ga0070675_1000116332 179
191 3300005354 Ga0070675_100278063 Ga0070675_1002780632 179
192 3300005354 Ga0070675_100301190 Ga0070675_1003011902 179
193 3300005355 Ga0070671_100005633 Ga0070671_1000056332 179
194 3300005355 Ga0070671_100009823 Ga0070671_1000098235 179
195 3300005355 Ga0070671_100027320 Ga0070671_1000273203 179
196 3300005355 Ga0070671_100085042 Ga0070671_1000850421 179
197 3300005355 Ga0070671_100158214 Ga0070671_1001582142 179
198 3300005355 Ga0070671_100460060 Ga0070671_1004600601 179
199 3300005356 Ga0070674_100039351 Ga0070674_1000393512 179
200 3300005356 Ga0070674_100045974 Ga0070674_1000459744 179
201 3300005356 Ga0070674_100129468 Ga0070674_1001294682 179
202 3300005356 Ga0070674_100497617 Ga0070674_1004976172 179
203 3300005356 Ga0070674_100721984 Ga0070674_1007219841 179
204 3300005364 Ga0070673_100021060 Ga0070673_1000210602 179
205 3300005364 Ga0070673_100024898 Ga0070673_1000248983 179
206 3300005364 Ga0070673_100044903 Ga0070673_1000449033 179
207 3300005364 Ga0070673_100371438 Ga0070673_1003714382 179
208 3300005365 Ga0070688_100001922 Ga0070688_1000019228 179
209 3300005365 Ga0070688_100098823 Ga0070688_1000988231 179
210 3300005365 Ga0070688_100234486 Ga0070688_1002344862 179
211 3300005365 Ga0070688_100373797 Ga0070688_1003737972 179
212 3300005365 Ga0070688_100484889 Ga0070688_1004848891 179
213 3300005366 Ga0070659_100161443 Ga0070659_1001614432 179
214 3300005366 Ga0070659_100300740 Ga0070659_1003007401 179
215 3300005367 Ga0070667_100000011 Ga0070667_100000011200 179
216 3300005367 Ga0070667_100029415 Ga0070667_1000294153 179
217 3300005367 Ga0070667_100066033 Ga0070667_1000660332 179
218 3300005367 Ga0070667_100413023 Ga0070667_1004130232 179
219 3300005367 Ga0070667_100584150 Ga0070667_1005841502 179
220 3300005367 Ga0070667_100707215 Ga0070667_1007072151 179
221 3300005434 Ga0070709_10008243 Ga0070709_100082433 179
222 3300005434 Ga0070709_10037581 Ga0070709_100375813 179
223 3300005434 Ga0070709_10599611 Ga0070709_105996112 179
224 3300005435 Ga0070714_100005056 Ga0070714_1000050566 179
225 3300005436 Ga0070713_100015790 Ga0070713_1000157902 179
226 3300005436 Ga0070713_100112789 Ga0070713_1001127894 179
227 3300005436 Ga0070713_100117990 Ga0070713_1001179901 179
228 3300005436 Ga0070713_100137932 Ga0070713_1001379322 179
229 3300005437 Ga0070710_10052096 Ga0070710_100520962 179
230 3300005437 Ga0070710_10254036 Ga0070710_102540362 179
231 3300005438 Ga0070701_10052866 Ga0070701_100528662 179
232 3300005438 Ga0070701_10539132 Ga0070701_105391321 179
233 3300005439 Ga0070711_100175658 Ga0070711_1001756582 179
234 3300005439 Ga0070711_101472529 Ga0070711_1014725291 179
235 3300005440 Ga0070705_100060432 Ga0070705_1000604323 179
236 3300005441 Ga0070700_100013887 Ga0070700_1000138875 179
237 3300005441 Ga0070700_100014864 Ga0070700_1000148644 179
238 3300005441 Ga0070700_100062509 Ga0070700_1000625092 179
239 3300005441 Ga0070700_100130090 Ga0070700_1001300902 179
240 3300005441 Ga0070700_100130486 Ga0070700_1001304862 179
241 3300005445 Ga0070708_100659527 Ga0070708_1006595272 179
242 3300005455 Ga0070663_100144080 Ga0070663_1001440802 179
243 3300005456 Ga0070678_100007254 Ga0070678_1000072546 179
244 3300005456 Ga0070678_100016401 Ga0070678_1000164017 179
245 3300005456 Ga0070678_100105706 Ga0070678_1001057062 179
246 3300005456 Ga0070678_100240690 Ga0070678_1002406903 179
247 3300005457 Ga0070662_100018507 Ga0070662_1000185074 179
248 3300005457 Ga0070662_100237739 Ga0070662_1002377392 179
249 3300005458 Ga0070681_10003202 Ga0070681_1000320212 179
250 3300005458 Ga0070681_10018495 Ga0070681_100184953 179
251 3300005458 Ga0070681_10034684 Ga0070681_100346845 179
252 3300005458 Ga0070681_10050700 Ga0070681_100507002 179
253 3300005458 Ga0070681_10057069 Ga0070681_100570695 179
254 3300005458 Ga0070681_10135263 Ga0070681_101352633 179
255 3300005458 Ga0070681_10410600 Ga0070681_104106002 179
256 3300005459 Ga0068867_100356474 Ga0068867_1003564742 179
257 3300005459 Ga0068867_100561019 Ga0068867_1005610192 179
258 3300005459 Ga0068867_100601595 Ga0068867_1006015952 179
259 3300005459 Ga0068867_100692053 Ga0068867_1006920531 179
260 3300005459 Ga0068867_100989373 Ga0068867_1009893731 179
261 3300005468 Ga0070707_100166622 Ga0070707_1001666223 179
262 3300005471 Ga0070698_100003450 Ga0070698_1000034502 179
263 3300005518 Ga0070699_100385215 Ga0070699_1003852152 179
264 3300005518 Ga0070699_101308213 Ga0070699_1013082131 179
265 3300005530 Ga0070679_100029331 Ga0070679_1000293313 179
266 3300005530 Ga0070679_100120363 Ga0070679_1001203633 179
267 3300005530 Ga0070679_100121897 Ga0070679_1001218974 179
268 3300005530 Ga0070679_100135159 Ga0070679_1001351593 179
269 3300005530 Ga0070679_100458302 Ga0070679_1004583022 179
270 3300005530 Ga0070679_100848135 Ga0070679_1008481351 179
271 3300005530 Ga0070679_101126297 Ga0070679_1011262971 179
272 3300005535 Ga0070684_100002573 Ga0070684_10000257313 179
273 3300005535 Ga0070684_100040392 Ga0070684_1000403923 179
274 3300005535 Ga0070684_100605533 Ga0070684_1006055331 179
275 3300005535 Ga0070684_101050360 Ga0070684_1010503602 179
276 3300005539 Ga0068853_100849591 Ga0068853_1008495912 179
277 3300005539 Ga0068853_100921835 Ga0068853_1009218351 179
278 3300005539 Ga0068853_100932233 Ga0068853_1009322331 179
279 3300005539 Ga0068853_101042865 Ga0068853_1010428651 179
280 3300005543 Ga0070672_100018046 Ga0070672_1000180465 179
281 3300005543 Ga0070672_100057039 Ga0070672_1000570393 179
282 3300005543 Ga0070672_100231671 Ga0070672_1002316712 179
283 3300005543 Ga0070672_100232701 Ga0070672_1002327012 179
284 3300005543 Ga0070672_100253443 Ga0070672_1002534431 179
285 3300005543 Ga0070672_100813064 Ga0070672_1008130641 179
286 3300005543 Ga0070672_101346824 Ga0070672_1013468241 179
287 3300005544 Ga0070686_100003317 Ga0070686_1000033176 179
288 3300005544 Ga0070686_100036607 Ga0070686_1000366075 179
289 3300005544 Ga0070686_100090483 Ga0070686_1000904832 179
290 3300005544 Ga0070686_100250400 Ga0070686_1002504002 179
291 3300005544 Ga0070686_100377995 Ga0070686_1003779951 179
292 3300005544 Ga0070686_100775245 Ga0070686_1007752452 179
293 3300005544 Ga0070686_101156942 Ga0070686_1011569421 179
294 3300005545 Ga0070695_100634540 Ga0070695_1006345401 179
295 3300005546 Ga0070696_100090533 Ga0070696_1000905332 179
296 3300005546 Ga0070696_100250139 Ga0070696_1002501392 179
297 3300005547 Ga0070693_100244942 Ga0070693_1002449422 179
298 3300005547 Ga0070693_100580284 Ga0070693_1005802841 179
299 3300005548 Ga0070665_100001687 Ga0070665_1000016875 179
300 3300005548 Ga0070665_100002827 Ga0070665_10000282710 179
301 3300005548 Ga0070665_100094327 Ga0070665_1000943274 179
302 3300005548 Ga0070665_100109779 Ga0070665_1001097794 179
303 3300005548 Ga0070665_100121768 Ga0070665_1001217682 179
304 3300005548 Ga0070665_100146654 Ga0070665_1001466545 179
305 3300005548 Ga0070665_100157767 Ga0070665_1001577673 179
306 3300005548 Ga0070665_100318697 Ga0070665_1003186973 179
307 3300005549 Ga0070704_100028868 Ga0070704_1000288684 179
308 3300005563 Ga0068855_100009392 Ga0068855_1000093924 179
309 3300005563 Ga0068855_100010992 Ga0068855_1000109922 179
310 3300005563 Ga0068855_100035062 Ga0068855_1000350621 179
311 3300005563 Ga0068855_100050765 Ga0068855_1000507655 179
312 3300005563 Ga0068855_100072666 Ga0068855_1000726664 179
313 3300005563 Ga0068855_100232277 Ga0068855_1002322773 179
314 3300005564 Ga0070664_100001025 Ga0070664_10000102519 179
315 3300005564 Ga0070664_100081493 Ga0070664_1000814932 179
316 3300005564 Ga0070664_100111372 Ga0070664_1001113723 179
317 3300005564 Ga0070664_100463335 Ga0070664_1004633352 179
318 3300005564 Ga0070664_100486902 Ga0070664_1004869022 179
319 3300005564 Ga0070664_100507834 Ga0070664_1005078342 179
320 3300005577 Ga0068857_100040769 Ga0068857_1000407693 179
321 3300005577 Ga0068857_100043190 Ga0068857_1000431906 179
322 3300005577 Ga0068857_100159520 Ga0068857_1001595202 179
323 3300005577 Ga0068857_100446228 Ga0068857_1004462282 179
324 3300005577 Ga0068857_100592291 Ga0068857_1005922912 179
325 3300005578 Ga0068854_100053452 Ga0068854_1000534523 179
326 3300005578 Ga0068854_100288862 Ga0068854_1002888622 179
327 3300005578 Ga0068854_100431501 Ga0068854_1004315011 179
328 3300005578 Ga0068854_100538253 Ga0068854_1005382531 179
329 3300005614 Ga0068856_100020206 Ga0068856_1000202064 179
330 3300005614 Ga0068856_100041061 Ga0068856_1000410611 179
331 3300005614 Ga0068856_100075876 Ga0068856_1000758763 179
332 3300005614 Ga0068856_100104583 Ga0068856_1001045832 179
333 3300005616 Ga0068852_100100858 Ga0068852_1001008585 179
334 3300005616 Ga0068852_101190394 Ga0068852_1011903942 179
335 3300005617 Ga0068859_100000715 Ga0068859_10000071524 179
336 3300005617 Ga0068859_100016276 Ga0068859_1000162766 179
337 3300005617 Ga0068859_100024730 Ga0068859_1000247303 179
338 3300005617 Ga0068859_100086680 Ga0068859_1000866806 179
339 3300005617 Ga0068859_100107183 Ga0068859_1001071835 179
340 3300005617 Ga0068859_100339583 Ga0068859_1003395832 179
341 3300005617 Ga0068859_100411252 Ga0068859_1004112522 179
342 3300005617 Ga0068859_100638488 Ga0068859_1006384882 179
343 3300005617 Ga0068859_100779843 Ga0068859_1007798431 179
344 3300005617 Ga0068859_101135195 Ga0068859_1011351951 179
345 3300005618 Ga0068864_100005754 Ga0068864_1000057542 179
346 3300005618 Ga0068864_100016171 Ga0068864_1000161713 179
347 3300005618 Ga0068864_100175244 Ga0068864_1001752442 179
348 3300005618 Ga0068864_100219989 Ga0068864_1002199892 179
349 3300005618 Ga0068864_101638907 Ga0068864_1016389071 179
350 3300005718 Ga0068866_10004184 Ga0068866_100041845 179
351 3300005718 Ga0068866_10351346 Ga0068866_103513461 179
352 3300005718 Ga0068866_10785035 Ga0068866_107850351 179
353 3300005719 Ga0068861_100013223 Ga0068861_1000132233 179
354 3300005719 Ga0068861_100021947 Ga0068861_1000219473 179
355 3300005719 Ga0068861_100086189 Ga0068861_1000861892 179
356 3300005719 Ga0068861_100090868 Ga0068861_1000908684 179
357 3300005719 Ga0068861_100124813 Ga0068861_1001248133 179
358 3300005719 Ga0068861_100154175 Ga0068861_1001541753 179
359 3300005719 Ga0068861_100608226 Ga0068861_1006082262 179
360 3300005719 Ga0068861_101333808 Ga0068861_1013338081 179
361 3300005840 Ga0068870_10003073 Ga0068870_100030735 179
362 3300005840 Ga0068870_10013288 Ga0068870_100132885 179
363 3300005840 Ga0068870_10064795 Ga0068870_100647953 179
364 3300005840 Ga0068870_10322056 Ga0068870_103220561 179
365 3300005841 Ga0068863_100002979 Ga0068863_1000029796 179
366 3300005841 Ga0068863_100005241 Ga0068863_1000052413 179
367 3300005841 Ga0068863_100009569 Ga0068863_1000095699 179
368 3300005841 Ga0068863_100072398 Ga0068863_1000723981 179
369 3300005841 Ga0068863_100379148 Ga0068863_1003791482 179
370 3300005841 Ga0068863_100696262 Ga0068863_1006962622 179
371 3300005841 Ga0068863_100804324 Ga0068863_1008043241 179
372 3300005841 Ga0068863_100848960 Ga0068863_1008489602 179
373 3300005842 Ga0068858_100005002 Ga0068858_10000500213 179
374 3300005842 Ga0068858_100012054 Ga0068858_1000120546 179
375 3300005842 Ga0068858_100014520 Ga0068858_1000145203 179
376 3300005842 Ga0068858_100061049 Ga0068858_1000610491 179
377 3300005842 Ga0068858_100174328 Ga0068858_1001743282 179
378 3300005842 Ga0068858_100551473 Ga0068858_1005514731 179
379 3300005843 Ga0068860_100003286 Ga0068860_1000032864 179
380 3300005843 Ga0068860_100024072 Ga0068860_1000240728 179
381 3300005843 Ga0068860_100064892 Ga0068860_1000648924 179
382 3300005843 Ga0068860_100065361 Ga0068860_1000653612 179
383 3300005843 Ga0068860_100108788 Ga0068860_1001087884 179
384 3300005843 Ga0068860_100146073 Ga0068860_1001460734 179
385 3300005844 Ga0068862_100001470 Ga0068862_1000014708 179
386 3300005844 Ga0068862_100002059 Ga0068862_1000020596 179
387 3300005844 Ga0068862_100004086 Ga0068862_10000408611 179
388 3300005844 Ga0068862_100058178 Ga0068862_1000581781 179
389 3300005844 Ga0068862_100200402 Ga0068862_1002004022 179
390 3300005844 Ga0068862_100875473 Ga0068862_1008754732 179
391 3300005844 Ga0068862_100962035 Ga0068862_1009620351 179
392 3300005844 Ga0068862_101255489 Ga0068862_1012554892 179
393 3300005844 Ga0068862_101782262 Ga0068862_1017822621 179
394 3300005937 Ga0081455_10001012 Ga0081455_1000101217 179
395 3300005937 Ga0081455_10057666 Ga0081455_100576664 179
396 3300005937 Ga0081455_10600666 Ga0081455_106006662 179
397 3300005985 Ga0081539_10000055 Ga0081539_1000005510 179
398 3300005985 Ga0081539_10004424 Ga0081539_100044243 179
399 3300005985 Ga0081539_10005465 Ga0081539_100054656 179
400 3300006028 Ga0070717_11153218 Ga0070717_111532182 179
401 3300006038 Ga0075365_10204243 Ga0075365_102042433 179
402 3300006163 Ga0070715_10316173 Ga0070715_103161732 179
403 3300006173 Ga0070716_100002584 Ga0070716_1000025847 179
404 3300006173 Ga0070716_100006429 Ga0070716_1000064296 179
405 3300006173 Ga0070716_100053175 Ga0070716_1000531752 179
406 3300006173 Ga0070716_100266822 Ga0070716_1002668222 179
407 3300006175 Ga0070712_100001982 Ga0070712_1000019829 179
408 3300006175 Ga0070712_100032042 Ga0070712_1000320421 179
409 3300006175 Ga0070712_100146152 Ga0070712_1001461521 179
410 3300006195 Ga0075366_10144311 Ga0075366_101443111 179
411 3300006195 Ga0075366_10435087 Ga0075366_104350871 179
412 3300006237 Ga0097621_100004031 Ga0097621_1000040318 179
413 3300006237 Ga0097621_100004662 Ga0097621_1000046626 179
414 3300006237 Ga0097621_100075288 Ga0097621_1000752884 179
415 3300006237 Ga0097621_100096165 Ga0097621_1000961652 179
416 3300006237 Ga0097621_100131167 Ga0097621_1001311671 179
417 3300006237 Ga0097621_100171335 Ga0097621_1001713353 179
418 3300006237 Ga0097621_100207521 Ga0097621_1002075212 179
419 3300006237 Ga0097621_100210662 Ga0097621_1002106622 179
420 3300006237 Ga0097621_100251778 Ga0097621_1002517782 179
421 3300006237 Ga0097621_100416746 Ga0097621_1004167462 179
422 3300006358 Ga0068871_100015582 Ga0068871_1000155825 179
423 3300006358 Ga0068871_100017404 Ga0068871_1000174043 179
424 3300006358 Ga0068871_100082487 Ga0068871_1000824872 179
425 3300006358 Ga0068871_100097128 Ga0068871_1000971281 179
426 3300006358 Ga0068871_100254001 Ga0068871_1002540013 179
427 3300006358 Ga0068871_100342520 Ga0068871_1003425202 179
428 3300006358 Ga0068871_100359803 Ga0068871_1003598031 179
429 3300006358 Ga0068871_100383971 Ga0068871_1003839712 179
430 3300006358 Ga0068871_100437282 Ga0068871_1004372821 179
431 3300006358 Ga0068871_101339547 Ga0068871_1013395471 179
432 3300006844 Ga0075428_100000991 Ga0075428_10000099120 179
433 3300006844 Ga0075428_100004128 Ga0075428_1000041288 179
434 3300006844 Ga0075428_100006037 Ga0075428_10000603716 179
435 3300006846 Ga0075430_100001603 Ga0075430_10000160310 179
436 3300006846 Ga0075430_100026158 Ga0075430_1000261587 179
437 3300006846 Ga0075430_100399433 Ga0075430_1003994332 179
438 3300006846 Ga0075430_100682693 Ga0075430_1006826931 179
439 3300006847 Ga0075431_100002145 Ga0075431_10000214512 179
440 3300006847 Ga0075431_100005153 Ga0075431_1000051536 179
441 3300006847 Ga0075431_100010663 Ga0075431_1000106635 179
442 3300006847 Ga0075431_100125160 Ga0075431_1001251603 179
443 3300006852 Ga0075433_10665798 Ga0075433_106657981 179
444 3300006871 Ga0075434_100350625 Ga0075434_1003506252 179
445 3300006880 Ga0075429_100000892 Ga0075429_10000089210 179
446 3300006880 Ga0075429_100004377 Ga0075429_1000043774 179
447 3300006880 Ga0075429_100208872 Ga0075429_1002088722 179
448 3300006880 Ga0075429_100376568 Ga0075429_1003765682 179
449 3300006881 Ga0068865_100011129 Ga0068865_1000111295 179
450 3300006881 Ga0068865_100041920 Ga0068865_1000419201 179
451 3300006881 Ga0068865_100151242 Ga0068865_1001512422 179
452 3300006881 Ga0068865_100227477 Ga0068865_1002274771 179
453 3300006881 Ga0068865_100275012 Ga0068865_1002750122 179
454 3300006914 Ga0075436_100070848 Ga0075436_1000708483 179
455 3300006914 Ga0075436_100490443 Ga0075436_1004904432 179
456 3300006931 Ga0097620_100000715 Ga0097620_10000071524 179
457 3300006931 Ga0097620_100016276 Ga0097620_1000162766 179
458 3300006931 Ga0097620_100024730 Ga0097620_1000247303 179
459 3300006931 Ga0097620_100086677 Ga0097620_1000866776 179
460 3300006931 Ga0097620_100107187 Ga0097620_1001071875 179
461 3300006931 Ga0097620_100339606 Ga0097620_1003396062 179
462 3300006931 Ga0097620_100411213 Ga0097620_1004112132 179
463 3300006931 Ga0097620_100638372 Ga0097620_1006383722 179
464 3300006931 Ga0097620_100780080 Ga0097620_1007800801 179
465 3300006931 Ga0097620_101135376 Ga0097620_1011353761 179
466 3300006948 Ga0099826_10018619 Ga0099826_100186195 179
467 3300007076 Ga0075435_100093833 Ga0075435_1000938333 179
468 3300009092 Ga0105250_10054875 Ga0105250_100548752 179
469 3300009092 Ga0105250_10087463 Ga0105250_100874632 179
470 3300009093 Ga0105240_10005273 Ga0105240_1000527315 179
471 3300009093 Ga0105240_10007059 Ga0105240_100070597 179
472 3300009093 Ga0105240_10007550 Ga0105240_1000755011 179
473 3300009093 Ga0105240_10024084 Ga0105240_1002408410 179
474 3300009093 Ga0105240_10030802 Ga0105240_100308022 179
475 3300009093 Ga0105240_10086562 Ga0105240_100865624 179
476 3300009093 Ga0105240_10110534 Ga0105240_101105345 179
477 3300009093 Ga0105240_10134635 Ga0105240_101346353 179
478 3300009093 Ga0105240_10238722 Ga0105240_102387221 179
479 3300009093 Ga0105240_10480810 Ga0105240_104808101 179
480 3300009093 Ga0105240_10546096 Ga0105240_105460962 179
481 3300009093 Ga0105240_10686700 Ga0105240_106867002 179
482 3300009093 Ga0105240_10843405 Ga0105240_108434052 179
483 3300009094 Ga0111539_10018383 Ga0111539_100183839 179
484 3300009094 Ga0111539_10101187 Ga0111539_101011873 179
485 3300009094 Ga0111539_10203540 Ga0111539_102035404 179
486 3300009094 Ga0111539_11420043 Ga0111539_114200432 179
487 3300009094 Ga0111539_11489965 Ga0111539_114899651 179
488 3300009094 Ga0111539_12179859 Ga0111539_121798591 179
489 3300009098 Ga0105245_10009918 Ga0105245_100099188 179
490 3300009098 Ga0105245_10037278 Ga0105245_100372783 179
491 3300009098 Ga0105245_10574927 Ga0105245_105749272 179
492 3300009098 Ga0105245_10815366 Ga0105245_108153662 179
493 3300009101 Ga0105247_10000557 Ga0105247_100005578 179
494 3300009101 Ga0105247_10006388 Ga0105247_100063888 179
495 3300009101 Ga0105247_10015442 Ga0105247_100154425 179
496 3300009101 Ga0105247_10030282 Ga0105247_100302825 179
497 3300009147 Ga0114129_10000531 Ga0114129_1000053110 179
498 3300009148 Ga0105243_10093409 Ga0105243_100934092 179
499 3300009174 Ga0105241_10024074 Ga0105241_100240742 179
500 3300009174 Ga0105241_10321408 Ga0105241_103214082 179
501 3300009174 Ga0105241_10460378 Ga0105241_104603782 179
502 3300009174 Ga0105241_11270332 Ga0105241_112703321 179
503 3300009176 Ga0105242_10000894 Ga0105242_1000089417 179
504 3300009176 Ga0105242_10064423 Ga0105242_100644231 179
505 3300009176 Ga0105242_10248244 Ga0105242_102482442 179
506 3300009176 Ga0105242_11105889 Ga0105242_111058892 179
507 3300009177 Ga0105248_10009456 Ga0105248_100094567 179
508 3300009177 Ga0105248_10012607 Ga0105248_100126074 179
509 3300009177 Ga0105248_10013134 Ga0105248_100131345 179
510 3300009177 Ga0105248_10141359 Ga0105248_101413592 179
511 3300009177 Ga0105248_10325348 Ga0105248_103253482 179
512 3300009177 Ga0105248_10382087 Ga0105248_103820873 179
513 3300009177 Ga0105248_10674855 Ga0105248_106748552 179
514 3300009177 Ga0105248_10678850 Ga0105248_106788501 179
515 3300009545 Ga0105237_10009386 Ga0105237_100093862 179
516 3300009545 Ga0105237_10018532 Ga0105237_100185328 179
517 3300009545 Ga0105237_10183150 Ga0105237_101831503 179
518 3300009545 Ga0105237_10560306 Ga0105237_105603061 179
519 3300009551 Ga0105238_10004856 Ga0105238_100048567 179
520 3300009551 Ga0105238_10010977 Ga0105238_100109778 179
521 3300009551 Ga0105238_10028530 Ga0105238_100285305 179
522 3300009551 Ga0105238_10058638 Ga0105238_100586383 179
523 3300009551 Ga0105238_10100214 Ga0105238_101002142 179
524 3300009551 Ga0105238_10139985 Ga0105238_101399853 179
525 3300009551 Ga0105238_10294035 Ga0105238_102940352 179
526 3300009551 Ga0105238_10316126 Ga0105238_103161262 179
527 3300009551 Ga0105238_10399888 Ga0105238_103998882 179
528 3300009553 Ga0105249_10005395 Ga0105249_100053955 179
529 3300009553 Ga0105249_10016314 Ga0105249_100163148 179
530 3300009553 Ga0105249_10125676 Ga0105249_101256763 179
531 3300009553 Ga0105249_10288378 Ga0105249_102883782 179
532 3300009553 Ga0105249_10508058 Ga0105249_105080582 179
533 3300009553 Ga0105249_11443842 Ga0105249_114438421 179
534 3300009987 Ga0105030_102515 Ga0105030_1025151 179
535 3300010375 Ga0105239_10013750 Ga0105239_100137504 179
536 3300010375 Ga0105239_10016193 Ga0105239_100161935 179
537 3300010375 Ga0105239_10027633 Ga0105239_100276332 179
538 3300010375 Ga0105239_11058539 Ga0105239_110585391 179
539 3300011119 Ga0105246_10189467 Ga0105246_101894672 179
540 3300011119 Ga0105246_10392668 Ga0105246_103926683 179
541 3300011119 Ga0105246_10804113 Ga0105246_108041132 179
542 3300011119 Ga0105246_11376354 Ga0105246_113763541 179
543 3300013104 Ga0157370_10022372 Ga0157370_100223722 179
544 3300013105 Ga0157369_10011861 Ga0157369_100118614 179
545 3300013105 Ga0157369_10031473 Ga0157369_100314733 179
546 3300013105 Ga0157369_10040019 Ga0157369_100400194 179
547 3300013105 Ga0157369_10472630 Ga0157369_104726302 179
548 3300013105 Ga0157369_10493345 Ga0157369_104933452 179
549 3300013105 Ga0157369_11268421 Ga0157369_112684211 179
550 3300013296 Ga0157374_10013136 Ga0157374_100131367 179
551 3300013296 Ga0157374_10074346 Ga0157374_100743463 179
552 3300013296 Ga0157374_10101969 Ga0157374_101019692 179
553 3300013296 Ga0157374_10142442 Ga0157374_101424422 179
554 3300013296 Ga0157374_10411530 Ga0157374_104115302 179
555 3300013296 Ga0157374_10510983 Ga0157374_105109831 179
556 3300013296 Ga0157374_10560903 Ga0157374_105609032 179
557 3300013296 Ga0157374_11495737 Ga0157374_114957371 179
558 3300013297 Ga0157378_10166673 Ga0157378_101666733 179
559 3300013297 Ga0157378_10430930 Ga0157378_104309301 179
560 3300013297 Ga0157378_10604741 Ga0157378_106047412 179
561 3300013297 Ga0157378_10732017 Ga0157378_107320172 179
562 3300013297 Ga0157378_10732359 Ga0157378_107323592 179
563 3300013297 Ga0157378_10874950 Ga0157378_108749502 179
564 3300013297 Ga0157378_10995778 Ga0157378_109957781 179
565 3300013306 Ga0163162_10037985 Ga0163162_100379857 179
566 3300013306 Ga0163162_10054126 Ga0163162_100541263 179
567 3300013306 Ga0163162_10072548 Ga0163162_100725483 179
568 3300013306 Ga0163162_10073471 Ga0163162_100734713 179
569 3300013306 Ga0163162_10077666 Ga0163162_100776664 179
570 3300013306 Ga0163162_10840573 Ga0163162_108405732 179
571 3300013307 Ga0157372_10084867 Ga0157372_100848674 179
572 3300013307 Ga0157372_10101471 Ga0157372_101014714 179
573 3300013307 Ga0157372_10197671 Ga0157372_101976713 179
574 3300013307 Ga0157372_10828932 Ga0157372_108289322 179
575 3300013308 Ga0157375_10010672 Ga0157375_100106721 179
576 3300013308 Ga0157375_10014363 Ga0157375_100143636 179
577 3300013308 Ga0157375_10117846 Ga0157375_101178462 179
578 3300013308 Ga0157375_10218727 Ga0157375_102187272 179
579 3300013308 Ga0157375_10228711 Ga0157375_102287114 179
580 3300013308 Ga0157375_10470359 Ga0157375_104703591 179
581 3300013308 Ga0157375_11057754 Ga0157375_110577541 179
582 3300013308 Ga0157375_11152615 Ga0157375_111526152 179
583 3300014325 Ga0163163_10004439 Ga0163163_100044392 179
584 3300014325 Ga0163163_10011676 Ga0163163_100116765 179
585 3300014325 Ga0163163_10150958 Ga0163163_101509584 179
586 3300014325 Ga0163163_10421409 Ga0163163_104214091 179
587 3300014325 Ga0163163_10473536 Ga0163163_104735362 179
588 3300014325 Ga0163163_10631814 Ga0163163_106318142 179
589 3300014325 Ga0163163_10771357 Ga0163163_107713572 179
590 3300014325 Ga0163163_12131122 Ga0163163_121311221 179
591 3300014326 Ga0157380_10004096 Ga0157380_100040962 179
592 3300014326 Ga0157380_10006341 Ga0157380_100063411 179
593 3300014326 Ga0157380_10028709 Ga0157380_100287094 179
594 3300014326 Ga0157380_10038698 Ga0157380_100386983 179
595 3300014326 Ga0157380_10050117 Ga0157380_100501176 179
596 3300014326 Ga0157380_10515769 Ga0157380_105157691 179
597 3300014326 Ga0157380_10636489 Ga0157380_106364892 179
598 3300014326 Ga0157380_10729029 Ga0157380_107290292 179
599 3300014326 Ga0157380_10991984 Ga0157380_109919841 179
600 3300014326 Ga0157380_11643943 Ga0157380_116439431 179
601 3300014326 Ga0157380_11752540 Ga0157380_117525401 179
602 3300014497 Ga0182008_10124920 Ga0182008_101249202 179
603 3300014745 Ga0157377_10012496 Ga0157377_100124963 179
604 3300014745 Ga0157377_10094493 Ga0157377_100944932 179
605 3300014745 Ga0157377_10131096 Ga0157377_101310961 179
606 3300014968 Ga0157379_10076147 Ga0157379_100761474 179
607 3300014968 Ga0157379_10110837 Ga0157379_101108374 179
608 3300014968 Ga0157379_10172442 Ga0157379_101724422 179
609 3300014968 Ga0157379_10184982 Ga0157379_101849822 179
610 3300014968 Ga0157379_10207484 Ga0157379_102074842 179
611 3300014968 Ga0157379_10255555 Ga0157379_102555552 179
612 3300014968 Ga0157379_10262245 Ga0157379_102622452 179
613 3300014969 Ga0157376_10063557 Ga0157376_100635572 179
614 3300014969 Ga0157376_10120904 Ga0157376_101209043 179
615 3300014969 Ga0157376_10200370 Ga0157376_102003702 179
616 3300014969 Ga0157376_10324251 Ga0157376_103242513 179
617 3300014969 Ga0157376_10373326 Ga0157376_103733262 179
618 3300014969 Ga0157376_10868025 Ga0157376_108680251 179
619 3300017792 Ga0163161_10038470 Ga0163161_100384704 179
620 3300017792 Ga0163161_10086608 Ga0163161_100866082 179
621 3300017792 Ga0163161_10677238 Ga0163161_106772382 179
622 3300020070 Ga0206356_11050776 Ga0206356_110507761 179
623 3300020076 Ga0206355_1087629 Ga0206355_10876291 179
624 3300020076 Ga0206355_1256135 Ga0206355_12561352 179
625 3300020076 Ga0206355_1310435 Ga0206355_13104351 179
626 3300020076 Ga0206355_1571275 Ga0206355_15712751 179
627 3300020076 Ga0206355_1687272 Ga0206355_16872721 179
628 3300020077 Ga0206351_10084949 Ga0206351_100849491 179
629 3300020081 Ga0206354_11591843 Ga0206354_115918431 179
630 3300021358 Ga0213873_10009552 Ga0213873_100095523 179
631 3300021361 Ga0213872_10217700 Ga0213872_102177001 179
632 3300021377 Ga0213874_10017174 Ga0213874_100171742 179
633 3300021377 Ga0213874_10073231 Ga0213874_100732311 179
634 3300021384 Ga0213876_10057608 Ga0213876_100576082 179
635 3300021441 Ga0213871_10060277 Ga0213871_100602771 179
636 3300021441 Ga0213871_10083117 Ga0213871_100831172 179
637 3300022467 Ga0224712_10160940 Ga0224712_101609402 179
638 3300022467 Ga0224712_10203175 Ga0224712_102031752 179
639 3300022467 Ga0224712_10374318 Ga0224712_103743182 179
640 3300022467 Ga0224712_10478910 Ga0224712_104789101 179
641 3300023304 Ga0256714_109273 Ga0256714_1092731 179
642 3300023304 Ga0256714_117914 Ga0256714_1179141 179
643 3300023304 Ga0256714_130426 Ga0256714_1304262 179
644 3300023309 Ga0256744_100180 Ga0256744_1001802 179
645 3300023309 Ga0256744_124239 Ga0256744_1242391 179
646 3300023436 Ga0256743_120810 Ga0256743_1208101 179
647 3300023438 Ga0256720_106382 Ga0256720_1063821 179
648 3300023438 Ga0256720_120993 Ga0256720_1209931 179
649 3300025893 Ga0207682_10025845 Ga0207682_100258453 179
650 3300025898 Ga0207692_10014797 Ga0207692_100147975 179
651 3300025898 Ga0207692_10231777 Ga0207692_102317772 179
652 3300025899 Ga0207642_10018122 Ga0207642_100181224 179
653 3300025899 Ga0207642_10091343 Ga0207642_100913431 179
654 3300025899 Ga0207642_10561600 Ga0207642_105616001 179
655 3300025900 Ga0207710_10016751 Ga0207710_100167514 179
656 3300025900 Ga0207710_10017004 Ga0207710_100170043 179
657 3300025900 Ga0207710_10072271 Ga0207710_100722711 179
658 3300025901 Ga0207688_10033787 Ga0207688_100337874 179
659 3300025901 Ga0207688_10567662 Ga0207688_105676621 179
660 3300025903 Ga0207680_10005980 Ga0207680_100059805 179
661 3300025903 Ga0207680_10108040 Ga0207680_101080402 179
662 3300025903 Ga0207680_10205517 Ga0207680_102055171 179
663 3300025904 Ga0207647_10146697 Ga0207647_101466972 179
664 3300025906 Ga0207699_10008193 Ga0207699_100081936 179
665 3300025906 Ga0207699_10035696 Ga0207699_100356963 179
666 3300025907 Ga0207645_10003653 Ga0207645_100036533 179
667 3300025907 Ga0207645_10024776 Ga0207645_100247764 179
668 3300025907 Ga0207645_10155569 Ga0207645_101555692 179
669 3300025908 Ga0207643_10007300 Ga0207643_100073002 179
670 3300025908 Ga0207643_10008594 Ga0207643_100085944 179
671 3300025908 Ga0207643_10050955 Ga0207643_100509553 179
672 3300025908 Ga0207643_10118712 Ga0207643_101187122 179
673 3300025911 Ga0207654_10224380 Ga0207654_102243802 179
674 3300025911 Ga0207654_10376454 Ga0207654_103764541 179
675 3300025911 Ga0207654_10694667 Ga0207654_106946671 179
676 3300025912 Ga0207707_10001046 Ga0207707_1000104624 179
677 3300025912 Ga0207707_10001063 Ga0207707_100010634 179
678 3300025912 Ga0207707_10029907 Ga0207707_100299074 179
679 3300025912 Ga0207707_10038018 Ga0207707_100380182 179
680 3300025912 Ga0207707_10045189 Ga0207707_100451894 179
681 3300025912 Ga0207707_10065562 Ga0207707_100655623 179
682 3300025912 Ga0207707_10250455 Ga0207707_102504553 179
683 3300025912 Ga0207707_10308629 Ga0207707_103086292 179
684 3300025913 Ga0207695_10012669 Ga0207695_1001266910 179
685 3300025913 Ga0207695_10014888 Ga0207695_100148882 179
686 3300025913 Ga0207695_10022293 Ga0207695_100222937 179
687 3300025913 Ga0207695_10079417 Ga0207695_100794173 179
688 3300025913 Ga0207695_10094303 Ga0207695_100943034 179
689 3300025913 Ga0207695_10098536 Ga0207695_100985363 179
690 3300025913 Ga0207695_10149224 Ga0207695_101492242 179
691 3300025913 Ga0207695_10151194 Ga0207695_101511944 179
692 3300025913 Ga0207695_10154088 Ga0207695_101540881 179
693 3300025913 Ga0207695_10183131 Ga0207695_101831312 179
694 3300025913 Ga0207695_10948710 Ga0207695_109487102 179
695 3300025914 Ga0207671_10062052 Ga0207671_100620524 179
696 3300025914 Ga0207671_10238569 Ga0207671_102385692 179
697 3300025915 Ga0207693_10000343 Ga0207693_1000034322 179
698 3300025915 Ga0207693_10038208 Ga0207693_100382083 179
699 3300025915 Ga0207693_10143200 Ga0207693_101432001 179
700 3300025915 Ga0207693_11131736 Ga0207693_111317361 179
701 3300025916 Ga0207663_10024971 Ga0207663_100249712 179
702 3300025916 Ga0207663_10335859 Ga0207663_103358592 179
703 3300025916 Ga0207663_10638706 Ga0207663_106387062 179
704 3300025917 Ga0207660_10003539 Ga0207660_100035393 179
705 3300025917 Ga0207660_10007909 Ga0207660_100079093 179
706 3300025917 Ga0207660_10045796 Ga0207660_100457964 179
707 3300025917 Ga0207660_10120743 Ga0207660_101207433 179
708 3300025917 Ga0207660_10128931 Ga0207660_101289311 179
709 3300025917 Ga0207660_10407250 Ga0207660_104072501 179
710 3300025917 Ga0207660_10614739 Ga0207660_106147391 179
711 3300025917 Ga0207660_10651873 Ga0207660_106518731 179
712 3300025918 Ga0207662_10086288 Ga0207662_100862882 179
713 3300025918 Ga0207662_10111372 Ga0207662_101113722 179
714 3300025918 Ga0207662_10217599 Ga0207662_102175992 179
715 3300025918 Ga0207662_10280596 Ga0207662_102805962 179
716 3300025919 Ga0207657_10133022 Ga0207657_101330222 179
717 3300025920 Ga0207649_10033170 Ga0207649_100331704 179
718 3300025920 Ga0207649_10186726 Ga0207649_101867262 179
719 3300025921 Ga0207652_10006570 Ga0207652_100065702 179
720 3300025921 Ga0207652_10018358 Ga0207652_100183584 179
721 3300025921 Ga0207652_10101803 Ga0207652_101018032 179
722 3300025921 Ga0207652_10137088 Ga0207652_101370881 179
723 3300025921 Ga0207652_10410592 Ga0207652_104105922 179
724 3300025921 Ga0207652_11210495 Ga0207652_112104951 179
725 3300025921 Ga0207652_11305661 Ga0207652_113056611 179
726 3300025923 Ga0207681_10050431 Ga0207681_100504313 179
727 3300025923 Ga0207681_10061283 Ga0207681_100612831 179
728 3300025924 Ga0207694_10117316 Ga0207694_101173161 179
729 3300025924 Ga0207694_10163111 Ga0207694_101631113 179
730 3300025924 Ga0207694_10233765 Ga0207694_102337652 179
731 3300025924 Ga0207694_10303183 Ga0207694_103031832 179
732 3300025924 Ga0207694_10306080 Ga0207694_103060802 179
733 3300025924 Ga0207694_10311731 Ga0207694_103117313 179
734 3300025924 Ga0207694_10371666 Ga0207694_103716661 179
735 3300025924 Ga0207694_10445441 Ga0207694_104454411 179
736 3300025925 Ga0207650_10041517 Ga0207650_100415172 179
737 3300025925 Ga0207650_10371870 Ga0207650_103718702 179
738 3300025925 Ga0207650_10522953 Ga0207650_105229531 179
739 3300025925 Ga0207650_11052694 Ga0207650_110526941 179
740 3300025926 Ga0207659_10044341 Ga0207659_100443412 179
741 3300025926 Ga0207659_10126075 Ga0207659_101260753 179
742 3300025926 Ga0207659_10158256 Ga0207659_101582562 179
743 3300025926 Ga0207659_10167622 Ga0207659_101676222 179
744 3300025926 Ga0207659_10978200 Ga0207659_109782001 179
745 3300025927 Ga0207687_10058430 Ga0207687_100584303 179
746 3300025927 Ga0207687_10707264 Ga0207687_107072642 179
747 3300025928 Ga0207700_10045557 Ga0207700_100455573 179
748 3300025928 Ga0207700_10072360 Ga0207700_100723604 179
749 3300025928 Ga0207700_10282312 Ga0207700_102823123 179
750 3300025929 Ga0207664_10030820 Ga0207664_100308203 179
751 3300025931 Ga0207644_10001535 Ga0207644_1000153510 179
752 3300025931 Ga0207644_10007221 Ga0207644_100072218 179
753 3300025931 Ga0207644_10028354 Ga0207644_100283545 179
754 3300025931 Ga0207644_10057643 Ga0207644_100576432 179
755 3300025932 Ga0207690_10058335 Ga0207690_100583354 179
756 3300025932 Ga0207690_10444345 Ga0207690_104443452 179
757 3300025932 Ga0207690_11191681 Ga0207690_111916811 179
758 3300025933 Ga0207706_10002507 Ga0207706_100025078 179
759 3300025933 Ga0207706_10006432 Ga0207706_100064322 179
760 3300025933 Ga0207706_10054130 Ga0207706_100541303 179
761 3300025934 Ga0207686_10013112 Ga0207686_100131123 179
762 3300025935 Ga0207709_10230668 Ga0207709_102306682 179
763 3300025936 Ga0207670_10034476 Ga0207670_100344762 179
764 3300025936 Ga0207670_10637647 Ga0207670_106376471 179
765 3300025936 Ga0207670_10912288 Ga0207670_109122881 179
766 3300025937 Ga0207669_10020704 Ga0207669_100207044 179
767 3300025937 Ga0207669_10057973 Ga0207669_100579733 179
768 3300025937 Ga0207669_10137697 Ga0207669_101376973 179
769 3300025937 Ga0207669_10764683 Ga0207669_107646831 179
770 3300025938 Ga0207704_10034972 Ga0207704_100349722 179
771 3300025938 Ga0207704_10237326 Ga0207704_102373262 179
772 3300025938 Ga0207704_10322539 Ga0207704_103225392 179
773 3300025939 Ga0207665_10011562 Ga0207665_100115622 179
774 3300025939 Ga0207665_10081413 Ga0207665_100814132 179
775 3300025939 Ga0207665_10138324 Ga0207665_101383242 179
776 3300025940 Ga0207691_10002085 Ga0207691_1000208512 179
777 3300025940 Ga0207691_10011812 Ga0207691_1001181211 179
778 3300025940 Ga0207691_10012001 Ga0207691_100120015 179
779 3300025940 Ga0207691_10067981 Ga0207691_100679813 179
780 3300025940 Ga0207691_10399138 Ga0207691_103991382 179
781 3300025940 Ga0207691_10399185 Ga0207691_103991852 179
782 3300025941 Ga0207711_10031266 Ga0207711_100312664 179
783 3300025941 Ga0207711_10183942 Ga0207711_101839421 179
784 3300025941 Ga0207711_10281105 Ga0207711_102811052 179
785 3300025941 Ga0207711_10334932 Ga0207711_103349322 179
786 3300025941 Ga0207711_10738353 Ga0207711_107383531 179
787 3300025941 Ga0207711_11008204 Ga0207711_110082041 179
788 3300025941 Ga0207711_11026120 Ga0207711_110261201 179
789 3300025942 Ga0207689_10001269 Ga0207689_1000126910 179
790 3300025942 Ga0207689_10013247 Ga0207689_100132476 179
791 3300025942 Ga0207689_10014425 Ga0207689_100144256 179
792 3300025944 Ga0207661_10039152 Ga0207661_100391524 179
793 3300025944 Ga0207661_10065862 Ga0207661_100658622 179
794 3300025944 Ga0207661_10195353 Ga0207661_101953531 179
795 3300025944 Ga0207661_10229210 Ga0207661_102292102 179
796 3300025944 Ga0207661_10277135 Ga0207661_102771352 179
797 3300025945 Ga0207679_10105262 Ga0207679_101052622 179
798 3300025945 Ga0207679_10124800 Ga0207679_101248004 179
799 3300025945 Ga0207679_10379264 Ga0207679_103792642 179
800 3300025945 Ga0207679_10537271 Ga0207679_105372712 179
801 3300025949 Ga0207667_10001150 Ga0207667_1000115035 179
802 3300025949 Ga0207667_10003474 Ga0207667_100034746 179
803 3300025949 Ga0207667_10012196 Ga0207667_100121963 179
804 3300025949 Ga0207667_10205164 Ga0207667_102051641 179
805 3300025949 Ga0207667_10244892 Ga0207667_102448922 179
806 3300025949 Ga0207667_10363517 Ga0207667_103635172 179
807 3300025949 Ga0207667_10873656 Ga0207667_108736562 179
808 3300025960 Ga0207651_10008465 Ga0207651_100084654 179
809 3300025960 Ga0207651_10023567 Ga0207651_100235675 179
810 3300025960 Ga0207651_10046838 Ga0207651_100468382 179
811 3300025960 Ga0207651_10494815 Ga0207651_104948151 179
812 3300025961 Ga0207712_10034875 Ga0207712_100348752 179
813 3300025961 Ga0207712_10039461 Ga0207712_100394613 179
814 3300025961 Ga0207712_10172351 Ga0207712_101723512 179
815 3300025961 Ga0207712_10277738 Ga0207712_102777382 179
816 3300025961 Ga0207712_10339311 Ga0207712_103393112 179
817 3300025961 Ga0207712_10823836 Ga0207712_108238362 179
818 3300025961 Ga0207712_11249686 Ga0207712_112496861 179
819 3300025972 Ga0207668_10005626 Ga0207668_100056265 179
820 3300025981 Ga0207640_10146673 Ga0207640_101466731 179
821 3300025981 Ga0207640_10731600 Ga0207640_107316002 179
822 3300025986 Ga0207658_10000046 Ga0207658_1000004658 179
823 3300025986 Ga0207658_10212687 Ga0207658_102126872 179
824 3300025986 Ga0207658_10453940 Ga0207658_104539401 179
825 3300025986 Ga0207658_10520633 Ga0207658_105206332 179
826 3300026023 Ga0207677_10158353 Ga0207677_101583532 179
827 3300026023 Ga0207677_10161352 Ga0207677_101613522 179
828 3300026023 Ga0207677_10733929 Ga0207677_107339291 179
829 3300026035 Ga0207703_10001297 Ga0207703_1000129722 179
830 3300026035 Ga0207703_10005685 Ga0207703_100056858 179
831 3300026035 Ga0207703_10217676 Ga0207703_102176762 179
832 3300026035 Ga0207703_10659709 Ga0207703_106597092 179
833 3300026041 Ga0207639_10684101 Ga0207639_106841011 179
834 3300026041 Ga0207639_10688642 Ga0207639_106886421 179
835 3300026041 Ga0207639_10778989 Ga0207639_107789892 179
836 3300026067 Ga0207678_10033130 Ga0207678_100331302 179
837 3300026067 Ga0207678_10088861 Ga0207678_100888612 179
838 3300026067 Ga0207678_10095922 Ga0207678_100959222 179
839 3300026075 Ga0207708_10011839 Ga0207708_100118394 179
840 3300026075 Ga0207708_10027141 Ga0207708_100271412 179
841 3300026075 Ga0207708_10032970 Ga0207708_100329703 179
842 3300026075 Ga0207708_10065887 Ga0207708_100658874 179
843 3300026075 Ga0207708_10114863 Ga0207708_101148632 179
844 3300026078 Ga0207702_10042270 Ga0207702_100422702 179
845 3300026078 Ga0207702_10198278 Ga0207702_101982782 179
846 3300026078 Ga0207702_10221018 Ga0207702_102210182 179
847 3300026078 Ga0207702_10321912 Ga0207702_103219123 179
848 3300026078 Ga0207702_11110888 Ga0207702_111108882 179
849 3300026088 Ga0207641_10001107 Ga0207641_1000110710 179
850 3300026088 Ga0207641_10009498 Ga0207641_100094984 179
851 3300026088 Ga0207641_10030599 Ga0207641_100305993 179
852 3300026088 Ga0207641_10063843 Ga0207641_100638432 179
853 3300026088 Ga0207641_10166310 Ga0207641_101663102 179
854 3300026088 Ga0207641_10179304 Ga0207641_101793043 179
855 3300026089 Ga0207648_10006603 Ga0207648_100066033 179
856 3300026089 Ga0207648_10015775 Ga0207648_100157755 179
857 3300026089 Ga0207648_10034879 Ga0207648_100348794 179
858 3300026089 Ga0207648_10074835 Ga0207648_100748352 179
859 3300026089 Ga0207648_10118417 Ga0207648_101184175 179
860 3300026089 Ga0207648_10427841 Ga0207648_104278412 179
861 3300026095 Ga0207676_10005142 Ga0207676_100051425 179
862 3300026095 Ga0207676_10135564 Ga0207676_101355643 179
863 3300026095 Ga0207676_10387442 Ga0207676_103874422 179
864 3300026095 Ga0207676_10399366 Ga0207676_103993662 179
865 3300026095 Ga0207676_10570977 Ga0207676_105709771 179
866 3300026116 Ga0207674_10021269 Ga0207674_100212699 179
867 3300026116 Ga0207674_10175259 Ga0207674_101752592 179
868 3300026116 Ga0207674_11018346 Ga0207674_110183461 179
869 3300026118 Ga0207675_100002246 Ga0207675_1000022466 179
870 3300026118 Ga0207675_100019823 Ga0207675_1000198236 179
871 3300026118 Ga0207675_100022386 Ga0207675_1000223863 179
872 3300026118 Ga0207675_100032167 Ga0207675_1000321675 179
873 3300026118 Ga0207675_100088034 Ga0207675_1000880343 179
874 3300026118 Ga0207675_100099065 Ga0207675_1000990653 179
875 3300026118 Ga0207675_100607503 Ga0207675_1006075031 179
876 3300026118 Ga0207675_100840914 Ga0207675_1008409141 179
877 3300026118 Ga0207675_100973492 Ga0207675_1009734922 179
878 3300026121 Ga0207683_10001586 Ga0207683_100015863 179
879 3300026121 Ga0207683_10012593 Ga0207683_100125933 179
880 3300026121 Ga0207683_10131880 Ga0207683_101318804 179
881 3300026121 Ga0207683_10181853 Ga0207683_101818532 179
882 3300026121 Ga0207683_10279247 Ga0207683_102792473 179
883 3300026121 Ga0207683_10844886 Ga0207683_108448862 179
884 3300026142 Ga0207698_10188454 Ga0207698_101884542 179
885 3300027252 Ga0209973_1006807 Ga0209973_10068072 179
886 3300027378 Ga0209981_1012113 Ga0209981_10121131 179
887 3300027395 Ga0209996_1016230 Ga0209996_10162302 179
888 3300027462 Ga0210000_1014497 Ga0210000_10144972 179
889 3300027471 Ga0209995_1021879 Ga0209995_10218792 179
890 3300027552 Ga0209982_1000647 Ga0209982_10006472 179
891 3300027614 Ga0209970_1001806 Ga0209970_10018063 179
892 3300027614 Ga0209970_1022312 Ga0209970_10223121 179
893 3300027617 Ga0210002_1003967 Ga0210002_10039671 179
894 3300027617 Ga0210002_1012379 Ga0210002_10123792 179
895 3300027665 Ga0209983_1000958 Ga0209983_10009583 179
896 3300027682 Ga0209971_1002508 Ga0209971_10025083 179
897 3300027682 Ga0209971_1006403 Ga0209971_10064033 179
898 3300027717 Ga0209998_10001105 Ga0209998_100011057 179
899 3300027876 Ga0209974_10007834 Ga0209974_100078347 179
900 3300027907 Ga0207428_10013272 Ga0207428_100132725 179
901 3300027907 Ga0207428_10013404 Ga0207428_100134043 179
902 3300027907 Ga0207428_10125257 Ga0207428_101252572 179
903 3300028379 Ga0268266_10000546 Ga0268266_1000054641 179
904 3300028379 Ga0268266_10000702 Ga0268266_1000070215 179
905 3300028379 Ga0268266_10008608 Ga0268266_100086082 179
906 3300028379 Ga0268266_10018660 Ga0268266_100186605 179
907 3300028379 Ga0268266_10138460 Ga0268266_101384602 179
908 3300028379 Ga0268266_10254761 Ga0268266_102547612 179
909 3300028379 Ga0268266_10384367 Ga0268266_103843672 179
910 3300028379 Ga0268266_10439947 Ga0268266_104399472 179
911 3300028379 Ga0268266_10773979 Ga0268266_107739792 179
912 3300028380 Ga0268265_10001988 Ga0268265_100019886 179
913 3300028380 Ga0268265_10008712 Ga0268265_100087123 179
914 3300028380 Ga0268265_10041644 Ga0268265_100416443 179
915 3300028380 Ga0268265_10080847 Ga0268265_100808472 179
916 3300028380 Ga0268265_10103451 Ga0268265_101034512 179
917 3300028380 Ga0268265_10274988 Ga0268265_102749882 179
918 3300028380 Ga0268265_10473251 Ga0268265_104732511 179
919 3300028380 Ga0268265_10574507 Ga0268265_105745072 179
920 3300028380 Ga0268265_10815739 Ga0268265_108157391 179
921 3300028380 Ga0268265_11430080 Ga0268265_114300801 179
922 3300028380 Ga0268265_11490719 Ga0268265_114907191 179
923 3300028380 Ga0268265_11686333 Ga0268265_116863331 179
924 3300028381 Ga0268264_10000085 Ga0268264_1000008531 179
925 3300028381 Ga0268264_10050877 Ga0268264_100508774 179
926 3300028381 Ga0268264_10054438 Ga0268264_100544386 179
927 3300028381 Ga0268264_10299807 Ga0268264_102998072 179
928 3300028381 Ga0268264_10301998 Ga0268264_103019982 179
929 3300028381 Ga0268264_10354146 Ga0268264_103541461 179
930 3300028381 Ga0268264_11435067 Ga0268264_114350671 179
931 3300028573 Ga0265334_10047476 Ga0265334_100474763 179
932 3300028577 Ga0265318_10077258 Ga0265318_100772582 179
933 3300028653 Ga0265323_10000510 Ga0265323_100005104 179
934 3300028786 Ga0307517_10264337 Ga0307517_102643372 179
935 3300028794 Ga0307515_10345458 Ga0307515_103454582 179
936 3300028800 Ga0265338_10002924 Ga0265338_100029247 179
937 3300028800 Ga0265338_10021907 Ga0265338_100219074 179
938 3300028800 Ga0265338_10039065 Ga0265338_100390652 179
939 3300028800 Ga0265338_10784389 Ga0265338_107843891 179
940 3300029272 Ga0311000_120665 Ga0311000_1206652 179
941 3300029276 Ga0311004_108406 Ga0311004_1084062 179
942 3300029276 Ga0311004_142814 Ga0311004_1428142 179
943 3300029277 Ga0311001_1017080 Ga0311001_10170801 179
944 3300029277 Ga0311001_1026809 Ga0311001_10268091 179
945 3300029277 Ga0311001_1027304 Ga0311001_10273041 179
946 3300029277 Ga0311001_1051811 Ga0311001_10518112 179
947 3300029277 Ga0311001_1102328 Ga0311001_11023281 179
948 3300029280 Ga0311011_111105 Ga0311011_1111051 179
949 3300029280 Ga0311011_113820 Ga0311011_1138201 179
950 3300029280 Ga0311011_129310 Ga0311011_1293102 179
951 3300029280 Ga0311011_141075 Ga0311011_1410752 179
952 3300029283 Ga0310982_100635 Ga0310982_1006351 179
953 3300029285 Ga0310981_1017140 Ga0310981_10171402 179
954 3300029285 Ga0310981_1047544 Ga0310981_10475442 179
955 3300029285 Ga0310981_1079241 Ga0310981_10792411 179
956 3300030521 Ga0307511_10001897 Ga0307511_100018972 179
957 3300030521 Ga0307511_10028879 Ga0307511_100288792 179
958 3300030836 Ga0265767_107209 Ga0265767_1072091 179
959 3300030879 Ga0265765_1033012 Ga0265765_10330121 179
960 3300031235 Ga0265330_10092997 Ga0265330_100929972 179
961 3300031238 Ga0265332_10178208 Ga0265332_101782081 179
962 3300031241 Ga0265325_10222495 Ga0265325_102224951 179
963 3300031242 Ga0265329_10070872 Ga0265329_100708722 179
964 3300031247 Ga0265340_10078805 Ga0265340_100788052 179
965 3300031247 Ga0265340_10129929 Ga0265340_101299292 179
966 3300031249 Ga0265339_10018466 Ga0265339_100184665 179
967 3300031250 Ga0265331_10021357 Ga0265331_100213572 179
968 3300031344 Ga0265316_10022943 Ga0265316_100229431 179
969 3300031344 Ga0265316_10027184 Ga0265316_100271842 179
970 3300031344 Ga0265316_10067284 Ga0265316_100672843 179
971 3300031456 Ga0307513_10007959 Ga0307513_1000795910 179
972 3300031456 Ga0307513_10014058 Ga0307513_100140584 179
973 3300031456 Ga0307513_10062517 Ga0307513_100625173 179
974 3300031456 Ga0307513_10067032 Ga0307513_100670324 179
975 3300031507 Ga0307509_10000008 Ga0307509_10000008177 179
976 3300031507 Ga0307509_10000543 Ga0307509_1000054314 179
977 3300031507 Ga0307509_10056828 Ga0307509_100568286 179
978 3300031507 Ga0307509_10247988 Ga0307509_102479882 179
979 3300031507 Ga0307509_10554218 Ga0307509_105542181 179
980 3300031548 Ga0307408_100015686 Ga0307408_1000156863 179
981 3300031548 Ga0307408_100092155 Ga0307408_1000921553 179
982 3300031548 Ga0307408_100196219 Ga0307408_1001962191 179
983 3300031548 Ga0307408_100248021 Ga0307408_1002480212 179
984 3300031548 Ga0307408_100352082 Ga0307408_1003520821 179
985 3300031548 Ga0307408_100403171 Ga0307408_1004031712 179
986 3300031548 Ga0307408_100418191 Ga0307408_1004181912 179
987 3300031548 Ga0307408_100434223 Ga0307408_1004342232 179
988 3300031548 Ga0307408_100860005 Ga0307408_1008600051 179
989 3300031548 Ga0307408_101682761 Ga0307408_1016827611 179
990 3300031649 Ga0307514_10175360 Ga0307514_101753602 179
991 3300031711 Ga0265314_10074062 Ga0265314_100740622 179
992 3300031712 Ga0265342_10426291 Ga0265342_104262911 179
993 3300031727 Ga0316576_10385501 Ga0316576_103855012 179
994 3300031730 Ga0307516_10015867 Ga0307516_100158672 179
995 3300031731 Ga0307405_10383450 Ga0307405_103834502 179
996 3300031731 Ga0307405_11614700 Ga0307405_116147001 179
997 3300031824 Ga0307413_10004678 Ga0307413_100046785 179
998 3300031824 Ga0307413_10015242 Ga0307413_100152424 179
999 3300031824 Ga0307413_10062574 Ga0307413_100625743 179
1000 3300031824 Ga0307413_10081954 Ga0307413_100819543 179
1001 3300031824 Ga0307413_10107591 Ga0307413_101075912 179
1002 3300031852 Ga0307410_10052893 Ga0307410_100528932 179
1003 3300031852 Ga0307410_10199293 Ga0307410_101992932 179
1004 3300031852 Ga0307410_10637665 Ga0307410_106376651 179
1005 3300031852 Ga0307410_11055972 Ga0307410_110559721 179
1006 3300031852 Ga0307410_11177151 Ga0307410_111771511 179
1007 3300031901 Ga0307406_10015666 Ga0307406_100156664 179
1008 3300031901 Ga0307406_10046703 Ga0307406_100467034 179
1009 3300031901 Ga0307406_10648840 Ga0307406_106488402 179
1010 3300031903 Ga0307407_10027659 Ga0307407_100276594 179
1011 3300031903 Ga0307407_10073748 Ga0307407_100737482 179
1012 3300031903 Ga0307407_10245456 Ga0307407_102454562 179
1013 3300031911 Ga0307412_10504024 Ga0307412_105040242 179
1014 3300031995 Ga0307409_100002005 Ga0307409_1000020054 179
1015 3300031995 Ga0307409_100023646 Ga0307409_1000236464 179
1016 3300031995 Ga0307409_100078147 Ga0307409_1000781472 179
1017 3300031995 Ga0307409_100104142 Ga0307409_1001041421 179
1018 3300032002 Ga0307416_100068965 Ga0307416_1000689654 179
1019 3300032002 Ga0307416_100138160 Ga0307416_1001381602 179
1020 3300032002 Ga0307416_100521631 Ga0307416_1005216312 179
1021 3300032002 Ga0307416_100543535 Ga0307416_1005435351 179
1022 3300032002 Ga0307416_101011562 Ga0307416_1010115622 179
1023 3300032004 Ga0307414_10172460 Ga0307414_101724601 179
1024 3300032004 Ga0307414_10246925 Ga0307414_102469251 179
1025 3300032005 Ga0307411_10003950 Ga0307411_100039505 179
1026 3300032005 Ga0307411_10009926 Ga0307411_100099264 179
1027 3300032005 Ga0307411_10133722 Ga0307411_101337222 179
1028 3300032005 Ga0307411_10169381 Ga0307411_101693813 179
1029 3300032005 Ga0307411_10280736 Ga0307411_102807362 179
1030 3300032126 Ga0307415_100410634 Ga0307415_1004106342 179
1031 3300032126 Ga0307415_100585933 Ga0307415_1005859332 179
1032 3300032126 Ga0307415_100772332 Ga0307415_1007723322 179
1033 3300032126 Ga0307415_101028462 Ga0307415_1010284622 179
1034 3300032168 Ga0316593_10003322 Ga0316593_100033224 179
1035 3300032168 Ga0316593_10296580 Ga0316593_102965801 179
1036 3300033180 Ga0307510_10000004 Ga0307510_10000004218 179
1037 3300033180 Ga0307510_10032882 Ga0307510_100328823 179
1038 3300033524 Ga0316592_1006133 Ga0316592_10061333 179
1039 3300033541 Ga0316596_1014010 Ga0316596_10140103 179
1040 3300035089 Ga0373944_0095602 Ga0373944_0095602_311_850 179
1041 3300035089 Ga0373944_0322012 Ga0373944_0322012_30_572 179
1042 3300035092 Ga0373952_0215414 Ga0373952_0215414_11_550 179
1043 3300035111 Ga0373923_0161962 Ga0373923_0161962_28_567 179
1044 3300035113 Ga0373936_0085248 Ga0373936_0085248_658_1197 179
1045 3300035113 Ga0373936_0170493 Ga0373936_0170493_74_613 179
1046 3300035118 Ga0373954_0006608 Ga0373954_0006608_498_1037 179
1047 3300035119 Ga0373956_0016639 Ga0373956_0016639_1422_1961 179
1048 3300035120 Ga0373957_0182967 Ga0373957_0182967_304_843 179
1049 3300035170 Ga0373943_0126625 Ga0373943_0126625_363_902 179
1050 3300035170 Ga0373943_0194643 Ga0373943_0194643_392_931 179
1051 3300035172 Ga0373955_0020250 Ga0373955_0020250_2140_2679 179
1052 3300035172 Ga0373955_0168064 Ga0373955_0168064_481_1020 179
1053 3300035172 Ga0373955_0317653 Ga0373955_0317653_156_698 179
1054 3300035692 Ga0373935_0214934 Ga0373935_0214934_564_1106 179
1055 3300035695 Ga0373927_0007466 Ga0373927_0007466_5751_6290 179
1056 3300035724 Ga0373933_0246802 Ga0373933_0246802_129_668 179
1057 3300035725 Ga0373947_0278398 Ga0373947_0278398_85_624 179
1058 3300036401 Ga0373937_0008505 Ga0373937_0008505_2801_3340 179
1059 3300036401 Ga0373937_0040899 Ga0373937_0040899_94_633 179
1060 3300036647 Ga0316582_0431586 Ga0316582_0431586_37_576 179
1061 3300037068 Ga0373925_0073075 Ga0373925_0073075_25_564 179
1062 3300037068 Ga0373925_1106045 Ga0373925_1106045_98_637 179
1063 3300037312 Ga0395899_0084351 Ga0395899_0084351_1287_1826 179
1064 3300037312 Ga0395899_0283956 Ga0395899_0283956_475_1014 179
1065 3300037418 Ga0395900_0003285 Ga0395900_0003285_9618_10157 179
1066 3300037418 Ga0395900_0005953 Ga0395900_0005953_2054_2593 179
1067 3300037418 Ga0395900_0091805 Ga0395900_0091805_2048_2587 179
1068 3300037466 Ga0395898_0017560 Ga0395898_0017560_2005_2544 179
1069 3300037466 Ga0395898_0020160 Ga0395898_0020160_3773_4312 179
1070 3300037466 Ga0395898_0065073 Ga0395898_0065073_2378_2917 179
1071 3300037466 Ga0395898_0421995 Ga0395898_0421995_553_1092 179
1072 3300038443 Ga0395901_0001587 Ga0395901_0001587_22056_22595 179
1073 3300038443 Ga0395901_0004093 Ga0395901_0004093_5290_5829 179
1074 3300038443 Ga0395901_0239630 Ga0395901_0239630_951_1496 179
1075 3300038443 Ga0395901_0679514 Ga0395901_0679514_61_600 179
1076 3300039437 Ga0436365_1290806 Ga0436365_1290806_78_617 179
1077 3300039437 Ga0436365_1372101 Ga0436365_1372101_45_584 179
1078 3300039437 Ga0436365_1560949 Ga0436365_1560949_105_644 179
1079 3300039438 Ga0436360_0075183 Ga0436360_0075183_1399_1938 179
1080 3300039438 Ga0436360_0107738 Ga0436360_0107738_248_787 179
1081 3300039438 Ga0436360_0389718 Ga0436360_0389718_796_1335 179
1082 3300039438 Ga0436360_0454473 Ga0436360_0454473_81_620 179
1083 3300039447 Ga0436361_0186433 Ga0436361_0186433_5694_6233 179
1084 3300039447 Ga0436361_0362369 Ga0436361_0362369_2283_2822 179
1085 3300039447 Ga0436361_0440847 Ga0436361_0440847_237_776 179
1086 3300039447 Ga0436361_0740004 Ga0436361_0740004_267_806 179
1087 3300039450 Ga0436363_0277534 Ga0436363_0277534_6888_7427 179
1088 3300039450 Ga0436363_0857817 Ga0436363_0857817_1508_2131 179
1089 3300039450 Ga0436363_1704374 Ga0436363_1704374_327_866 179
1090 3300039453 Ga0436362_0042252 Ga0436362_0042252_3109_3648 179
1091 3300039453 Ga0436362_0149361 Ga0436362_0149361_30_569 179
1092 3300041407 Ga0439447_107427 Ga0439447_107427_92_631 179
1093 3300041408 Ga0439453_0023200 Ga0439453_0023200_50_592 179
1094 3300041410 Ga0439461_0078449 Ga0439461_0078449_43_582 179
1095 3300041443 Ga0451789_0864192 Ga0451789_0864192_88_627 179
1096 3300041453 Ga0451797_1238842 Ga0451797_1238842_257_796 179
1097 3300041486 Ga0451807_0380208 Ga0451807_0380208_2176_2715 179
1098 3300041486 Ga0451807_1529842 Ga0451807_1529842_893_1432 179
1099 3300041491 Ga0451833_0736883 Ga0451833_0736883_393_932 179
1100 3300041509 Ga0451843_1719082 Ga0451843_1719082_16_573 179
1101 3300041997 Ga0439431_0009590 Ga0439431_0009590_1315_1854 179
1102 3300042002 Ga0439442_031446 Ga0439442_031446_492_1031 179
1103 3300042007 Ga0439449_0068730 Ga0439449_0068730_343_882 179
1104 3300042009 Ga0439451_028521 Ga0439451_028521_101_640 179
1105 3300042016 Ga0439463_097766 Ga0439463_097766_204_746 179
1106 3300042116 Ga0450912_012088 Ga0450912_012088_180_719 179
1107 3300042116 Ga0450912_012522 Ga0450912_012522_102_641 179
1108 3300042122 Ga0450920_001538 Ga0450920_001538_2537_3076 179
1109 3300042124 Ga0450922_019419 Ga0450922_019419_79_618 179
1110 3300042132 Ga0450895_000379 Ga0450895_000379_283_822 179
1111 3300042133 Ga0450896_007026 Ga0450896_007026_914_1453 179
1112 3300042133 Ga0450896_013064 Ga0450896_013064_530_1069 179
1113 3300042145 Ga0450906_032460 Ga0450906_032460_57_596 179
1114 3300042147 Ga0450910_011124 Ga0450910_011124_83_622 179
1115 3300042147 Ga0450910_044514 Ga0450910_044514_94_633 179
1116 3300042184 Ga0450908_000146 Ga0450908_000146_4913_5452 179
1117 3300042435 Ga0439434_0000736 Ga0439434_0000736_441_980 179
1118 3300042436 Ga0439435_0005858 Ga0439435_0005858_1335_1874 179
1119 3300042436 Ga0439435_0114065 Ga0439435_0114065_185_724 179
1120 3300042437 Ga0439444_0002019 Ga0439444_0002019_1169_1708 179
1121 3300042437 Ga0439444_0038206 Ga0439444_0038206_77_619 179
1122 3300042461 Ga0439460_0003891 Ga0439460_0003891_582_1121 179
1123 3300042532 Ga0450893_0048887 Ga0450893_0048887_52_591 179
1124 3300042876 Ga0451577_0721082 Ga0451577_0721082_22_561 179
1125 3300044656 Ga0466969_0009963 Ga0466969_0009963_4164_4727 179
1126 3300044658 Ga0466972_0097642 Ga0466972_0097642_270_809 179
1127 3300044684 Ga0466966_0055175 Ga0466966_0055175_369_908 179
1128 3300044693 Ga0466961_0147137 Ga0466961_0147137_159_698 179
1129 3300044694 Ga0466963_0138844 Ga0466963_0138844_241_780 179
1130 3300044712 Ga0453684_0001552 Ga0453684_0001552_50391_50930 179
1131 3300044712 Ga0453684_1633594 Ga0453684_1633594_57_605 179
1132 3300044765 Ga0466970_0036817 Ga0466970_0036817_1269_1832 179
1133 3300044842 Ga0466957_0473453 Ga0466957_0473453_127_666 179
1134 3300044842 Ga0466957_0611298 Ga0466957_0611298_94_633 179
1135 3300044842 Ga0466957_0634167 Ga0466957_0634167_183_725 179
1136 3300044901 Ga0466960_0154987 Ga0466960_0154987_58_597 179
1137 3300045049 Ga0466959_0006281 Ga0466959_0006281_6347_6886 179
1138 3300045049 Ga0466959_0069118 Ga0466959_0069118_206_745 179
1139 3300045051 Ga0451576_0000042 Ga0451576_0000042_244147_244686 179
1140 3300045051 Ga0451576_0012094 Ga0451576_0012094_5358_5897 179
1141 3300045051 Ga0451576_0122196 Ga0451576_0122196_311_850 179
1142 3300045051 Ga0451576_0199114 Ga0451576_0199114_1424_1963 179
1143 3300045836 Ga0466958_0222977 Ga0466958_0222977_81_629 179
1144 3300045976 Ga0466967_0061247 Ga0466967_0061247_2651_3205 179
1145 3300045976 Ga0466967_0346217 Ga0466967_0346217_534_1073 179
1146 3300045976 Ga0466967_0350728 Ga0466967_0350728_843_1382 179
1147 3300046457 Ga0495590_0147342 Ga0495590_0147342_256_801 179
1148 3300046459 Ga0495629_0514239 Ga0495629_0514239_51_602 179
1149 3300046460 Ga0495638_0002587 Ga0495638_0002587_977_1516 179
1150 3300046460 Ga0495638_0003316 Ga0495638_0003316_905_1444 179
1151 3300046460 Ga0495638_0053209 Ga0495638_0053209_258_797 179
1152 3300046460 Ga0495638_0062992 Ga0495638_0062992_1738_2277 179
1153 3300046462 Ga0495651_0239527 Ga0495651_0239527_217_756 179
1154 3300046462 Ga0495651_0421007 Ga0495651_0421007_135_677 179
1155 3300046471 Ga0495650_0013417 Ga0495650_0013417_2354_2893 179
1156 3300046472 Ga0495580_0015700 Ga0495580_0015700_3181_3723 179
1157 3300046472 Ga0495580_0017539 Ga0495580_0017539_444_983 179
1158 3300046472 Ga0495580_0020241 Ga0495580_0020241_1010_1549 179
1159 3300046473 Ga0495582_0437309 Ga0495582_0437309_70_609 179
1160 3300046476 Ga0495662_0049903 Ga0495662_0049903_863_1405 179
1161 3300046477 Ga0495664_0149650 Ga0495664_0149650_30_572 179
1162 3300046477 Ga0495664_0186262 Ga0495664_0186262_632_1174 179
1163 3300046491 Ga0495584_0181099 Ga0495584_0181099_381_920 179
1164 3300046492 Ga0495585_0060131 Ga0495585_0060131_1009_1548 179
1165 3300046506 Ga0495583_0056737 Ga0495583_0056737_467_1030 179
1166 3300046507 Ga0495606_0209596 Ga0495606_0209596_217_756 179
1167 3300046513 Ga0495616_0049419 Ga0495616_0049419_1295_1834 179
1168 3300046514 Ga0495618_0116095 Ga0495618_0116095_510_1052 179
1169 3300046514 Ga0495618_0149890 Ga0495618_0149890_826_1377 179
1170 3300046515 Ga0495620_0070396 Ga0495620_0070396_656_1195 179
1171 3300046516 Ga0495628_0030797 Ga0495628_0030797_1074_1616 179
1172 3300046516 Ga0495628_0065042 Ga0495628_0065042_1125_1667 179
1173 3300046517 Ga0495630_0076512 Ga0495630_0076512_700_1239 179
1174 3300046517 Ga0495630_1001622 Ga0495630_1001622_76_615 179
1175 3300046517 Ga0495630_1083785 Ga0495630_1083785_38_580 179
1176 3300046519 Ga0495632_0043486 Ga0495632_0043486_1567_2106 179
1177 3300046519 Ga0495632_0084959 Ga0495632_0084959_545_1084 179
1178 3300046520 Ga0495637_0277425 Ga0495637_0277425_22_561 179
1179 3300046524 Ga0495648_0055833 Ga0495648_0055833_1454_1993 179
1180 3300046529 Ga0495652_0131980 Ga0495652_0131980_871_1413 179
1181 3300046531 Ga0495665_0124948 Ga0495665_0124948_544_1086 179
1182 3300046533 Ga0495640_0151957 Ga0495640_0151957_795_1337 179
1183 3300046536 Ga0495587_0029626 Ga0495587_0029626_931_1473 179
1184 3300046539 Ga0495621_0023719 Ga0495621_0023719_752_1291 179
1185 3300046543 Ga0495645_0029760 Ga0495645_0029760_1716_2258 179
1186 3300046543 Ga0495645_0257218 Ga0495645_0257218_360_902 179
1187 3300046559 Ga0495667_0016573 Ga0495667_0016573_1128_1670 179
1188 3300046559 Ga0495667_0051369 Ga0495667_0051369_894_1436 179
1189 3300046559 Ga0495667_0115263 Ga0495667_0115263_1122_1664 179
1190 3300046559 Ga0495667_0416063 Ga0495667_0416063_63_605 179
1191 3300046559 Ga0495667_0488916 Ga0495667_0488916_209_748 179
1192 3300046615 Ga0495656_0186767 Ga0495656_0186767_380_919 179
1193 3300046616 Ga0495668_0032582 Ga0495668_0032582_1933_2472 179
1194 3300046616 Ga0495668_0371900 Ga0495668_0371900_147_686 179
1195 3300046660 Ga0495625_0017237 Ga0495625_0017237_1126_1665 179
1196 3300046660 Ga0495625_0036484 Ga0495625_0036484_119_658 179
1197 3300046660 Ga0495625_0069652 Ga0495625_0069652_1294_1833 179
1198 3300046660 Ga0495625_0166820 Ga0495625_0166820_862_1443 179
1199 3300046660 Ga0495625_0274337 Ga0495625_0274337_435_974 179
1200 3300046660 Ga0495625_0365070 Ga0495625_0365070_213_752 179
1201 3300046660 Ga0495625_0506002 Ga0495625_0506002_25_564 179
1202 3300046675 Ga0495657_0159093 Ga0495657_0159093_330_869 179
1203 3300046678 Ga0495599_0481032 Ga0495599_0481032_107_649 179
1204 3300046679 Ga0495623_0055711 Ga0495623_0055711_1478_2020 179
1205 3300046680 Ga0495646_0131359 Ga0495646_0131359_842_1384 179
1206 3300046692 Ga0495671_0004294 Ga0495671_0004294_8012_8551 179
1207 3300046694 Ga0495649_0046588 Ga0495649_0046588_1466_2005 179
1208 3300046809 Ga0495600_0108839 Ga0495600_0108839_598_1140 179
1209 3300047317 Ga0495604_0069026 Ga0495604_0069026_807_1349 179
1210 3300047317 Ga0495604_0188600 Ga0495604_0188600_758_1300 179
1211 3300047317 Ga0495604_0189099 Ga0495604_0189099_625_1164 179
1212 3300047319 Ga0495674_0002309 Ga0495674_0002309_8808_9350 179
1213 3300047319 Ga0495674_0023603 Ga0495674_0023603_1309_1851 179
1214 3300047319 Ga0495674_0140585 Ga0495674_0140585_460_999 179
1215 3300047319 Ga0495674_0142196 Ga0495674_0142196_1014_1556 179
1216 3300047319 Ga0495674_0242921 Ga0495674_0242921_807_1349 179
1217 3300047319 Ga0495674_1192591 Ga0495674_1192591_27_566 179
1218 3300047322 Ga0495680_0300157 Ga0495680_0300157_238_777 179
1219 3300047322 Ga0495680_0310694 Ga0495680_0310694_512_1054 179
1220 3300047443 Ga0495687_044475 Ga0495687_044475_529_1068 179
1221 3300047444 Ga0495675_0033838 Ga0495675_0033838_622_1164 179
1222 3300047444 Ga0495675_0053461 Ga0495675_0053461_1942_2484 179
1223 3300047469 Ga0495673_0124530 Ga0495673_0124530_322_861 179
1224 3300047471 Ga0495684_0003346 Ga0495684_0003346_9283_9825 179
1225 3300047471 Ga0495684_0065386 Ga0495684_0065386_1381_1923 179
1226 3300047471 Ga0495684_0402254 Ga0495684_0402254_376_918 179
1227 3300047472 Ga0495686_0097341 Ga0495686_0097341_1056_1595 179
1228 3300047472 Ga0495686_0099908 Ga0495686_0099908_406_945 179
1229 3300047472 Ga0495686_0415088 Ga0495686_0415088_39_578 179
1230 3300048088 Ga0495602_0010228 Ga0495602_0010228_53_595 179
1231 3300048088 Ga0495602_0019635 Ga0495602_0019635_2909_3448 179
1232 3300048088 Ga0495602_0229158 Ga0495602_0229158_330_869 179
1233 3300048903 Ga0496100_0077980 Ga0496100_0077980_600_1139 179
1234 3300048903 Ga0496100_0117038 Ga0496100_0117038_114_653 179
1235 3300048903 Ga0496100_0219368 Ga0496100_0219368_90_629 179
1236 3300048903 Ga0496100_0530475 Ga0496100_0530475_39_578 179
1237 3300048904 Ga0496101_0011003 Ga0496101_0011003_4430_4969 179
1238 3300048904 Ga0496101_0170831 Ga0496101_0170831_697_1236 179
1239 3300048904 Ga0496101_0912541 Ga0496101_0912541_127_666 179
1240 3300048904 Ga0496101_1238537 Ga0496101_1238537_34_573 179
1241 3300048905 Ga0496102_0011185 Ga0496102_0011185_1826_2365 179
1242 3300048905 Ga0496102_0017816 Ga0496102_0017816_666_1205 179
1243 3300048905 Ga0496102_0069765 Ga0496102_0069765_863_1402 179
1244 3300048906 Ga0496103_0038246 Ga0496103_0038246_15_554 179
1245 3300048906 Ga0496103_0060675 Ga0496103_0060675_1248_1787 179
1246 3300048906 Ga0496103_0258452 Ga0496103_0258452_247_855 179
1247 3300048906 Ga0496103_0344059 Ga0496103_0344059_68_607 179
1248 3300048907 Ga0496104_0010127 Ga0496104_0010127_1104_1643 179
1249 3300048907 Ga0496104_0097439 Ga0496104_0097439_160_699 179
1250 3300048907 Ga0496104_0992751 Ga0496104_0992751_104_643 179
1251 3300048908 Ga0496105_0061592 Ga0496105_0061592_2526_3065 179
1252 3300048908 Ga0496105_1073248 Ga0496105_1073248_44_583 179
1253 3300048909 Ga0496106_0028021 Ga0496106_0028021_2354_2893 179
1254 3300048909 Ga0496106_0060453 Ga0496106_0060453_166_705 179
1255 3300048909 Ga0496106_0184015 Ga0496106_0184015_985_1524 179
1256 3300048910 Ga0496107_0224972 Ga0496107_0224972_334_873 179
1257 3300048911 Ga0496108_0067338 Ga0496108_0067338_177_716 179
1258 3300048911 Ga0496108_0552979 Ga0496108_0552979_433_972 179
1259 3300048912 Ga0496109_0059265 Ga0496109_0059265_2871_3410 179
1260 3300048912 Ga0496109_0800491 Ga0496109_0800491_309_848 179
1261 3300048913 Ga0496110_0183292 Ga0496110_0183292_240_779 179
1262 3300048913 Ga0496110_0202342 Ga0496110_0202342_162_701 179
1263 3300048914 Ga0496111_0007055 Ga0496111_0007055_1620_2159 179
1264 3300048915 Ga0496112_0006250 Ga0496112_0006250_4437_4976 179
1265 3300048915 Ga0496112_0040816 Ga0496112_0040816_2869_3477 179
1266 3300048915 Ga0496112_0428100 Ga0496112_0428100_527_1066 179
1267 3300048916 Ga0496113_0160546 Ga0496113_0160546_140_679 179
1268 3300048916 Ga0496113_0166256 Ga0496113_0166256_1163_1702 179
1269 3300048917 Ga0496114_0001283 Ga0496114_0001283_10615_11154 179
1270 3300048917 Ga0496114_0077219 Ga0496114_0077219_777_1316 179
1271 3300048917 Ga0496114_0389571 Ga0496114_0389571_235_777 179
1272 3300048918 Ga0496115_0007516 Ga0496115_0007516_4534_5073 179
1273 3300048918 Ga0496115_0015044 Ga0496115_0015044_4727_5266 179
1274 3300048919 Ga0496116_0017845 Ga0496116_0017845_3738_4277 179
1275 3300048920 Ga0496117_0000251 Ga0496117_0000251_64327_64866 179
1276 3300048921 Ga0496118_0000611 Ga0496118_0000611_36810_37349 179
1277 3300048921 Ga0496118_0038221 Ga0496118_0038221_1325_1864 179
1278 3300048922 Ga0496119_0000879 Ga0496119_0000879_15669_16208 179
1279 3300048922 Ga0496119_0005071 Ga0496119_0005071_9377_9916 179
1280 3300048923 Ga0496120_0000025 Ga0496120_0000025_32421_32960 179
1281 3300048923 Ga0496120_0034271 Ga0496120_0034271_1167_1706 179
1282 3300048924 Ga0496121_0006243 Ga0496121_0006243_5343_5951 179
1283 3300048924 Ga0496121_0026956 Ga0496121_0026956_1091_1630 179
1284 3300048924 Ga0496121_0027248 Ga0496121_0027248_3507_4046 179
1285 3300048928 Ga0496125_0004822 Ga0496125_0004822_5385_5924 179
1286 3300048928 Ga0496125_0043041 Ga0496125_0043041_1758_2366 179
1287 3300048928 Ga0496125_0072600 Ga0496125_0072600_464_1003 179
1288 3300048929 Ga0496126_0003192 Ga0496126_0003192_14228_14767 179
1289 3300048929 Ga0496126_0147414 Ga0496126_0147414_1245_1790 179
1290 3300048929 Ga0496126_0218636 Ga0496126_0218636_226_765 179
1291 3300049127 Ga0501306_010628 Ga0501306_010628_47_586 179
1292 3300049127 Ga0501306_026832 Ga0501306_026832_22_561 179
1293 3300049127 Ga0501306_068218 Ga0501306_068218_22_561 179
1294 3300049128 Ga0501308_049651 Ga0501308_049651_40_579 179
1295 3300049129 Ga0501309_058481 Ga0501309_058481_26_565 179
1296 3300049129 Ga0501309_067139 Ga0501309_067139_29_568 179
1297 3300049130 Ga0501310_034440 Ga0501310_034440_12_557 179
1298 3300049130 Ga0501310_045712 Ga0501310_045712_53_607 179
1299 3300049160 Ga0501304_017027 Ga0501304_017027_132_671 179
1300 3300049161 Ga0501305_030731 Ga0501305_030731_15_554 179
1301 3300049161 Ga0501305_063456 Ga0501305_063456_17_571 179
1302 3300049161 Ga0501305_070299 Ga0501305_070299_57_596 179
1303 3300049162 Ga0501307_022402 Ga0501307_022402_12_551 179
1304 3300049162 Ga0501307_029475 Ga0501307_029475_132_671 179
1305 3300049162 Ga0501307_054780 Ga0501307_054780_49_588 179
1306 3300049524 Ga0501301_001136 Ga0501301_001136_1060_1599 179
1307 3300049528 Ga0501312_019893 Ga0501312_019893_17_559 179
1308 3300049528 Ga0501312_079272 Ga0501312_079272_33_572 179
1309 3300049529 Ga0501313_037800 Ga0501313_037800_46_585 179
1310 3300049529 Ga0501313_045962 Ga0501313_045962_25_564 179
1311 3300049531 Ga0501315_037936 Ga0501315_037936_90_629 179
1312 3300049534 Ga0501318_036805 Ga0501318_036805_12_551 179
1313 3300049537 Ga0501321_062584 Ga0501321_062584_12_551 179
1314 3300049568 Ga0501031_0035899 Ga0501031_0035899_137_676 179
1315 3300049570 Ga0501033_0009908 Ga0501033_0009908_550_1089 179
1316 3300049571 Ga0501034_0061967 Ga0501034_0061967_1741_2280 179
1317 3300049572 Ga0501036_0047299 Ga0501036_0047299_2667_3206 179
1318 3300049572 Ga0501036_0233278 Ga0501036_0233278_100_639 179
1319 3300049573 Ga0501037_0059406 Ga0501037_0059406_1822_2361 179
1320 3300049574 Ga0501038_0005329 Ga0501038_0005329_6399_6938 179
1321 3300049574 Ga0501038_0065115 Ga0501038_0065115_33_572 179
1322 3300049574 Ga0501038_0125098 Ga0501038_0125098_388_927 179
1323 3300049575 Ga0501039_0005494 Ga0501039_0005494_6228_6767 179
1324 3300049575 Ga0501039_0011760 Ga0501039_0011760_2841_3380 179
1325 3300049575 Ga0501039_0135483 Ga0501039_0135483_1362_1901 179
1326 3300049576 Ga0501040_0006961 Ga0501040_0006961_1939_2478 179
1327 3300049576 Ga0501040_0009344 Ga0501040_0009344_3521_4060 179
1328 3300049576 Ga0501040_0073938 Ga0501040_0073938_87_626 179
1329 3300049576 Ga0501040_0883859 Ga0501040_0883859_39_578 179
1330 3300049577 Ga0501041_0013770 Ga0501041_0013770_2501_3040 179
1331 3300049577 Ga0501041_0025726 Ga0501041_0025726_1170_1709 179
1332 3300049578 Ga0501042_0000915 Ga0501042_0000915_10772_11311 179
1333 3300049578 Ga0501042_0051806 Ga0501042_0051806_398_937 179
1334 3300049578 Ga0501042_0068944 Ga0501042_0068944_1757_2296 179
1335 3300049578 Ga0501042_0728450 Ga0501042_0728450_159_698 179
1336 3300049579 Ga0501043_0061144 Ga0501043_0061144_596_1135 179
1337 3300049579 Ga0501043_0218544 Ga0501043_0218544_146_685 179
1338 3300049579 Ga0501043_0500218 Ga0501043_0500218_264_803 179
1339 3300049579 Ga0501043_0711352 Ga0501043_0711352_103_642 179
1340 3300049580 Ga0501046_0008093 Ga0501046_0008093_6976_7515 179
1341 3300049580 Ga0501046_0020394 Ga0501046_0020394_4116_4655 179
1342 3300049580 Ga0501046_0190562 Ga0501046_0190562_867_1406 179
1343 3300049581 Ga0501047_0205297 Ga0501047_0205297_345_884 179
1344 3300049581 Ga0501047_0282351 Ga0501047_0282351_937_1491 179
1345 3300049582 Ga0501048_0006562 Ga0501048_0006562_6488_7027 179
1346 3300049582 Ga0501048_0976963 Ga0501048_0976963_22_561 179
1347 3300049583 Ga0501067_0014051 Ga0501067_0014051_1433_1972 179
1348 3300049583 Ga0501067_0125647 Ga0501067_0125647_138_677 179
1349 3300049583 Ga0501067_0169797 Ga0501067_0169797_429_968 179
1350 3300049584 Ga0501068_0000867 Ga0501068_0000867_6109_6648 179
1351 3300049584 Ga0501068_0059666 Ga0501068_0059666_1048_1587 179
1352 3300049584 Ga0501068_0243459 Ga0501068_0243459_214_753 179
1353 3300049586 Ga0501070_0060130 Ga0501070_0060130_2133_2672 179
1354 3300049587 Ga0501071_0004440 Ga0501071_0004440_4275_4814 179
1355 3300049587 Ga0501071_0021226 Ga0501071_0021226_3884_4423 179
1356 3300049587 Ga0501071_0392235 Ga0501071_0392235_320_859 179
1357 3300049587 Ga0501071_1011006 Ga0501071_1011006_33_572 179
1358 3300049588 Ga0501072_0004135 Ga0501072_0004135_2570_3109 179
1359 3300049588 Ga0501072_0033552 Ga0501072_0033552_534_1073 179
1360 3300049588 Ga0501072_0228299 Ga0501072_0228299_233_772 179
1361 3300049588 Ga0501072_0242447 Ga0501072_0242447_781_1320 179
1362 3300049589 Ga0501073_0004134 Ga0501073_0004134_7457_7996 179
1363 3300049589 Ga0501073_0011609 Ga0501073_0011609_3959_4498 179
1364 3300049589 Ga0501073_0026538 Ga0501073_0026538_438_977 179
1365 3300049589 Ga0501073_0034466 Ga0501073_0034466_1055_1594 179
1366 3300049589 Ga0501073_0059015 Ga0501073_0059015_1816_2355 179
1367 3300049590 Ga0501074_0099931 Ga0501074_0099931_1248_1787 179
1368 3300049590 Ga0501074_0120613 Ga0501074_0120613_104_643 179
1369 3300049590 Ga0501074_0242113 Ga0501074_0242113_62_601 179
1370 3300049591 Ga0501075_0005108 Ga0501075_0005108_2593_3132 179
1371 3300049591 Ga0501075_0172471 Ga0501075_0172471_123_662 179
1372 3300049591 Ga0501075_0424194 Ga0501075_0424194_427_966 179
1373 3300049592 Ga0501076_0010445 Ga0501076_0010445_4214_4753 179
1374 3300049592 Ga0501076_0011218 Ga0501076_0011218_2253_2792 179
1375 3300049592 Ga0501076_0049580 Ga0501076_0049580_2450_2989 179
1376 3300049592 Ga0501076_0218696 Ga0501076_0218696_262_801 179
1377 3300049593 Ga0501077_0006169 Ga0501077_0006169_3609_4148 179
1378 3300049593 Ga0501077_0019420 Ga0501077_0019420_230_769 179
1379 3300049593 Ga0501077_0036799 Ga0501077_0036799_1023_1562 179
1380 3300049593 Ga0501077_0106262 Ga0501077_0106262_1138_1677 179
1381 3300049676 Ga0501246_029409 Ga0501246_029409_16_555 179
1382 3300049679 Ga0501249_023042 Ga0501249_023042_686_1225 179
1383 3300049741 Ga0501079_0000565 Ga0501079_0000565_5568_6107 179
1384 3300049741 Ga0501079_0001159 Ga0501079_0001159_4084_4623 179
1385 3300049741 Ga0501079_0003223 Ga0501079_0003223_3195_3734 179
1386 3300049741 Ga0501079_0100737 Ga0501079_0100737_1640_2179 179
1387 3300049742 Ga0501080_0000453 Ga0501080_0000453_7457_7996 179
1388 3300049742 Ga0501080_0001345 Ga0501080_0001345_141_680 179
1389 3300049742 Ga0501080_0143961 Ga0501080_0143961_359_898 179
1390 3300049742 Ga0501080_0479591 Ga0501080_0479591_32_571 179
1391 3300049742 Ga0501080_0523078 Ga0501080_0523078_30_569 179
1392 3300049742 Ga0501080_0876561 Ga0501080_0876561_128_667 179
1393 3300049743 Ga0501081_0000381 Ga0501081_0000381_19986_20525 179
1394 3300049743 Ga0501081_0008007 Ga0501081_0008007_4529_5068 179
1395 3300049744 Ga0501083_0001296 Ga0501083_0001296_13109_13648 179
1396 3300049744 Ga0501083_0026643 Ga0501083_0026643_1754_2293 179
1397 3300049744 Ga0501083_0073024 Ga0501083_0073024_700_1239 179
1398 3300049744 Ga0501083_0080694 Ga0501083_0080694_174_713 179
1399 3300049822 Ga0501035_0004435 Ga0501035_0004435_4110_4649 179
1400 3300049822 Ga0501035_0019306 Ga0501035_0019306_4252_4791 179
1401 3300049822 Ga0501035_0871967 Ga0501035_0871967_136_675 179
1402 3300049824 Ga0501045_0009394 Ga0501045_0009394_114_653 179
1403 3300049824 Ga0501045_0014470 Ga0501045_0014470_3084_3623 179
1404 3300049824 Ga0501045_0073028 Ga0501045_0073028_1926_2465 179
1405 3300049824 Ga0501045_0512433 Ga0501045_0512433_67_612 179
1406 3300049824 Ga0501045_0668872 Ga0501045_0668872_56_595 179
1407 3300050492 nmdc:mga0yw44_41471_c1 nmdc:mga0yw44_41471_c1_595_1134 179
1408 3300050492 nmdc:mga0yw44_816867_c1 nmdc:mga0yw44_816867_c1_27_566 179
1409 3300050493 nmdc:mga0k408_61132_c1 nmdc:mga0k408_61132_c1_1082_1621 179
1410 3300050507 nmdc:mga05p37_333657_c1 nmdc:mga05p37_333657_c1_457_996 179
1411 3300050507 nmdc:mga05p37_3957_c1 nmdc:mga05p37_3957_c1_8130_8669 179
1412 3300050507 nmdc:mga05p37_617083_c1 nmdc:mga05p37_617083_c1_70_609 179
1413 3300050507 nmdc:mga05p37_7207_c1 nmdc:mga05p37_7207_c1_9109_9651 179
1414 3300050507 nmdc:mga05p37_987277_c1 nmdc:mga05p37_987277_c1_29_568 179
1415 3300050508 nmdc:mga09592_128537_c1 nmdc:mga09592_128537_c1_1596_2135 179
1416 3300050508 nmdc:mga09592_267633_c1 nmdc:mga09592_267633_c1_292_831 179
1417 3300050508 nmdc:mga09592_6699_c1 nmdc:mga09592_6699_c1_1794_2333 179
1418 3300050508 nmdc:mga09592_780_c1 nmdc:mga09592_780_c1_8956_9498 179
1419 3300050509 nmdc:mga0qj67_13394_c1 nmdc:mga0qj67_13394_c1_4391_4930 179
1420 3300050509 nmdc:mga0qj67_218813_c1 nmdc:mga0qj67_218813_c1_414_953 179
1421 3300050509 nmdc:mga0qj67_259927_c1 nmdc:mga0qj67_259927_c1_40_582 179
1422 3300050509 nmdc:mga0qj67_76540_c1 nmdc:mga0qj67_76540_c1_793_1332 179
1423 3300050509 nmdc:mga0qj67_8518_c1 nmdc:mga0qj67_8518_c1_4923_5462 179
1424 3300050510 nmdc:mga06r32_1571_c1 nmdc:mga06r32_1571_c1_15744_16283 179
1425 3300050510 nmdc:mga06r32_3176_c1 nmdc:mga06r32_3176_c1_11352_11894 179
1426 3300050510 nmdc:mga06r32_5339_c1 nmdc:mga06r32_5339_c1_9113_9652 179
1427 3300050511 nmdc:mga08y16_1280306_c1 nmdc:mga08y16_1280306_c1_86_625 179
1428 3300050511 nmdc:mga08y16_138691_c1 nmdc:mga08y16_138691_c1_1256_1795 179
1429 3300050511 nmdc:mga08y16_164730_c1 nmdc:mga08y16_164730_c1_1428_1967 179
1430 3300050511 nmdc:mga08y16_87881_c1 nmdc:mga08y16_87881_c1_1100_1639 179
1431 3300050511 nmdc:mga08y16_961855_c1 nmdc:mga08y16_961855_c1_94_633 179
1432 3300050512 nmdc:mga0n895_1690896_c1 nmdc:mga0n895_1690896_c1_40_579 179
1433 3300050512 nmdc:mga0n895_337372_c1 nmdc:mga0n895_337372_c1_568_1107 179
1434 3300050513 nmdc:mga0rr50_60574_c1 nmdc:mga0rr50_60574_c1_1335_1874 179
1435 3300050514 nmdc:mga08x19_102123_c1 nmdc:mga08x19_102123_c1_858_1397 179
1436 3300050514 nmdc:mga08x19_122209_c1 nmdc:mga08x19_122209_c1_21_560 179
1437 3300050515 nmdc:mga0a205_163676_c1 nmdc:mga0a205_163676_c1_1469_2008 179
1438 3300053086 Ga0500578_0309779 Ga0500578_0309779_36_575 179
1439 3300053088 Ga0500644_0166923 Ga0500644_0166923_320_859 179
1440 3300053091 Ga0500647_0040234 Ga0500647_0040234_1313_1858 179
1441 3300053092 Ga0500583_0008778 Ga0500583_0008778_582_1139 179
1442 3300053092 Ga0500583_0039233 Ga0500583_0039233_1580_2119 179
1443 3300053094 Ga0500566_0014529 Ga0500566_0014529_1427_1966 179
1444 3300053095 Ga0500640_002285 Ga0500640_002285_5611_6150 179
1445 3300053096 Ga0500641_0018886 Ga0500641_0018886_440_979 179
1446 3300053096 Ga0500641_0155084 Ga0500641_0155084_36_581 179
1447 3300053098 Ga0500650_0066976 Ga0500650_0066976_192_731 179
1448 3300053102 Ga0500554_002327 Ga0500554_002327_1019_1558 179
1449 3300053104 Ga0500556_0000646 Ga0500556_0000646_20155_20694 179
1450 3300053104 Ga0500556_0015792 Ga0500556_0015792_120_677 179
1451 3300053115 Ga0500591_164512 Ga0500591_164512_30_638 179
1452 3300053119 Ga0500595_001726 Ga0500595_001726_2153_2692 179
1453 3300053119 Ga0500595_006081 Ga0500595_006081_515_1060 179
1454 3300053121 Ga0500607_229752 Ga0500607_229752_143_682 179
1455 3300053123 Ga0500614_003262 Ga0500614_003262_778_1317 179
1456 3300053124 Ga0500617_019473 Ga0500617_019473_1943_2500 179
1457 3300053133 Ga0500655_042194 Ga0500655_042194_42_596 179
1458 3300053134 Ga0500658_0165539 Ga0500658_0165539_145_702 179
1459 3300053136 Ga0500559_0009784 Ga0500559_0009784_1412_1951 179
1460 3300053142 Ga0500577_0232857 Ga0500577_0232857_121_660 179
1461 3300053146 Ga0500588_0000279 Ga0500588_0000279_1992_2537 179
1462 3300053146 Ga0500588_0007867 Ga0500588_0007867_198_737 179
1463 3300053146 Ga0500588_0102187 Ga0500588_0102187_272_829 179
1464 3300053146 Ga0500588_0130033 Ga0500588_0130033_194_733 179
1465 3300053153 Ga0500616_0000096 Ga0500616_0000096_31283_31828 179
1466 3300053153 Ga0500616_0009124 Ga0500616_0009124_1368_1907 179
1467 3300053156 Ga0500622_0002975 Ga0500622_0002975_5466_6005 179
1468 3300053156 Ga0500622_0056851 Ga0500622_0056851_861_1400 179
1469 3300053158 Ga0500627_0092343 Ga0500627_0092343_38_577 179
1470 3300053178 Ga0500637_0045803 Ga0500637_0045803_1825_2364 179
1471 3300053178 Ga0500637_0069933 Ga0500637_0069933_464_1003 179
1472 3300053178 Ga0500637_0123352 Ga0500637_0123352_901_1440 179
1473 3300053730 Ga0500645_027276 Ga0500645_027276_391_930 179
1474 3300054114 Ga0501084_0000703 Ga0501084_0000703_3935_4474 179
1475 3300054114 Ga0501084_0027449 Ga0501084_0027449_2056_2595 179
1476 3300054114 Ga0501084_0054651 Ga0501084_0054651_91_630 179
1477 3300054114 Ga0501084_0342056 Ga0501084_0342056_175_714 179
1478 3300059478 Ga0587093_037946 Ga0587093_037946_142_681 179
1479 3300059503 Ga0587080_011658 Ga0587080_011658_11_553 179
1480 3300059505 Ga0587083_0170672 Ga0587083_0170672_39_578 179
1481 3300060353 Ga0501082_0001073 Ga0501082_0001073_1011_1553 179
1482 3300060353 Ga0501082_0002270 Ga0501082_0002270_15485_16024 179
1483 3300060353 Ga0501082_0018634 Ga0501082_0018634_4756_5295 179
1484 3300060353 Ga0501082_0022513 Ga0501082_0022513_2421_2960 179
1485 3300060353 Ga0501082_0082649 Ga0501082_0082649_1157_1696 179
1486 3300060353 Ga0501082_0165930 Ga0501082_0165930_1153_1692 179
1487 3300060353 Ga0501082_0315578 Ga0501082_0315578_454_993 179
1488 3300060353 Ga0501082_1244283 Ga0501082_1244283_30_569 179
1489 3300061734 Ga0530510_0005434 Ga0530510_0005434_634_1173 179
1490 3300061734 Ga0530510_0015910 Ga0530510_0015910_863_1402 179
1491 3300061734 Ga0530510_0701196 Ga0530510_0701196_147_686 179

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

43

177

0.98

PF08534

Redoxin

Redoxin

43

195

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4xs1-assembly1.cif.gz_D-2 salmonella typhimurium ahpc t43v mutant 0.9523 4 160
4xts-assembly2.cif.gz_T salmonella typhimurium ahpc t43a mutant 0.9503 4 160
4xs6-assembly1.cif.gz_E-2 salmonella typhimurium ahpc w81f mutant 0.9495 4 160
4ql7-assembly1.cif.gz_D-2 crystal structure of c-terminus truncated alkylhydroperoxide reductase subunit c (ahpc1-172) from e. coli 0.9477 1 160
3emp-assembly1.cif.gz_D-2 crystal structure of the s-acetanilide modified form of c165s ahpc 0.9455 4 160
ID Description Score Start End Superfamily
2bmxC00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9232 1 160 3.40.30.10
5ijtA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9115 3 160 3.40.30.10
af_P9WQB7_4_193_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8984 2 178 3.40.30.10
5id2B00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8959 1 159 3.40.30.10
5b8aJ00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8906 1 169 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A3C2E313-F1-model_v4 Alkyl hydroperoxide reductase C (EC 1.11.1.26) (Peroxiredoxin) 0.9768 60 164 GO:0005829
GO:0006979
GO:0008379
GO:0033554
GO:0042744
GO:0045454
AF-A0A4Q6CWX4-F1-model_v4 deleted 0.9738 1 127
AF-A0A356KLJ1-F1-model_v4 Thioredoxin domain-containing protein 0.9692 1 160 GO:0005829
GO:0006979
GO:0008379
GO:0033554
GO:0042744
GO:0045454
AF-A0A829H4Z3-F1-model_v4 Alkyl hydroperoxide reductase subunit C 0.9652 1 160 GO:0005829
GO:0006979
GO:0008379
GO:0033554
GO:0042744
GO:0045454
AF-A0A846P0V0-F1-model_v4 Redoxin domain-containing protein 0.9642 2 154 GO:0005829
GO:0006979
GO:0008379
GO:0033554
GO:0042744
GO:0045454

Feature Viewer

pLDDT pTM Quality
90.09 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map