F492633

General Info

Members Datasets Scaffolds Average Seq Length
1290 501 2578 111

Family's Representative Sequence

Representative Sequence 3300049581|Ga0501047_0798992|Ga0501047_0798992_71_469
Length 132
Sequence MRSVSHRVRCRARGRRQQDKNAMGIEQFIDNEVKGNDVVLFMKGTPQFPQCGFSGQVVQILDHLGVSYKGLNVLESDDLRNGIKAYSNWPTIPQLYVKGEFVGGCDIVREMFQAGELQQTLKDKGIPVRETA

Samples

Sample ID Description Type Environment
1 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
2 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
5 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
6 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
7 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
8 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
9 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
10 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
11 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
12 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
13 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
14 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
15 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
16 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
17 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
18 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
19 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
20 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
21 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
22 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
23 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
24 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
25 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
26 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
27 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
28 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
29 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
30 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
31 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
32 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
33 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
34 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
36 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
37 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
38 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
39 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
40 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
41 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
42 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
43 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
44 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
45 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
46 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
47 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
48 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
49 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
50 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
51 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
52 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
53 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
54 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
55 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
56 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
57 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
58 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
59 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
60 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
61 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
62 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
63 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
64 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
65 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
66 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
67 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
68 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
69 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
70 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
71 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
72 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
73 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
74 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
75 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
76 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
77 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
78 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
79 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
80 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
81 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
82 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
83 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
84 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
85 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
86 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
87 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
88 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
89 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
90 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
91 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
92 3300005507 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) Metagenome Rhizosphere
93 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
94 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
95 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
96 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
97 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
98 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
99 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
100 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
101 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
102 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
103 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
104 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
105 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
106 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
107 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
108 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
109 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
110 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
111 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
112 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
113 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
114 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
115 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
116 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
117 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
118 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
119 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
120 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
121 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
122 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
123 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
124 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
125 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
126 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
127 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
128 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
129 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
130 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
131 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
132 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
133 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
134 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
135 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
136 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
137 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
138 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
139 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
140 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
141 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
142 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
143 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
144 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
145 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
146 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
147 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
148 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
149 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
150 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
151 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
152 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
153 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
154 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
155 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
156 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
157 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
158 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
159 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
160 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
161 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
162 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
163 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
164 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
165 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
166 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
167 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
168 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
169 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
170 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
171 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
172 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
173 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
174 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
175 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
176 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
177 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
178 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
179 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
180 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
181 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
182 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
183 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
184 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
185 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
186 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
187 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
188 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
189 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
190 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
191 3300019190 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
193 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
194 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
195 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
196 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
197 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
198 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
200 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
201 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
202 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
204 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
270 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
271 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
273 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
274 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
275 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
276 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
277 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
278 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
279 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
280 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
281 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
282 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
283 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
284 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
285 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
286 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
288 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
289 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
290 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
291 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
292 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
293 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
294 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
295 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
296 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
297 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
298 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
299 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
300 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
301 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
302 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
303 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
304 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
305 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
306 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
307 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
308 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
309 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
310 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
311 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
312 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
313 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
314 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
315 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
316 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
317 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
318 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
319 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
320 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
321 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
322 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
323 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
324 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
325 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
326 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
327 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
328 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
329 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
330 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
331 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
332 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
333 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
334 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
335 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
336 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
337 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
338 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
339 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
340 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
341 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
342 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
343 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
344 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
345 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
346 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
347 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
348 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
349 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
350 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
351 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
352 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
353 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
354 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
355 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
356 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
357 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
358 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
359 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
360 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
361 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
362 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
363 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
364 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
365 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
366 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
367 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
368 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
369 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
370 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
371 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
372 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
373 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
374 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
375 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
376 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
377 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
378 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
379 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
380 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
381 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
382 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
383 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
384 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
385 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
386 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
387 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
388 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
389 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
390 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
391 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
392 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
393 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
394 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
395 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
396 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
397 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
398 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
399 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
400 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
401 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
402 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
403 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
404 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
405 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
406 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
407 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
408 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
409 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
410 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
411 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
412 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
413 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
414 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
415 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
416 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
417 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
418 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
419 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
420 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
421 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
422 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
423 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
424 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
425 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
426 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
427 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
428 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
429 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
430 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
431 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
432 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
433 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
434 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
435 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
436 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
437 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
438 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
439 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
440 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
441 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
442 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
443 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
444 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
445 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
446 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
447 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
448 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
449 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
450 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
451 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
452 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
453 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
454 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
455 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
456 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
457 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
458 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
459 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
460 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
461 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
462 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
463 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
464 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
465 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
466 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
467 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
468 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
469 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
470 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
471 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
472 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
473 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
474 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
475 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
476 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
477 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
478 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
479 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
480 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
481 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
482 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
483 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
484 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
485 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
486 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
487 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
488 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
489 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
490 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
491 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
492 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
493 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
494 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
495 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
496 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
497 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
498 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
499 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
500 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
501 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.52
Metatranscriptomes 2.4
Isolates 0.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.56
Nodule 0.08
Rhizoplane 5.81
Rhizosphere 90.85
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501047_0798992 3300049581 Bacteria 758
2 RicEn_FSXC31522_g1 2010549000 Bacteria 780
3 SwRhRL2b_contig_1160324 2162886007 Bacteria 1004
4 2214856312 2209111006 Bacteria 8100
5 ARcpr5oldR_c000194 3300000041 Bacteria 10352
6 ARSoilYngRDRAFT_c00073 3300000042 Bacteria 16794
7 ARcpr5yngRDRAFT_c000011 3300000043 Bacteria 35549
8 ARSoilOldRDRAFT_c000062 3300000044 Bacteria 21391
9 ARCol0oldRDRAFT_c01014 3300000045 Bacteria 2139
10 CNAas_1016385 3300000532 Bacteria 527
11 ARCol0yngRDRAFT_1000112 3300000652 Bacteria 14801
12 JGI24736J21556_1069610 3300001904 Bacteria 548
13 JGI24741J21665_1028932 3300001915 Bacteria 834
14 JGI24752J21851_1006533 3300001976 Bacteria 1524
15 JGI24752J21851_1016439 3300001976 Bacteria 963
16 JGI24746J21847_1000121 3300001977 Bacteria 9285
17 JGI24746J21847_1010940 3300001977 Bacteria 1338
18 JGI24747J21853_1000764 3300001978 Bacteria 2175
19 JGI24747J21853_1003096 3300001978 Bacteria 1417
20 JGI24740J21852_10038498 3300001979 Bacteria 1467
21 JGI24739J22299_10000577 3300001989 Bacteria 13212
22 JGI24739J22299_10114825 3300001989 Bacteria 807
23 JGI24737J22298_10001844 3300001990 Bacteria 7580
24 JGI24737J22298_10002151 3300001990 Bacteria 7029
25 JGI24737J22298_10033220 3300001990 Bacteria 1604
26 JGI24743J22301_10004095 3300001991 Bacteria 2351
27 JGI24743J22301_10053149 3300001991 Bacteria 827
28 JGI24735J21928_10118417 3300002067 Bacteria 762
29 JGI24750J21931_1000727 3300002070 Bacteria 4722
30 JGI24750J21931_1002396 3300002070 Bacteria 2262
31 JGI24750J21931_1002707 3300002070 Bacteria 2126
32 JGI24750J21931_1003125 3300002070 Bacteria 1988
33 JGI24745J21846_1000168 3300002073 Bacteria 5245
34 JGI24748J21848_1000471 3300002074 Bacteria 4472
35 JGI24748J21848_1002811 3300002074 Bacteria 1979
36 JGI24748J21848_1044948 3300002074 Bacteria 568
37 JGI24738J21930_10002477 3300002075 Bacteria 4824
38 JGI24738J21930_10018559 3300002075 Bacteria 1453
39 JGI24749J21850_1000640 3300002076 Bacteria 5070
40 JGI24744J21845_10001158 3300002077 Bacteria 5133
41 JGI24744J21845_10019183 3300002077 Bacteria 1352
42 JGI24035J26624_1000108 3300002126 Bacteria 7155
43 JGI24033J26618_1029646 3300002155 Bacteria 732
44 JGI24034J26672_10001081 3300002239 Bacteria 3557
45 JGI24034J26672_10002728 3300002239 Bacteria 2435
46 JGI24034J26672_10041848 3300002239 Bacteria 771
47 JGI24034J26672_10105674 3300002239 Bacteria 534
48 JGI24742J22300_10000221 3300002244 Bacteria 8499
49 JGI24742J22300_10005895 3300002244 Bacteria 2018
50 JGI24751J29686_10053936 3300002459 Bacteria 829
51 JGI24751J29686_10071636 3300002459 Bacteria 715
52 JGI24751J29686_10081010 3300002459 Bacteria 672
53 Ga0007429J51699_1018610 3300003579 Bacteria 531
54 JGI25405J52794_10012179 3300003911 Bacteria 1653
55 JGI25405J52794_10021951 3300003911 Bacteria 1292
56 JGI25405J52794_10028338 3300003911 Bacteria 1156
57 JGI25405J52794_10040778 3300003911 Bacteria 981
58 JGI25405J52794_10084674 3300003911 Bacteria 699
59 Ga0058859_10055373 3300004798 Bacteria 918
60 Ga0058863_11869705 3300004799 Bacteria 661
61 Ga0058861_10076840 3300004800 Bacteria 779
62 Ga0058860_10020217 3300004801 Bacteria 670
63 Ga0058860_12156334 3300004801 Bacteria 549
64 Ga0058862_12566060 3300004803 Bacteria 579
65 Ga0065717_1003715 3300005276 Bacteria 1196
66 Ga0065716_1001732 3300005277 Bacteria 3730
67 Ga0065704_10080111 3300005289 Bacteria 3982
68 Ga0065704_10581893 3300005289 Bacteria 617
69 Ga0065712_10002317 3300005290 Bacteria 6632
70 Ga0065712_10068922 3300005290 Bacteria 8576
71 Ga0065712_10074824 3300005290 Bacteria 3993
72 Ga0065715_10000683 3300005293 Bacteria 9226
73 Ga0065715_10004478 3300005293 Bacteria 6739
74 Ga0065715_10377521 3300005293 Bacteria 912
75 Ga0065715_10666809 3300005293 Bacteria 670
76 Ga0065707_10181444 3300005295 Bacteria 1416
77 Ga0070658_10074579 3300005327 Bacteria 2782
78 Ga0070658_10369815 3300005327 Bacteria 1229
79 Ga0070676_10000260 3300005328 Bacteria 23003
80 Ga0070676_10045650 3300005328 Bacteria 2552
81 Ga0070683_100015534 3300005329 Bacteria 6691
82 Ga0070683_100385387 3300005329 Bacteria 1336
83 Ga0070690_100003067 3300005330 Bacteria 9081
84 Ga0070690_100006162 3300005330 Bacteria 6795
85 Ga0070690_100034811 3300005330 Bacteria 3157
86 Ga0070670_100001716 3300005331 Bacteria 17842
87 Ga0070670_100032751 3300005331 Bacteria 4478
88 Ga0070670_100054447 3300005331 Bacteria 3435
89 Ga0070670_100298933 3300005331 Bacteria 1408
90 Ga0070677_10000049 3300005333 Bacteria 37210
91 Ga0070677_10210608 3300005333 Bacteria 944
92 Ga0068869_100005257 3300005334 Bacteria 8130
93 Ga0068869_100496680 3300005334 Bacteria 1018
94 Ga0070666_10227189 3300005335 Bacteria 1317
95 Ga0070666_10735478 3300005335 Bacteria 725
96 Ga0070680_100005276 3300005336 Bacteria 9772
97 Ga0070680_100005308 3300005336 Bacteria 9751
98 Ga0070680_100038584 3300005336 Bacteria 3863
99 Ga0070680_100103970 3300005336 Bacteria 2360
100 Ga0070680_100106108 3300005336 Bacteria 2336
101 Ga0070680_100403078 3300005336 Bacteria 1166
102 Ga0070680_101001686 3300005336 Bacteria 721
103 Ga0070682_100001047 3300005337 Bacteria 15999
104 Ga0070682_100086975 3300005337 Bacteria 2037
105 Ga0070682_100221659 3300005337 Bacteria 1346
106 Ga0070682_100478642 3300005337 Bacteria 960
107 Ga0068868_100003020 3300005338 Bacteria 11706
108 Ga0068868_100007432 3300005338 Bacteria 7800
109 Ga0068868_100548105 3300005338 Bacteria 1019
110 Ga0070660_100004688 3300005339 Bacteria 9467
111 Ga0070660_100014718 3300005339 Bacteria 5642
112 Ga0070660_100067455 3300005339 Bacteria 2787
113 Ga0070660_100282240 3300005339 Bacteria 1359
114 Ga0070660_100583387 3300005339 Bacteria 934
115 Ga0070660_101257993 3300005339 Bacteria 628
116 Ga0070689_100009709 3300005340 Bacteria 6828
117 Ga0070689_100011054 3300005340 Bacteria 6454
118 Ga0070689_100066087 3300005340 Bacteria 2817
119 Ga0070689_100166171 3300005340 Bacteria 1786
120 Ga0070691_10027328 3300005341 Bacteria 2662
121 Ga0070691_10057899 3300005341 Bacteria 1859
122 Ga0070687_100001111 3300005343 Bacteria 9268
123 Ga0070687_100040356 3300005343 Bacteria 2351
124 Ga0070687_100122061 3300005343 Bacteria 1491
125 Ga0070661_100000242 3300005344 Bacteria 44945
126 Ga0070661_100041316 3300005344 Bacteria 3366
127 Ga0070661_100191782 3300005344 Bacteria 1559
128 Ga0070661_100327272 3300005344 Bacteria 1198
129 Ga0070692_10001796 3300005345 Bacteria 8019
130 Ga0070692_10021538 3300005345 Bacteria 3138
131 Ga0070692_10385535 3300005345 Bacteria 880
132 Ga0070668_100002745 3300005347 Bacteria 12957
133 Ga0070668_100072456 3300005347 Bacteria 2684
134 Ga0070669_100040902 3300005353 Bacteria 3370
135 Ga0070669_100068194 3300005353 Bacteria 2625
136 Ga0070669_100079619 3300005353 Bacteria 2437
137 Ga0070669_100441809 3300005353 Bacteria 1071
138 Ga0070675_100005150 3300005354 Bacteria 9971
139 Ga0070675_100067032 3300005354 Bacteria 2969
140 Ga0070675_100141728 3300005354 Bacteria 2055
141 Ga0070675_101505169 3300005354 Bacteria 621
142 Ga0070671_100002515 3300005355 Bacteria 14203
143 Ga0070674_100019229 3300005356 Bacteria 4336
144 Ga0070674_100350916 3300005356 Bacteria 1192
145 Ga0070673_100001955 3300005364 Bacteria 12424
146 Ga0070688_100003900 3300005365 Bacteria 7736
147 Ga0070688_100006957 3300005365 Bacteria 6078
148 Ga0070688_100019196 3300005365 Bacteria 3959
149 Ga0070659_100011013 3300005366 Bacteria 6678
150 Ga0070659_100265325 3300005366 Bacteria 1425
151 Ga0070667_100080034 3300005367 Bacteria 2794
152 Ga0070667_100149028 3300005367 Bacteria 2054
153 Ga0070703_10033171 3300005406 Bacteria 1571
154 Ga0070703_10435804 3300005406 Bacteria 578
155 Ga0070709_10176584 3300005434 Bacteria 1497
156 Ga0070709_10272233 3300005434 Bacteria 1227
157 Ga0070709_10423722 3300005434 Bacteria 998
158 Ga0070714_100024153 3300005435 Bacteria 5000
159 Ga0070714_100070994 3300005435 Bacteria 3011
160 Ga0070714_100188688 3300005435 Bacteria 1880
161 Ga0070714_102194694 3300005435 Bacteria 538
162 Ga0070713_100095522 3300005436 Bacteria 2564
163 Ga0070713_100387084 3300005436 Bacteria 1304
164 Ga0070713_100484864 3300005436 Bacteria 1165
165 Ga0070710_10254200 3300005437 Bacteria 1130
166 Ga0070701_10031326 3300005438 Bacteria 2638
167 Ga0070701_10080983 3300005438 Bacteria 1757
168 Ga0070711_100005580 3300005439 Bacteria 7530
169 Ga0070711_100392490 3300005439 Bacteria 1124
170 Ga0070711_100748026 3300005439 Bacteria 826
171 Ga0070711_100896466 3300005439 Bacteria 757
172 Ga0070711_102057272 3300005439 Bacteria 503
173 Ga0070705_100260063 3300005440 Bacteria 1223
174 Ga0070700_100002176 3300005441 Bacteria 9951
175 Ga0070700_100065173 3300005441 Bacteria 2309
176 Ga0070694_100003584 3300005444 Bacteria 9275
177 Ga0070694_100007637 3300005444 Bacteria 6601
178 Ga0070694_100939086 3300005444 Bacteria 716
179 Ga0070708_100019084 3300005445 Bacteria 5751
180 Ga0070708_100678195 3300005445 Bacteria 970
181 Ga0070708_101511480 3300005445 Bacteria 626
182 Ga0070663_100007690 3300005455 Bacteria 6579
183 Ga0070663_100184107 3300005455 Bacteria 1622
184 Ga0070678_100003068 3300005456 Bacteria 9259
185 Ga0070662_100003935 3300005457 Bacteria 9312
186 Ga0070662_100014948 3300005457 Bacteria 5190
187 Ga0070662_100068416 3300005457 Bacteria 2611
188 Ga0070681_10028949 3300005458 Bacteria 5565
189 Ga0070681_10048230 3300005458 Bacteria 4256
190 Ga0070681_10112484 3300005458 Bacteria 2662
191 Ga0070681_10151971 3300005458 Bacteria 2241
192 Ga0070681_10157589 3300005458 Bacteria 2195
193 Ga0070681_10703168 3300005458 Bacteria 926
194 Ga0070681_11370189 3300005458 Bacteria 631
195 Ga0068867_100011724 3300005459 Bacteria 6189
196 Ga0068867_100079223 3300005459 Bacteria 2472
197 Ga0068867_100273437 3300005459 Bacteria 1382
198 Ga0070685_10017180 3300005466 Bacteria 3870
199 Ga0070685_10109534 3300005466 Bacteria 1699
200 Ga0070685_10262201 3300005466 Bacteria 1149
201 Ga0070706_100808845 3300005467 Bacteria 867
202 Ga0070707_100147294 3300005468 Bacteria 2291
203 Ga0070698_100404469 3300005471 Bacteria 1299
204 Ga0070698_100832435 3300005471 Bacteria 867
205 Ga0074259_10076998 3300005507 Bacteria 958
206 Ga0070699_100019774 3300005518 Bacteria 5804
207 Ga0070699_100162581 3300005518 Bacteria 1976
208 Ga0070699_100173410 3300005518 Bacteria 1912
209 Ga0070679_100008294 3300005530 Bacteria 9775
210 Ga0070679_100056111 3300005530 Bacteria 3924
211 Ga0070679_100067721 3300005530 Bacteria 3560
212 Ga0070679_100093792 3300005530 Bacteria 2989
213 Ga0070679_100129157 3300005530 Bacteria 2508
214 Ga0070679_100170885 3300005530 Bacteria 2147
215 Ga0070679_100181504 3300005530 Bacteria 2077
216 Ga0070679_100257053 3300005530 Bacteria 1702
217 Ga0070684_100006738 3300005535 Bacteria 8910
218 Ga0070684_100401664 3300005535 Bacteria 1263
219 Ga0070697_100158946 3300005536 Bacteria 1909
220 Ga0070697_100346585 3300005536 Bacteria 1282
221 Ga0068853_100102546 3300005539 Bacteria 2532
222 Ga0068853_100220039 3300005539 Bacteria 1734
223 Ga0068853_100317428 3300005539 Bacteria 1444
224 Ga0068853_100923818 3300005539 Bacteria 839
225 Ga0070672_100000779 3300005543 Bacteria 18969
226 Ga0070672_100024274 3300005543 Bacteria 4478
227 Ga0070672_100188068 3300005543 Bacteria 1723
228 Ga0070686_100002512 3300005544 Bacteria 10105
229 Ga0070686_100051330 3300005544 Bacteria 2625
230 Ga0070686_100126978 3300005544 Bacteria 1759
231 Ga0070686_100234499 3300005544 Bacteria 1333
232 Ga0070686_100334117 3300005544 Bacteria 1134
233 Ga0070686_100800031 3300005544 Bacteria 760
234 Ga0070695_100002662 3300005545 Bacteria 10333
235 Ga0070695_100072415 3300005545 Bacteria 2259
236 Ga0070696_100005072 3300005546 Bacteria 8797
237 Ga0070696_100081463 3300005546 Bacteria 2293
238 Ga0070696_100100771 3300005546 Bacteria 2070
239 Ga0070696_101773015 3300005546 Bacteria 533
240 Ga0070693_100001394 3300005547 Bacteria 10872
241 Ga0070693_100111806 3300005547 Bacteria 1681
242 Ga0070665_100020952 3300005548 Bacteria 6570
243 Ga0070665_100304510 3300005548 Bacteria 1597
244 Ga0070665_100528856 3300005548 Bacteria 1191
245 Ga0070704_100022552 3300005549 Bacteria 4099
246 Ga0070704_100061810 3300005549 Bacteria 2682
247 Ga0070704_101408379 3300005549 Bacteria 640
248 Ga0068855_100058052 3300005563 Bacteria 4533
249 Ga0068855_100077640 3300005563 Bacteria 3853
250 Ga0068855_100096075 3300005563 Bacteria 3415
251 Ga0068855_100174337 3300005563 Bacteria 2434
252 Ga0068855_100177306 3300005563 Bacteria 2411
253 Ga0068855_100228715 3300005563 Bacteria 2083
254 Ga0068855_101081891 3300005563 Bacteria 839
255 Ga0068855_101143947 3300005563 Bacteria 812
256 Ga0070664_100003126 3300005564 Bacteria 13379
257 Ga0070664_100067502 3300005564 Bacteria 3056
258 Ga0070664_100153066 3300005564 Bacteria 2037
259 Ga0070664_100703137 3300005564 Bacteria 942
260 Ga0068857_100003871 3300005577 Bacteria 12604
261 Ga0068857_100131358 3300005577 Bacteria 2259
262 Ga0068857_100286824 3300005577 Bacteria 1515
263 Ga0068854_100005481 3300005578 Bacteria 8017
264 Ga0068854_100035958 3300005578 Bacteria 3469
265 Ga0068854_100220085 3300005578 Bacteria 1502
266 Ga0068854_100643327 3300005578 Bacteria 910
267 Ga0068856_100006680 3300005614 Bacteria 11308
268 Ga0068856_100308750 3300005614 Bacteria 1599
269 Ga0068856_100396558 3300005614 Bacteria 1400
270 Ga0068856_100958772 3300005614 Bacteria 874
271 Ga0068856_101083330 3300005614 Bacteria 819
272 Ga0068856_101802377 3300005614 Bacteria 624
273 Ga0070702_100000927 3300005615 Bacteria 11472
274 Ga0070702_100014784 3300005615 Bacteria 3968
275 Ga0070702_100132541 3300005615 Bacteria 1576
276 Ga0068852_100075769 3300005616 Bacteria 2968
277 Ga0068852_100229354 3300005616 Bacteria 1769
278 Ga0068852_100270059 3300005616 Bacteria 1636
279 Ga0068852_100339480 3300005616 Bacteria 1464
280 Ga0068859_100016580 3300005617 Bacteria 7397
281 Ga0068859_100092750 3300005617 Bacteria 3071
282 Ga0068859_100126714 3300005617 Bacteria 2623
283 Ga0068864_100000227 3300005618 Bacteria 50765
284 Ga0068864_100095387 3300005618 Bacteria 2630
285 Ga0068864_100364370 3300005618 Bacteria 1367
286 Ga0068866_10001232 3300005718 Bacteria 11097
287 Ga0068866_10087121 3300005718 Bacteria 1691
288 Ga0068861_100011830 3300005719 Bacteria 6073
289 Ga0068861_100042299 3300005719 Bacteria 3414
290 Ga0068861_100075457 3300005719 Bacteria 2625
291 Ga0068851_10048384 3300005834 Bacteria 2155
292 Ga0068851_10646581 3300005834 Bacteria 647
293 Ga0068851_10766483 3300005834 Bacteria 598
294 Ga0068870_10000062 3300005840 Bacteria 33752
295 Ga0068870_10000922 3300005840 Bacteria 11510
296 Ga0068863_100009931 3300005841 Bacteria 9268
297 Ga0068863_100050824 3300005841 Bacteria 3929
298 Ga0068863_100840212 3300005841 Bacteria 917
299 Ga0068858_100009135 3300005842 Bacteria 9478
300 Ga0068858_100274450 3300005842 Bacteria 1605
301 Ga0068858_100470867 3300005842 Bacteria 1212
302 Ga0068860_100003111 3300005843 Bacteria 17149
303 Ga0068860_100012394 3300005843 Bacteria 8400
304 Ga0068860_100140036 3300005843 Bacteria 2325
305 Ga0068860_100167010 3300005843 Bacteria 2125
306 Ga0068860_100260322 3300005843 Bacteria 1691
307 Ga0068862_100014320 3300005844 Bacteria 6579
308 Ga0068862_100044458 3300005844 Bacteria 3788
309 Ga0068862_100093264 3300005844 Bacteria 2625
310 Ga0068862_101166413 3300005844 Bacteria 768
311 Ga0081455_10000204 3300005937 Bacteria 75793
312 Ga0081455_10005856 3300005937 Bacteria 13373
313 Ga0081455_10009672 3300005937 Bacteria 9887
314 Ga0081455_10071467 3300005937 Bacteria 2877
315 Ga0081538_10063068 3300005981 Bacteria 2107
316 Ga0081538_10277089 3300005981 Bacteria 625
317 Ga0081540_1006259 3300005983 Bacteria 8714
318 Ga0081540_1028094 3300005983 Bacteria 3168
319 Ga0081540_1031674 3300005983 Bacteria 2902
320 Ga0081540_1103065 3300005983 Bacteria 1224
321 Ga0081540_1337824 3300005983 Bacteria 516
322 Ga0070717_10160494 3300006028 Bacteria 1950
323 Ga0070717_10783083 3300006028 Bacteria 867
324 Ga0070717_10821830 3300006028 Bacteria 845
325 Ga0070717_10853433 3300006028 Bacteria 829
326 Ga0070717_10889194 3300006028 Bacteria 811
327 Ga0075365_10005666 3300006038 Bacteria 6767
328 Ga0075365_10059212 3300006038 Bacteria 2552
329 Ga0075365_10199173 3300006038 Bacteria 1403
330 Ga0075365_10524306 3300006038 Bacteria 838
331 Ga0075363_100524316 3300006048 Bacteria 705
332 Ga0075364_10155982 3300006051 Bacteria 1540
333 Ga0075364_10191373 3300006051 Bacteria 1386
334 Ga0075432_10003061 3300006058 Bacteria 5633
335 Ga0070715_10093632 3300006163 Bacteria 1388
336 Ga0070716_100149663 3300006173 Bacteria 1500
337 Ga0070716_100839006 3300006173 Bacteria 715
338 Ga0070716_101017893 3300006173 Bacteria 656
339 Ga0070712_100001034 3300006175 Bacteria 16789
340 Ga0070712_100133941 3300006175 Bacteria 1882
341 Ga0070712_100446237 3300006175 Bacteria 1076
342 Ga0070712_100830849 3300006175 Bacteria 794
343 Ga0070712_101132517 3300006175 Bacteria 680
344 Ga0075362_10096589 3300006177 Bacteria 1377
345 Ga0075367_10273645 3300006178 Bacteria 1061
346 Ga0075367_10375298 3300006178 Bacteria 898
347 Ga0075367_10606246 3300006178 Bacteria 696
348 Ga0075367_10771517 3300006178 Bacteria 612
349 Ga0075369_10445575 3300006186 Bacteria 613
350 Ga0075427_10000102 3300006194 Bacteria 7189
351 Ga0097621_100000010 3300006237 Bacteria 112867
352 Ga0097621_100253115 3300006237 Bacteria 1543
353 Ga0075370_10300813 3300006353 Bacteria 954
354 Ga0068871_100012046 3300006358 Bacteria 6364
355 Ga0068871_100027563 3300006358 Bacteria 4445
356 Ga0075428_100060816 3300006844 Bacteria 4137
357 Ga0075428_100072641 3300006844 Bacteria 3758
358 Ga0075428_100106899 3300006844 Bacteria 3050
359 Ga0075428_100116900 3300006844 Bacteria 2904
360 Ga0075428_100171490 3300006844 Bacteria 2351
361 Ga0075428_100676414 3300006844 Bacteria 1100
362 Ga0075428_102760360 3300006844 Bacteria 500
363 Ga0075430_100000112 3300006846 Bacteria 48871
364 Ga0075430_100000160 3300006846 Bacteria 44139
365 Ga0075430_100046452 3300006846 Bacteria 3667
366 Ga0075430_100372919 3300006846 Bacteria 1178
367 Ga0075430_100420696 3300006846 Bacteria 1103
368 Ga0075430_100565923 3300006846 Bacteria 937
369 Ga0075430_100675373 3300006846 Bacteria 852
370 Ga0075430_100705570 3300006846 Bacteria 832
371 Ga0075431_100003174 3300006847 Bacteria 15904
372 Ga0075431_100039133 3300006847 Bacteria 4884
373 Ga0075431_100078947 3300006847 Bacteria 3398
374 Ga0075431_100106223 3300006847 Bacteria 2897
375 Ga0075431_100254396 3300006847 Bacteria 1784
376 Ga0075431_100270623 3300006847 Bacteria 1721
377 Ga0075431_100733527 3300006847 Bacteria 964
378 Ga0075431_100970319 3300006847 Bacteria 818
379 Ga0075431_101018583 3300006847 Bacteria 794
380 Ga0075431_101020237 3300006847 Bacteria 794
381 Ga0075431_101950540 3300006847 Bacteria 543
382 Ga0075433_10000443 3300006852 Bacteria 26775
383 Ga0075433_10069407 3300006852 Bacteria 3095
384 Ga0075433_10290866 3300006852 Bacteria 1447
385 Ga0075433_11174020 3300006852 Bacteria 667
386 Ga0075433_11699189 3300006852 Bacteria 544
387 Ga0075434_100000570 3300006871 Bacteria 28382
388 Ga0075434_100005858 3300006871 Bacteria 11225
389 Ga0075434_100025373 3300006871 Bacteria 5798
390 Ga0075434_100231480 3300006871 Bacteria 1867
391 Ga0075434_100749554 3300006871 Bacteria 993
392 Ga0075434_101116250 3300006871 Bacteria 802
393 Ga0075434_101142498 3300006871 Bacteria 792
394 Ga0075429_100001532 3300006880 Bacteria 18968
395 Ga0075429_100044267 3300006880 Bacteria 3872
396 Ga0075429_100284238 3300006880 Bacteria 1449
397 Ga0068865_100000325 3300006881 Bacteria 26438
398 Ga0068865_100050406 3300006881 Bacteria 2875
399 Ga0068865_100250097 3300006881 Bacteria 1399
400 Ga0075436_100228798 3300006914 Bacteria 1321
401 Ga0075436_100493877 3300006914 Bacteria 895
402 Ga0075436_100612509 3300006914 Bacteria 803
403 Ga0075436_100672304 3300006914 Bacteria 766
404 Ga0097620_100016580 3300006931 Bacteria 7397
405 Ga0097620_100092752 3300006931 Bacteria 3071
406 Ga0097620_100126714 3300006931 Bacteria 2623
407 Ga0075435_100002037 3300007076 Bacteria 13232
408 Ga0075435_100020889 3300007076 Bacteria 5027
409 Ga0075435_100129869 3300007076 Bacteria 2108
410 Ga0099794_10015820 3300007265 Bacteria 3336
411 Ga0099794_10741117 3300007265 Bacteria 524
412 Ga0099795_10000363 3300007788 Bacteria 8151
413 Ga0099795_10215365 3300007788 Bacteria 815
414 Ga0099795_10254334 3300007788 Bacteria 759
415 Ga0099795_10562808 3300007788 Bacteria 539
416 Ga0105251_10237776 3300009011 Bacteria 820
417 Ga0105244_10140097 3300009036 Bacteria 1164
418 Ga0105250_10044324 3300009092 Bacteria 1784
419 Ga0105240_10116268 3300009093 Bacteria 3227
420 Ga0105240_10449195 3300009093 Bacteria 1443
421 Ga0111539_10000993 3300009094 Bacteria 37156
422 Ga0111539_10029499 3300009094 Bacteria 6680
423 Ga0111539_10115743 3300009094 Bacteria 3144
424 Ga0111539_10123279 3300009094 Bacteria 3037
425 Ga0111539_10309686 3300009094 Bacteria 1838
426 Ga0111539_11570079 3300009094 Bacteria 763
427 Ga0111539_12566175 3300009094 Bacteria 591
428 Ga0105245_10000152 3300009098 Bacteria 65742
429 Ga0105245_10044225 3300009098 Bacteria 3974
430 Ga0105245_10333764 3300009098 Bacteria 1497
431 Ga0105247_10012265 3300009101 Bacteria 5148
432 Ga0105247_10041218 3300009101 Bacteria 2825
433 Ga0105247_10155551 3300009101 Bacteria 1510
434 Ga0105247_10177021 3300009101 Bacteria 1421
435 Ga0105247_10407870 3300009101 Bacteria 970
436 Ga0114129_10002182 3300009147 Bacteria 26942
437 Ga0114129_10003347 3300009147 Bacteria 22518
438 Ga0114129_10009224 3300009147 Bacteria 14071
439 Ga0114129_10030322 3300009147 Bacteria 7654
440 Ga0114129_10377814 3300009147 Bacteria 1872
441 Ga0114129_10485533 3300009147 Bacteria 1616
442 Ga0114129_11780462 3300009147 Bacteria 750
443 Ga0114129_12346053 3300009147 Bacteria 640
444 Ga0105243_10006762 3300009148 Bacteria 8847
445 Ga0105243_10022157 3300009148 Bacteria 4827
446 Ga0105243_11056032 3300009148 Bacteria 818
447 Ga0105241_10070096 3300009174 Bacteria 2719
448 Ga0105242_10000037 3300009176 Bacteria 91293
449 Ga0105248_10013259 3300009177 Bacteria 9073
450 Ga0105248_10171294 3300009177 Bacteria 2447
451 Ga0105248_10171851 3300009177 Bacteria 2443
452 Ga0105248_11725851 3300009177 Bacteria 710
453 Ga0105237_10110134 3300009545 Bacteria 2746
454 Ga0105237_10196494 3300009545 Bacteria 2017
455 Ga0105237_10275822 3300009545 Bacteria 1684
456 Ga0105237_10949522 3300009545 Bacteria 867
457 Ga0105237_11516698 3300009545 Bacteria 677
458 Ga0105238_10058723 3300009551 Bacteria 3855
459 Ga0105238_10762570 3300009551 Bacteria 982
460 Ga0105249_10011210 3300009553 Bacteria 7875
461 Ga0105249_10023632 3300009553 Bacteria 5518
462 Ga0105249_10209950 3300009553 Bacteria 1910
463 Ga0105249_10274413 3300009553 Bacteria 1681
464 Ga0099796_10012524 3300010159 Bacteria 2397
465 Ga0099796_10283745 3300010159 Bacteria 697
466 Ga0105239_10049972 3300010375 Bacteria 4586
467 Ga0105239_10076865 3300010375 Bacteria 3672
468 Ga0105239_10096486 3300010375 Bacteria 3266
469 Ga0105239_10234458 3300010375 Bacteria 2059
470 Ga0105246_10052057 3300011119 Bacteria 2813
471 Ga0105246_10341677 3300011119 Bacteria 1224
472 Ga0157320_1038189 3300012481 Bacteria 511
473 Ga0157335_1042480 3300012492 Bacteria 518
474 Ga0157341_1001158 3300012494 Bacteria 1534
475 Ga0157345_1008271 3300012498 Bacteria 866
476 Ga0157347_1065153 3300012502 Bacteria 528
477 Ga0157338_1000316 3300012515 Bacteria 2636
478 Ga0157373_10144865 3300013100 Bacteria 1671
479 Ga0157373_10530286 3300013100 Bacteria 852
480 Ga0157371_10012605 3300013102 Bacteria 6453
481 Ga0157371_10048730 3300013102 Bacteria 3011
482 Ga0157371_10176033 3300013102 Bacteria 1529
483 Ga0157371_10501018 3300013102 Bacteria 897
484 Ga0157371_10653013 3300013102 Bacteria 785
485 Ga0157370_10183345 3300013104 Bacteria 1944
486 Ga0157370_10348618 3300013104 Bacteria 1365
487 Ga0157370_10351210 3300013104 Bacteria 1359
488 Ga0157370_10604075 3300013104 Bacteria 1004
489 Ga0157370_11512487 3300013104 Bacteria 603
490 Ga0157369_10095097 3300013105 Bacteria 3180
491 Ga0157369_10145695 3300013105 Bacteria 2504
492 Ga0157369_10560833 3300013105 Bacteria 1180
493 Ga0157374_10035559 3300013296 Bacteria 4558
494 Ga0157374_10080867 3300013296 Bacteria 3083
495 Ga0157378_10007750 3300013297 Bacteria 9370
496 Ga0157378_10042620 3300013297 Bacteria 4029
497 Ga0157378_10642735 3300013297 Bacteria 1076
498 Ga0157378_10795975 3300013297 Bacteria 971
499 Ga0157378_10846670 3300013297 Bacteria 943
500 Ga0157378_11400070 3300013297 Bacteria 742
501 Ga0163162_10010184 3300013306 Bacteria 9133
502 Ga0163162_10051078 3300013306 Bacteria 4147
503 Ga0157372_10134619 3300013307 Bacteria 2845
504 Ga0157372_10201879 3300013307 Bacteria 2303
505 Ga0157372_10386337 3300013307 Bacteria 1631
506 Ga0157372_10885536 3300013307 Bacteria 1036
507 Ga0157375_10029677 3300013308 Bacteria 5146
508 Ga0157375_10037646 3300013308 Bacteria 4636
509 Ga0157375_10367996 3300013308 Bacteria 1604
510 Ga0163163_10044706 3300014325 Bacteria 4345
511 Ga0163163_10094739 3300014325 Bacteria 3004
512 Ga0163163_10169830 3300014325 Bacteria 2227
513 Ga0163163_12269982 3300014325 Bacteria 602
514 Ga0157380_10001645 3300014326 Bacteria 14713
515 Ga0157380_10123702 3300014326 Bacteria 2195
516 Ga0157377_10000908 3300014745 Bacteria 12358
517 Ga0157377_10112066 3300014745 Bacteria 1641
518 Ga0157379_10035382 3300014968 Bacteria 4453
519 Ga0157379_10086365 3300014968 Bacteria 2813
520 Ga0157376_10000098 3300014969 Bacteria 63149
521 Ga0157376_10196863 3300014969 Bacteria 1852
522 Ga0157376_10306157 3300014969 Bacteria 1506
523 Ga0163161_10000517 3300017792 Bacteria 31485
524 Ga0163161_10194614 3300017792 Bacteria 1560
525 Ga0184600_119888 3300019190 Bacteria 555
526 Ga0197907_10021714 3300020069 Bacteria 570
527 Ga0197907_10267674 3300020069 Bacteria 1262
528 Ga0197907_10322994 3300020069 Bacteria 672
529 Ga0197907_11472364 3300020069 Bacteria 958
530 Ga0206356_10616003 3300020070 Bacteria 1639
531 Ga0206355_1044422 3300020076 Bacteria 533
532 Ga0206355_1321509 3300020076 Bacteria 655
533 Ga0206355_1607865 3300020076 Bacteria 528
534 Ga0206352_10070973 3300020078 Bacteria 740
535 Ga0206352_10990502 3300020078 Bacteria 514
536 Ga0206354_10057609 3300020081 Bacteria 3122
537 Ga0206353_11351368 3300020082 Bacteria 3420
538 Ga0154015_1155604 3300020610 Bacteria 851
539 Ga0154015_1309315 3300020610 Bacteria 660
540 Ga0154015_1558961 3300020610 Bacteria 758
541 Ga0213872_10015119 3300021361 Bacteria 3590
542 Ga0224712_10320348 3300022467 Bacteria 728
543 Ga0224712_10407319 3300022467 Bacteria 649
544 Ga0228598_1028738 3300024227 Bacteria 1094
545 Ga0207666_1000340 3300025271 Bacteria 6422
546 Ga0207666_1008668 3300025271 Bacteria 1361
547 Ga0207673_1001667 3300025290 Bacteria 2454
548 Ga0207697_10001646 3300025315 Bacteria 12078
549 Ga0207697_10017664 3300025315 Bacteria 2930
550 Ga0207697_10054579 3300025315 Bacteria 1656
551 Ga0207656_10085459 3300025321 Bacteria 1424
552 Ga0207656_10558826 3300025321 Bacteria 583
553 Ga0207656_10682959 3300025321 Bacteria 525
554 Ga0207696_1035844 3300025711 Bacteria 1474
555 Ga0207655_1085276 3300025728 Bacteria 1127
556 Ga0207653_10055806 3300025885 Bacteria 1323
557 Ga0207653_10144809 3300025885 Bacteria 871
558 Ga0207682_10001127 3300025893 Bacteria 12353
559 Ga0207692_10026490 3300025898 Bacteria 2720
560 Ga0207692_10070442 3300025898 Bacteria 1841
561 Ga0207692_10608053 3300025898 Bacteria 703
562 Ga0207642_10001064 3300025899 Bacteria 8516
563 Ga0207710_10000646 3300025900 Bacteria 19702
564 Ga0207710_10018970 3300025900 Bacteria 2931
565 Ga0207710_10194076 3300025900 Bacteria 1001
566 Ga0207688_10000421 3300025901 Bacteria 19947
567 Ga0207688_10011945 3300025901 Bacteria 4727
568 Ga0207688_10526350 3300025901 Bacteria 742
569 Ga0207680_10019271 3300025903 Bacteria 3645
570 Ga0207647_10027881 3300025904 Bacteria 3678
571 Ga0207647_10096278 3300025904 Bacteria 1762
572 Ga0207647_10171003 3300025904 Bacteria 1265
573 Ga0207685_10027629 3300025905 Bacteria 1988
574 Ga0207685_10249684 3300025905 Bacteria 857
575 Ga0207685_10497322 3300025905 Bacteria 641
576 Ga0207699_10007521 3300025906 Bacteria 5331
577 Ga0207699_10259356 3300025906 Bacteria 1201
578 Ga0207645_10000023 3300025907 Bacteria 98724
579 Ga0207645_10034532 3300025907 Bacteria 3250
580 Ga0207643_10000007 3300025908 Bacteria 171706
581 Ga0207643_10001763 3300025908 Bacteria 12080
582 Ga0207705_10020248 3300025909 Bacteria 4758
583 Ga0207705_10031743 3300025909 Bacteria 3772
584 Ga0207684_10094548 3300025910 Bacteria 2549
585 Ga0207684_10361555 3300025910 Bacteria 1249
586 Ga0207684_10730244 3300025910 Bacteria 840
587 Ga0207684_11191626 3300025910 Bacteria 631
588 Ga0207654_10005412 3300025911 Bacteria 6456
589 Ga0207707_10005596 3300025912 Bacteria 10994
590 Ga0207707_10111096 3300025912 Bacteria 2396
591 Ga0207707_10140397 3300025912 Bacteria 2112
592 Ga0207707_10236724 3300025912 Bacteria 1588
593 Ga0207707_10457545 3300025912 Bacteria 1092
594 Ga0207695_10056615 3300025913 Bacteria 4078
595 Ga0207695_10181240 3300025913 Bacteria 2027
596 Ga0207671_10019782 3300025914 Bacteria 5140
597 Ga0207671_10192985 3300025914 Bacteria 1589
598 Ga0207671_11546786 3300025914 Bacteria 511
599 Ga0207693_10006335 3300025915 Bacteria 9811
600 Ga0207693_10009479 3300025915 Bacteria 7929
601 Ga0207693_10024014 3300025915 Bacteria 4840
602 Ga0207693_10048492 3300025915 Bacteria 3335
603 Ga0207693_10591672 3300025915 Bacteria 864
604 Ga0207663_10096738 3300025916 Bacteria 1973
605 Ga0207663_10174250 3300025916 Bacteria 1531
606 Ga0207663_10537837 3300025916 Bacteria 912
607 Ga0207663_10598154 3300025916 Bacteria 866
608 Ga0207660_10000058 3300025917 Bacteria 56791
609 Ga0207660_10024467 3300025917 Bacteria 4089
610 Ga0207660_10159311 3300025917 Bacteria 1740
611 Ga0207660_10203366 3300025917 Bacteria 1548
612 Ga0207660_10335059 3300025917 Bacteria 1210
613 Ga0207660_10826582 3300025917 Bacteria 756
614 Ga0207662_10002534 3300025918 Bacteria 9200
615 Ga0207662_10008351 3300025918 Bacteria 5668
616 Ga0207662_10055229 3300025918 Bacteria 2370
617 Ga0207657_10010577 3300025919 Bacteria 9200
618 Ga0207657_10018216 3300025919 Bacteria 6718
619 Ga0207657_10076527 3300025919 Bacteria 2823
620 Ga0207657_10105114 3300025919 Bacteria 2338
621 Ga0207657_10369041 3300025919 Bacteria 1131
622 Ga0207657_10999066 3300025919 Bacteria 642
623 Ga0207657_11118419 3300025919 Bacteria 601
624 Ga0207649_10000265 3300025920 Bacteria 41422
625 Ga0207649_10109207 3300025920 Bacteria 1845
626 Ga0207649_10281624 3300025920 Bacteria 1209
627 Ga0207652_10006100 3300025921 Bacteria 9749
628 Ga0207652_10030984 3300025921 Bacteria 4486
629 Ga0207652_10080345 3300025921 Bacteria 2850
630 Ga0207652_10136713 3300025921 Bacteria 2189
631 Ga0207652_10154722 3300025921 Bacteria 2054
632 Ga0207652_10161495 3300025921 Bacteria 2009
633 Ga0207652_10163805 3300025921 Bacteria 1993
634 Ga0207652_10637415 3300025921 Bacteria 954
635 Ga0207681_10000338 3300025923 Bacteria 33675
636 Ga0207681_10048718 3300025923 Bacteria 2861
637 Ga0207681_10099360 3300025923 Bacteria 2095
638 Ga0207694_10045367 3300025924 Bacteria 3395
639 Ga0207694_10629652 3300025924 Bacteria 903
640 Ga0207650_10003024 3300025925 Bacteria 11589
641 Ga0207650_10003490 3300025925 Bacteria 10803
642 Ga0207650_10043964 3300025925 Bacteria 3282
643 Ga0207650_11167727 3300025925 Bacteria 655
644 Ga0207659_10000852 3300025926 Bacteria 18076
645 Ga0207659_10043402 3300025926 Bacteria 3158
646 Ga0207659_10272027 3300025926 Bacteria 1382
647 Ga0207687_10000390 3300025927 Bacteria 29754
648 Ga0207687_10033046 3300025927 Bacteria 3508
649 Ga0207687_10109916 3300025927 Bacteria 2043
650 Ga0207700_10185526 3300025928 Bacteria 1745
651 Ga0207700_10310622 3300025928 Bacteria 1364
652 Ga0207664_10043096 3300025929 Bacteria 3527
653 Ga0207664_10181774 3300025929 Bacteria 1806
654 Ga0207664_10287081 3300025929 Bacteria 1445
655 Ga0207644_10004631 3300025931 Bacteria 8948
656 Ga0207644_10140146 3300025931 Bacteria 1861
657 Ga0207644_10649015 3300025931 Bacteria 878
658 Ga0207690_10001293 3300025932 Bacteria 15814
659 Ga0207690_10429001 3300025932 Bacteria 1059
660 Ga0207706_10008986 3300025933 Bacteria 9198
661 Ga0207706_10016275 3300025933 Bacteria 6718
662 Ga0207706_10027220 3300025933 Bacteria 5114
663 Ga0207686_10000329 3300025934 Bacteria 34169
664 Ga0207709_10000419 3300025935 Bacteria 41401
665 Ga0207709_10012298 3300025935 Bacteria 4717
666 Ga0207709_10064366 3300025935 Bacteria 2302
667 Ga0207709_10655045 3300025935 Bacteria 836
668 Ga0207670_10004455 3300025936 Bacteria 7546
669 Ga0207670_10020284 3300025936 Bacteria 4081
670 Ga0207670_10192221 3300025936 Bacteria 1545
671 Ga0207670_10223797 3300025936 Bacteria 1442
672 Ga0207669_10000197 3300025937 Bacteria 27542
673 Ga0207669_10025135 3300025937 Bacteria 3212
674 Ga0207704_10000381 3300025938 Bacteria 20335
675 Ga0207704_10026763 3300025938 Bacteria 3169
676 Ga0207704_10084949 3300025938 Bacteria 2059
677 Ga0207665_11318111 3300025939 Bacteria 575
678 Ga0207691_10000405 3300025940 Bacteria 43134
679 Ga0207691_10008342 3300025940 Bacteria 9950
680 Ga0207691_10313462 3300025940 Bacteria 1346
681 Ga0207711_10006325 3300025941 Bacteria 9990
682 Ga0207711_10109893 3300025941 Bacteria 2451
683 Ga0207711_10235029 3300025941 Bacteria 1679
684 Ga0207711_11640570 3300025941 Bacteria 586
685 Ga0207689_10001529 3300025942 Bacteria 21993
686 Ga0207689_10181193 3300025942 Bacteria 1737
687 Ga0207689_10572677 3300025942 Bacteria 949
688 Ga0207661_10004218 3300025944 Bacteria 10057
689 Ga0207661_10272690 3300025944 Bacteria 1510
690 Ga0207679_10000029 3300025945 Bacteria 183002
691 Ga0207679_10057461 3300025945 Bacteria 2878
692 Ga0207679_10398839 3300025945 Bacteria 1210
693 Ga0207667_10113510 3300025949 Bacteria 2793
694 Ga0207667_10128743 3300025949 Bacteria 2607
695 Ga0207667_10247612 3300025949 Bacteria 1823
696 Ga0207667_10386992 3300025949 Bacteria 1425
697 Ga0207667_10703055 3300025949 Bacteria 1013
698 Ga0207667_10931445 3300025949 Bacteria 859
699 Ga0207667_11830845 3300025949 Bacteria 570
700 Ga0207651_10002680 3300025960 Bacteria 8525
701 Ga0207651_10010769 3300025960 Bacteria 5083
702 Ga0207712_10000756 3300025961 Bacteria 24444
703 Ga0207712_10041636 3300025961 Bacteria 3158
704 Ga0207712_10124459 3300025961 Bacteria 1955
705 Ga0207668_10000158 3300025972 Bacteria 47189
706 Ga0207668_10070822 3300025972 Bacteria 2488
707 Ga0207668_10076909 3300025972 Bacteria 2404
708 Ga0207640_10000403 3300025981 Bacteria 27427
709 Ga0207640_10553132 3300025981 Bacteria 967
710 Ga0207640_11939571 3300025981 Bacteria 533
711 Ga0207658_10000929 3300025986 Bacteria 24221
712 Ga0207658_10313067 3300025986 Bacteria 1356
713 Ga0207677_10016686 3300026023 Bacteria 4357
714 Ga0207677_10041040 3300026023 Bacteria 3056
715 Ga0207677_10880790 3300026023 Bacteria 806
716 Ga0207703_10006542 3300026035 Bacteria 9292
717 Ga0207703_10113333 3300026035 Bacteria 2317
718 Ga0207703_10408174 3300026035 Bacteria 1262
719 Ga0207703_10594468 3300026035 Bacteria 1046
720 Ga0207703_10658102 3300026035 Bacteria 994
721 Ga0207703_11454842 3300026035 Bacteria 659
722 Ga0207639_10354965 3300026041 Bacteria 1310
723 Ga0207639_10360086 3300026041 Bacteria 1301
724 Ga0207639_10373249 3300026041 Bacteria 1279
725 Ga0207678_10006751 3300026067 Bacteria 10176
726 Ga0207678_10060487 3300026067 Bacteria 3258
727 Ga0207678_11551588 3300026067 Bacteria 584
728 Ga0207708_10005713 3300026075 Bacteria 9197
729 Ga0207708_10037195 3300026075 Bacteria 3708
730 Ga0207702_10000404 3300026078 Bacteria 49177
731 Ga0207702_10041853 3300026078 Bacteria 3842
732 Ga0207702_10306636 3300026078 Bacteria 1508
733 Ga0207702_10457948 3300026078 Bacteria 1238
734 Ga0207702_10749169 3300026078 Bacteria 964
735 Ga0207702_10808118 3300026078 Bacteria 927
736 Ga0207702_11331197 3300026078 Bacteria 712
737 Ga0207641_10000510 3300026088 Bacteria 43699
738 Ga0207641_10000520 3300026088 Bacteria 43187
739 Ga0207641_10104402 3300026088 Bacteria 2502
740 Ga0207641_10148643 3300026088 Bacteria 2120
741 Ga0207648_10006692 3300026089 Bacteria 11433
742 Ga0207648_10009603 3300026089 Bacteria 9254
743 Ga0207648_10125208 3300026089 Bacteria 2260
744 Ga0207676_10000180 3300026095 Bacteria 55634
745 Ga0207676_10027786 3300026095 Bacteria 4218
746 Ga0207676_10173240 3300026095 Bacteria 1882
747 Ga0207674_10003014 3300026116 Bacteria 20885
748 Ga0207674_10319372 3300026116 Bacteria 1502
749 Ga0207675_100003095 3300026118 Bacteria 16298
750 Ga0207675_100009333 3300026118 Bacteria 9197
751 Ga0207675_100047140 3300026118 Bacteria 4024
752 Ga0207683_10000082 3300026121 Bacteria 74842
753 Ga0207683_10033900 3300026121 Bacteria 4436
754 Ga0207698_10004441 3300026142 Bacteria 8548
755 Ga0207698_10012788 3300026142 Bacteria 5510
756 Ga0207698_10061873 3300026142 Bacteria 2920
757 Ga0207698_10822214 3300026142 Bacteria 932
758 Ga0209973_1020686 3300027252 Bacteria 870
759 Ga0209179_1000817 3300027512 Bacteria 3432
760 Ga0209999_1054096 3300027543 Bacteria 760
761 Ga0209970_1030290 3300027614 Bacteria 939
762 Ga0210002_1000174 3300027617 Bacteria 9399
763 Ga0209983_1018630 3300027665 Bacteria 1443
764 Ga0209971_1007808 3300027682 Bacteria 2537
765 Ga0209966_1022550 3300027695 Bacteria 1232
766 Ga0209998_10001094 3300027717 Bacteria 6774
767 Ga0209998_10009774 3300027717 Bacteria 1990
768 Ga0209998_10091589 3300027717 Bacteria 746
769 Ga0209813_10500113 3300027866 Bacteria 504
770 Ga0209974_10007090 3300027876 Bacteria 3874
771 Ga0209974_10074680 3300027876 Bacteria 1160
772 Ga0207428_10000124 3300027907 Bacteria 105795
773 Ga0207428_10015251 3300027907 Bacteria 6650
774 Ga0207428_10138438 3300027907 Bacteria 1860
775 Ga0207428_10259025 3300027907 Bacteria 1296
776 Ga0207428_11139371 3300027907 Bacteria 544
777 Ga0265357_1001399 3300028023 Bacteria 1760
778 Ga0268266_10064600 3300028379 Bacteria 3162
779 Ga0268266_10218902 3300028379 Bacteria 1749
780 Ga0268265_10000978 3300028380 Bacteria 26064
781 Ga0268265_10078035 3300028380 Bacteria 2603
782 Ga0268265_10606912 3300028380 Bacteria 1046
783 Ga0268265_11602369 3300028380 Bacteria 656
784 Ga0268264_10001059 3300028381 Bacteria 27314
785 Ga0268264_10088953 3300028381 Bacteria 2658
786 Ga0268264_10224624 3300028381 Bacteria 1731
787 Ga0268264_10420473 3300028381 Bacteria 1289
788 Ga0268264_10617943 3300028381 Bacteria 1070
789 Ga0268264_10700074 3300028381 Bacteria 1006
790 Ga0265337_1001961 3300028556 Bacteria 9778
791 Ga0265334_10049477 3300028573 Bacteria 1617
792 Ga0265334_10121145 3300028573 Bacteria 935
793 Ga0265336_10230925 3300028666 Bacteria 549
794 Ga0265338_10077624 3300028800 Bacteria 2806
795 Ga0265763_1000209 3300030763 Bacteria 3209
796 Ga0265760_10009953 3300031090 Bacteria 2712
797 Ga0265330_10007239 3300031235 Bacteria 5426
798 Ga0265332_10195315 3300031238 Bacteria 842
799 Ga0265332_10491967 3300031238 Bacteria 508
800 Ga0265325_10000509 3300031241 Bacteria 28185
801 Ga0265325_10001196 3300031241 Bacteria 18484
802 Ga0265325_10003976 3300031241 Bacteria 9460
803 Ga0265325_10049914 3300031241 Bacteria 2157
804 Ga0265325_10146426 3300031241 Bacteria 1120
805 Ga0265325_10349933 3300031241 Bacteria 653
806 Ga0265340_10108944 3300031247 Bacteria 1281
807 Ga0265340_10346147 3300031247 Bacteria 657
808 Ga0265340_10567539 3300031247 Bacteria 500
809 Ga0265339_10010967 3300031249 Bacteria 5603
810 Ga0265339_10026893 3300031249 Bacteria 3290
811 Ga0265339_10053595 3300031249 Bacteria 2193
812 Ga0265331_10022996 3300031250 Bacteria 3173
813 Ga0265316_10173183 3300031344 Bacteria 1609
814 Ga0265316_10416941 3300031344 Bacteria 966
815 Ga0265316_11305858 3300031344 Bacteria 501
816 Ga0265313_10000041 3300031595 Bacteria 119119
817 Ga0265313_10001711 3300031595 Bacteria 20204
818 Ga0265313_10015078 3300031595 Bacteria 4528
819 Ga0265313_10030972 3300031595 Bacteria 2747
820 Ga0265313_10047125 3300031595 Bacteria 2088
821 Ga0265313_10236859 3300031595 Bacteria 748
822 Ga0265313_10383279 3300031595 Bacteria 553
823 Ga0316579_10098314 3300031691 Bacteria 1400
824 Ga0265314_10000279 3300031711 Bacteria 74300
825 Ga0265314_10136672 3300031711 Bacteria 1521
826 Ga0265342_10001581 3300031712 Bacteria 21006
827 Ga0265342_10033881 3300031712 Bacteria 3136
828 Ga0307410_12041757 3300031852 Bacteria 512
829 Ga0307406_10588302 3300031901 Bacteria 916
830 Ga0316593_10226911 3300032168 Bacteria 695
831 Ga0373930_0000118 3300034816 Bacteria 8485
832 Ga0373930_0121893 3300034816 Bacteria 635
833 Ga0373948_0000147 3300034817 Bacteria 7624
834 Ga0373950_0003340 3300034818 Bacteria 2287
835 Ga0373950_0138078 3300034818 Bacteria 550
836 Ga0373958_0000218 3300034819 Bacteria 6759
837 Ga0373958_0153466 3300034819 Bacteria 578
838 Ga0373959_0012047 3300034820 Bacteria 1537
839 Ga0373938_0000294 3300034957 Bacteria 8054
840 Ga0373938_0000477 3300034957 Bacteria 6479
841 Ga0373928_0000248 3300035084 Bacteria 10645
842 Ga0373928_0002106 3300035084 Bacteria 3885
843 Ga0373929_0000807 3300035085 Bacteria 6099
844 Ga0373929_0001120 3300035085 Bacteria 5199
845 Ga0373934_0036336 3300035086 Bacteria 1941
846 Ga0373940_0000051 3300035088 Bacteria 13180
847 Ga0373940_0005015 3300035088 Bacteria 2841
848 Ga0373940_0027031 3300035088 Bacteria 1505
849 Ga0373944_0112597 3300035089 Bacteria 930
850 Ga0373944_0119779 3300035089 Bacteria 906
851 Ga0373949_0000838 3300035090 Bacteria 9815
852 Ga0373951_0000405 3300035091 Bacteria 12741
853 Ga0373951_0002198 3300035091 Bacteria 4963
854 Ga0373951_0206332 3300035091 Bacteria 575
855 Ga0373952_0002594 3300035092 Bacteria 3255
856 Ga0373952_0003584 3300035092 Bacteria 2798
857 Ga0373952_0081086 3300035092 Bacteria 828
858 Ga0373932_0001096 3300035112 Bacteria 7812
859 Ga0373932_0001105 3300035112 Bacteria 7777
860 Ga0373932_0255053 3300035112 Bacteria 641
861 Ga0373936_0312550 3300035113 Bacteria 711
862 Ga0373939_0004371 3300035114 Bacteria 3337
863 Ga0373939_0414539 3300035114 Bacteria 560
864 Ga0373941_0000393 3300035115 Bacteria 8708
865 Ga0373941_0008857 3300035115 Bacteria 2517
866 Ga0373941_0009336 3300035115 Bacteria 2467
867 Ga0373941_0011239 3300035115 Bacteria 2309
868 Ga0373941_0308690 3300035115 Bacteria 633
869 Ga0373945_0015433 3300035116 Bacteria 2570
870 Ga0373953_0514042 3300035117 Bacteria 531
871 Ga0373954_0020414 3300035118 Bacteria 2997
872 Ga0373954_0065353 3300035118 Bacteria 1721
873 Ga0373956_0004278 3300035119 Bacteria 5739
874 Ga0373957_0024142 3300035120 Bacteria 2181
875 Ga0373960_0000511 3300035121 Bacteria 7752
876 Ga0373960_0028221 3300035121 Bacteria 1547
877 Ga0373943_0004745 3300035170 Bacteria 6144
878 Ga0373943_0143775 3300035170 Bacteria 1287
879 Ga0373946_0025903 3300035171 Bacteria 2309
880 Ga0373946_0075573 3300035171 Bacteria 1465
881 Ga0373955_0017240 3300035172 Bacteria 3570
882 Ga0373955_0054666 3300035172 Bacteria 2184
883 Ga0373955_0199534 3300035172 Bacteria 1191
884 Ga0373955_0261309 3300035172 Bacteria 1039
885 Ga0373942_0001831 3300035207 Bacteria 5373
886 Ga0373942_0112156 3300035207 Bacteria 844
887 Ga0373961_0001733 3300035241 Bacteria 6067
888 Ga0373961_0002011 3300035241 Bacteria 5449
889 Ga0373961_0060382 3300035241 Bacteria 1149
890 Ga0373962_0000743 3300035242 Bacteria 7389
891 Ga0373962_0000854 3300035242 Bacteria 6947
892 Ga0373924_0010093 3300035410 Bacteria 3476
893 Ga0373924_0025325 3300035410 Bacteria 2346
894 Ga0373924_0093949 3300035410 Bacteria 1285
895 Ga0373924_0492480 3300035410 Bacteria 551
896 Ga0373931_0001777 3300035691 Bacteria 9368
897 Ga0373931_0004621 3300035691 Bacteria 6294
898 Ga0373931_0011132 3300035691 Bacteria 4339
899 Ga0373931_0215235 3300035691 Bacteria 1154
900 Ga0373935_0033552 3300035692 Bacteria 3195
901 Ga0373935_0039088 3300035692 Bacteria 2973
902 Ga0373935_1037936 3300035692 Bacteria 609
903 Ga0373927_0119529 3300035695 Bacteria 1720
904 Ga0373927_0389252 3300035695 Bacteria 919
905 Ga0373933_0004332 3300035724 Bacteria 7794
906 Ga0373933_0019915 3300035724 Bacteria 3798
907 Ga0373947_0131433 3300035725 Bacteria 1598
908 Ga0373937_0002645 3300036401 Bacteria 14924
909 Ga0373937_0009243 3300036401 Bacteria 8556
910 Ga0373937_0052641 3300036401 Bacteria 3733
911 Ga0373937_0157317 3300036401 Bacteria 2130
912 Ga0373937_0350132 3300036401 Bacteria 1399
913 Ga0373937_0689674 3300036401 Bacteria 968
914 Ga0373937_0729764 3300036401 Bacteria 938
915 Ga0373937_1330799 3300036401 Bacteria 666
916 Ga0265778_063297 3300036457 Bacteria 519
917 Ga0373925_0057613 3300037068 Bacteria 2911
918 Ga0373925_0061622 3300037068 Bacteria 2818
919 Ga0373925_0199946 3300037068 Bacteria 1589
920 Ga0395899_0062467 3300037312 Bacteria 2743
921 Ga0395900_0011017 3300037418 Bacteria 9242
922 Ga0395900_0344456 3300037418 Bacteria 1465
923 Ga0395898_0045263 3300037466 Bacteria 4326
924 Ga0395898_0315549 3300037466 Bacteria 1491
925 Ga0395898_0473096 3300037466 Bacteria 1192
926 Ga0436364_1067547 3300037853 Bacteria 515
927 Ga0395901_0258334 3300038443 Bacteria 1813
928 Ga0395901_0349872 3300038443 Bacteria 1525
929 Ga0395901_0353972 3300038443 Bacteria 1515
930 Ga0242420_005485 3300038996 Bacteria 1970
931 Ga0436365_0616428 3300039437 Bacteria 777
932 Ga0436361_0247770 3300039447 Bacteria 602
933 Ga0436361_0579909 3300039447 Bacteria 7228
934 Ga0436363_0136452 3300039450 Bacteria 1242
935 Ga0436363_1129005 3300039450 Bacteria 538
936 Ga0436362_0351535 3300039453 Bacteria 875
937 Ga0436362_0962350 3300039453 Bacteria 505
938 Ga0436362_1240385 3300039453 Bacteria 618
939 Ga0451800_0035694 3300041459 Bacteria 598
940 Ga0451800_0736633 3300041459 Bacteria 591
941 Ga0451835_0584884 3300041492 Bacteria 612
942 Ga0451839_0392821 3300041496 Bacteria 523
943 Ga0439448_0056883 3300042005 Bacteria 1288
944 Ga0439448_0239883 3300042005 Bacteria 639
945 Ga0439458_0157834 3300042157 Bacteria 610
946 Ga0439459_0208341 3300042438 Bacteria 537
947 Ga0439464_0083279 3300042439 Bacteria 957
948 Ga0439460_0187684 3300042461 Bacteria 700
949 Ga0451577_0373251 3300042876 Bacteria 1294
950 Ga0453683_0118949 3300044673 Bacteria 1663
951 Ga0453684_0071365 3300044712 Bacteria 4391
952 Ga0453684_1537615 3300044712 Bacteria 685
953 Ga0451576_0019986 3300045051 Bacteria 7300
954 Ga0466958_0248237 3300045836 Bacteria 1138
955 Ga0466967_2211268 3300045976 Bacteria 546
956 Ga0466967_2549088 3300045976 Bacteria 506
957 Ga0495592_0009683 3300046454 Bacteria 7254
958 Ga0495592_0307661 3300046454 Bacteria 1028
959 Ga0495603_0020013 3300046455 Bacteria 4055
960 Ga0495603_0081080 3300046455 Bacteria 1901
961 Ga0495629_0062377 3300046459 Bacteria 2604
962 Ga0495641_0015691 3300046461 Bacteria 4026
963 Ga0495651_0021682 3300046462 Bacteria 4994
964 Ga0495651_0044807 3300046462 Bacteria 3428
965 Ga0495651_0775217 3300046462 Bacteria 593
966 Ga0495653_0083353 3300046463 Bacteria 2358
967 Ga0495580_0139053 3300046472 Bacteria 1684
968 Ga0495582_0019377 3300046473 Bacteria 3719
969 Ga0495582_0129947 3300046473 Bacteria 1423
970 Ga0495639_0718314 3300046475 Bacteria 516
971 Ga0495664_0158039 3300046477 Bacteria 1375
972 Ga0495584_0055059 3300046491 Bacteria 2002
973 Ga0495585_0053446 3300046492 Bacteria 2235
974 Ga0495607_0406501 3300046501 Bacteria 618
975 Ga0495608_0055137 3300046511 Bacteria 2627
976 Ga0495608_0223541 3300046511 Bacteria 1180
977 Ga0495616_0242169 3300046513 Bacteria 778
978 Ga0495628_0004222 3300046516 Bacteria 12768
979 Ga0495628_0037655 3300046516 Bacteria 3878
980 Ga0495630_0316306 3300046517 Bacteria 1193
981 Ga0495630_0492766 3300046517 Bacteria 940
982 Ga0495630_0529200 3300046517 Bacteria 904
983 Ga0495630_0626457 3300046517 Bacteria 824
984 Ga0495637_0050965 3300046520 Bacteria 1735
985 Ga0495637_0136346 3300046520 Bacteria 934
986 Ga0495644_0098352 3300046523 Bacteria 1107
987 Ga0495666_0047392 3300046526 Bacteria 2070
988 Ga0495652_0080227 3300046529 Bacteria 2696
989 Ga0495665_0353835 3300046531 Bacteria 748
990 Ga0495640_0075222 3300046533 Bacteria 2256
991 Ga0495640_0299538 3300046533 Bacteria 999
992 Ga0495587_0037722 3300046536 Bacteria 2900
993 Ga0495598_0121299 3300046537 Bacteria 886
994 Ga0495598_0397650 3300046537 Bacteria 538
995 Ga0495645_0002519 3300046543 Bacteria 12436
996 Ga0495622_0329250 3300046557 Bacteria 663
997 Ga0495622_0393721 3300046557 Bacteria 597
998 Ga0495633_0517988 3300046558 Bacteria 537
999 Ga0495667_0026210 3300046559 Bacteria 3927
1000 Ga0495667_0163302 3300046559 Bacteria 1432
1001 Ga0495667_0375738 3300046559 Bacteria 896
1002 Ga0495656_0016742 3300046615 Bacteria 2786
1003 Ga0495656_0103963 3300046615 Bacteria 1318
1004 Ga0495668_0394447 3300046616 Bacteria 760
1005 Ga0495634_0206818 3300046642 Bacteria 1217
1006 Ga0495611_0083705 3300046648 Bacteria 1470
1007 Ga0495635_0175416 3300046663 Bacteria 1457
1008 Ga0495635_0464909 3300046663 Bacteria 835
1009 Ga0495659_0068421 3300046664 Bacteria 1326
1010 Ga0495659_0249601 3300046664 Bacteria 739
1011 Ga0495588_0474246 3300046674 Bacteria 656
1012 Ga0495657_0110975 3300046675 Bacteria 1737
1013 Ga0495657_0170385 3300046675 Bacteria 1341
1014 Ga0495623_0023287 3300046679 Bacteria 3997
1015 Ga0495623_0483751 3300046679 Bacteria 655
1016 Ga0495646_0125228 3300046680 Bacteria 1451
1017 Ga0495646_0626367 3300046680 Bacteria 545
1018 Ga0495658_0025976 3300046683 Bacteria 3134
1019 Ga0495658_0354166 3300046683 Bacteria 933
1020 Ga0495658_0560829 3300046683 Bacteria 731
1021 Ga0495669_0127381 3300046684 Bacteria 1197
1022 Ga0495613_0067248 3300046689 Bacteria 2616
1023 Ga0495624_0080758 3300046690 Bacteria 2015
1024 Ga0495670_0019861 3300046691 Bacteria 3311
1025 Ga0495600_0005701 3300046809 Bacteria 7520
1026 Ga0495600_0180746 3300046809 Bacteria 1359
1027 Ga0495600_0278096 3300046809 Bacteria 1060
1028 Ga0495581_0168421 3300047315 Bacteria 1281
1029 Ga0495604_0043855 3300047317 Bacteria 3498
1030 Ga0495604_0097720 3300047317 Bacteria 2165
1031 Ga0495674_0344519 3300047319 Bacteria 1210
1032 Ga0495674_0588163 3300047319 Bacteria 883
1033 Ga0495672_0140285 3300047320 Bacteria 1263
1034 Ga0495672_0237686 3300047320 Bacteria 891
1035 Ga0495672_0281978 3300047320 Bacteria 794
1036 Ga0495676_0159626 3300047321 Bacteria 1596
1037 Ga0495680_0246378 3300047322 Bacteria 1267
1038 Ga0495683_0420002 3300047323 Bacteria 553
1039 Ga0495675_0355864 3300047444 Bacteria 860
1040 Ga0495675_0669571 3300047444 Bacteria 583
1041 Ga0495677_0265836 3300047445 Bacteria 672
1042 Ga0495684_0047124 3300047471 Bacteria 3298
1043 Ga0495602_0021067 3300048088 Bacteria 6426
1044 Ga0495602_0024507 3300048088 Bacteria 5853
1045 Ga0495602_0257571 3300048088 Bacteria 1296
1046 Ga0495626_0094052 3300048091 Bacteria 1315
1047 Ga0496100_0000057 3300048903 Bacteria 67216
1048 Ga0496100_0120830 3300048903 Bacteria 1832
1049 Ga0496100_1049295 3300048903 Bacteria 642
1050 Ga0496100_1473203 3300048903 Bacteria 537
1051 Ga0496101_0005881 3300048904 Bacteria 7853
1052 Ga0496101_0017927 3300048904 Bacteria 4806
1053 Ga0496101_0077727 3300048904 Bacteria 2446
1054 Ga0496101_0279110 3300048904 Bacteria 1305
1055 Ga0496101_1155290 3300048904 Bacteria 607
1056 Ga0496102_0000811 3300048905 Bacteria 30408
1057 Ga0496102_0004777 3300048905 Bacteria 11462
1058 Ga0496102_0016603 3300048905 Bacteria 6437
1059 Ga0496102_0036109 3300048905 Bacteria 4451
1060 Ga0496102_0574228 3300048905 Bacteria 1050
1061 Ga0496103_0000157 3300048906 Bacteria 71452
1062 Ga0496103_0012065 3300048906 Bacteria 5133
1063 Ga0496103_0013686 3300048906 Bacteria 4813
1064 Ga0496103_0047937 3300048906 Bacteria 2640
1065 Ga0496104_0000792 3300048907 Bacteria 27082
1066 Ga0496104_0000840 3300048907 Bacteria 26510
1067 Ga0496104_0001594 3300048907 Bacteria 19522
1068 Ga0496104_0036268 3300048907 Bacteria 4610
1069 Ga0496104_0041302 3300048907 Bacteria 4325
1070 Ga0496104_0054936 3300048907 Bacteria 3764
1071 Ga0496105_0001180 3300048908 Bacteria 18193
1072 Ga0496105_0028643 3300048908 Bacteria 4555
1073 Ga0496105_0045897 3300048908 Bacteria 3605
1074 Ga0496105_0062694 3300048908 Bacteria 3068
1075 Ga0496105_0091222 3300048908 Bacteria 2516
1076 Ga0496105_0674229 3300048908 Bacteria 796
1077 Ga0496105_1233585 3300048908 Bacteria 549
1078 Ga0496106_0001727 3300048909 Bacteria 16302
1079 Ga0496106_0003682 3300048909 Bacteria 11426
1080 Ga0496106_0018620 3300048909 Bacteria 5139
1081 Ga0496106_0021095 3300048909 Bacteria 4836
1082 Ga0496106_0333446 3300048909 Bacteria 1218
1083 Ga0496106_0542352 3300048909 Bacteria 933
1084 Ga0496107_0000249 3300048910 Bacteria 28499
1085 Ga0496107_0032231 3300048910 Bacteria 3745
1086 Ga0496107_0065707 3300048910 Bacteria 2630
1087 Ga0496108_0002560 3300048911 Bacteria 14562
1088 Ga0496108_0013756 3300048911 Bacteria 6601
1089 Ga0496108_0316431 3300048911 Bacteria 1360
1090 Ga0496108_0475724 3300048911 Bacteria 1091
1091 Ga0496108_1371472 3300048911 Bacteria 592
1092 Ga0496109_0025700 3300048912 Bacteria 5248
1093 Ga0496109_0028830 3300048912 Bacteria 4969
1094 Ga0496109_0050950 3300048912 Bacteria 3770
1095 Ga0496109_0058427 3300048912 Bacteria 3522
1096 Ga0496109_0073150 3300048912 Bacteria 3149
1097 Ga0496109_0180457 3300048912 Bacteria 1982
1098 Ga0496109_0185743 3300048912 Bacteria 1953
1099 Ga0496110_0002431 3300048913 Bacteria 13955
1100 Ga0496110_0003026 3300048913 Bacteria 12758
1101 Ga0496110_0056946 3300048913 Bacteria 3440
1102 Ga0496110_0529537 3300048913 Bacteria 1072
1103 Ga0496111_0010279 3300048914 Bacteria 6270
1104 Ga0496111_0047176 3300048914 Bacteria 3102
1105 Ga0496111_0087220 3300048914 Bacteria 2284
1106 Ga0496111_0194169 3300048914 Bacteria 1509
1107 Ga0496112_0001894 3300048915 Bacteria 16508
1108 Ga0496112_0010777 3300048915 Bacteria 8314
1109 Ga0496112_0029462 3300048915 Bacteria 5309
1110 Ga0496112_0035169 3300048915 Bacteria 4877
1111 Ga0496112_0043146 3300048915 Bacteria 4415
1112 Ga0496112_1509437 3300048915 Bacteria 586
1113 Ga0496113_0038315 3300048916 Bacteria 3524
1114 Ga0496113_0039016 3300048916 Bacteria 3494
1115 Ga0496113_0190854 3300048916 Bacteria 1626
1116 Ga0496114_0012603 3300048917 Bacteria 6773
1117 Ga0496114_0188577 3300048917 Bacteria 1803
1118 Ga0496115_0063399 3300048918 Bacteria 2982
1119 Ga0496115_0213067 3300048918 Bacteria 1595
1120 Ga0501031_0233663 3300049568 Bacteria 1196
1121 Ga0501032_0029827 3300049569 Bacteria 3741
1122 Ga0501033_0039201 3300049570 Bacteria 3539
1123 Ga0501033_0208373 3300049570 Bacteria 1395
1124 Ga0501033_0459726 3300049570 Bacteria 883
1125 Ga0501033_0519123 3300049570 Bacteria 823
1126 Ga0501033_0754706 3300049570 Bacteria 660
1127 Ga0501034_0083101 3300049571 Bacteria 3204
1128 Ga0501034_0087563 3300049571 Bacteria 3114
1129 Ga0501034_0118751 3300049571 Bacteria 2631
1130 Ga0501034_0119406 3300049571 Bacteria 2623
1131 Ga0501034_0310777 3300049571 Bacteria 1511
1132 Ga0501034_1154619 3300049571 Bacteria 654
1133 Ga0501036_0146116 3300049572 Bacteria 1994
1134 Ga0501036_0841049 3300049572 Bacteria 755
1135 Ga0501037_0059247 3300049573 Bacteria 2794
1136 Ga0501038_0050290 3300049574 Bacteria 3601
1137 Ga0501038_0164255 3300049574 Bacteria 1802
1138 Ga0501038_0265235 3300049574 Bacteria 1356
1139 Ga0501039_0088018 3300049575 Bacteria 2420
1140 Ga0501039_0266052 3300049575 Bacteria 1347
1141 Ga0501039_1488693 3300049575 Bacteria 520
1142 Ga0501041_0245691 3300049577 Bacteria 1125
1143 Ga0501043_0014810 3300049579 Bacteria 6106
1144 Ga0501046_0065399 3300049580 Bacteria 2837
1145 Ga0501047_0005189 3300049581 Bacteria 12227
1146 Ga0501047_0100372 3300049581 Bacteria 2773
1147 Ga0501047_0156062 3300049581 Bacteria 2156
1148 Ga0501068_0081659 3300049584 Bacteria 1984
1149 Ga0501068_0712416 3300049584 Bacteria 656
1150 Ga0501069_0003606 3300049585 Bacteria 7974
1151 Ga0501069_0022685 3300049585 Bacteria 3418
1152 Ga0501069_0128256 3300049585 Bacteria 1452
1153 Ga0501069_0136574 3300049585 Bacteria 1405
1154 Ga0501070_0015110 3300049586 Bacteria 6499
1155 Ga0501070_0020675 3300049586 Bacteria 5522
1156 Ga0501070_0026876 3300049586 Bacteria 4827
1157 Ga0501070_0068827 3300049586 Bacteria 2930
1158 Ga0501070_0161831 3300049586 Bacteria 1845
1159 Ga0501070_0174248 3300049586 Bacteria 1771
1160 Ga0501071_0148718 3300049587 Bacteria 1746
1161 Ga0501071_0632859 3300049587 Bacteria 823
1162 Ga0501072_0130193 3300049588 Bacteria 2005
1163 Ga0501072_0210917 3300049588 Bacteria 1548
1164 Ga0501072_0292044 3300049588 Bacteria 1296
1165 Ga0501072_0385028 3300049588 Bacteria 1113
1166 Ga0501072_0907359 3300049588 Bacteria 688
1167 Ga0501073_0039712 3300049589 Bacteria 3333
1168 Ga0501073_0062898 3300049589 Bacteria 2588
1169 Ga0501073_0266715 3300049589 Bacteria 1181
1170 Ga0501074_0085558 3300049590 Bacteria 2259
1171 Ga0501074_0992221 3300049590 Bacteria 590
1172 Ga0501075_1244635 3300049591 Bacteria 564
1173 Ga0501076_0340756 3300049592 Bacteria 1230
1174 Ga0501077_0009150 3300049593 Bacteria 6152
1175 Ga0501079_0544708 3300049741 Bacteria 912
1176 Ga0501080_0018469 3300049742 Bacteria 6453
1177 Ga0501080_0217399 3300049742 Bacteria 1750
1178 Ga0501080_0366696 3300049742 Bacteria 1299
1179 Ga0501080_0381438 3300049742 Bacteria 1270
1180 Ga0501080_0534238 3300049742 Bacteria 1045
1181 Ga0501081_0453256 3300049743 Bacteria 953
1182 Ga0501081_1022000 3300049743 Bacteria 625
1183 Ga0501081_1319133 3300049743 Bacteria 547
1184 Ga0501083_0658106 3300049744 Bacteria 681
1185 Ga0501083_1058847 3300049744 Bacteria 528
1186 Ga0501035_0090691 3300049822 Bacteria 2690
1187 Ga0501035_0140637 3300049822 Bacteria 2099
1188 Ga0501035_0156001 3300049822 Bacteria 1978
1189 Ga0501044_0112198 3300049823 Bacteria 2734
1190 Ga0501044_0119848 3300049823 Bacteria 2633
1191 Ga0501044_0243255 3300049823 Bacteria 1742
1192 Ga0501044_0288828 3300049823 Bacteria 1572
1193 nmdc:mga00v17_37235_c1 3300050491 Bacteria 1780
1194 nmdc:mga0yw44_130861_c1 3300050492 Bacteria 1624
1195 nmdc:mga0yw44_18223_c1 3300050492 Bacteria 3840
1196 nmdc:mga0yw44_25992_c1 3300050492 Bacteria 3338
1197 nmdc:mga0yw44_3959_c1 3300050492 Bacteria 6683
1198 nmdc:mga06z11_181447_c1 3300050494 Bacteria 1214
1199 nmdc:mga06z11_331359_c1 3300050494 Bacteria 909
1200 nmdc:mga06z11_34869_c1 3300050494 Bacteria 1432
1201 nmdc:mga06z11_458430_c1 3300050494 Bacteria 771
1202 nmdc:mga04h51_454439_c1 3300050495 Bacteria 542
1203 nmdc:mga07m45_101399_c1 3300050496 Bacteria 1653
1204 nmdc:mga07m45_397872_c1 3300050496 Bacteria 799
1205 nmdc:mga05p37_211988_c1 3300050507 Bacteria 2341
1206 nmdc:mga05p37_290041_c1 3300050507 Bacteria 1948
1207 nmdc:mga05p37_331809_c1 3300050507 Bacteria 1796
1208 nmdc:mga05p37_4262_c1 3300050507 Bacteria 16709
1209 nmdc:mga05p37_44681_c1 3300050507 Bacteria 5451
1210 nmdc:mga05p37_45_c1 3300050507 Bacteria 81140
1211 nmdc:mga05p37_502323_c1 3300050507 Bacteria 1391
1212 nmdc:mga05p37_96872_c1 3300050507 Bacteria 3635
1213 nmdc:mga09592_232235_c1 3300050508 Bacteria 1598
1214 nmdc:mga09592_603_c1 3300050508 Bacteria 27289
1215 nmdc:mga0qj67_1399_c1 3300050509 Bacteria 16928
1216 nmdc:mga0qj67_156066_c1 3300050509 Bacteria 1852
1217 nmdc:mga0qj67_197942_c1 3300050509 Bacteria 1633
1218 nmdc:mga0qj67_64_c1 3300050509 Bacteria 77795
1219 nmdc:mga0qj67_678760_c1 3300050509 Bacteria 821
1220 nmdc:mga0qj67_797208_c1 3300050509 Bacteria 748
1221 nmdc:mga06r32_127948_c1 3300050510 Bacteria 2510
1222 nmdc:mga06r32_227_c1 3300050510 Bacteria 45651
1223 nmdc:mga06r32_261434_c1 3300050510 Bacteria 1718
1224 nmdc:mga06r32_392566_c1 3300050510 Bacteria 1370
1225 nmdc:mga06r32_774467_c1 3300050510 Bacteria 921
1226 nmdc:mga06r32_77843_c1 3300050510 Bacteria 3222
1227 nmdc:mga08y16_182633_c1 3300050511 Bacteria 2178
1228 nmdc:mga08y16_210179_c1 3300050511 Bacteria 2015
1229 nmdc:mga08y16_278488_c1 3300050511 Bacteria 1726
1230 nmdc:mga08y16_2912_c1 3300050511 Bacteria 17615
1231 nmdc:mga08y16_36270_c1 3300050511 Bacteria 5178
1232 nmdc:mga08y16_647967_c1 3300050511 Bacteria 1061
1233 nmdc:mga0n895_1201316_c1 3300050512 Bacteria 732
1234 nmdc:mga0n895_162111_c1 3300050512 Bacteria 2268
1235 nmdc:mga0n895_1904_c1 3300050512 Bacteria 15972
1236 nmdc:mga0n895_363034_c1 3300050512 Bacteria 1466
1237 nmdc:mga0n895_363051_c1 3300050512 Bacteria 1466
1238 nmdc:mga0n895_38352_c1 3300050512 Bacteria 4642
1239 nmdc:mga0n895_465601_c1 3300050512 Bacteria 1275
1240 nmdc:mga0n895_50_c1 3300050512 Bacteria 71634
1241 nmdc:mga0n895_6291_c1 3300050512 Bacteria 10065
1242 nmdc:mga0rr50_1115334_c1 3300050513 Bacteria 671
1243 nmdc:mga0rr50_1389383_c1 3300050513 Bacteria 594
1244 nmdc:mga0rr50_15896_c1 3300050513 Bacteria 4980
1245 nmdc:mga0rr50_1666802_c1 3300050513 Bacteria 538
1246 nmdc:mga0rr50_26811_c1 3300050513 Bacteria 4028
1247 nmdc:mga0rr50_555701_c1 3300050513 Bacteria 977
1248 nmdc:mga08x19_253586_c1 3300050514 Bacteria 1215
1249 nmdc:mga08x19_368404_c1 3300050514 Bacteria 1005
1250 nmdc:mga08x19_396684_c1 3300050514 Bacteria 967
1251 nmdc:mga0a205_114890_c1 3300050515 Bacteria 2590
1252 nmdc:mga0a205_141084_c1 3300050515 Bacteria 2310
1253 nmdc:mga0a205_175889_c1 3300050515 Bacteria 2036
1254 nmdc:mga0a205_244219_c1 3300050515 Bacteria 1676
1255 nmdc:mga0a205_590_c1 3300050515 Bacteria 28771
1256 Ga0495601_0000204 3300053077 Bacteria 31605
1257 Ga0495601_0001005 3300053077 Bacteria 15446
1258 Ga0495601_0006777 3300053077 Bacteria 6710
1259 Ga0495612_0008601 3300053078 Bacteria 4140
1260 Ga0495612_0051445 3300053078 Bacteria 1693
1261 Ga0495612_0152367 3300053078 Bacteria 1006
1262 Ga0495612_0286871 3300053078 Bacteria 736
1263 Ga0495655_0003346 3300053083 Bacteria 2638
1264 Ga0495595_0000987 3300053084 Bacteria 10965
1265 Ga0495595_0005693 3300053084 Bacteria 5045
1266 Ga0495595_0017766 3300053084 Bacteria 3064
1267 Ga0495595_0177558 3300053084 Bacteria 1055
1268 Ga0495595_0193573 3300053084 Bacteria 1011
1269 Ga0495619_0000161 3300053085 Bacteria 49400
1270 Ga0495619_0052589 3300053085 Bacteria 2692
1271 Ga0495619_0055201 3300053085 Bacteria 2630
1272 Ga0495619_0079035 3300053085 Bacteria 2212
1273 Ga0495619_0176094 3300053085 Bacteria 1479
1274 Ga0495619_0660973 3300053085 Bacteria 712
1275 Ga0500650_0089345 3300053098 Bacteria 1442
1276 Ga0500595_008009 3300053119 Bacteria 4339
1277 Ga0500642_0322701 3300053130 Bacteria 692
1278 Ga0500652_000030 3300053131 Bacteria 90754
1279 Ga0500636_0022315 3300053177 Bacteria 3747
1280 Ga0501084_0021548 3300054114 Bacteria 5372
1281 Ga0501084_0580339 3300054114 Bacteria 947
1282 Ga0501084_0635436 3300054114 Bacteria 901
1283 Ga0501084_1259474 3300054114 Bacteria 620
1284 Ga0587082_070358 3300059504 Bacteria 709
1285 Ga0587115_051489 3300059626 Bacteria 670
1286 Ga0501082_0046844 3300060353 Bacteria 3726
1287 Ga0501082_0122057 3300060353 Bacteria 2259
1288 Ga0466962_0126698 3300061719 Bacteria 1233
1289 2513589046 2513237087 Bacteria 5817514
1290 Ga0501047_0798992
1291 RicEn_FSXC31522_g1
1292 SwRhRL2b_contig_1160324
1293 2214856312
1294 ARcpr5oldR_c000194
1295 ARSoilYngRDRAFT_c00073
1296 ARcpr5yngRDRAFT_c000011
1297 ARSoilOldRDRAFT_c000062
1298 ARCol0oldRDRAFT_c01014
1299 CNAas_1016385
1300 ARCol0yngRDRAFT_1000112
1301 JGI24736J21556_1069610
1302 JGI24741J21665_1028932
1303 JGI24752J21851_1006533
1304 JGI24752J21851_1016439
1305 JGI24746J21847_1000121
1306 JGI24746J21847_1010940
1307 JGI24747J21853_1000764
1308 JGI24747J21853_1003096
1309 JGI24740J21852_10038498
1310 JGI24739J22299_10000577
1311 JGI24739J22299_10114825
1312 JGI24737J22298_10001844
1313 JGI24737J22298_10002151
1314 JGI24737J22298_10033220
1315 JGI24743J22301_10004095
1316 JGI24743J22301_10053149
1317 JGI24735J21928_10118417
1318 JGI24750J21931_1000727
1319 JGI24750J21931_1002396
1320 JGI24750J21931_1002707
1321 JGI24750J21931_1003125
1322 JGI24745J21846_1000168
1323 JGI24748J21848_1000471
1324 JGI24748J21848_1002811
1325 JGI24748J21848_1044948
1326 JGI24738J21930_10002477
1327 JGI24738J21930_10018559
1328 JGI24749J21850_1000640
1329 JGI24744J21845_10001158
1330 JGI24744J21845_10019183
1331 JGI24035J26624_1000108
1332 JGI24033J26618_1029646
1333 JGI24034J26672_10001081
1334 JGI24034J26672_10002728
1335 JGI24034J26672_10041848
1336 JGI24034J26672_10105674
1337 JGI24742J22300_10000221
1338 JGI24742J22300_10005895
1339 JGI24751J29686_10053936
1340 JGI24751J29686_10071636
1341 JGI24751J29686_10081010
1342 Ga0007429J51699_1018610
1343 JGI25405J52794_10012179
1344 JGI25405J52794_10021951
1345 JGI25405J52794_10028338
1346 JGI25405J52794_10040778
1347 JGI25405J52794_10084674
1348 Ga0058859_10055373
1349 Ga0058863_11869705
1350 Ga0058861_10076840
1351 Ga0058860_10020217
1352 Ga0058860_12156334
1353 Ga0058862_12566060
1354 Ga0065717_1003715
1355 Ga0065716_1001732
1356 Ga0065704_10080111
1357 Ga0065704_10581893
1358 Ga0065712_10002317
1359 Ga0065712_10068922
1360 Ga0065712_10074824
1361 Ga0065715_10000683
1362 Ga0065715_10004478
1363 Ga0065715_10377521
1364 Ga0065715_10666809
1365 Ga0065707_10181444
1366 Ga0070658_10074579
1367 Ga0070658_10369815
1368 Ga0070676_10000260
1369 Ga0070676_10045650
1370 Ga0070683_100015534
1371 Ga0070683_100385387
1372 Ga0070690_100003067
1373 Ga0070690_100006162
1374 Ga0070690_100034811
1375 Ga0070670_100001716
1376 Ga0070670_100032751
1377 Ga0070670_100054447
1378 Ga0070670_100298933
1379 Ga0070677_10000049
1380 Ga0070677_10210608
1381 Ga0068869_100005257
1382 Ga0068869_100496680
1383 Ga0070666_10227189
1384 Ga0070666_10735478
1385 Ga0070680_100005276
1386 Ga0070680_100005308
1387 Ga0070680_100038584
1388 Ga0070680_100103970
1389 Ga0070680_100106108
1390 Ga0070680_100403078
1391 Ga0070680_101001686
1392 Ga0070682_100001047
1393 Ga0070682_100086975
1394 Ga0070682_100221659
1395 Ga0070682_100478642
1396 Ga0068868_100003020
1397 Ga0068868_100007432
1398 Ga0068868_100548105
1399 Ga0070660_100004688
1400 Ga0070660_100014718
1401 Ga0070660_100067455
1402 Ga0070660_100282240
1403 Ga0070660_100583387
1404 Ga0070660_101257993
1405 Ga0070689_100009709
1406 Ga0070689_100011054
1407 Ga0070689_100066087
1408 Ga0070689_100166171
1409 Ga0070691_10027328
1410 Ga0070691_10057899
1411 Ga0070687_100001111
1412 Ga0070687_100040356
1413 Ga0070687_100122061
1414 Ga0070661_100000242
1415 Ga0070661_100041316
1416 Ga0070661_100191782
1417 Ga0070661_100327272
1418 Ga0070692_10001796
1419 Ga0070692_10021538
1420 Ga0070692_10385535
1421 Ga0070668_100002745
1422 Ga0070668_100072456
1423 Ga0070669_100040902
1424 Ga0070669_100068194
1425 Ga0070669_100079619
1426 Ga0070669_100441809
1427 Ga0070675_100005150
1428 Ga0070675_100067032
1429 Ga0070675_100141728
1430 Ga0070675_101505169
1431 Ga0070671_100002515
1432 Ga0070674_100019229
1433 Ga0070674_100350916
1434 Ga0070673_100001955
1435 Ga0070688_100003900
1436 Ga0070688_100006957
1437 Ga0070688_100019196
1438 Ga0070659_100011013
1439 Ga0070659_100265325
1440 Ga0070667_100080034
1441 Ga0070667_100149028
1442 Ga0070703_10033171
1443 Ga0070703_10435804
1444 Ga0070709_10176584
1445 Ga0070709_10272233
1446 Ga0070709_10423722
1447 Ga0070714_100024153
1448 Ga0070714_100070994
1449 Ga0070714_100188688
1450 Ga0070714_102194694
1451 Ga0070713_100095522
1452 Ga0070713_100387084
1453 Ga0070713_100484864
1454 Ga0070710_10254200
1455 Ga0070701_10031326
1456 Ga0070701_10080983
1457 Ga0070711_100005580
1458 Ga0070711_100392490
1459 Ga0070711_100748026
1460 Ga0070711_100896466
1461 Ga0070711_102057272
1462 Ga0070705_100260063
1463 Ga0070700_100002176
1464 Ga0070700_100065173
1465 Ga0070694_100003584
1466 Ga0070694_100007637
1467 Ga0070694_100939086
1468 Ga0070708_100019084
1469 Ga0070708_100678195
1470 Ga0070708_101511480
1471 Ga0070663_100007690
1472 Ga0070663_100184107
1473 Ga0070678_100003068
1474 Ga0070662_100003935
1475 Ga0070662_100014948
1476 Ga0070662_100068416
1477 Ga0070681_10028949
1478 Ga0070681_10048230
1479 Ga0070681_10112484
1480 Ga0070681_10151971
1481 Ga0070681_10157589
1482 Ga0070681_10703168
1483 Ga0070681_11370189
1484 Ga0068867_100011724
1485 Ga0068867_100079223
1486 Ga0068867_100273437
1487 Ga0070685_10017180
1488 Ga0070685_10109534
1489 Ga0070685_10262201
1490 Ga0070706_100808845
1491 Ga0070707_100147294
1492 Ga0070698_100404469
1493 Ga0070698_100832435
1494 Ga0074259_10076998
1495 Ga0070699_100019774
1496 Ga0070699_100162581
1497 Ga0070699_100173410
1498 Ga0070679_100008294
1499 Ga0070679_100056111
1500 Ga0070679_100067721
1501 Ga0070679_100093792
1502 Ga0070679_100129157
1503 Ga0070679_100170885
1504 Ga0070679_100181504
1505 Ga0070679_100257053
1506 Ga0070684_100006738
1507 Ga0070684_100401664
1508 Ga0070697_100158946
1509 Ga0070697_100346585
1510 Ga0068853_100102546
1511 Ga0068853_100220039
1512 Ga0068853_100317428
1513 Ga0068853_100923818
1514 Ga0070672_100000779
1515 Ga0070672_100024274
1516 Ga0070672_100188068
1517 Ga0070686_100002512
1518 Ga0070686_100051330
1519 Ga0070686_100126978
1520 Ga0070686_100234499
1521 Ga0070686_100334117
1522 Ga0070686_100800031
1523 Ga0070695_100002662
1524 Ga0070695_100072415
1525 Ga0070696_100005072
1526 Ga0070696_100081463
1527 Ga0070696_100100771
1528 Ga0070696_101773015
1529 Ga0070693_100001394
1530 Ga0070693_100111806
1531 Ga0070665_100020952
1532 Ga0070665_100304510
1533 Ga0070665_100528856
1534 Ga0070704_100022552
1535 Ga0070704_100061810
1536 Ga0070704_101408379
1537 Ga0068855_100058052
1538 Ga0068855_100077640
1539 Ga0068855_100096075
1540 Ga0068855_100174337
1541 Ga0068855_100177306
1542 Ga0068855_100228715
1543 Ga0068855_101081891
1544 Ga0068855_101143947
1545 Ga0070664_100003126
1546 Ga0070664_100067502
1547 Ga0070664_100153066
1548 Ga0070664_100703137
1549 Ga0068857_100003871
1550 Ga0068857_100131358
1551 Ga0068857_100286824
1552 Ga0068854_100005481
1553 Ga0068854_100035958
1554 Ga0068854_100220085
1555 Ga0068854_100643327
1556 Ga0068856_100006680
1557 Ga0068856_100308750
1558 Ga0068856_100396558
1559 Ga0068856_100958772
1560 Ga0068856_101083330
1561 Ga0068856_101802377
1562 Ga0070702_100000927
1563 Ga0070702_100014784
1564 Ga0070702_100132541
1565 Ga0068852_100075769
1566 Ga0068852_100229354
1567 Ga0068852_100270059
1568 Ga0068852_100339480
1569 Ga0068859_100016580
1570 Ga0068859_100092750
1571 Ga0068859_100126714
1572 Ga0068864_100000227
1573 Ga0068864_100095387
1574 Ga0068864_100364370
1575 Ga0068866_10001232
1576 Ga0068866_10087121
1577 Ga0068861_100011830
1578 Ga0068861_100042299
1579 Ga0068861_100075457
1580 Ga0068851_10048384
1581 Ga0068851_10646581
1582 Ga0068851_10766483
1583 Ga0068870_10000062
1584 Ga0068870_10000922
1585 Ga0068863_100009931
1586 Ga0068863_100050824
1587 Ga0068863_100840212
1588 Ga0068858_100009135
1589 Ga0068858_100274450
1590 Ga0068858_100470867
1591 Ga0068860_100003111
1592 Ga0068860_100012394
1593 Ga0068860_100140036
1594 Ga0068860_100167010
1595 Ga0068860_100260322
1596 Ga0068862_100014320
1597 Ga0068862_100044458
1598 Ga0068862_100093264
1599 Ga0068862_101166413
1600 Ga0081455_10000204
1601 Ga0081455_10005856
1602 Ga0081455_10009672
1603 Ga0081455_10071467
1604 Ga0081538_10063068
1605 Ga0081538_10277089
1606 Ga0081540_1006259
1607 Ga0081540_1028094
1608 Ga0081540_1031674
1609 Ga0081540_1103065
1610 Ga0081540_1337824
1611 Ga0070717_10160494
1612 Ga0070717_10783083
1613 Ga0070717_10821830
1614 Ga0070717_10853433
1615 Ga0070717_10889194
1616 Ga0075365_10005666
1617 Ga0075365_10059212
1618 Ga0075365_10199173
1619 Ga0075365_10524306
1620 Ga0075363_100524316
1621 Ga0075364_10155982
1622 Ga0075364_10191373
1623 Ga0075432_10003061
1624 Ga0070715_10093632
1625 Ga0070716_100149663
1626 Ga0070716_100839006
1627 Ga0070716_101017893
1628 Ga0070712_100001034
1629 Ga0070712_100133941
1630 Ga0070712_100446237
1631 Ga0070712_100830849
1632 Ga0070712_101132517
1633 Ga0075362_10096589
1634 Ga0075367_10273645
1635 Ga0075367_10375298
1636 Ga0075367_10606246
1637 Ga0075367_10771517
1638 Ga0075369_10445575
1639 Ga0075427_10000102
1640 Ga0097621_100000010
1641 Ga0097621_100253115
1642 Ga0075370_10300813
1643 Ga0068871_100012046
1644 Ga0068871_100027563
1645 Ga0075428_100060816
1646 Ga0075428_100072641
1647 Ga0075428_100106899
1648 Ga0075428_100116900
1649 Ga0075428_100171490
1650 Ga0075428_100676414
1651 Ga0075428_102760360
1652 Ga0075430_100000112
1653 Ga0075430_100000160
1654 Ga0075430_100046452
1655 Ga0075430_100372919
1656 Ga0075430_100420696
1657 Ga0075430_100565923
1658 Ga0075430_100675373
1659 Ga0075430_100705570
1660 Ga0075431_100003174
1661 Ga0075431_100039133
1662 Ga0075431_100078947
1663 Ga0075431_100106223
1664 Ga0075431_100254396
1665 Ga0075431_100270623
1666 Ga0075431_100733527
1667 Ga0075431_100970319
1668 Ga0075431_101018583
1669 Ga0075431_101020237
1670 Ga0075431_101950540
1671 Ga0075433_10000443
1672 Ga0075433_10069407
1673 Ga0075433_10290866
1674 Ga0075433_11174020
1675 Ga0075433_11699189
1676 Ga0075434_100000570
1677 Ga0075434_100005858
1678 Ga0075434_100025373
1679 Ga0075434_100231480
1680 Ga0075434_100749554
1681 Ga0075434_101116250
1682 Ga0075434_101142498
1683 Ga0075429_100001532
1684 Ga0075429_100044267
1685 Ga0075429_100284238
1686 Ga0068865_100000325
1687 Ga0068865_100050406
1688 Ga0068865_100250097
1689 Ga0075436_100228798
1690 Ga0075436_100493877
1691 Ga0075436_100612509
1692 Ga0075436_100672304
1693 Ga0097620_100016580
1694 Ga0097620_100092752
1695 Ga0097620_100126714
1696 Ga0075435_100002037
1697 Ga0075435_100020889
1698 Ga0075435_100129869
1699 Ga0099794_10015820
1700 Ga0099794_10741117
1701 Ga0099795_10000363
1702 Ga0099795_10215365
1703 Ga0099795_10254334
1704 Ga0099795_10562808
1705 Ga0105251_10237776
1706 Ga0105244_10140097
1707 Ga0105250_10044324
1708 Ga0105240_10116268
1709 Ga0105240_10449195
1710 Ga0111539_10000993
1711 Ga0111539_10029499
1712 Ga0111539_10115743
1713 Ga0111539_10123279
1714 Ga0111539_10309686
1715 Ga0111539_11570079
1716 Ga0111539_12566175
1717 Ga0105245_10000152
1718 Ga0105245_10044225
1719 Ga0105245_10333764
1720 Ga0105247_10012265
1721 Ga0105247_10041218
1722 Ga0105247_10155551
1723 Ga0105247_10177021
1724 Ga0105247_10407870
1725 Ga0114129_10002182
1726 Ga0114129_10003347
1727 Ga0114129_10009224
1728 Ga0114129_10030322
1729 Ga0114129_10377814
1730 Ga0114129_10485533
1731 Ga0114129_11780462
1732 Ga0114129_12346053
1733 Ga0105243_10006762
1734 Ga0105243_10022157
1735 Ga0105243_11056032
1736 Ga0105241_10070096
1737 Ga0105242_10000037
1738 Ga0105248_10013259
1739 Ga0105248_10171294
1740 Ga0105248_10171851
1741 Ga0105248_11725851
1742 Ga0105237_10110134
1743 Ga0105237_10196494
1744 Ga0105237_10275822
1745 Ga0105237_10949522
1746 Ga0105237_11516698
1747 Ga0105238_10058723
1748 Ga0105238_10762570
1749 Ga0105249_10011210
1750 Ga0105249_10023632
1751 Ga0105249_10209950
1752 Ga0105249_10274413
1753 Ga0099796_10012524
1754 Ga0099796_10283745
1755 Ga0105239_10049972
1756 Ga0105239_10076865
1757 Ga0105239_10096486
1758 Ga0105239_10234458
1759 Ga0105246_10052057
1760 Ga0105246_10341677
1761 Ga0157320_1038189
1762 Ga0157335_1042480
1763 Ga0157341_1001158
1764 Ga0157345_1008271
1765 Ga0157347_1065153
1766 Ga0157338_1000316
1767 Ga0157373_10144865
1768 Ga0157373_10530286
1769 Ga0157371_10012605
1770 Ga0157371_10048730
1771 Ga0157371_10176033
1772 Ga0157371_10501018
1773 Ga0157371_10653013
1774 Ga0157370_10183345
1775 Ga0157370_10348618
1776 Ga0157370_10351210
1777 Ga0157370_10604075
1778 Ga0157370_11512487
1779 Ga0157369_10095097
1780 Ga0157369_10145695
1781 Ga0157369_10560833
1782 Ga0157374_10035559
1783 Ga0157374_10080867
1784 Ga0157378_10007750
1785 Ga0157378_10042620
1786 Ga0157378_10642735
1787 Ga0157378_10795975
1788 Ga0157378_10846670
1789 Ga0157378_11400070
1790 Ga0163162_10010184
1791 Ga0163162_10051078
1792 Ga0157372_10134619
1793 Ga0157372_10201879
1794 Ga0157372_10386337
1795 Ga0157372_10885536
1796 Ga0157375_10029677
1797 Ga0157375_10037646
1798 Ga0157375_10367996
1799 Ga0163163_10044706
1800 Ga0163163_10094739
1801 Ga0163163_10169830
1802 Ga0163163_12269982
1803 Ga0157380_10001645
1804 Ga0157380_10123702
1805 Ga0157377_10000908
1806 Ga0157377_10112066
1807 Ga0157379_10035382
1808 Ga0157379_10086365
1809 Ga0157376_10000098
1810 Ga0157376_10196863
1811 Ga0157376_10306157
1812 Ga0163161_10000517
1813 Ga0163161_10194614
1814 Ga0184600_119888
1815 Ga0197907_10021714
1816 Ga0197907_10267674
1817 Ga0197907_10322994
1818 Ga0197907_11472364
1819 Ga0206356_10616003
1820 Ga0206355_1044422
1821 Ga0206355_1321509
1822 Ga0206355_1607865
1823 Ga0206352_10070973
1824 Ga0206352_10990502
1825 Ga0206354_10057609
1826 Ga0206353_11351368
1827 Ga0154015_1155604
1828 Ga0154015_1309315
1829 Ga0154015_1558961
1830 Ga0213872_10015119
1831 Ga0224712_10320348
1832 Ga0224712_10407319
1833 Ga0228598_1028738
1834 Ga0207666_1000340
1835 Ga0207666_1008668
1836 Ga0207673_1001667
1837 Ga0207697_10001646
1838 Ga0207697_10017664
1839 Ga0207697_10054579
1840 Ga0207656_10085459
1841 Ga0207656_10558826
1842 Ga0207656_10682959
1843 Ga0207696_1035844
1844 Ga0207655_1085276
1845 Ga0207653_10055806
1846 Ga0207653_10144809
1847 Ga0207682_10001127
1848 Ga0207692_10026490
1849 Ga0207692_10070442
1850 Ga0207692_10608053
1851 Ga0207642_10001064
1852 Ga0207710_10000646
1853 Ga0207710_10018970
1854 Ga0207710_10194076
1855 Ga0207688_10000421
1856 Ga0207688_10011945
1857 Ga0207688_10526350
1858 Ga0207680_10019271
1859 Ga0207647_10027881
1860 Ga0207647_10096278
1861 Ga0207647_10171003
1862 Ga0207685_10027629
1863 Ga0207685_10249684
1864 Ga0207685_10497322
1865 Ga0207699_10007521
1866 Ga0207699_10259356
1867 Ga0207645_10000023
1868 Ga0207645_10034532
1869 Ga0207643_10000007
1870 Ga0207643_10001763
1871 Ga0207705_10020248
1872 Ga0207705_10031743
1873 Ga0207684_10094548
1874 Ga0207684_10361555
1875 Ga0207684_10730244
1876 Ga0207684_11191626
1877 Ga0207654_10005412
1878 Ga0207707_10005596
1879 Ga0207707_10111096
1880 Ga0207707_10140397
1881 Ga0207707_10236724
1882 Ga0207707_10457545
1883 Ga0207695_10056615
1884 Ga0207695_10181240
1885 Ga0207671_10019782
1886 Ga0207671_10192985
1887 Ga0207671_11546786
1888 Ga0207693_10006335
1889 Ga0207693_10009479
1890 Ga0207693_10024014
1891 Ga0207693_10048492
1892 Ga0207693_10591672
1893 Ga0207663_10096738
1894 Ga0207663_10174250
1895 Ga0207663_10537837
1896 Ga0207663_10598154
1897 Ga0207660_10000058
1898 Ga0207660_10024467
1899 Ga0207660_10159311
1900 Ga0207660_10203366
1901 Ga0207660_10335059
1902 Ga0207660_10826582
1903 Ga0207662_10002534
1904 Ga0207662_10008351
1905 Ga0207662_10055229
1906 Ga0207657_10010577
1907 Ga0207657_10018216
1908 Ga0207657_10076527
1909 Ga0207657_10105114
1910 Ga0207657_10369041
1911 Ga0207657_10999066
1912 Ga0207657_11118419
1913 Ga0207649_10000265
1914 Ga0207649_10109207
1915 Ga0207649_10281624
1916 Ga0207652_10006100
1917 Ga0207652_10030984
1918 Ga0207652_10080345
1919 Ga0207652_10136713
1920 Ga0207652_10154722
1921 Ga0207652_10161495
1922 Ga0207652_10163805
1923 Ga0207652_10637415
1924 Ga0207681_10000338
1925 Ga0207681_10048718
1926 Ga0207681_10099360
1927 Ga0207694_10045367
1928 Ga0207694_10629652
1929 Ga0207650_10003024
1930 Ga0207650_10003490
1931 Ga0207650_10043964
1932 Ga0207650_11167727
1933 Ga0207659_10000852
1934 Ga0207659_10043402
1935 Ga0207659_10272027
1936 Ga0207687_10000390
1937 Ga0207687_10033046
1938 Ga0207687_10109916
1939 Ga0207700_10185526
1940 Ga0207700_10310622
1941 Ga0207664_10043096
1942 Ga0207664_10181774
1943 Ga0207664_10287081
1944 Ga0207644_10004631
1945 Ga0207644_10140146
1946 Ga0207644_10649015
1947 Ga0207690_10001293
1948 Ga0207690_10429001
1949 Ga0207706_10008986
1950 Ga0207706_10016275
1951 Ga0207706_10027220
1952 Ga0207686_10000329
1953 Ga0207709_10000419
1954 Ga0207709_10012298
1955 Ga0207709_10064366
1956 Ga0207709_10655045
1957 Ga0207670_10004455
1958 Ga0207670_10020284
1959 Ga0207670_10192221
1960 Ga0207670_10223797
1961 Ga0207669_10000197
1962 Ga0207669_10025135
1963 Ga0207704_10000381
1964 Ga0207704_10026763
1965 Ga0207704_10084949
1966 Ga0207665_11318111
1967 Ga0207691_10000405
1968 Ga0207691_10008342
1969 Ga0207691_10313462
1970 Ga0207711_10006325
1971 Ga0207711_10109893
1972 Ga0207711_10235029
1973 Ga0207711_11640570
1974 Ga0207689_10001529
1975 Ga0207689_10181193
1976 Ga0207689_10572677
1977 Ga0207661_10004218
1978 Ga0207661_10272690
1979 Ga0207679_10000029
1980 Ga0207679_10057461
1981 Ga0207679_10398839
1982 Ga0207667_10113510
1983 Ga0207667_10128743
1984 Ga0207667_10247612
1985 Ga0207667_10386992
1986 Ga0207667_10703055
1987 Ga0207667_10931445
1988 Ga0207667_11830845
1989 Ga0207651_10002680
1990 Ga0207651_10010769
1991 Ga0207712_10000756
1992 Ga0207712_10041636
1993 Ga0207712_10124459
1994 Ga0207668_10000158
1995 Ga0207668_10070822
1996 Ga0207668_10076909
1997 Ga0207640_10000403
1998 Ga0207640_10553132
1999 Ga0207640_11939571
2000 Ga0207658_10000929
2001 Ga0207658_10313067
2002 Ga0207677_10016686
2003 Ga0207677_10041040
2004 Ga0207677_10880790
2005 Ga0207703_10006542
2006 Ga0207703_10113333
2007 Ga0207703_10408174
2008 Ga0207703_10594468
2009 Ga0207703_10658102
2010 Ga0207703_11454842
2011 Ga0207639_10354965
2012 Ga0207639_10360086
2013 Ga0207639_10373249
2014 Ga0207678_10006751
2015 Ga0207678_10060487
2016 Ga0207678_11551588
2017 Ga0207708_10005713
2018 Ga0207708_10037195
2019 Ga0207702_10000404
2020 Ga0207702_10041853
2021 Ga0207702_10306636
2022 Ga0207702_10457948
2023 Ga0207702_10749169
2024 Ga0207702_10808118
2025 Ga0207702_11331197
2026 Ga0207641_10000510
2027 Ga0207641_10000520
2028 Ga0207641_10104402
2029 Ga0207641_10148643
2030 Ga0207648_10006692
2031 Ga0207648_10009603
2032 Ga0207648_10125208
2033 Ga0207676_10000180
2034 Ga0207676_10027786
2035 Ga0207676_10173240
2036 Ga0207674_10003014
2037 Ga0207674_10319372
2038 Ga0207675_100003095
2039 Ga0207675_100009333
2040 Ga0207675_100047140
2041 Ga0207683_10000082
2042 Ga0207683_10033900
2043 Ga0207698_10004441
2044 Ga0207698_10012788
2045 Ga0207698_10061873
2046 Ga0207698_10822214
2047 Ga0209973_1020686
2048 Ga0209179_1000817
2049 Ga0209999_1054096
2050 Ga0209970_1030290
2051 Ga0210002_1000174
2052 Ga0209983_1018630
2053 Ga0209971_1007808
2054 Ga0209966_1022550
2055 Ga0209998_10001094
2056 Ga0209998_10009774
2057 Ga0209998_10091589
2058 Ga0209813_10500113
2059 Ga0209974_10007090
2060 Ga0209974_10074680
2061 Ga0207428_10000124
2062 Ga0207428_10015251
2063 Ga0207428_10138438
2064 Ga0207428_10259025
2065 Ga0207428_11139371
2066 Ga0265357_1001399
2067 Ga0268266_10064600
2068 Ga0268266_10218902
2069 Ga0268265_10000978
2070 Ga0268265_10078035
2071 Ga0268265_10606912
2072 Ga0268265_11602369
2073 Ga0268264_10001059
2074 Ga0268264_10088953
2075 Ga0268264_10224624
2076 Ga0268264_10420473
2077 Ga0268264_10617943
2078 Ga0268264_10700074
2079 Ga0265337_1001961
2080 Ga0265334_10049477
2081 Ga0265334_10121145
2082 Ga0265336_10230925
2083 Ga0265338_10077624
2084 Ga0265763_1000209
2085 Ga0265760_10009953
2086 Ga0265330_10007239
2087 Ga0265332_10195315
2088 Ga0265332_10491967
2089 Ga0265325_10000509
2090 Ga0265325_10001196
2091 Ga0265325_10003976
2092 Ga0265325_10049914
2093 Ga0265325_10146426
2094 Ga0265325_10349933
2095 Ga0265340_10108944
2096 Ga0265340_10346147
2097 Ga0265340_10567539
2098 Ga0265339_10010967
2099 Ga0265339_10026893
2100 Ga0265339_10053595
2101 Ga0265331_10022996
2102 Ga0265316_10173183
2103 Ga0265316_10416941
2104 Ga0265316_11305858
2105 Ga0265313_10000041
2106 Ga0265313_10001711
2107 Ga0265313_10015078
2108 Ga0265313_10030972
2109 Ga0265313_10047125
2110 Ga0265313_10236859
2111 Ga0265313_10383279
2112 Ga0316579_10098314
2113 Ga0265314_10000279
2114 Ga0265314_10136672
2115 Ga0265342_10001581
2116 Ga0265342_10033881
2117 Ga0307410_12041757
2118 Ga0307406_10588302
2119 Ga0316593_10226911
2120 Ga0373930_0000118
2121 Ga0373930_0121893
2122 Ga0373948_0000147
2123 Ga0373950_0003340
2124 Ga0373950_0138078
2125 Ga0373958_0000218
2126 Ga0373958_0153466
2127 Ga0373959_0012047
2128 Ga0373938_0000294
2129 Ga0373938_0000477
2130 Ga0373928_0000248
2131 Ga0373928_0002106
2132 Ga0373929_0000807
2133 Ga0373929_0001120
2134 Ga0373934_0036336
2135 Ga0373940_0000051
2136 Ga0373940_0005015
2137 Ga0373940_0027031
2138 Ga0373944_0112597
2139 Ga0373944_0119779
2140 Ga0373949_0000838
2141 Ga0373951_0000405
2142 Ga0373951_0002198
2143 Ga0373951_0206332
2144 Ga0373952_0002594
2145 Ga0373952_0003584
2146 Ga0373952_0081086
2147 Ga0373932_0001096
2148 Ga0373932_0001105
2149 Ga0373932_0255053
2150 Ga0373936_0312550
2151 Ga0373939_0004371
2152 Ga0373939_0414539
2153 Ga0373941_0000393
2154 Ga0373941_0008857
2155 Ga0373941_0009336
2156 Ga0373941_0011239
2157 Ga0373941_0308690
2158 Ga0373945_0015433
2159 Ga0373953_0514042
2160 Ga0373954_0020414
2161 Ga0373954_0065353
2162 Ga0373956_0004278
2163 Ga0373957_0024142
2164 Ga0373960_0000511
2165 Ga0373960_0028221
2166 Ga0373943_0004745
2167 Ga0373943_0143775
2168 Ga0373946_0025903
2169 Ga0373946_0075573
2170 Ga0373955_0017240
2171 Ga0373955_0054666
2172 Ga0373955_0199534
2173 Ga0373955_0261309
2174 Ga0373942_0001831
2175 Ga0373942_0112156
2176 Ga0373961_0001733
2177 Ga0373961_0002011
2178 Ga0373961_0060382
2179 Ga0373962_0000743
2180 Ga0373962_0000854
2181 Ga0373924_0010093
2182 Ga0373924_0025325
2183 Ga0373924_0093949
2184 Ga0373924_0492480
2185 Ga0373931_0001777
2186 Ga0373931_0004621
2187 Ga0373931_0011132
2188 Ga0373931_0215235
2189 Ga0373935_0033552
2190 Ga0373935_0039088
2191 Ga0373935_1037936
2192 Ga0373927_0119529
2193 Ga0373927_0389252
2194 Ga0373933_0004332
2195 Ga0373933_0019915
2196 Ga0373947_0131433
2197 Ga0373937_0002645
2198 Ga0373937_0009243
2199 Ga0373937_0052641
2200 Ga0373937_0157317
2201 Ga0373937_0350132
2202 Ga0373937_0689674
2203 Ga0373937_0729764
2204 Ga0373937_1330799
2205 Ga0265778_063297
2206 Ga0373925_0057613
2207 Ga0373925_0061622
2208 Ga0373925_0199946
2209 Ga0395899_0062467
2210 Ga0395900_0011017
2211 Ga0395900_0344456
2212 Ga0395898_0045263
2213 Ga0395898_0315549
2214 Ga0395898_0473096
2215 Ga0436364_1067547
2216 Ga0395901_0258334
2217 Ga0395901_0349872
2218 Ga0395901_0353972
2219 Ga0242420_005485
2220 Ga0436365_0616428
2221 Ga0436361_0247770
2222 Ga0436361_0579909
2223 Ga0436363_0136452
2224 Ga0436363_1129005
2225 Ga0436362_0351535
2226 Ga0436362_0962350
2227 Ga0436362_1240385
2228 Ga0451800_0035694
2229 Ga0451800_0736633
2230 Ga0451835_0584884
2231 Ga0451839_0392821
2232 Ga0439448_0056883
2233 Ga0439448_0239883
2234 Ga0439458_0157834
2235 Ga0439459_0208341
2236 Ga0439464_0083279
2237 Ga0439460_0187684
2238 Ga0451577_0373251
2239 Ga0453683_0118949
2240 Ga0453684_0071365
2241 Ga0453684_1537615
2242 Ga0451576_0019986
2243 Ga0466958_0248237
2244 Ga0466967_2211268
2245 Ga0466967_2549088
2246 Ga0495592_0009683
2247 Ga0495592_0307661
2248 Ga0495603_0020013
2249 Ga0495603_0081080
2250 Ga0495629_0062377
2251 Ga0495641_0015691
2252 Ga0495651_0021682
2253 Ga0495651_0044807
2254 Ga0495651_0775217
2255 Ga0495653_0083353
2256 Ga0495580_0139053
2257 Ga0495582_0019377
2258 Ga0495582_0129947
2259 Ga0495639_0718314
2260 Ga0495664_0158039
2261 Ga0495584_0055059
2262 Ga0495585_0053446
2263 Ga0495607_0406501
2264 Ga0495608_0055137
2265 Ga0495608_0223541
2266 Ga0495616_0242169
2267 Ga0495628_0004222
2268 Ga0495628_0037655
2269 Ga0495630_0316306
2270 Ga0495630_0492766
2271 Ga0495630_0529200
2272 Ga0495630_0626457
2273 Ga0495637_0050965
2274 Ga0495637_0136346
2275 Ga0495644_0098352
2276 Ga0495666_0047392
2277 Ga0495652_0080227
2278 Ga0495665_0353835
2279 Ga0495640_0075222
2280 Ga0495640_0299538
2281 Ga0495587_0037722
2282 Ga0495598_0121299
2283 Ga0495598_0397650
2284 Ga0495645_0002519
2285 Ga0495622_0329250
2286 Ga0495622_0393721
2287 Ga0495633_0517988
2288 Ga0495667_0026210
2289 Ga0495667_0163302
2290 Ga0495667_0375738
2291 Ga0495656_0016742
2292 Ga0495656_0103963
2293 Ga0495668_0394447
2294 Ga0495634_0206818
2295 Ga0495611_0083705
2296 Ga0495635_0175416
2297 Ga0495635_0464909
2298 Ga0495659_0068421
2299 Ga0495659_0249601
2300 Ga0495588_0474246
2301 Ga0495657_0110975
2302 Ga0495657_0170385
2303 Ga0495623_0023287
2304 Ga0495623_0483751
2305 Ga0495646_0125228
2306 Ga0495646_0626367
2307 Ga0495658_0025976
2308 Ga0495658_0354166
2309 Ga0495658_0560829
2310 Ga0495669_0127381
2311 Ga0495613_0067248
2312 Ga0495624_0080758
2313 Ga0495670_0019861
2314 Ga0495600_0005701
2315 Ga0495600_0180746
2316 Ga0495600_0278096
2317 Ga0495581_0168421
2318 Ga0495604_0043855
2319 Ga0495604_0097720
2320 Ga0495674_0344519
2321 Ga0495674_0588163
2322 Ga0495672_0140285
2323 Ga0495672_0237686
2324 Ga0495672_0281978
2325 Ga0495676_0159626
2326 Ga0495680_0246378
2327 Ga0495683_0420002
2328 Ga0495675_0355864
2329 Ga0495675_0669571
2330 Ga0495677_0265836
2331 Ga0495684_0047124
2332 Ga0495602_0021067
2333 Ga0495602_0024507
2334 Ga0495602_0257571
2335 Ga0495626_0094052
2336 Ga0496100_0000057
2337 Ga0496100_0120830
2338 Ga0496100_1049295
2339 Ga0496100_1473203
2340 Ga0496101_0005881
2341 Ga0496101_0017927
2342 Ga0496101_0077727
2343 Ga0496101_0279110
2344 Ga0496101_1155290
2345 Ga0496102_0000811
2346 Ga0496102_0004777
2347 Ga0496102_0016603
2348 Ga0496102_0036109
2349 Ga0496102_0574228
2350 Ga0496103_0000157
2351 Ga0496103_0012065
2352 Ga0496103_0013686
2353 Ga0496103_0047937
2354 Ga0496104_0000792
2355 Ga0496104_0000840
2356 Ga0496104_0001594
2357 Ga0496104_0036268
2358 Ga0496104_0041302
2359 Ga0496104_0054936
2360 Ga0496105_0001180
2361 Ga0496105_0028643
2362 Ga0496105_0045897
2363 Ga0496105_0062694
2364 Ga0496105_0091222
2365 Ga0496105_0674229
2366 Ga0496105_1233585
2367 Ga0496106_0001727
2368 Ga0496106_0003682
2369 Ga0496106_0018620
2370 Ga0496106_0021095
2371 Ga0496106_0333446
2372 Ga0496106_0542352
2373 Ga0496107_0000249
2374 Ga0496107_0032231
2375 Ga0496107_0065707
2376 Ga0496108_0002560
2377 Ga0496108_0013756
2378 Ga0496108_0316431
2379 Ga0496108_0475724
2380 Ga0496108_1371472
2381 Ga0496109_0025700
2382 Ga0496109_0028830
2383 Ga0496109_0050950
2384 Ga0496109_0058427
2385 Ga0496109_0073150
2386 Ga0496109_0180457
2387 Ga0496109_0185743
2388 Ga0496110_0002431
2389 Ga0496110_0003026
2390 Ga0496110_0056946
2391 Ga0496110_0529537
2392 Ga0496111_0010279
2393 Ga0496111_0047176
2394 Ga0496111_0087220
2395 Ga0496111_0194169
2396 Ga0496112_0001894
2397 Ga0496112_0010777
2398 Ga0496112_0029462
2399 Ga0496112_0035169
2400 Ga0496112_0043146
2401 Ga0496112_1509437
2402 Ga0496113_0038315
2403 Ga0496113_0039016
2404 Ga0496113_0190854
2405 Ga0496114_0012603
2406 Ga0496114_0188577
2407 Ga0496115_0063399
2408 Ga0496115_0213067
2409 Ga0501031_0233663
2410 Ga0501032_0029827
2411 Ga0501033_0039201
2412 Ga0501033_0208373
2413 Ga0501033_0459726
2414 Ga0501033_0519123
2415 Ga0501033_0754706
2416 Ga0501034_0083101
2417 Ga0501034_0087563
2418 Ga0501034_0118751
2419 Ga0501034_0119406
2420 Ga0501034_0310777
2421 Ga0501034_1154619
2422 Ga0501036_0146116
2423 Ga0501036_0841049
2424 Ga0501037_0059247
2425 Ga0501038_0050290
2426 Ga0501038_0164255
2427 Ga0501038_0265235
2428 Ga0501039_0088018
2429 Ga0501039_0266052
2430 Ga0501039_1488693
2431 Ga0501041_0245691
2432 Ga0501043_0014810
2433 Ga0501046_0065399
2434 Ga0501047_0005189
2435 Ga0501047_0100372
2436 Ga0501047_0156062
2437 Ga0501068_0081659
2438 Ga0501068_0712416
2439 Ga0501069_0003606
2440 Ga0501069_0022685
2441 Ga0501069_0128256
2442 Ga0501069_0136574
2443 Ga0501070_0015110
2444 Ga0501070_0020675
2445 Ga0501070_0026876
2446 Ga0501070_0068827
2447 Ga0501070_0161831
2448 Ga0501070_0174248
2449 Ga0501071_0148718
2450 Ga0501071_0632859
2451 Ga0501072_0130193
2452 Ga0501072_0210917
2453 Ga0501072_0292044
2454 Ga0501072_0385028
2455 Ga0501072_0907359
2456 Ga0501073_0039712
2457 Ga0501073_0062898
2458 Ga0501073_0266715
2459 Ga0501074_0085558
2460 Ga0501074_0992221
2461 Ga0501075_1244635
2462 Ga0501076_0340756
2463 Ga0501077_0009150
2464 Ga0501079_0544708
2465 Ga0501080_0018469
2466 Ga0501080_0217399
2467 Ga0501080_0366696
2468 Ga0501080_0381438
2469 Ga0501080_0534238
2470 Ga0501081_0453256
2471 Ga0501081_1022000
2472 Ga0501081_1319133
2473 Ga0501083_0658106
2474 Ga0501083_1058847
2475 Ga0501035_0090691
2476 Ga0501035_0140637
2477 Ga0501035_0156001
2478 Ga0501044_0112198
2479 Ga0501044_0119848
2480 Ga0501044_0243255
2481 Ga0501044_0288828
2482 nmdc:mga00v17_37235_c1
2483 nmdc:mga0yw44_130861_c1
2484 nmdc:mga0yw44_18223_c1
2485 nmdc:mga0yw44_25992_c1
2486 nmdc:mga0yw44_3959_c1
2487 nmdc:mga06z11_181447_c1
2488 nmdc:mga06z11_331359_c1
2489 nmdc:mga06z11_34869_c1
2490 nmdc:mga06z11_458430_c1
2491 nmdc:mga04h51_454439_c1
2492 nmdc:mga07m45_101399_c1
2493 nmdc:mga07m45_397872_c1
2494 nmdc:mga05p37_211988_c1
2495 nmdc:mga05p37_290041_c1
2496 nmdc:mga05p37_331809_c1
2497 nmdc:mga05p37_4262_c1
2498 nmdc:mga05p37_44681_c1
2499 nmdc:mga05p37_45_c1
2500 nmdc:mga05p37_502323_c1
2501 nmdc:mga05p37_96872_c1
2502 nmdc:mga09592_232235_c1
2503 nmdc:mga09592_603_c1
2504 nmdc:mga0qj67_1399_c1
2505 nmdc:mga0qj67_156066_c1
2506 nmdc:mga0qj67_197942_c1
2507 nmdc:mga0qj67_64_c1
2508 nmdc:mga0qj67_678760_c1
2509 nmdc:mga0qj67_797208_c1
2510 nmdc:mga06r32_127948_c1
2511 nmdc:mga06r32_227_c1
2512 nmdc:mga06r32_261434_c1
2513 nmdc:mga06r32_392566_c1
2514 nmdc:mga06r32_774467_c1
2515 nmdc:mga06r32_77843_c1
2516 nmdc:mga08y16_182633_c1
2517 nmdc:mga08y16_210179_c1
2518 nmdc:mga08y16_278488_c1
2519 nmdc:mga08y16_2912_c1
2520 nmdc:mga08y16_36270_c1
2521 nmdc:mga08y16_647967_c1
2522 nmdc:mga0n895_1201316_c1
2523 nmdc:mga0n895_162111_c1
2524 nmdc:mga0n895_1904_c1
2525 nmdc:mga0n895_363034_c1
2526 nmdc:mga0n895_363051_c1
2527 nmdc:mga0n895_38352_c1
2528 nmdc:mga0n895_465601_c1
2529 nmdc:mga0n895_50_c1
2530 nmdc:mga0n895_6291_c1
2531 nmdc:mga0rr50_1115334_c1
2532 nmdc:mga0rr50_1389383_c1
2533 nmdc:mga0rr50_15896_c1
2534 nmdc:mga0rr50_1666802_c1
2535 nmdc:mga0rr50_26811_c1
2536 nmdc:mga0rr50_555701_c1
2537 nmdc:mga08x19_253586_c1
2538 nmdc:mga08x19_368404_c1
2539 nmdc:mga08x19_396684_c1
2540 nmdc:mga0a205_114890_c1
2541 nmdc:mga0a205_141084_c1
2542 nmdc:mga0a205_175889_c1
2543 nmdc:mga0a205_244219_c1
2544 nmdc:mga0a205_590_c1
2545 Ga0495601_0000204
2546 Ga0495601_0001005
2547 Ga0495601_0006777
2548 Ga0495612_0008601
2549 Ga0495612_0051445
2550 Ga0495612_0152367
2551 Ga0495612_0286871
2552 Ga0495655_0003346
2553 Ga0495595_0000987
2554 Ga0495595_0005693
2555 Ga0495595_0017766
2556 Ga0495595_0177558
2557 Ga0495595_0193573
2558 Ga0495619_0000161
2559 Ga0495619_0052589
2560 Ga0495619_0055201
2561 Ga0495619_0079035
2562 Ga0495619_0176094
2563 Ga0495619_0660973
2564 Ga0500650_0089345
2565 Ga0500595_008009
2566 Ga0500642_0322701
2567 Ga0500652_000030
2568 Ga0500636_0022315
2569 Ga0501084_0021548
2570 Ga0501084_0580339
2571 Ga0501084_0635436
2572 Ga0501084_1259474
2573 Ga0587082_070358
2574 Ga0587115_051489
2575 Ga0501082_0046844
2576 Ga0501082_0122057
2577 Ga0466962_0126698
2578 2513589046

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00462

Glutaredoxin

Glutaredoxin

38

102

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3gx8-assembly1.cif.gz_A structural and biochemical characterization of yeast monothiol glutaredoxin grx5 0.9509 3 107
2wul-assembly1.cif.gz_D crystal structure of the human glutaredoxin 5 with bound glutathione in an fes cluster 0.9487 4 106
2mma-assembly1.cif.gz_A nmr-based docking model of grxs14-bola2 apo-heterodimer from arabidopsis thaliana 0.9486 3 103
2wci-assembly1.cif.gz_A structure of e. coli monothiol glutaredoxin grx4 homodimer 0.9357 5 103
5y4u-assembly1.cif.gz_A crystal structure of grx domain of grx3 from saccharomyces cerevisiae 0.9279 6 102
ID Description Score Start End Superfamily
af_K7UQQ8_80_167_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9807 8 93 3.40.30.10
af_C6KSR7_119_214_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9788 7 97 3.40.30.10
af_O97232_76_171_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9781 7 95 3.40.30.10
2wemC01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9725 7 101 3.40.30.10
af_A0A1D6I9B4_1510_1569_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.971 7 64 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A4Q3S1W3-F1-model_v4 Glutaredoxin 0.9983 3 104 GO:0015036
GO:0046872
GO:0051537
AF-A0A4V3KB34-F1-model_v4 Glutaredoxin 0.9963 3 106 GO:0015036
GO:0046872
GO:0051537
AF-A0A7V9PL43-F1-model_v4 deleted 0.9952 3 101
AF-A0A8A7V6K4-F1-model_v4 deleted 0.9934 4 109
AF-A0A261DAN7-F1-model_v4 Glutaredoxin 0.9929 3 105 GO:0015036
GO:0046872
GO:0051537

Map