F489890
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1091 | 562 | 1053 | 107 |
Family's Representative Sequence
| Representative Sequence | 3300047323|Ga0495683_0366451|Ga0495683_0366451_132_464 |
| Length | 110 |
| Sequence | MLTCTQAAAKRIACHLAEHPTAVGLRIGVRTSGCSGLAYTFEVCSELGADDNVVDTEGVRLIVSNRDLVFLKGSELHYERHGLNSTFQVRNPQEVARCGCGESFTVRERT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501025501 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 2 | 2501025504 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 3 | 2510065045 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 4 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 5 | 2510917015 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 6 | 2512047030 | Paraburkholderia tuberum STM678 | Isolate | Nodule |
| 7 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 8 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 9 | 2554235231 | Pseudomonas putida MTCC 5279 | Isolate | Unclassified |
| 10 | 2600254954 | Pseudomonas sp. NFACC19-2 | Isolate | Rhizoplane |
| 11 | 2600255067 | Paraburkholderia kururiensis thiooxydans NBRC 107107 | Isolate | Unclassified |
| 12 | 2600255389 | Pseudomonas sp. NFPP33 | Isolate | Rhizoplane |
| 13 | 2718217991 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 14 | 2721755763 | Pandoraea thiooxydans ATSB16 | Isolate | Rhizosphere |
| 15 | 2806310737 | Pseudomonas mosselii BS011 | Isolate | Unclassified |
| 16 | 2806310745 | Pseudomonas mosselii PtA1 | Isolate | Unclassified |
| 17 | 2808606373 | Pseudomonas sp. SLBN-2 | Isolate | Unclassified |
| 18 | 2808606384 | Burkholderia sp. SJZ089 | Isolate | Rhizosphere |
| 19 | 2808606390 | Burkholderia sp. SJZ115 | Isolate | Rhizosphere |
| 20 | 2808606391 | Burkholderia sp. SJZ091 | Isolate | Rhizosphere |
| 21 | 2842324504 | Paraburkholderia fungorum SEMIA 4007 | Isolate | Nodule |
| 22 | 2842348783 | Paraburkholderia fungorum SEMIA 4013 | Isolate | Nodule |
| 23 | 2842454564 | Paraburkholderia fungorum SEMIA 4056 | Isolate | Nodule |
| 24 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 25 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 26 | 2887375801 | Parapusillimonas sp. SGNA-6 | Isolate | Rhizosphere |
| 27 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 28 | 2917832318 | Pseudomonas rhizoryzae RY24 | Isolate | Unclassified |
| 29 | 2919125081 | Pseudomonas psychrotolerans 1545 | Isolate | Rhizosphere |
| 30 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 31 | 2984504281 | Pseudomonas psychrotolerans SORGH_AS201 | Isolate | Aerial Root |
| 32 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 33 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 34 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 35 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 36 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 37 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 38 | 3300003479 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_06_lowP_mix1_d1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 39 | 3300003558 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_10_fullP_mix1_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 40 | 3300003565 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_16_lowP_mix3_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 41 | 3300003567 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 42 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 43 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 44 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 45 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 46 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 47 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 48 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 49 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 50 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 51 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 52 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 53 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 54 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 55 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 56 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 57 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 58 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 59 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 62 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 63 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 65 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 66 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 76 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 85 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 86 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 87 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 88 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 89 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 90 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 92 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 93 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 95 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 96 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 98 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 99 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 100 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 102 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 103 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 104 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 105 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 106 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 107 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 108 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 109 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 110 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 111 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 113 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 114 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 115 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 116 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 117 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 118 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 119 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 120 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 122 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 123 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 134 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300012506 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 | Metagenome | Rhizosphere |
| 136 | 3300013045 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 137 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 147 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 149 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 150 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300019190 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE3 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 152 | 3300019192 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA3 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 153 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 154 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 155 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 156 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 157 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 158 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 159 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 160 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 161 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 162 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 163 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 164 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 165 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 166 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 167 | 3300023539 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 168 | 3300023672 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 169 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 177 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 178 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 181 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 183 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 185 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 187 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 188 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 189 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 190 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 191 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 260 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 262 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 266 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 267 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 268 | 3300030762 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 269 | 3300030877 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 270 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 271 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 272 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 273 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 274 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 275 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 276 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 277 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 278 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 279 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 280 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 281 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 282 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 283 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 284 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 285 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 286 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 287 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 288 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 289 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 290 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 291 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 292 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 293 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 294 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 295 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 296 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 297 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 298 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 299 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 300 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 301 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 302 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 303 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 304 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 305 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 306 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 307 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 308 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 309 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 310 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 311 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 312 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 313 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 314 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 315 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 316 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 317 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 318 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 319 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 320 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 321 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 322 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 323 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 324 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 325 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 326 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 327 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 328 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 329 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 330 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 331 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 332 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 333 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 334 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 335 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 336 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 337 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 338 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 339 | 3300041461 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT | Metatranscriptome | Rhizoplane |
| 340 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 341 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 342 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 343 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 344 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 345 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 346 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 347 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 348 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 349 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 350 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 351 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 352 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 353 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 354 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 355 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 356 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 357 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 358 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 359 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 360 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 361 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 362 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 363 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 364 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 365 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 366 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 367 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 368 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 369 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 370 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 371 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 372 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 373 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 374 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 446 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 447 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 448 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 449 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 450 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 451 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 452 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 453 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 454 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 455 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 456 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 457 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 458 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 459 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 460 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 461 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 462 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 463 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 464 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 465 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 466 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 467 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 468 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 469 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 470 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 471 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 472 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 473 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 475 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 476 | 3300049526 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control | Metagenome | Rhizosphere |
| 477 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 478 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 479 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 480 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 481 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 482 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 483 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 484 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 485 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 486 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 487 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 488 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 489 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 490 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 491 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 492 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 493 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 494 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 495 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 496 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 497 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 498 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 499 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 500 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 501 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 502 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 503 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 504 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 505 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 506 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 507 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 508 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 509 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 510 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 511 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 512 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 513 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 514 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 515 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 516 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 517 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 518 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 519 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 520 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 521 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 522 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 523 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 524 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 525 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 526 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 527 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 528 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 529 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 530 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 531 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 532 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 533 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 534 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 535 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 536 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 537 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 538 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 539 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 540 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 541 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 542 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 543 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 544 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 545 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 546 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 547 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 548 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 549 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 550 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 551 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 552 | 3300059648 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 553 | 3300059650 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 554 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 555 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 556 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 557 | 8011350971 | Pseudomonas sp. 30_B | Isolate | Rhizosphere |
| 558 | 8016728285 | Pseudomonas psychrotolerans SORGH_AS 227 | Isolate | Unclassified |
| 559 | 8034962539 | Pseudomonas sediminis PI11 | Isolate | Rhizosphere |
| 560 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
| 561 | 8056115690 | Pseudomonas muyukensis COW39 | Isolate | Rhizosphere |
| 562 | 8056120720 | Pseudomonas maumuensis COW77 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.55 |
| Metatranscriptomes | 6.97 |
| Isolates | 3.48 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.09 |
| Bulb | 0 |
| Endosphere | 5.32 |
| Nodule | 0.64 |
| Rhizoplane | 3.21 |
| Rhizosphere | 84.69 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.05 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10000304 | 3300001979 | Bacteria | 20859 |
| 2 | JGI24740J21852_10000783 | 3300001979 | Bacteria | 13957 |
| 3 | JGI24739J22299_10026729 | 3300001989 | Bacteria | 2023 |
| 4 | JGI24735J21928_10000592 | 3300002067 | Bacteria | 12758 |
| 5 | JGI25156J39149_1004627 | 3300002705 | Bacteria | 4148 |
| 6 | JGI25156J39149_1013980 | 3300002705 | Bacteria | 1676 |
| 7 | JGI25154J39366_1000649 | 3300002738 | Bacteria | 16270 |
| 8 | Ga0006556J51387_1030706 | 3300003479 | Bacteria | 2642 |
| 9 | Ga0006558J51389_1031326 | 3300003558 | Bacteria | 851 |
| 10 | Ga0006560J51390_1025704 | 3300003565 | Bacteria | 1511 |
| 11 | Ga0006554J51385_1045016 | 3300003567 | Bacteria | 736 |
| 12 | Ga0055538_1012937 | 3300003751 | Bacteria | 580 |
| 13 | Ga0055539_1000034 | 3300003752 | Bacteria | 223400 |
| 14 | Ga0055533_1002398 | 3300003756 | Bacteria | 4273 |
| 15 | Ga0055532_1000002 | 3300003758 | Bacteria | 576000 |
| 16 | Ga0055525_1000313 | 3300003759 | Bacteria | 39508 |
| 17 | Ga0055525_1000473 | 3300003759 | Bacteria | 22055 |
| 18 | Ga0055527_1000923 | 3300003760 | Bacteria | 7271 |
| 19 | Ga0055542_1003748 | 3300003762 | Bacteria | 3967 |
| 20 | Ga0055529_1000028 | 3300003763 | Bacteria | 287650 |
| 21 | Ga0055534_1000984 | 3300003784 | Bacteria | 12593 |
| 22 | Ga0055531_10033129 | 3300003794 | Bacteria | 1671 |
| 23 | Ga0055541_1003150 | 3300003841 | Bacteria | 3155 |
| 24 | Ga0055543_1003665 | 3300004625 | Bacteria | 4423 |
| 25 | Ga0058859_11623198 | 3300004798 | Bacteria | 528 |
| 26 | Ga0058859_11781410 | 3300004798 | Bacteria | 563 |
| 27 | Ga0058860_12150010 | 3300004801 | Bacteria | 647 |
| 28 | Ga0058862_12823266 | 3300004803 | Bacteria | 1286 |
| 29 | Ga0065165_1000613 | 3300005262 | Bacteria | 51836 |
| 30 | Ga0065707_10057951 | 3300005295 | Bacteria | 623 |
| 31 | Ga0070658_10002480 | 3300005327 | Bacteria | 15419 |
| 32 | Ga0070683_101505761 | 3300005329 | Bacteria | 647 |
| 33 | Ga0070690_100989682 | 3300005330 | Bacteria | 662 |
| 34 | Ga0068869_100050869 | 3300005334 | Bacteria | 3004 |
| 35 | Ga0068869_100128505 | 3300005334 | Bacteria | 1945 |
| 36 | Ga0068869_101145432 | 3300005334 | Bacteria | 682 |
| 37 | Ga0070666_10073819 | 3300005335 | Bacteria | 2324 |
| 38 | Ga0068868_100458728 | 3300005338 | Bacteria | 1110 |
| 39 | Ga0068868_101402616 | 3300005338 | Bacteria | 652 |
| 40 | Ga0070689_100012797 | 3300005340 | Bacteria | 6056 |
| 41 | Ga0070689_100151335 | 3300005340 | Bacteria | 1871 |
| 42 | Ga0070689_100423690 | 3300005340 | Bacteria | 1128 |
| 43 | Ga0070689_101285639 | 3300005340 | Bacteria | 658 |
| 44 | Ga0070691_10183806 | 3300005341 | Bacteria | 1089 |
| 45 | Ga0070661_100000013 | 3300005344 | Bacteria | 163010 |
| 46 | Ga0070692_10775184 | 3300005345 | Bacteria | 652 |
| 47 | Ga0070668_100280263 | 3300005347 | Bacteria | 1392 |
| 48 | Ga0070669_100024733 | 3300005353 | Bacteria | 4308 |
| 49 | Ga0070675_100004581 | 3300005354 | Bacteria | 10556 |
| 50 | Ga0070675_100515510 | 3300005354 | Bacteria | 1078 |
| 51 | Ga0070671_100737060 | 3300005355 | Bacteria | 856 |
| 52 | Ga0070671_101149174 | 3300005355 | Bacteria | 683 |
| 53 | Ga0070674_100019780 | 3300005356 | Bacteria | 4284 |
| 54 | Ga0070674_100078297 | 3300005356 | Bacteria | 2355 |
| 55 | Ga0070674_100826826 | 3300005356 | Bacteria | 802 |
| 56 | Ga0070673_100284418 | 3300005364 | Bacteria | 1451 |
| 57 | Ga0070673_101031899 | 3300005364 | Bacteria | 766 |
| 58 | Ga0070688_100006303 | 3300005365 | Bacteria | 6333 |
| 59 | Ga0070688_100487624 | 3300005365 | Bacteria | 927 |
| 60 | Ga0070659_100003967 | 3300005366 | Bacteria | 10534 |
| 61 | Ga0070659_100148160 | 3300005366 | Bacteria | 1913 |
| 62 | Ga0070659_100393514 | 3300005366 | Bacteria | 1169 |
| 63 | Ga0070701_10090013 | 3300005438 | Bacteria | 1679 |
| 64 | Ga0070701_10753732 | 3300005438 | Bacteria | 660 |
| 65 | Ga0070705_100046152 | 3300005440 | Bacteria | 2510 |
| 66 | Ga0070705_100781955 | 3300005440 | Bacteria | 758 |
| 67 | Ga0070700_100033148 | 3300005441 | Bacteria | 3109 |
| 68 | Ga0070700_100196938 | 3300005441 | Bacteria | 1413 |
| 69 | Ga0070700_101361389 | 3300005441 | Bacteria | 599 |
| 70 | Ga0070694_100555456 | 3300005444 | Bacteria | 920 |
| 71 | Ga0070694_100969277 | 3300005444 | Bacteria | 705 |
| 72 | Ga0070694_101083890 | 3300005444 | Bacteria | 668 |
| 73 | Ga0070694_101104676 | 3300005444 | Bacteria | 661 |
| 74 | Ga0070708_101231157 | 3300005445 | Bacteria | 700 |
| 75 | Ga0070708_101876357 | 3300005445 | Bacteria | 556 |
| 76 | Ga0070663_100000006 | 3300005455 | Bacteria | 208068 |
| 77 | Ga0070663_100237780 | 3300005455 | Bacteria | 1436 |
| 78 | Ga0070663_101395441 | 3300005455 | Bacteria | 620 |
| 79 | Ga0070662_100488787 | 3300005457 | Bacteria | 1025 |
| 80 | Ga0070681_10000198 | 3300005458 | Bacteria | 47037 |
| 81 | Ga0070681_11068917 | 3300005458 | Bacteria | 728 |
| 82 | Ga0068867_100446316 | 3300005459 | Bacteria | 1101 |
| 83 | Ga0068867_101027745 | 3300005459 | Bacteria | 749 |
| 84 | Ga0070685_10013293 | 3300005466 | Bacteria | 4339 |
| 85 | Ga0070698_100219769 | 3300005471 | Bacteria | 1834 |
| 86 | Ga0070698_100268912 | 3300005471 | Bacteria | 1636 |
| 87 | Ga0070698_102115005 | 3300005471 | Bacteria | 516 |
| 88 | Ga0070679_101201299 | 3300005530 | Bacteria | 704 |
| 89 | Ga0070684_100413301 | 3300005535 | Bacteria | 1245 |
| 90 | Ga0070672_100049500 | 3300005543 | Bacteria | 3269 |
| 91 | Ga0070686_100203785 | 3300005544 | Bacteria | 1420 |
| 92 | Ga0070686_100411785 | 3300005544 | Bacteria | 1031 |
| 93 | Ga0070686_100720214 | 3300005544 | Bacteria | 797 |
| 94 | Ga0070695_100298109 | 3300005545 | Bacteria | 1190 |
| 95 | Ga0070696_100041783 | 3300005546 | Bacteria | 3168 |
| 96 | Ga0070696_100185224 | 3300005546 | Bacteria | 1546 |
| 97 | Ga0070696_100521115 | 3300005546 | Bacteria | 948 |
| 98 | Ga0070696_100525610 | 3300005546 | Bacteria | 945 |
| 99 | Ga0070696_100677636 | 3300005546 | Bacteria | 838 |
| 100 | Ga0070696_100766813 | 3300005546 | Bacteria | 791 |
| 101 | Ga0070704_100059341 | 3300005549 | Bacteria | 2729 |
| 102 | Ga0070704_100300271 | 3300005549 | Bacteria | 1338 |
| 103 | Ga0070704_100618443 | 3300005549 | Bacteria | 953 |
| 104 | Ga0070704_100834099 | 3300005549 | Bacteria | 826 |
| 105 | Ga0068855_100008103 | 3300005563 | Bacteria | 12696 |
| 106 | Ga0068855_100483412 | 3300005563 | Bacteria | 1348 |
| 107 | Ga0068855_100730200 | 3300005563 | Bacteria | 1058 |
| 108 | Ga0070664_100000002 | 3300005564 | Bacteria | 458815 |
| 109 | Ga0068857_100071642 | 3300005577 | Bacteria | 3088 |
| 110 | Ga0068857_100093939 | 3300005577 | Bacteria | 2685 |
| 111 | Ga0068854_100000004 | 3300005578 | Bacteria | 216381 |
| 112 | Ga0068854_100713211 | 3300005578 | Bacteria | 867 |
| 113 | Ga0068854_100993615 | 3300005578 | Bacteria | 743 |
| 114 | Ga0068856_100003447 | 3300005614 | Bacteria | 15991 |
| 115 | Ga0070702_100110337 | 3300005615 | Bacteria | 1704 |
| 116 | Ga0070702_100395406 | 3300005615 | Bacteria | 987 |
| 117 | Ga0070702_100601158 | 3300005615 | Bacteria | 824 |
| 118 | Ga0070702_101081673 | 3300005615 | Bacteria | 640 |
| 119 | Ga0068852_100055664 | 3300005616 | Bacteria | 3415 |
| 120 | Ga0068852_101056565 | 3300005616 | Bacteria | 831 |
| 121 | Ga0068852_101648974 | 3300005616 | Bacteria | 664 |
| 122 | Ga0068859_100746798 | 3300005617 | Bacteria | 1067 |
| 123 | Ga0068859_101978320 | 3300005617 | Bacteria | 644 |
| 124 | Ga0068866_10321979 | 3300005718 | Bacteria | 973 |
| 125 | Ga0068866_11395815 | 3300005718 | Bacteria | 512 |
| 126 | Ga0068861_100021205 | 3300005719 | Bacteria | 4669 |
| 127 | Ga0068851_10708730 | 3300005834 | Bacteria | 620 |
| 128 | Ga0068870_10086996 | 3300005840 | Bacteria | 1739 |
| 129 | Ga0068870_10205810 | 3300005840 | Bacteria | 1196 |
| 130 | Ga0068858_100386817 | 3300005842 | Bacteria | 1343 |
| 131 | Ga0068860_100844025 | 3300005843 | Bacteria | 930 |
| 132 | Ga0068862_101244952 | 3300005844 | Bacteria | 744 |
| 133 | Ga0081538_10033593 | 3300005981 | Bacteria | 3411 |
| 134 | Ga0070717_11083081 | 3300006028 | Bacteria | 730 |
| 135 | Ga0075367_10108825 | 3300006178 | Bacteria | 1699 |
| 136 | Ga0075366_10862639 | 3300006195 | Bacteria | 564 |
| 137 | Ga0075428_100149716 | 3300006844 | Bacteria | 2535 |
| 138 | Ga0075428_102222596 | 3300006844 | Bacteria | 566 |
| 139 | Ga0075431_100739663 | 3300006847 | Bacteria | 959 |
| 140 | Ga0075433_10014942 | 3300006852 | Bacteria | 6354 |
| 141 | Ga0075433_10109839 | 3300006852 | Bacteria | 2446 |
| 142 | Ga0075433_10227719 | 3300006852 | Bacteria | 1655 |
| 143 | Ga0075433_10415323 | 3300006852 | Bacteria | 1187 |
| 144 | Ga0075433_11805246 | 3300006852 | Bacteria | 526 |
| 145 | Ga0075434_100000073 | 3300006871 | Bacteria | 52987 |
| 146 | Ga0075434_100001176 | 3300006871 | Bacteria | 21677 |
| 147 | Ga0075434_100019885 | 3300006871 | Bacteria | 6503 |
| 148 | Ga0075434_100075855 | 3300006871 | Bacteria | 3357 |
| 149 | Ga0075434_100296357 | 3300006871 | Bacteria | 1637 |
| 150 | Ga0075434_100955287 | 3300006871 | Bacteria | 871 |
| 151 | Ga0068865_101977635 | 3300006881 | Bacteria | 529 |
| 152 | Ga0075436_100000205 | 3300006914 | Bacteria | 36621 |
| 153 | Ga0075436_100000352 | 3300006914 | Bacteria | 29413 |
| 154 | Ga0075436_100214012 | 3300006914 | Bacteria | 1367 |
| 155 | Ga0075436_100279283 | 3300006914 | Bacteria | 1194 |
| 156 | Ga0075436_100752945 | 3300006914 | Bacteria | 724 |
| 157 | Ga0097620_100746780 | 3300006931 | Bacteria | 1067 |
| 158 | Ga0097620_101978139 | 3300006931 | Bacteria | 644 |
| 159 | Ga0075435_100000302 | 3300007076 | Bacteria | 30480 |
| 160 | Ga0075435_100006291 | 3300007076 | Bacteria | 8385 |
| 161 | Ga0075435_101081743 | 3300007076 | Bacteria | 701 |
| 162 | Ga0099794_10668363 | 3300007265 | Bacteria | 552 |
| 163 | Ga0105251_10000235 | 3300009011 | Bacteria | 55832 |
| 164 | Ga0111539_10050653 | 3300009094 | Bacteria | 4947 |
| 165 | Ga0105245_10259188 | 3300009098 | Bacteria | 1692 |
| 166 | Ga0114129_10241625 | 3300009147 | Bacteria | 2427 |
| 167 | Ga0114129_10344711 | 3300009147 | Bacteria | 1975 |
| 168 | Ga0114129_10913622 | 3300009147 | Bacteria | 1111 |
| 169 | Ga0114129_13059416 | 3300009147 | Bacteria | 548 |
| 170 | Ga0105243_10090461 | 3300009148 | Bacteria | 2519 |
| 171 | Ga0105241_10224775 | 3300009174 | Bacteria | 1580 |
| 172 | Ga0105241_10909822 | 3300009174 | Bacteria | 818 |
| 173 | Ga0105242_10603294 | 3300009176 | Bacteria | 1061 |
| 174 | Ga0105242_12819068 | 3300009176 | Bacteria | 536 |
| 175 | Ga0105237_10108140 | 3300009545 | Bacteria | 2773 |
| 176 | Ga0105237_10174567 | 3300009545 | Bacteria | 2149 |
| 177 | Ga0105237_12167344 | 3300009545 | Bacteria | 565 |
| 178 | Ga0105238_10260771 | 3300009551 | Bacteria | 1712 |
| 179 | Ga0105249_10061295 | 3300009553 | Bacteria | 3452 |
| 180 | Ga0105249_10412529 | 3300009553 | Bacteria | 1383 |
| 181 | Ga0099796_10226747 | 3300010159 | Bacteria | 768 |
| 182 | Ga0105239_11374966 | 3300010375 | Bacteria | 815 |
| 183 | Ga0157324_1035676 | 3300012506 | Bacteria | 586 |
| 184 | Ga0154016_118439 | 3300013045 | Bacteria | 769 |
| 185 | Ga0154016_126409 | 3300013045 | Bacteria | 2884 |
| 186 | Ga0157373_10284059 | 3300013100 | Bacteria | 1173 |
| 187 | Ga0157373_10977570 | 3300013100 | Bacteria | 631 |
| 188 | Ga0157371_10000116 | 3300013102 | Bacteria | 121387 |
| 189 | Ga0157370_10000113 | 3300013104 | Bacteria | 94213 |
| 190 | Ga0157370_10003535 | 3300013104 | Bacteria | 18305 |
| 191 | Ga0157374_10070470 | 3300013296 | Bacteria | 3294 |
| 192 | Ga0157378_12234315 | 3300013297 | Bacteria | 598 |
| 193 | Ga0163162_10404034 | 3300013306 | Bacteria | 1499 |
| 194 | Ga0157372_10000934 | 3300013307 | Bacteria | 31887 |
| 195 | Ga0157372_10712663 | 3300013307 | Bacteria | 1167 |
| 196 | Ga0157375_10284339 | 3300013308 | Bacteria | 1817 |
| 197 | Ga0157375_11556615 | 3300013308 | Bacteria | 781 |
| 198 | Ga0157380_10551560 | 3300014326 | Bacteria | 1131 |
| 199 | Ga0157380_11204112 | 3300014326 | Bacteria | 801 |
| 200 | Ga0182008_10215370 | 3300014497 | Bacteria | 981 |
| 201 | Ga0157377_10003991 | 3300014745 | Bacteria | 6733 |
| 202 | Ga0157377_10303577 | 3300014745 | Bacteria | 1054 |
| 203 | Ga0182006_1002957 | 3300015261 | Bacteria | 8978 |
| 204 | Ga0182007_10164852 | 3300015262 | Bacteria | 759 |
| 205 | Ga0163161_10111557 | 3300017792 | Bacteria | 2045 |
| 206 | Ga0163161_10643358 | 3300017792 | Bacteria | 878 |
| 207 | Ga0184600_143334 | 3300019190 | Bacteria | 521 |
| 208 | Ga0184603_113096 | 3300019192 | Bacteria | 588 |
| 209 | Ga0197907_10096748 | 3300020069 | Bacteria | 3077 |
| 210 | Ga0197907_10461614 | 3300020069 | Bacteria | 796 |
| 211 | Ga0197907_11057503 | 3300020069 | Bacteria | 3277 |
| 212 | Ga0206356_10486280 | 3300020070 | Bacteria | 4370 |
| 213 | Ga0206356_10513374 | 3300020070 | Bacteria | 4308 |
| 214 | Ga0206356_10873524 | 3300020070 | Bacteria | 686 |
| 215 | Ga0206349_1662652 | 3300020075 | Bacteria | 3098 |
| 216 | Ga0206355_1023336 | 3300020076 | Bacteria | 5596 |
| 217 | Ga0206355_1392539 | 3300020076 | Bacteria | 3458 |
| 218 | Ga0206351_10684938 | 3300020077 | Bacteria | 2798 |
| 219 | Ga0206351_10916833 | 3300020077 | Bacteria | 8214 |
| 220 | Ga0206352_10572019 | 3300020078 | Bacteria | 703 |
| 221 | Ga0206352_10729265 | 3300020078 | Bacteria | 687 |
| 222 | Ga0206352_10974575 | 3300020078 | Bacteria | 2310 |
| 223 | Ga0206352_11336802 | 3300020078 | Bacteria | 1136 |
| 224 | Ga0206350_10211646 | 3300020080 | Bacteria | 4550 |
| 225 | Ga0206350_11498580 | 3300020080 | Bacteria | 1292 |
| 226 | Ga0206354_10021521 | 3300020081 | Bacteria | 9191 |
| 227 | Ga0206354_10880266 | 3300020081 | Bacteria | 1036 |
| 228 | Ga0206353_11167456 | 3300020082 | Bacteria | 890 |
| 229 | Ga0206353_11500459 | 3300020082 | Bacteria | 5453 |
| 230 | Ga0154015_1067364 | 3300020610 | Bacteria | 2589 |
| 231 | Ga0154015_1128747 | 3300020610 | Bacteria | 11172 |
| 232 | Ga0213872_10016326 | 3300021361 | Bacteria | 3447 |
| 233 | Ga0213874_10327120 | 3300021377 | Bacteria | 582 |
| 234 | Ga0213876_10296692 | 3300021384 | Bacteria | 859 |
| 235 | Ga0224712_10000044 | 3300022467 | Bacteria | 19276 |
| 236 | Ga0224712_10247596 | 3300022467 | Bacteria | 822 |
| 237 | Ga0247555_103641 | 3300023539 | Bacteria | 549 |
| 238 | Ga0247553_105158 | 3300023672 | Bacteria | 674 |
| 239 | Ga0209784_100003 | 3300025224 | Bacteria | 1379451 |
| 240 | Ga0209784_101717 | 3300025224 | Bacteria | 2627 |
| 241 | Ga0209566_100002 | 3300025225 | Bacteria | 2614868 |
| 242 | Ga0209566_100561 | 3300025225 | Bacteria | 24375 |
| 243 | Ga0209674_100008 | 3300025226 | Bacteria | 1076909 |
| 244 | Ga0209674_100122 | 3300025226 | Bacteria | 131720 |
| 245 | Ga0209674_104864 | 3300025226 | Bacteria | 2102 |
| 246 | Ga0209672_100191 | 3300025228 | Bacteria | 49747 |
| 247 | Ga0209672_100262 | 3300025228 | Bacteria | 38958 |
| 248 | Ga0209147_100002 | 3300025229 | Bacteria | 2158988 |
| 249 | Ga0209563_100004 | 3300025230 | Bacteria | 1814108 |
| 250 | Ga0209563_114310 | 3300025230 | Bacteria | 1022 |
| 251 | Ga0209258_100002 | 3300025242 | Bacteria | 2158988 |
| 252 | Ga0209646_1000022 | 3300025246 | Bacteria | 446621 |
| 253 | Ga0209026_1004035 | 3300025250 | Bacteria | 4545 |
| 254 | Ga0209026_1012816 | 3300025250 | Bacteria | 1448 |
| 255 | Ga0209677_100013 | 3300025253 | Bacteria | 548200 |
| 256 | Ga0209677_103383 | 3300025253 | Bacteria | 5220 |
| 257 | Ga0209148_1000021 | 3300025254 | Bacteria | 714645 |
| 258 | Ga0209759_1001746 | 3300025256 | Bacteria | 11158 |
| 259 | Ga0209759_1009787 | 3300025256 | Bacteria | 2868 |
| 260 | Ga0209759_1009842 | 3300025256 | Bacteria | 2857 |
| 261 | Ga0209455_1000021 | 3300025272 | Bacteria | 699993 |
| 262 | Ga0209673_1006937 | 3300025273 | Bacteria | 5353 |
| 263 | Ga0209673_1120883 | 3300025273 | Bacteria | 534 |
| 264 | Ga0209130_1001018 | 3300025284 | Bacteria | 21612 |
| 265 | Ga0209675_1002884 | 3300025291 | Bacteria | 8522 |
| 266 | Ga0209676_1004231 | 3300025292 | Bacteria | 8115 |
| 267 | Ga0209564_1000003 | 3300025295 | Bacteria | 1585848 |
| 268 | Ga0209564_1054880 | 3300025295 | Bacteria | 937 |
| 269 | Ga0209050_1042299 | 3300025298 | Bacteria | 1245 |
| 270 | Ga0207426_1005325 | 3300025302 | Bacteria | 5910 |
| 271 | Ga0209051_1004959 | 3300025303 | Bacteria | 7955 |
| 272 | Ga0209257_1017381 | 3300025304 | Bacteria | 2837 |
| 273 | Ga0207697_10188647 | 3300025315 | Bacteria | 905 |
| 274 | Ga0207656_10476970 | 3300025321 | Bacteria | 632 |
| 275 | Ga0207713_1003258 | 3300025735 | Bacteria | 11184 |
| 276 | Ga0207682_10165497 | 3300025893 | Bacteria | 1004 |
| 277 | Ga0207692_10046539 | 3300025898 | Bacteria | 2175 |
| 278 | Ga0207692_10268318 | 3300025898 | Bacteria | 1028 |
| 279 | Ga0207642_10019006 | 3300025899 | Bacteria | 2651 |
| 280 | Ga0207642_10376384 | 3300025899 | Bacteria | 844 |
| 281 | Ga0207642_10870093 | 3300025899 | Bacteria | 576 |
| 282 | Ga0207688_10058923 | 3300025901 | Bacteria | 2162 |
| 283 | Ga0207688_10217995 | 3300025901 | Bacteria | 1149 |
| 284 | Ga0207647_10096771 | 3300025904 | Bacteria | 1756 |
| 285 | Ga0207699_10817504 | 3300025906 | Bacteria | 685 |
| 286 | Ga0207645_10080293 | 3300025907 | Bacteria | 2091 |
| 287 | Ga0207645_10149669 | 3300025907 | Bacteria | 1523 |
| 288 | Ga0207645_10350479 | 3300025907 | Bacteria | 988 |
| 289 | Ga0207643_10052674 | 3300025908 | Bacteria | 2312 |
| 290 | Ga0207643_10296139 | 3300025908 | Bacteria | 1006 |
| 291 | Ga0207705_10004497 | 3300025909 | Bacteria | 10541 |
| 292 | Ga0207705_10048443 | 3300025909 | Bacteria | 3057 |
| 293 | Ga0207705_10102021 | 3300025909 | Bacteria | 2111 |
| 294 | Ga0207684_11338875 | 3300025910 | Bacteria | 588 |
| 295 | Ga0207654_10129305 | 3300025911 | Bacteria | 1596 |
| 296 | Ga0207654_10262477 | 3300025911 | Bacteria | 1162 |
| 297 | Ga0207654_10444638 | 3300025911 | Bacteria | 908 |
| 298 | Ga0207654_10514987 | 3300025911 | Bacteria | 846 |
| 299 | Ga0207707_10003333 | 3300025912 | Bacteria | 14259 |
| 300 | Ga0207707_10017964 | 3300025912 | Bacteria | 6165 |
| 301 | Ga0207707_10352596 | 3300025912 | Bacteria | 1268 |
| 302 | Ga0207707_10431661 | 3300025912 | Bacteria | 1128 |
| 303 | Ga0207695_10007787 | 3300025913 | Bacteria | 13564 |
| 304 | Ga0207695_10167799 | 3300025913 | Bacteria | 2122 |
| 305 | Ga0207695_11478049 | 3300025913 | Bacteria | 560 |
| 306 | Ga0207671_10957107 | 3300025914 | Bacteria | 676 |
| 307 | Ga0207671_11416962 | 3300025914 | Bacteria | 538 |
| 308 | Ga0207693_10935222 | 3300025915 | Bacteria | 664 |
| 309 | Ga0207663_10632400 | 3300025916 | Bacteria | 843 |
| 310 | Ga0207660_11295582 | 3300025917 | Bacteria | 592 |
| 311 | Ga0207660_11551235 | 3300025917 | Bacteria | 534 |
| 312 | Ga0207662_10065469 | 3300025918 | Bacteria | 2188 |
| 313 | Ga0207662_10074935 | 3300025918 | Bacteria | 2055 |
| 314 | Ga0207662_11288732 | 3300025918 | Bacteria | 519 |
| 315 | Ga0207657_10376439 | 3300025919 | Bacteria | 1118 |
| 316 | Ga0207649_10000019 | 3300025920 | Bacteria | 212682 |
| 317 | Ga0207649_10514318 | 3300025920 | Bacteria | 912 |
| 318 | Ga0207646_10904070 | 3300025922 | Bacteria | 783 |
| 319 | Ga0207681_10006318 | 3300025923 | Bacteria | 7273 |
| 320 | Ga0207681_11626813 | 3300025923 | Bacteria | 540 |
| 321 | Ga0207694_10024154 | 3300025924 | Bacteria | 4616 |
| 322 | Ga0207694_10061904 | 3300025924 | Bacteria | 2913 |
| 323 | Ga0207694_10840093 | 3300025924 | Bacteria | 776 |
| 324 | Ga0207659_10117562 | 3300025926 | Bacteria | 2032 |
| 325 | Ga0207687_10179688 | 3300025927 | Bacteria | 1638 |
| 326 | Ga0207687_11510270 | 3300025927 | Bacteria | 577 |
| 327 | Ga0207700_10000495 | 3300025928 | Bacteria | 23059 |
| 328 | Ga0207700_10009038 | 3300025928 | Bacteria | 6203 |
| 329 | Ga0207664_11280642 | 3300025929 | Bacteria | 652 |
| 330 | Ga0207644_10598831 | 3300025931 | Bacteria | 915 |
| 331 | Ga0207644_10878043 | 3300025931 | Bacteria | 751 |
| 332 | Ga0207644_11664126 | 3300025931 | Bacteria | 535 |
| 333 | Ga0207690_10004220 | 3300025932 | Bacteria | 8494 |
| 334 | Ga0207690_10083643 | 3300025932 | Bacteria | 2235 |
| 335 | Ga0207690_10092771 | 3300025932 | Bacteria | 2138 |
| 336 | Ga0207690_10414985 | 3300025932 | Bacteria | 1076 |
| 337 | Ga0207690_11063113 | 3300025932 | Bacteria | 674 |
| 338 | Ga0207706_10818677 | 3300025933 | Bacteria | 790 |
| 339 | Ga0207706_10926708 | 3300025933 | Bacteria | 735 |
| 340 | Ga0207686_10017691 | 3300025934 | Bacteria | 4020 |
| 341 | Ga0207686_10341938 | 3300025934 | Bacteria | 1124 |
| 342 | Ga0207686_10653498 | 3300025934 | Bacteria | 832 |
| 343 | Ga0207686_10975756 | 3300025934 | Bacteria | 687 |
| 344 | Ga0207686_11642537 | 3300025934 | Bacteria | 531 |
| 345 | Ga0207709_10304272 | 3300025935 | Bacteria | 1187 |
| 346 | Ga0207709_10513108 | 3300025935 | Bacteria | 937 |
| 347 | Ga0207709_10732430 | 3300025935 | Bacteria | 794 |
| 348 | Ga0207670_10016847 | 3300025936 | Bacteria | 4403 |
| 349 | Ga0207670_10095265 | 3300025936 | Bacteria | 2114 |
| 350 | Ga0207670_10162231 | 3300025936 | Bacteria | 1669 |
| 351 | Ga0207670_10319587 | 3300025936 | Bacteria | 1221 |
| 352 | Ga0207670_10500308 | 3300025936 | Bacteria | 987 |
| 353 | Ga0207670_11183547 | 3300025936 | Bacteria | 647 |
| 354 | Ga0207670_11314179 | 3300025936 | Bacteria | 613 |
| 355 | Ga0207670_11387470 | 3300025936 | Bacteria | 596 |
| 356 | Ga0207669_10003349 | 3300025937 | Bacteria | 6939 |
| 357 | Ga0207669_10067218 | 3300025937 | Bacteria | 2233 |
| 358 | Ga0207669_10215681 | 3300025937 | Bacteria | 1404 |
| 359 | Ga0207669_10589111 | 3300025937 | Bacteria | 902 |
| 360 | Ga0207669_11926550 | 3300025937 | Bacteria | 505 |
| 361 | Ga0207704_10186636 | 3300025938 | Bacteria | 1504 |
| 362 | Ga0207704_10419248 | 3300025938 | Bacteria | 1061 |
| 363 | Ga0207704_10702915 | 3300025938 | Bacteria | 837 |
| 364 | Ga0207704_11369597 | 3300025938 | Bacteria | 606 |
| 365 | Ga0207691_10009168 | 3300025940 | Bacteria | 9498 |
| 366 | Ga0207691_10048698 | 3300025940 | Bacteria | 3884 |
| 367 | Ga0207691_10066699 | 3300025940 | Bacteria | 3256 |
| 368 | Ga0207691_10089068 | 3300025940 | Bacteria | 2768 |
| 369 | Ga0207711_10177084 | 3300025941 | Bacteria | 1938 |
| 370 | Ga0207689_10146813 | 3300025942 | Bacteria | 1943 |
| 371 | Ga0207689_10348701 | 3300025942 | Bacteria | 1230 |
| 372 | Ga0207679_10000001 | 3300025945 | Bacteria | 777444 |
| 373 | Ga0207667_10000448 | 3300025949 | Bacteria | 55202 |
| 374 | Ga0207667_10033006 | 3300025949 | Bacteria | 5571 |
| 375 | Ga0207651_10090054 | 3300025960 | Bacteria | 2242 |
| 376 | Ga0207651_10874916 | 3300025960 | Bacteria | 799 |
| 377 | Ga0207651_11656330 | 3300025960 | Bacteria | 576 |
| 378 | Ga0207712_10048652 | 3300025961 | Bacteria | 2950 |
| 379 | Ga0207712_10311319 | 3300025961 | Bacteria | 1296 |
| 380 | Ga0207668_10070816 | 3300025972 | Bacteria | 2488 |
| 381 | Ga0207640_10000524 | 3300025981 | Bacteria | 23157 |
| 382 | Ga0207658_10127539 | 3300025986 | Bacteria | 2039 |
| 383 | Ga0207677_11385106 | 3300026023 | Bacteria | 647 |
| 384 | Ga0207703_10060947 | 3300026035 | Bacteria | 3087 |
| 385 | Ga0207703_10398177 | 3300026035 | Bacteria | 1277 |
| 386 | Ga0207639_10009210 | 3300026041 | Bacteria | 6806 |
| 387 | Ga0207639_10077667 | 3300026041 | Bacteria | 2618 |
| 388 | Ga0207678_10000001 | 3300026067 | Bacteria | 433184 |
| 389 | Ga0207678_10270872 | 3300026067 | Bacteria | 1456 |
| 390 | Ga0207678_10799333 | 3300026067 | Bacteria | 833 |
| 391 | Ga0207678_11299199 | 3300026067 | Bacteria | 644 |
| 392 | Ga0207708_10109603 | 3300026075 | Bacteria | 2142 |
| 393 | Ga0207708_10135070 | 3300026075 | Bacteria | 1931 |
| 394 | Ga0207708_10558744 | 3300026075 | Bacteria | 966 |
| 395 | Ga0207708_10730771 | 3300026075 | Bacteria | 848 |
| 396 | Ga0207708_11107100 | 3300026075 | Bacteria | 691 |
| 397 | Ga0207708_11705663 | 3300026075 | Bacteria | 553 |
| 398 | Ga0207708_11994386 | 3300026075 | Bacteria | 508 |
| 399 | Ga0207702_10000009 | 3300026078 | Bacteria | 305906 |
| 400 | Ga0207702_10352718 | 3300026078 | Bacteria | 1408 |
| 401 | Ga0207702_11596169 | 3300026078 | Bacteria | 646 |
| 402 | Ga0207702_12044860 | 3300026078 | Bacteria | 563 |
| 403 | Ga0207648_10002987 | 3300026089 | Bacteria | 17871 |
| 404 | Ga0207648_10023686 | 3300026089 | Bacteria | 5495 |
| 405 | Ga0207648_10329467 | 3300026089 | Bacteria | 1373 |
| 406 | Ga0207648_10628130 | 3300026089 | Bacteria | 992 |
| 407 | Ga0207648_11992140 | 3300026089 | Bacteria | 542 |
| 408 | Ga0207676_10226347 | 3300026095 | Bacteria | 1669 |
| 409 | Ga0207674_10045617 | 3300026116 | Bacteria | 4507 |
| 410 | Ga0207674_10054589 | 3300026116 | Bacteria | 4067 |
| 411 | Ga0207675_100000651 | 3300026118 | Bacteria | 34173 |
| 412 | Ga0207675_100750097 | 3300026118 | Bacteria | 987 |
| 413 | Ga0207675_101326854 | 3300026118 | Bacteria | 740 |
| 414 | Ga0207675_102621661 | 3300026118 | Bacteria | 513 |
| 415 | Ga0207683_10429447 | 3300026121 | Bacteria | 1217 |
| 416 | Ga0207683_11554482 | 3300026121 | Bacteria | 610 |
| 417 | Ga0207683_12135017 | 3300026121 | Bacteria | 508 |
| 418 | Ga0207698_10009939 | 3300026142 | Bacteria | 6086 |
| 419 | Ga0207698_10011610 | 3300026142 | Bacteria | 5720 |
| 420 | Ga0207698_10047010 | 3300026142 | Bacteria | 3265 |
| 421 | Ga0209973_1067432 | 3300027252 | Bacteria | 557 |
| 422 | Ga0209969_1045956 | 3300027360 | Bacteria | 682 |
| 423 | Ga0209967_1057407 | 3300027364 | Bacteria | 602 |
| 424 | Ga0209981_1026343 | 3300027378 | Bacteria | 844 |
| 425 | Ga0209996_1010049 | 3300027395 | Bacteria | 1252 |
| 426 | Ga0210000_1006410 | 3300027462 | Bacteria | 1713 |
| 427 | Ga0209999_1014606 | 3300027543 | Bacteria | 1426 |
| 428 | Ga0209999_1113214 | 3300027543 | Bacteria | 531 |
| 429 | Ga0209966_1013884 | 3300027695 | Bacteria | 1497 |
| 430 | Ga0209813_10228650 | 3300027866 | Bacteria | 699 |
| 431 | Ga0209974_10007790 | 3300027876 | Bacteria | 3682 |
| 432 | Ga0209974_10261786 | 3300027876 | Bacteria | 653 |
| 433 | Ga0207428_10010038 | 3300027907 | Bacteria | 8474 |
| 434 | Ga0207428_10019374 | 3300027907 | Bacteria | 5803 |
| 435 | Ga0268266_10621820 | 3300028379 | Bacteria | 1038 |
| 436 | Ga0268265_10000781 | 3300028380 | Bacteria | 30469 |
| 437 | Ga0268264_10890793 | 3300028381 | Bacteria | 893 |
| 438 | Ga0268264_11272816 | 3300028381 | Bacteria | 745 |
| 439 | Ga0307517_10090243 | 3300028786 | Bacteria | 2516 |
| 440 | Ga0307515_10005265 | 3300028794 | Bacteria | 26299 |
| 441 | Ga0265338_10000437 | 3300028800 | Bacteria | 74941 |
| 442 | Ga0265338_10345137 | 3300028800 | Bacteria | 1072 |
| 443 | Ga0265338_10546694 | 3300028800 | Bacteria | 811 |
| 444 | Ga0265775_103433 | 3300030762 | Bacteria | 856 |
| 445 | Ga0265777_120507 | 3300030877 | Bacteria | 544 |
| 446 | Ga0265340_10113759 | 3300031247 | Bacteria | 1249 |
| 447 | Ga0265339_10070299 | 3300031249 | Bacteria | 1867 |
| 448 | Ga0265327_10108566 | 3300031251 | Bacteria | 1329 |
| 449 | Ga0307509_10313403 | 3300031507 | Bacteria | 1310 |
| 450 | Ga0307408_100000045 | 3300031548 | Bacteria | 169484 |
| 451 | Ga0307408_100120473 | 3300031548 | Bacteria | 2032 |
| 452 | Ga0307408_100630004 | 3300031548 | Bacteria | 956 |
| 453 | Ga0307408_101427371 | 3300031548 | Bacteria | 652 |
| 454 | Ga0307408_101599402 | 3300031548 | Bacteria | 619 |
| 455 | Ga0307508_10088170 | 3300031616 | Bacteria | 2687 |
| 456 | Ga0316575_10006460 | 3300031665 | Bacteria | 4219 |
| 457 | Ga0316575_10190708 | 3300031665 | Bacteria | 852 |
| 458 | Ga0316579_10203284 | 3300031691 | Bacteria | 958 |
| 459 | Ga0316576_10002247 | 3300031727 | Bacteria | 10925 |
| 460 | Ga0316576_10093005 | 3300031727 | Bacteria | 2247 |
| 461 | Ga0316578_10007566 | 3300031728 | Bacteria | 5457 |
| 462 | Ga0316578_10011211 | 3300031728 | Bacteria | 4679 |
| 463 | Ga0307516_10000497 | 3300031730 | Bacteria | 52295 |
| 464 | Ga0307405_10278881 | 3300031731 | Bacteria | 1257 |
| 465 | Ga0307405_10554047 | 3300031731 | Bacteria | 931 |
| 466 | Ga0307405_10691956 | 3300031731 | Bacteria | 843 |
| 467 | Ga0316577_10355600 | 3300031733 | Bacteria | 831 |
| 468 | Ga0316577_10864253 | 3300031733 | Bacteria | 513 |
| 469 | Ga0307410_11217328 | 3300031852 | Bacteria | 656 |
| 470 | Ga0307410_11792653 | 3300031852 | Bacteria | 545 |
| 471 | Ga0307406_10393856 | 3300031901 | Bacteria | 1096 |
| 472 | Ga0307407_10240309 | 3300031903 | Bacteria | 1235 |
| 473 | Ga0307407_10308579 | 3300031903 | Bacteria | 1106 |
| 474 | Ga0307407_11357904 | 3300031903 | Bacteria | 559 |
| 475 | Ga0307407_11507949 | 3300031903 | Bacteria | 532 |
| 476 | Ga0307412_10857053 | 3300031911 | Bacteria | 793 |
| 477 | Ga0307412_11450827 | 3300031911 | Bacteria | 622 |
| 478 | Ga0307412_11988103 | 3300031911 | Bacteria | 538 |
| 479 | Ga0307409_101229868 | 3300031995 | Bacteria | 773 |
| 480 | Ga0307416_100110795 | 3300032002 | Bacteria | 2418 |
| 481 | Ga0307416_100285191 | 3300032002 | Bacteria | 1631 |
| 482 | Ga0307416_100438841 | 3300032002 | Bacteria | 1355 |
| 483 | Ga0307416_100901108 | 3300032002 | Bacteria | 984 |
| 484 | Ga0307416_101752088 | 3300032002 | Bacteria | 725 |
| 485 | Ga0307416_102269369 | 3300032002 | Bacteria | 643 |
| 486 | Ga0307416_103573097 | 3300032002 | Bacteria | 520 |
| 487 | Ga0307414_11105717 | 3300032004 | Bacteria | 732 |
| 488 | Ga0307411_10388379 | 3300032005 | Bacteria | 1150 |
| 489 | Ga0307411_10497003 | 3300032005 | Bacteria | 1030 |
| 490 | Ga0307411_12320205 | 3300032005 | Bacteria | 504 |
| 491 | Ga0307415_102196916 | 3300032126 | Bacteria | 540 |
| 492 | Ga0316585_10091901 | 3300032137 | Bacteria | 992 |
| 493 | Ga0316580_10011155 | 3300032139 | Bacteria | 2723 |
| 494 | Ga0316593_10003965 | 3300032168 | Bacteria | 3743 |
| 495 | Ga0316593_10089441 | 3300032168 | Bacteria | 1083 |
| 496 | Ga0307507_10019824 | 3300033179 | Bacteria | 7557 |
| 497 | Ga0316592_1134577 | 3300033524 | Bacteria | 578 |
| 498 | Ga0316586_1103683 | 3300033527 | Bacteria | 545 |
| 499 | Ga0316588_1097460 | 3300033528 | Bacteria | 735 |
| 500 | Ga0316588_1123078 | 3300033528 | Bacteria | 657 |
| 501 | Ga0316587_1002090 | 3300033529 | Bacteria | 2610 |
| 502 | Ga0316587_1011610 | 3300033529 | Bacteria | 1424 |
| 503 | Ga0316587_1019366 | 3300033529 | Bacteria | 1150 |
| 504 | Ga0316596_1034527 | 3300033541 | Bacteria | 1321 |
| 505 | Ga0373928_0191453 | 3300035084 | Bacteria | 586 |
| 506 | Ga0373928_0228638 | 3300035084 | Bacteria | 547 |
| 507 | Ga0373934_0145630 | 3300035086 | Bacteria | 969 |
| 508 | Ga0373952_0159408 | 3300035092 | Bacteria | 638 |
| 509 | Ga0373923_0031333 | 3300035111 | Bacteria | 2143 |
| 510 | Ga0373923_0382017 | 3300035111 | Bacteria | 676 |
| 511 | Ga0373932_0126165 | 3300035112 | Bacteria | 858 |
| 512 | Ga0373939_0030774 | 3300035114 | Bacteria | 1546 |
| 513 | Ga0373941_0413071 | 3300035115 | Bacteria | 560 |
| 514 | Ga0373956_0000024 | 3300035119 | Bacteria | 47805 |
| 515 | Ga0373956_0203203 | 3300035119 | Bacteria | 939 |
| 516 | Ga0373956_0518955 | 3300035119 | Bacteria | 569 |
| 517 | Ga0373957_0205695 | 3300035120 | Bacteria | 821 |
| 518 | Ga0373955_0046538 | 3300035172 | Bacteria | 2345 |
| 519 | Ga0373955_0139157 | 3300035172 | Bacteria | 1422 |
| 520 | Ga0373962_0148338 | 3300035242 | Bacteria | 766 |
| 521 | Ga0316574_0001833 | 3300035398 | Bacteria | 10353 |
| 522 | Ga0316574_0005586 | 3300035398 | Bacteria | 6719 |
| 523 | Ga0316574_0052189 | 3300035398 | Bacteria | 2549 |
| 524 | Ga0316574_0357223 | 3300035398 | Bacteria | 924 |
| 525 | Ga0316574_0504742 | 3300035398 | Bacteria | 754 |
| 526 | Ga0373924_0045660 | 3300035410 | Bacteria | 1802 |
| 527 | Ga0373931_0091770 | 3300035691 | Bacteria | 1693 |
| 528 | Ga0373931_0314507 | 3300035691 | Bacteria | 971 |
| 529 | Ga0373931_0372930 | 3300035691 | Bacteria | 898 |
| 530 | Ga0373931_1108584 | 3300035691 | Bacteria | 539 |
| 531 | Ga0373927_0042117 | 3300035695 | Bacteria | 2960 |
| 532 | Ga0373933_0001797 | 3300035724 | Bacteria | 12425 |
| 533 | Ga0373933_0002861 | 3300035724 | Bacteria | 9637 |
| 534 | Ga0373933_0081365 | 3300035724 | Bacteria | 1987 |
| 535 | Ga0373947_0310657 | 3300035725 | Bacteria | 1053 |
| 536 | Ga0373937_0008435 | 3300036401 | Bacteria | 8956 |
| 537 | Ga0373937_0250628 | 3300036401 | Bacteria | 1669 |
| 538 | Ga0373937_0419245 | 3300036401 | Bacteria | 1270 |
| 539 | Ga0373937_0877475 | 3300036401 | Bacteria | 846 |
| 540 | Ga0316582_0006883 | 3300036647 | Bacteria | 6013 |
| 541 | Ga0316582_0021935 | 3300036647 | Bacteria | 3783 |
| 542 | Ga0316584_0074316 | 3300036712 | Bacteria | 2548 |
| 543 | Ga0373925_0023592 | 3300037068 | Bacteria | 4489 |
| 544 | Ga0395899_0004578 | 3300037312 | Bacteria | 10779 |
| 545 | Ga0395899_0182624 | 3300037312 | Bacteria | 1472 |
| 546 | Ga0395900_0011866 | 3300037418 | Bacteria | 8912 |
| 547 | Ga0395900_1535479 | 3300037418 | Bacteria | 578 |
| 548 | Ga0395898_0106330 | 3300037466 | Bacteria | 2691 |
| 549 | Ga0395905_0041433 | 3300037471 | Bacteria | 4321 |
| 550 | Ga0395905_0070324 | 3300037471 | Bacteria | 3279 |
| 551 | Ga0395901_0000067 | 3300038443 | Bacteria | 144966 |
| 552 | Ga0395901_0000133 | 3300038443 | Bacteria | 96281 |
| 553 | Ga0395901_0040588 | 3300038443 | Bacteria | 4821 |
| 554 | Ga0400488_49855 | 3300038741 | Bacteria | 1276 |
| 555 | Ga0400488_61282 | 3300038741 | Bacteria | 1247 |
| 556 | Ga0400483_089547 | 3300039062 | Bacteria | 1114 |
| 557 | Ga0400483_166330 | 3300039062 | Bacteria | 1540 |
| 558 | Ga0400483_232620 | 3300039062 | Bacteria | 2105 |
| 559 | Ga0436365_1415897 | 3300039437 | Bacteria | 1117 |
| 560 | Ga0436360_0397467 | 3300039438 | Bacteria | 519 |
| 561 | Ga0436361_0175365 | 3300039447 | Bacteria | 3447 |
| 562 | Ga0436361_0445788 | 3300039447 | Bacteria | 9657 |
| 563 | Ga0436361_0519408 | 3300039447 | Bacteria | 562 |
| 564 | Ga0436363_1636299 | 3300039450 | Bacteria | 594 |
| 565 | Ga0439453_0019803 | 3300041408 | Bacteria | 1201 |
| 566 | Ga0451787_551626 | 3300041441 | Bacteria | 591 |
| 567 | Ga0451791_1922986 | 3300041451 | Bacteria | 1218 |
| 568 | Ga0451793_1901220 | 3300041452 | Bacteria | 510 |
| 569 | Ga0451800_1202501 | 3300041459 | Bacteria | 1197 |
| 570 | Ga0451802_0617498 | 3300041460 | Bacteria | 895 |
| 571 | Ga0451805_043617 | 3300041461 | Bacteria | 792 |
| 572 | Ga0451807_0798448 | 3300041486 | Bacteria | 1149 |
| 573 | Ga0451807_1988912 | 3300041486 | Bacteria | 1548 |
| 574 | Ga0451807_2587691 | 3300041486 | Bacteria | 518 |
| 575 | Ga0451835_0942726 | 3300041492 | Bacteria | 511 |
| 576 | Ga0451837_0972705 | 3300041494 | Bacteria | 553 |
| 577 | Ga0451849_0100067 | 3300041505 | Bacteria | 671 |
| 578 | Ga0451849_0963451 | 3300041505 | Bacteria | 580 |
| 579 | Ga0451853_2875636 | 3300041512 | Bacteria | 538 |
| 580 | Ga0439441_001465 | 3300042001 | Bacteria | 3090 |
| 581 | Ga0439441_075255 | 3300042001 | Bacteria | 729 |
| 582 | Ga0439441_140780 | 3300042001 | Bacteria | 564 |
| 583 | Ga0439441_157897 | 3300042001 | Bacteria | 537 |
| 584 | Ga0439432_069865 | 3300042006 | Bacteria | 1072 |
| 585 | Ga0450912_017126 | 3300042116 | Bacteria | 676 |
| 586 | Ga0450898_087457 | 3300042134 | Bacteria | 640 |
| 587 | Ga0439446_0078567 | 3300042156 | Bacteria | 1019 |
| 588 | Ga0439446_0372046 | 3300042156 | Bacteria | 512 |
| 589 | Ga0439435_0002787 | 3300042436 | Bacteria | 3530 |
| 590 | Ga0439435_0003953 | 3300042436 | Bacteria | 3145 |
| 591 | Ga0439444_0119056 | 3300042437 | Bacteria | 614 |
| 592 | Ga0439464_0013042 | 3300042439 | Bacteria | 2220 |
| 593 | Ga0439460_0002676 | 3300042461 | Bacteria | 4298 |
| 594 | Ga0439460_0002980 | 3300042461 | Bacteria | 4085 |
| 595 | Ga0450916_097199 | 3300042530 | Bacteria | 519 |
| 596 | Ga0450893_0056963 | 3300042532 | Bacteria | 741 |
| 597 | Ga0450901_004179 | 3300042533 | Bacteria | 1495 |
| 598 | Ga0451577_0000743 | 3300042876 | Bacteria | 50109 |
| 599 | Ga0451577_0130736 | 3300042876 | Bacteria | 2252 |
| 600 | Ga0451577_0264911 | 3300042876 | Bacteria | 1556 |
| 601 | Ga0451577_0450751 | 3300042876 | Bacteria | 1168 |
| 602 | Ga0451577_0590509 | 3300042876 | Bacteria | 1008 |
| 603 | Ga0451577_0760264 | 3300042876 | Bacteria | 876 |
| 604 | Ga0451577_0794399 | 3300042876 | Bacteria | 855 |
| 605 | Ga0466969_0035504 | 3300044656 | Bacteria | 2521 |
| 606 | Ga0466969_0083388 | 3300044656 | Bacteria | 1522 |
| 607 | Ga0466969_0125530 | 3300044656 | Bacteria | 1192 |
| 608 | Ga0466972_0380629 | 3300044658 | Bacteria | 661 |
| 609 | Ga0466965_0018466 | 3300044683 | Bacteria | 3343 |
| 610 | Ga0466966_0000067 | 3300044684 | Bacteria | 69077 |
| 611 | Ga0466966_0032486 | 3300044684 | Bacteria | 3382 |
| 612 | Ga0466966_0038100 | 3300044684 | Bacteria | 3098 |
| 613 | Ga0466966_0717331 | 3300044684 | Bacteria | 603 |
| 614 | Ga0466966_0849720 | 3300044684 | Bacteria | 550 |
| 615 | Ga0466961_0000526 | 3300044693 | Bacteria | 24271 |
| 616 | Ga0466961_0004076 | 3300044693 | Bacteria | 9134 |
| 617 | Ga0466961_0019938 | 3300044693 | Bacteria | 4316 |
| 618 | Ga0466961_0054694 | 3300044693 | Bacteria | 2545 |
| 619 | Ga0466963_0053430 | 3300044694 | Bacteria | 2682 |
| 620 | Ga0466963_0056541 | 3300044694 | Bacteria | 2611 |
| 621 | Ga0466964_0040415 | 3300044706 | Bacteria | 1883 |
| 622 | Ga0466964_0568719 | 3300044706 | Bacteria | 618 |
| 623 | Ga0466964_0834294 | 3300044706 | Bacteria | 523 |
| 624 | Ga0453684_0002107 | 3300044712 | Bacteria | 50213 |
| 625 | Ga0453684_0002541 | 3300044712 | Bacteria | 43926 |
| 626 | Ga0453684_2135829 | 3300044712 | Bacteria | 561 |
| 627 | Ga0466971_0001855 | 3300044719 | Bacteria | 8989 |
| 628 | Ga0466968_0054594 | 3300044735 | Bacteria | 1713 |
| 629 | Ga0466968_0207575 | 3300044735 | Bacteria | 919 |
| 630 | Ga0466970_0007036 | 3300044765 | Bacteria | 5631 |
| 631 | Ga0466970_0193481 | 3300044765 | Bacteria | 1131 |
| 632 | Ga0466970_0373307 | 3300044765 | Bacteria | 811 |
| 633 | Ga0466957_0022761 | 3300044842 | Bacteria | 3699 |
| 634 | Ga0466957_0050029 | 3300044842 | Bacteria | 2542 |
| 635 | Ga0466957_0191677 | 3300044842 | Bacteria | 1339 |
| 636 | Ga0466959_0003982 | 3300045049 | Bacteria | 9816 |
| 637 | Ga0466959_0017713 | 3300045049 | Bacteria | 5224 |
| 638 | Ga0466959_0667145 | 3300045049 | Bacteria | 698 |
| 639 | Ga0451576_0004451 | 3300045051 | Bacteria | 18188 |
| 640 | Ga0451576_0017229 | 3300045051 | Bacteria | 7947 |
| 641 | Ga0451576_0045166 | 3300045051 | Bacteria | 4641 |
| 642 | Ga0451576_1646353 | 3300045051 | Bacteria | 665 |
| 643 | Ga0466958_0004016 | 3300045836 | Bacteria | 7711 |
| 644 | Ga0466958_0041673 | 3300045836 | Bacteria | 2762 |
| 645 | Ga0466958_0373082 | 3300045836 | Bacteria | 919 |
| 646 | Ga0466967_0281748 | 3300045976 | Bacteria | 1595 |
| 647 | Ga0466967_0895544 | 3300045976 | Bacteria | 882 |
| 648 | Ga0466967_0955052 | 3300045976 | Bacteria | 853 |
| 649 | Ga0495592_0001313 | 3300046454 | Bacteria | 17257 |
| 650 | Ga0495592_0001592 | 3300046454 | Bacteria | 15869 |
| 651 | Ga0495592_0479801 | 3300046454 | Bacteria | 775 |
| 652 | Ga0495603_0011812 | 3300046455 | Bacteria | 5284 |
| 653 | Ga0495603_0040511 | 3300046455 | Bacteria | 2788 |
| 654 | Ga0495603_0654510 | 3300046455 | Bacteria | 601 |
| 655 | Ga0495603_0696925 | 3300046455 | Bacteria | 581 |
| 656 | Ga0495590_0014064 | 3300046457 | Bacteria | 2930 |
| 657 | Ga0495590_0355523 | 3300046457 | Bacteria | 557 |
| 658 | Ga0495591_005751 | 3300046458 | Bacteria | 5651 |
| 659 | Ga0495591_092749 | 3300046458 | Bacteria | 756 |
| 660 | Ga0495629_0001354 | 3300046459 | Bacteria | 19293 |
| 661 | Ga0495629_0008262 | 3300046459 | Bacteria | 7654 |
| 662 | Ga0495629_0090926 | 3300046459 | Bacteria | 2129 |
| 663 | Ga0495629_0426703 | 3300046459 | Bacteria | 899 |
| 664 | Ga0495641_0030091 | 3300046461 | Bacteria | 2608 |
| 665 | Ga0495651_0001164 | 3300046462 | Bacteria | 20299 |
| 666 | Ga0495651_0003321 | 3300046462 | Bacteria | 12354 |
| 667 | Ga0495651_0032641 | 3300046462 | Bacteria | 4060 |
| 668 | Ga0495651_0313471 | 3300046462 | Bacteria | 1048 |
| 669 | Ga0495653_0001712 | 3300046463 | Bacteria | 17277 |
| 670 | Ga0495653_0055383 | 3300046463 | Bacteria | 3026 |
| 671 | Ga0495653_0417694 | 3300046463 | Bacteria | 849 |
| 672 | Ga0495650_0005992 | 3300046471 | Bacteria | 7698 |
| 673 | Ga0495650_0039110 | 3300046471 | Bacteria | 2049 |
| 674 | Ga0495580_0002474 | 3300046472 | Bacteria | 16116 |
| 675 | Ga0495580_0025511 | 3300046472 | Bacteria | 4320 |
| 676 | Ga0495580_0099531 | 3300046472 | Bacteria | 2022 |
| 677 | Ga0495580_0107541 | 3300046472 | Bacteria | 1937 |
| 678 | Ga0495580_0118557 | 3300046472 | Bacteria | 1837 |
| 679 | Ga0495580_0291872 | 3300046472 | Bacteria | 1111 |
| 680 | Ga0495582_0017320 | 3300046473 | Bacteria | 3943 |
| 681 | Ga0495582_0131448 | 3300046473 | Bacteria | 1414 |
| 682 | Ga0495582_0233271 | 3300046473 | Bacteria | 1054 |
| 683 | Ga0495639_0273857 | 3300046475 | Bacteria | 838 |
| 684 | Ga0495662_0039184 | 3300046476 | Bacteria | 2289 |
| 685 | Ga0495662_0041092 | 3300046476 | Bacteria | 2233 |
| 686 | Ga0495662_0068173 | 3300046476 | Bacteria | 1722 |
| 687 | Ga0495662_0125752 | 3300046476 | Bacteria | 1259 |
| 688 | Ga0495664_0003770 | 3300046477 | Bacteria | 8269 |
| 689 | Ga0495664_0275698 | 3300046477 | Bacteria | 1016 |
| 690 | Ga0495584_0147566 | 3300046491 | Bacteria | 1195 |
| 691 | Ga0495596_0032260 | 3300046500 | Bacteria | 2089 |
| 692 | Ga0495596_0169647 | 3300046500 | Bacteria | 848 |
| 693 | Ga0495596_0266694 | 3300046500 | Bacteria | 665 |
| 694 | Ga0495606_0080138 | 3300046507 | Bacteria | 2032 |
| 695 | Ga0495606_0251040 | 3300046507 | Bacteria | 981 |
| 696 | Ga0495608_0003166 | 3300046511 | Bacteria | 11770 |
| 697 | Ga0495608_0007794 | 3300046511 | Bacteria | 7537 |
| 698 | Ga0495608_0117916 | 3300046511 | Bacteria | 1703 |
| 699 | Ga0495608_0567513 | 3300046511 | Bacteria | 683 |
| 700 | Ga0495608_0616736 | 3300046511 | Bacteria | 650 |
| 701 | Ga0495618_0024676 | 3300046514 | Bacteria | 3725 |
| 702 | Ga0495618_0053484 | 3300046514 | Bacteria | 2553 |
| 703 | Ga0495618_0137124 | 3300046514 | Bacteria | 1565 |
| 704 | Ga0495620_0036525 | 3300046515 | Bacteria | 2197 |
| 705 | Ga0495620_0425052 | 3300046515 | Bacteria | 503 |
| 706 | Ga0495628_0003126 | 3300046516 | Bacteria | 14870 |
| 707 | Ga0495628_0011513 | 3300046516 | Bacteria | 7477 |
| 708 | Ga0495628_0088456 | 3300046516 | Bacteria | 2400 |
| 709 | Ga0495628_0121134 | 3300046516 | Bacteria | 2006 |
| 710 | Ga0495628_1073780 | 3300046516 | Bacteria | 551 |
| 711 | Ga0495630_0054008 | 3300046517 | Bacteria | 3009 |
| 712 | Ga0495630_0079050 | 3300046517 | Bacteria | 2481 |
| 713 | Ga0495630_0312817 | 3300046517 | Bacteria | 1200 |
| 714 | Ga0495630_0392172 | 3300046517 | Bacteria | 1063 |
| 715 | Ga0495630_0747523 | 3300046517 | Bacteria | 747 |
| 716 | Ga0495630_0989092 | 3300046517 | Bacteria | 639 |
| 717 | Ga0495644_0281566 | 3300046523 | Bacteria | 649 |
| 718 | Ga0495648_0089258 | 3300046524 | Bacteria | 1730 |
| 719 | Ga0495648_0116974 | 3300046524 | Bacteria | 1439 |
| 720 | Ga0495663_0099363 | 3300046525 | Bacteria | 957 |
| 721 | Ga0495666_0004045 | 3300046526 | Bacteria | 7413 |
| 722 | Ga0495666_0048114 | 3300046526 | Bacteria | 2054 |
| 723 | Ga0495666_0064344 | 3300046526 | Bacteria | 1750 |
| 724 | Ga0495666_0126969 | 3300046526 | Bacteria | 1192 |
| 725 | Ga0495642_0023552 | 3300046528 | Bacteria | 2431 |
| 726 | Ga0495642_0171034 | 3300046528 | Bacteria | 944 |
| 727 | Ga0495642_0294950 | 3300046528 | Bacteria | 710 |
| 728 | Ga0495652_0034252 | 3300046529 | Bacteria | 4427 |
| 729 | Ga0495652_0106642 | 3300046529 | Bacteria | 2262 |
| 730 | Ga0495652_0168866 | 3300046529 | Bacteria | 1690 |
| 731 | Ga0495652_0308545 | 3300046529 | Bacteria | 1147 |
| 732 | Ga0495652_0311665 | 3300046529 | Bacteria | 1140 |
| 733 | Ga0495654_0096746 | 3300046530 | Bacteria | 1364 |
| 734 | Ga0495665_0005305 | 3300046531 | Bacteria | 6945 |
| 735 | Ga0495665_0009459 | 3300046531 | Bacteria | 5275 |
| 736 | Ga0495665_0280870 | 3300046531 | Bacteria | 854 |
| 737 | Ga0495640_0009959 | 3300046533 | Bacteria | 7369 |
| 738 | Ga0495640_0051399 | 3300046533 | Bacteria | 2833 |
| 739 | Ga0495640_0072910 | 3300046533 | Bacteria | 2299 |
| 740 | Ga0495586_0001580 | 3300046535 | Bacteria | 12553 |
| 741 | Ga0495586_0049093 | 3300046535 | Bacteria | 2281 |
| 742 | Ga0495586_0177410 | 3300046535 | Bacteria | 1205 |
| 743 | Ga0495586_0286902 | 3300046535 | Bacteria | 942 |
| 744 | Ga0495586_0449764 | 3300046535 | Bacteria | 742 |
| 745 | Ga0495587_0000845 | 3300046536 | Bacteria | 20252 |
| 746 | Ga0495587_0029444 | 3300046536 | Bacteria | 3333 |
| 747 | Ga0495587_0054506 | 3300046536 | Bacteria | 2356 |
| 748 | Ga0495598_0141111 | 3300046537 | Bacteria | 834 |
| 749 | Ga0495598_0326362 | 3300046537 | Bacteria | 586 |
| 750 | Ga0495598_0373275 | 3300046537 | Bacteria | 553 |
| 751 | Ga0495609_0218860 | 3300046538 | Bacteria | 791 |
| 752 | Ga0495621_0019326 | 3300046539 | Bacteria | 2224 |
| 753 | Ga0495621_0108380 | 3300046539 | Bacteria | 1063 |
| 754 | Ga0495621_0258489 | 3300046539 | Bacteria | 713 |
| 755 | Ga0495597_0010631 | 3300046542 | Bacteria | 4488 |
| 756 | Ga0495645_0017147 | 3300046543 | Bacteria | 5187 |
| 757 | Ga0495645_0065743 | 3300046543 | Bacteria | 2623 |
| 758 | Ga0495645_0217268 | 3300046543 | Bacteria | 1287 |
| 759 | Ga0495667_0049285 | 3300046559 | Bacteria | 2780 |
| 760 | Ga0495667_0125134 | 3300046559 | Bacteria | 1659 |
| 761 | Ga0495634_0005222 | 3300046642 | Bacteria | 10032 |
| 762 | Ga0495634_0014642 | 3300046642 | Bacteria | 5649 |
| 763 | Ga0495634_0020851 | 3300046642 | Bacteria | 4642 |
| 764 | Ga0495634_0371027 | 3300046642 | Bacteria | 854 |
| 765 | Ga0495635_0068023 | 3300046663 | Bacteria | 2443 |
| 766 | Ga0495635_0148225 | 3300046663 | Bacteria | 1597 |
| 767 | Ga0495635_0158203 | 3300046663 | Bacteria | 1542 |
| 768 | Ga0495635_0345506 | 3300046663 | Bacteria | 993 |
| 769 | Ga0495635_0611025 | 3300046663 | Bacteria | 711 |
| 770 | Ga0495661_0005549 | 3300046665 | Bacteria | 8950 |
| 771 | Ga0495661_0017977 | 3300046665 | Bacteria | 4658 |
| 772 | Ga0495588_0285746 | 3300046674 | Bacteria | 869 |
| 773 | Ga0495657_0201102 | 3300046675 | Bacteria | 1214 |
| 774 | Ga0495657_0905174 | 3300046675 | Bacteria | 501 |
| 775 | Ga0495599_0017466 | 3300046678 | Bacteria | 4459 |
| 776 | Ga0495599_0292994 | 3300046678 | Bacteria | 983 |
| 777 | Ga0495599_0412285 | 3300046678 | Bacteria | 803 |
| 778 | Ga0495599_0580502 | 3300046678 | Bacteria | 654 |
| 779 | Ga0495599_0641271 | 3300046678 | Bacteria | 616 |
| 780 | Ga0495599_0791057 | 3300046678 | Bacteria | 542 |
| 781 | Ga0495623_0007848 | 3300046679 | Bacteria | 6940 |
| 782 | Ga0495623_0080548 | 3300046679 | Bacteria | 2015 |
| 783 | Ga0495623_0316562 | 3300046679 | Bacteria | 858 |
| 784 | Ga0495646_0003413 | 3300046680 | Bacteria | 9871 |
| 785 | Ga0495646_0004507 | 3300046680 | Bacteria | 8768 |
| 786 | Ga0495658_0017875 | 3300046683 | Bacteria | 3675 |
| 787 | Ga0495658_0060519 | 3300046683 | Bacteria | 2172 |
| 788 | Ga0495658_0721417 | 3300046683 | Bacteria | 639 |
| 789 | Ga0495658_0806415 | 3300046683 | Bacteria | 601 |
| 790 | Ga0495669_0045320 | 3300046684 | Bacteria | 1960 |
| 791 | Ga0495669_0242068 | 3300046684 | Bacteria | 866 |
| 792 | Ga0495613_0019201 | 3300046689 | Bacteria | 5095 |
| 793 | Ga0495613_0036939 | 3300046689 | Bacteria | 3621 |
| 794 | Ga0495613_0065036 | 3300046689 | Bacteria | 2666 |
| 795 | Ga0495613_0538570 | 3300046689 | Bacteria | 782 |
| 796 | Ga0495624_0017343 | 3300046690 | Bacteria | 4835 |
| 797 | Ga0495624_0094431 | 3300046690 | Bacteria | 1844 |
| 798 | Ga0495624_0132745 | 3300046690 | Bacteria | 1526 |
| 799 | Ga0495624_0143973 | 3300046690 | Bacteria | 1459 |
| 800 | Ga0495624_0385279 | 3300046690 | Bacteria | 842 |
| 801 | Ga0495624_0753769 | 3300046690 | Bacteria | 576 |
| 802 | Ga0495670_0604992 | 3300046691 | Bacteria | 597 |
| 803 | Ga0495671_0060933 | 3300046692 | Bacteria | 1862 |
| 804 | Ga0495649_0012027 | 3300046694 | Bacteria | 5055 |
| 805 | Ga0495649_0048027 | 3300046694 | Bacteria | 2320 |
| 806 | Ga0495649_0075838 | 3300046694 | Bacteria | 1800 |
| 807 | Ga0495589_0049162 | 3300046794 | Bacteria | 2087 |
| 808 | Ga0495589_0074606 | 3300046794 | Bacteria | 1654 |
| 809 | Ga0495589_0100336 | 3300046794 | Bacteria | 1401 |
| 810 | Ga0495589_0225410 | 3300046794 | Bacteria | 880 |
| 811 | Ga0495589_0467800 | 3300046794 | Bacteria | 576 |
| 812 | Ga0495600_0015117 | 3300046809 | Bacteria | 4875 |
| 813 | Ga0495600_0036242 | 3300046809 | Bacteria | 3205 |
| 814 | Ga0495600_0685620 | 3300046809 | Bacteria | 617 |
| 815 | Ga0495581_0001049 | 3300047315 | Bacteria | 14962 |
| 816 | Ga0495581_0010529 | 3300047315 | Bacteria | 5346 |
| 817 | Ga0495581_0094740 | 3300047315 | Bacteria | 1733 |
| 818 | Ga0495604_0001474 | 3300047317 | Bacteria | 19379 |
| 819 | Ga0495604_0008726 | 3300047317 | Bacteria | 8014 |
| 820 | Ga0495604_0018792 | 3300047317 | Bacteria | 5534 |
| 821 | Ga0495604_0026152 | 3300047317 | Bacteria | 4646 |
| 822 | Ga0495604_0059228 | 3300047317 | Bacteria | 2936 |
| 823 | Ga0495604_0206685 | 3300047317 | Bacteria | 1358 |
| 824 | Ga0495604_0426244 | 3300047317 | Bacteria | 870 |
| 825 | Ga0495636_0006341 | 3300047318 | Bacteria | 4646 |
| 826 | Ga0495636_0291468 | 3300047318 | Bacteria | 762 |
| 827 | Ga0495674_0081656 | 3300047319 | Bacteria | 2772 |
| 828 | Ga0495674_0100187 | 3300047319 | Bacteria | 2465 |
| 829 | Ga0495674_0720619 | 3300047319 | Bacteria | 781 |
| 830 | Ga0495674_1022855 | 3300047319 | Bacteria | 632 |
| 831 | Ga0495676_0254554 | 3300047321 | Bacteria | 1196 |
| 832 | Ga0495676_0589405 | 3300047321 | Bacteria | 725 |
| 833 | Ga0495680_0001252 | 3300047322 | Bacteria | 27832 |
| 834 | Ga0495680_0006154 | 3300047322 | Bacteria | 11193 |
| 835 | Ga0495680_0028998 | 3300047322 | Bacteria | 4535 |
| 836 | Ga0495680_0258368 | 3300047322 | Bacteria | 1232 |
| 837 | Ga0495680_0367110 | 3300047322 | Bacteria | 999 |
| 838 | Ga0495680_0872482 | 3300047322 | Bacteria | 583 |
| 839 | Ga0495683_0002338 | 3300047323 | Bacteria | 11515 |
| 840 | Ga0495683_0006981 | 3300047323 | Bacteria | 6132 |
| 841 | Ga0495683_0057968 | 3300047323 | Bacteria | 1924 |
| 842 | Ga0495683_0366451 | 3300047323 | Unclassified | 605 |
| 843 | Ga0495687_000078 | 3300047443 | Bacteria | 148202 |
| 844 | Ga0495687_045152 | 3300047443 | Bacteria | 1910 |
| 845 | Ga0495675_0031304 | 3300047444 | Bacteria | 3396 |
| 846 | Ga0495675_0149692 | 3300047444 | Bacteria | 1442 |
| 847 | Ga0495675_0160606 | 3300047444 | Bacteria | 1384 |
| 848 | Ga0495675_0187973 | 3300047444 | Bacteria | 1262 |
| 849 | Ga0495675_0252568 | 3300047444 | Bacteria | 1058 |
| 850 | Ga0495679_006165 | 3300047446 | Bacteria | 5214 |
| 851 | Ga0495679_022378 | 3300047446 | Bacteria | 2163 |
| 852 | Ga0495679_038477 | 3300047446 | Bacteria | 1498 |
| 853 | Ga0495673_0033340 | 3300047469 | Bacteria | 2391 |
| 854 | Ga0495684_0157650 | 3300047471 | Bacteria | 1695 |
| 855 | Ga0495593_0008398 | 3300047673 | Bacteria | 6005 |
| 856 | Ga0495593_0012595 | 3300047673 | Bacteria | 4829 |
| 857 | Ga0495593_0053913 | 3300047673 | Bacteria | 2121 |
| 858 | Ga0495593_0077978 | 3300047673 | Bacteria | 1716 |
| 859 | Ga0495593_0447735 | 3300047673 | Bacteria | 646 |
| 860 | Ga0495602_0011608 | 3300048088 | Bacteria | 9101 |
| 861 | Ga0495602_0049942 | 3300048088 | Bacteria | 3742 |
| 862 | Ga0495602_0153071 | 3300048088 | Bacteria | 1810 |
| 863 | Ga0495602_0193040 | 3300048088 | Bacteria | 1559 |
| 864 | Ga0495614_0003464 | 3300048089 | Bacteria | 7057 |
| 865 | Ga0495614_0051130 | 3300048089 | Bacteria | 1771 |
| 866 | Ga0495614_0107248 | 3300048089 | Bacteria | 1224 |
| 867 | Ga0496100_0008448 | 3300048903 | Bacteria | 5741 |
| 868 | Ga0496101_0023297 | 3300048904 | Bacteria | 4275 |
| 869 | Ga0496101_0113453 | 3300048904 | Bacteria | 2042 |
| 870 | Ga0496101_0493729 | 3300048904 | Bacteria | 967 |
| 871 | Ga0496102_0018939 | 3300048905 | Bacteria | 6056 |
| 872 | Ga0496102_0065386 | 3300048905 | Bacteria | 3333 |
| 873 | Ga0496103_0011604 | 3300048906 | Bacteria | 5224 |
| 874 | Ga0496103_0021032 | 3300048906 | Bacteria | 3924 |
| 875 | Ga0496104_0295492 | 3300048907 | Bacteria | 1532 |
| 876 | Ga0496105_0111021 | 3300048908 | Bacteria | 2263 |
| 877 | Ga0496106_0000023 | 3300048909 | Bacteria | 165457 |
| 878 | Ga0496106_0015183 | 3300048909 | Bacteria | 5700 |
| 879 | Ga0496107_0270121 | 3300048910 | Bacteria | 1266 |
| 880 | Ga0496108_0099751 | 3300048911 | Bacteria | 2476 |
| 881 | Ga0496108_0414784 | 3300048911 | Bacteria | 1176 |
| 882 | Ga0496109_0404606 | 3300048912 | Bacteria | 1289 |
| 883 | Ga0496110_0114538 | 3300048913 | Bacteria | 2426 |
| 884 | Ga0496110_0148999 | 3300048913 | Bacteria | 2118 |
| 885 | Ga0496111_0253983 | 3300048914 | Bacteria | 1304 |
| 886 | Ga0496111_0774908 | 3300048914 | Bacteria | 695 |
| 887 | Ga0496112_0044311 | 3300048915 | Bacteria | 4359 |
| 888 | Ga0496113_0042009 | 3300048916 | Bacteria | 3377 |
| 889 | Ga0496114_0033858 | 3300048917 | Bacteria | 4212 |
| 890 | Ga0496115_0006263 | 3300048918 | Bacteria | 8705 |
| 891 | Ga0496116_0026332 | 3300048919 | Bacteria | 4257 |
| 892 | Ga0496116_0080085 | 3300048919 | Bacteria | 2029 |
| 893 | Ga0496117_0043089 | 3300048920 | Bacteria | 3286 |
| 894 | Ga0496117_0052900 | 3300048920 | Bacteria | 2858 |
| 895 | Ga0496117_0075692 | 3300048920 | Bacteria | 2235 |
| 896 | Ga0496118_0010415 | 3300048921 | Bacteria | 9214 |
| 897 | Ga0496118_0023542 | 3300048921 | Bacteria | 5346 |
| 898 | Ga0496118_0226382 | 3300048921 | Bacteria | 1083 |
| 899 | Ga0496119_0202909 | 3300048922 | Bacteria | 1025 |
| 900 | Ga0496121_0005179 | 3300048924 | Bacteria | 16904 |
| 901 | Ga0496121_0028951 | 3300048924 | Bacteria | 5141 |
| 902 | Ga0496122_0010546 | 3300048925 | Bacteria | 9498 |
| 903 | Ga0496123_0040469 | 3300048926 | Bacteria | 3245 |
| 904 | Ga0496124_0032787 | 3300048927 | Bacteria | 4581 |
| 905 | Ga0496124_0193818 | 3300048927 | Bacteria | 1552 |
| 906 | Ga0496125_0027893 | 3300048928 | Bacteria | 5109 |
| 907 | Ga0496126_0001279 | 3300048929 | Bacteria | 40379 |
| 908 | Ga0496126_0001770 | 3300048929 | Bacteria | 31970 |
| 909 | Ga0496126_0043993 | 3300048929 | Bacteria | 4115 |
| 910 | Ga0501309_012746 | 3300049129 | Bacteria | 1111 |
| 911 | Ga0501305_094306 | 3300049161 | Bacteria | 551 |
| 912 | Ga0495678_185078 | 3300049459 | Bacteria | 651 |
| 913 | Ga0501291_024806 | 3300049514 | Bacteria | 977 |
| 914 | Ga0501291_031963 | 3300049514 | Bacteria | 892 |
| 915 | Ga0501291_097346 | 3300049514 | Bacteria | 609 |
| 916 | Ga0501297_042019 | 3300049520 | Bacteria | 647 |
| 917 | Ga0501297_052237 | 3300049520 | Bacteria | 604 |
| 918 | Ga0501303_008441 | 3300049526 | Bacteria | 936 |
| 919 | Ga0501311_042555 | 3300049527 | Bacteria | 692 |
| 920 | Ga0501312_109184 | 3300049528 | Bacteria | 526 |
| 921 | Ga0501314_030602 | 3300049530 | Bacteria | 597 |
| 922 | Ga0501031_0098236 | 3300049568 | Bacteria | 1911 |
| 923 | Ga0501031_0362808 | 3300049568 | Bacteria | 937 |
| 924 | Ga0501032_0258858 | 3300049569 | Bacteria | 1129 |
| 925 | Ga0501033_0241590 | 3300049570 | Bacteria | 1281 |
| 926 | Ga0501034_0409979 | 3300049571 | Bacteria | 1277 |
| 927 | Ga0501034_0427120 | 3300049571 | Bacteria | 1245 |
| 928 | Ga0501034_1215936 | 3300049571 | Bacteria | 632 |
| 929 | Ga0501036_0052878 | 3300049572 | Bacteria | 3440 |
| 930 | Ga0501036_0857819 | 3300049572 | Bacteria | 746 |
| 931 | Ga0501036_0859596 | 3300049572 | Bacteria | 745 |
| 932 | Ga0501037_0003038 | 3300049573 | Bacteria | 12180 |
| 933 | Ga0501038_0303394 | 3300049574 | Bacteria | 1253 |
| 934 | Ga0501039_0024671 | 3300049575 | Bacteria | 4619 |
| 935 | Ga0501040_0003600 | 3300049576 | Bacteria | 10021 |
| 936 | Ga0501040_0034644 | 3300049576 | Bacteria | 3420 |
| 937 | Ga0501040_0865955 | 3300049576 | Bacteria | 654 |
| 938 | Ga0501041_0116026 | 3300049577 | Bacteria | 1662 |
| 939 | Ga0501042_0396719 | 3300049578 | Bacteria | 999 |
| 940 | Ga0501046_0098411 | 3300049580 | Bacteria | 2246 |
| 941 | Ga0501046_0138215 | 3300049580 | Bacteria | 1845 |
| 942 | Ga0501046_0485880 | 3300049580 | Bacteria | 886 |
| 943 | Ga0501046_0507391 | 3300049580 | Bacteria | 863 |
| 944 | Ga0501047_0019486 | 3300049581 | Bacteria | 6508 |
| 945 | Ga0501047_0167337 | 3300049581 | Bacteria | 2068 |
| 946 | Ga0501047_1091044 | 3300049581 | Bacteria | 611 |
| 947 | Ga0501048_1122440 | 3300049582 | Bacteria | 566 |
| 948 | Ga0501067_0495896 | 3300049583 | Bacteria | 683 |
| 949 | Ga0501068_0537516 | 3300049584 | Bacteria | 759 |
| 950 | Ga0501071_0111706 | 3300049587 | Bacteria | 2020 |
| 951 | Ga0501072_0008011 | 3300049588 | Bacteria | 8018 |
| 952 | Ga0501072_0686394 | 3300049588 | Bacteria | 805 |
| 953 | Ga0501074_0220060 | 3300049590 | Bacteria | 1352 |
| 954 | Ga0501075_0076329 | 3300049591 | Bacteria | 2534 |
| 955 | Ga0501076_0000290 | 3300049592 | Bacteria | 31327 |
| 956 | Ga0501077_0504698 | 3300049593 | Bacteria | 776 |
| 957 | Ga0501201_010158 | 3300049651 | Bacteria | 920 |
| 958 | Ga0501202_146817 | 3300049652 | Bacteria | 614 |
| 959 | Ga0501207_063540 | 3300049654 | Bacteria | 681 |
| 960 | Ga0501223_122641 | 3300049663 | Bacteria | 550 |
| 961 | Ga0501249_138579 | 3300049679 | Bacteria | 604 |
| 962 | Ga0501257_235092 | 3300049686 | Bacteria | 538 |
| 963 | Ga0501221_215760 | 3300049704 | Bacteria | 539 |
| 964 | Ga0501225_0159976 | 3300049705 | Bacteria | 692 |
| 965 | Ga0501079_0085041 | 3300049741 | Bacteria | 2448 |
| 966 | Ga0501080_0096596 | 3300049742 | Bacteria | 2743 |
| 967 | Ga0501080_0106464 | 3300049742 | Bacteria | 2599 |
| 968 | Ga0501080_0333901 | 3300049742 | Bacteria | 1370 |
| 969 | Ga0501080_0985827 | 3300049742 | Bacteria | 731 |
| 970 | Ga0501081_0005740 | 3300049743 | Bacteria | 8036 |
| 971 | Ga0501083_0656215 | 3300049744 | Bacteria | 682 |
| 972 | Ga0501283_018398 | 3300049779 | Bacteria | 1099 |
| 973 | Ga0501035_0527664 | 3300049822 | Bacteria | 969 |
| 974 | Ga0501035_1188834 | 3300049822 | Bacteria | 592 |
| 975 | Ga0501044_0177984 | 3300049823 | Bacteria | 2095 |
| 976 | Ga0501044_0497465 | 3300049823 | Bacteria | 1121 |
| 977 | Ga0501045_0167109 | 3300049824 | Bacteria | 1638 |
| 978 | nmdc:mga00v17_76853_c1 | 3300050491 | Bacteria | 2078 |
| 979 | nmdc:mga0yw44_315642_c1 | 3300050492 | Bacteria | 1049 |
| 980 | nmdc:mga0k408_12409_c1 | 3300050493 | Bacteria | 4657 |
| 981 | nmdc:mga0k408_132002_c1 | 3300050493 | Bacteria | 1483 |
| 982 | nmdc:mga06z11_362980_c1 | 3300050494 | Bacteria | 868 |
| 983 | nmdc:mga06z11_898647_c1 | 3300050494 | Bacteria | 540 |
| 984 | nmdc:mga04h51_61024_c1 | 3300050495 | Bacteria | 1292 |
| 985 | nmdc:mga05p37_2115337_c1 | 3300050507 | Bacteria | 527 |
| 986 | nmdc:mga05p37_222484_c1 | 3300050507 | Bacteria | 2277 |
| 987 | nmdc:mga09592_1117136_c1 | 3300050508 | Bacteria | 655 |
| 988 | nmdc:mga09592_712219_c1 | 3300050508 | Bacteria | 854 |
| 989 | nmdc:mga06r32_446739_c1 | 3300050510 | Bacteria | 1273 |
| 990 | nmdc:mga08y16_1878441_c1 | 3300050511 | Bacteria | 550 |
| 991 | nmdc:mga08y16_5343_c1 | 3300050511 | Bacteria | 13436 |
| 992 | nmdc:mga08y16_588427_c1 | 3300050511 | Bacteria | 1123 |
| 993 | nmdc:mga08y16_729185_c1 | 3300050511 | Bacteria | 989 |
| 994 | nmdc:mga08y16_86961_c1 | 3300050511 | Bacteria | 3257 |
| 995 | nmdc:mga0n895_313173_c1 | 3300050512 | Bacteria | 1591 |
| 996 | nmdc:mga0n895_582_c1 | 3300050512 | Bacteria | 25135 |
| 997 | nmdc:mga0n895_62787_c1 | 3300050512 | Bacteria | 3673 |
| 998 | nmdc:mga0n895_629202_c1 | 3300050512 | Bacteria | 1073 |
| 999 | nmdc:mga0n895_637282_c1 | 3300050512 | Bacteria | 1066 |
| 1000 | nmdc:mga0rr50_19252_c1 | 3300050513 | Bacteria | 4603 |
| 1001 | nmdc:mga0rr50_218123_c1 | 3300050513 | Bacteria | 1574 |
| 1002 | nmdc:mga0rr50_234962_c1 | 3300050513 | Bacteria | 1518 |
| 1003 | nmdc:mga0rr50_273030_c1 | 3300050513 | Bacteria | 1409 |
| 1004 | nmdc:mga0rr50_3282_c1 | 3300050513 | Bacteria | 9282 |
| 1005 | nmdc:mga0rr50_665357_c1 | 3300050513 | Bacteria | 889 |
| 1006 | nmdc:mga0rr50_871708_c1 | 3300050513 | Bacteria | 768 |
| 1007 | nmdc:mga08x19_1199325_c1 | 3300050514 | Bacteria | 538 |
| 1008 | nmdc:mga08x19_1858_c1 | 3300050514 | Bacteria | 12938 |
| 1009 | nmdc:mga08x19_250421_c1 | 3300050514 | Bacteria | 1223 |
| 1010 | nmdc:mga08x19_269_c1 | 3300050514 | Bacteria | 39443 |
| 1011 | nmdc:mga08x19_5533_c1 | 3300050514 | Bacteria | 7469 |
| 1012 | nmdc:mga0a205_107303_c1 | 3300050515 | Bacteria | 2690 |
| 1013 | nmdc:mga0a205_12708_c1 | 3300050515 | Bacteria | 7802 |
| 1014 | nmdc:mga0a205_428_c1 | 3300050515 | Bacteria | 32380 |
| 1015 | nmdc:mga0a205_956344_c1 | 3300050515 | Bacteria | 703 |
| 1016 | nmdc:mga0sz30_138726_c1 | 3300050516 | Bacteria | 1073 |
| 1017 | nmdc:mga0sz30_19086_c1 | 3300050516 | Bacteria | 2750 |
| 1018 | Ga0495601_0079602 | 3300053077 | Bacteria | 2101 |
| 1019 | Ga0495601_0235706 | 3300053077 | Bacteria | 1195 |
| 1020 | Ga0495601_0569482 | 3300053077 | Bacteria | 728 |
| 1021 | Ga0495612_0459003 | 3300053078 | Bacteria | 582 |
| 1022 | Ga0495619_0694822 | 3300053085 | Bacteria | 692 |
| 1023 | Ga0500588_0244235 | 3300053146 | Bacteria | 673 |
| 1024 | Ga0500616_0286137 | 3300053153 | Bacteria | 690 |
| 1025 | Ga0500627_0127791 | 3300053158 | Bacteria | 1147 |
| 1026 | Ga0500637_0508192 | 3300053178 | Bacteria | 595 |
| 1027 | Ga0501084_0227805 | 3300054114 | Bacteria | 1573 |
| 1028 | Ga0501084_0805497 | 3300054114 | Bacteria | 791 |
| 1029 | Ga0501084_0905061 | 3300054114 | Bacteria | 742 |
| 1030 | Ga0587084_000186 | 3300059477 | Bacteria | 3994 |
| 1031 | Ga0587084_032074 | 3300059477 | Bacteria | 851 |
| 1032 | Ga0587084_078057 | 3300059477 | Bacteria | 637 |
| 1033 | Ga0587073_0005556 | 3300059492 | Bacteria | 1885 |
| 1034 | Ga0587082_013997 | 3300059504 | Bacteria | 1218 |
| 1035 | Ga0587088_000182 | 3300059508 | Bacteria | 4154 |
| 1036 | Ga0587088_015464 | 3300059508 | Bacteria | 1202 |
| 1037 | Ga0587091_011293 | 3300059511 | Bacteria | 1390 |
| 1038 | Ga0587109_170298 | 3300059624 | Bacteria | 550 |
| 1039 | Ga0587128_001876 | 3300059630 | Bacteria | 2085 |
| 1040 | Ga0587128_144159 | 3300059630 | Bacteria | 537 |
| 1041 | Ga0587067_000236 | 3300059640 | Bacteria | 4271 |
| 1042 | Ga0587068_002388 | 3300059641 | Bacteria | 2276 |
| 1043 | Ga0587072_000335 | 3300059643 | Bacteria | 4494 |
| 1044 | Ga0587075_011493 | 3300059644 | Bacteria | 1188 |
| 1045 | Ga0587076_011609 | 3300059645 | Bacteria | 1299 |
| 1046 | Ga0587100_009542 | 3300059648 | Bacteria | 803 |
| 1047 | Ga0587104_001168 | 3300059650 | Bacteria | 1343 |
| 1048 | Ga0587111_0007854 | 3300060346 | Bacteria | 1749 |
| 1049 | Ga0501082_0083800 | 3300060353 | Bacteria | 2750 |
| 1050 | Ga0501082_1047968 | 3300060353 | Bacteria | 713 |
| 1051 | Ga0466962_0000364 | 3300061719 | Bacteria | 19522 |
| 1052 | Ga0466962_0007045 | 3300061719 | Bacteria | 5388 |
| 1053 | Ga0466962_0657091 | 3300061719 | Bacteria | 536 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300038741 | Ga0400488_49855 | Ga0400488_49855_624_935 | 103 |
| 2 | 3300039062 | Ga0400483_166330 | Ga0400483_166330_361_672 | 103 |
| 3 | 3300044658 | Ga0466972_0380629 | Ga0466972_0380629_19_330 | 103 |
| 4 | 3300046455 | Ga0495603_0654510 | Ga0495603_0654510_12_323 | 103 |
| 5 | 3300047322 | Ga0495680_0258368 | Ga0495680_0258368_910_1221 | 103 |
| 6 | 3300049571 | Ga0501034_0409979 | Ga0501034_0409979_134_445 | 103 |
| 7 | iso_pu_bacteria | 2501025501 | 2501072653 | 103 |
| 8 | iso_pu_bacteria | 2501025504 | 2501410535 | 103 |
| 9 | iso_pu_bacteria | 2510065045 | 2510251512 | 103 |
| 10 | iso_pu_bacteria | 2510917014 | 2511096997 | 103 |
| 11 | iso_pu_bacteria | 2510917015 | 2511103807 | 103 |
| 12 | iso_pu_bacteria | 2512047030 | 2512345530 | 103 |
| 13 | iso_pu_bacteria | 2515154122 | 2515680816 | 103 |
| 14 | iso_pu_bacteria | 2515154189 | 2516019474 | 103 |
| 15 | iso_pu_bacteria | 2554235231 | 2555245487 | 103 |
| 16 | iso_pu_bacteria | 2600254954 | 2600442501 | 103 |
| 17 | iso_pu_bacteria | 2600255067 | 2600812110 | 103 |
| 18 | iso_pu_bacteria | 2600255389 | 2602012436 | 103 |
| 19 | iso_pu_bacteria | 2718217991 | 2719640626 | 103 |
| 20 | iso_pu_bacteria | 2721755763 | 2723878537 | 103 |
| 21 | iso_pu_bacteria | 2806310737 | 2807406683 | 103 |
| 22 | iso_pu_bacteria | 2806310745 | 2807455015 | 103 |
| 23 | iso_pu_bacteria | 2808606373 | 2808906873 | 103 |
| 24 | iso_pu_bacteria | 2808606384 | 2808972719 | 103 |
| 25 | iso_pu_bacteria | 2808606390 | 2809007701 | 103 |
| 26 | iso_pu_bacteria | 2808606391 | 2809014759 | 103 |
| 27 | iso_pu_bacteria | 2842324504 | 2842328623 | 103 |
| 28 | iso_pu_bacteria | 2842348783 | 2842352939 | 103 |
| 29 | iso_pu_bacteria | 2842454564 | 2842458716 | 103 |
| 30 | iso_pu_bacteria | 2883087390 | 2883093068 | 103 |
| 31 | iso_pu_bacteria | 2885270888 | 2885272974 | 103 |
| 32 | iso_pu_bacteria | 2887375801 | 2887379270 | 103 |
| 33 | iso_pu_bacteria | 2902682994 | 2902683730 | 103 |
| 34 | iso_pu_bacteria | 2917832318 | 2917835057 | 103 |
| 35 | iso_pu_bacteria | 2919125081 | 2919128999 | 103 |
| 36 | iso_pu_bacteria | 2928115317 | 2928116399 | 103 |
| 37 | iso_pu_bacteria | 2984504281 | 2984507808 | 103 |
| 38 | iso_pu_bacteria | 3007861166 | 3007866032 | 103 |
| 39 | iso_pu_bacteria | 8011350971 | 8011353515 | 103 |
| 40 | iso_pu_bacteria | 8016728285 | 8016730040 | 103 |
| 41 | iso_pu_bacteria | 8034962539 | 8034964213 | 103 |
| 42 | iso_pu_bacteria | 8054929484 | 8054934350 | 103 |
| 43 | iso_pu_bacteria | 8056115690 | 8056120445 | 103 |
| 44 | iso_pu_bacteria | 8056120720 | 8056121729 | 103 |
| 45 | 3300001979 | JGI24740J21852_10000304 | JGI24740J21852_100003044 | 106 |
| 46 | 3300001979 | JGI24740J21852_10000783 | JGI24740J21852_1000078311 | 106 |
| 47 | 3300001989 | JGI24739J22299_10026729 | JGI24739J22299_100267292 | 106 |
| 48 | 3300002067 | JGI24735J21928_10000592 | JGI24735J21928_1000059210 | 106 |
| 49 | 3300002705 | JGI25156J39149_1004627 | JGI25156J39149_10046273 | 106 |
| 50 | 3300002705 | JGI25156J39149_1013980 | JGI25156J39149_10139803 | 106 |
| 51 | 3300002738 | JGI25154J39366_1000649 | JGI25154J39366_10006497 | 106 |
| 52 | 3300003479 | Ga0006556J51387_1030706 | Ga0006556J51387_10307063 | 106 |
| 53 | 3300003558 | Ga0006558J51389_1031326 | Ga0006558J51389_10313262 | 106 |
| 54 | 3300003565 | Ga0006560J51390_1025704 | Ga0006560J51390_10257043 | 106 |
| 55 | 3300003567 | Ga0006554J51385_1045016 | Ga0006554J51385_10450162 | 106 |
| 56 | 3300003751 | Ga0055538_1012937 | Ga0055538_10129371 | 106 |
| 57 | 3300003752 | Ga0055539_1000034 | Ga0055539_1000034109 | 106 |
| 58 | 3300003756 | Ga0055533_1002398 | Ga0055533_10023984 | 106 |
| 59 | 3300003758 | Ga0055532_1000002 | Ga0055532_1000002303 | 106 |
| 60 | 3300003759 | Ga0055525_1000313 | Ga0055525_100031317 | 106 |
| 61 | 3300003759 | Ga0055525_1000473 | Ga0055525_10004734 | 106 |
| 62 | 3300003760 | Ga0055527_1000923 | Ga0055527_10009235 | 106 |
| 63 | 3300003762 | Ga0055542_1003748 | Ga0055542_10037484 | 106 |
| 64 | 3300003763 | Ga0055529_1000028 | Ga0055529_1000028145 | 106 |
| 65 | 3300003784 | Ga0055534_1000984 | Ga0055534_100098413 | 106 |
| 66 | 3300003794 | Ga0055531_10033129 | Ga0055531_100331292 | 106 |
| 67 | 3300003841 | Ga0055541_1003150 | Ga0055541_10031504 | 106 |
| 68 | 3300004625 | Ga0055543_1003665 | Ga0055543_10036653 | 106 |
| 69 | 3300004798 | Ga0058859_11623198 | Ga0058859_116231982 | 106 |
| 70 | 3300004798 | Ga0058859_11781410 | Ga0058859_117814102 | 106 |
| 71 | 3300004801 | Ga0058860_12150010 | Ga0058860_121500102 | 106 |
| 72 | 3300004803 | Ga0058862_12823266 | Ga0058862_128232662 | 106 |
| 73 | 3300005262 | Ga0065165_1000613 | Ga0065165_10006139 | 106 |
| 74 | 3300005295 | Ga0065707_10057951 | Ga0065707_100579511 | 106 |
| 75 | 3300005327 | Ga0070658_10002480 | Ga0070658_1000248013 | 106 |
| 76 | 3300005329 | Ga0070683_101505761 | Ga0070683_1015057611 | 106 |
| 77 | 3300005330 | Ga0070690_100989682 | Ga0070690_1009896821 | 106 |
| 78 | 3300005334 | Ga0068869_100050869 | Ga0068869_1000508693 | 106 |
| 79 | 3300005334 | Ga0068869_100128505 | Ga0068869_1001285053 | 106 |
| 80 | 3300005334 | Ga0068869_101145432 | Ga0068869_1011454321 | 106 |
| 81 | 3300005335 | Ga0070666_10073819 | Ga0070666_100738193 | 106 |
| 82 | 3300005338 | Ga0068868_100458728 | Ga0068868_1004587283 | 106 |
| 83 | 3300005338 | Ga0068868_101402616 | Ga0068868_1014026161 | 106 |
| 84 | 3300005340 | Ga0070689_100012797 | Ga0070689_1000127973 | 106 |
| 85 | 3300005340 | Ga0070689_100151335 | Ga0070689_1001513353 | 106 |
| 86 | 3300005340 | Ga0070689_100423690 | Ga0070689_1004236902 | 106 |
| 87 | 3300005340 | Ga0070689_101285639 | Ga0070689_1012856392 | 106 |
| 88 | 3300005341 | Ga0070691_10183806 | Ga0070691_101838062 | 106 |
| 89 | 3300005344 | Ga0070661_100000013 | Ga0070661_100000013105 | 106 |
| 90 | 3300005345 | Ga0070692_10775184 | Ga0070692_107751841 | 106 |
| 91 | 3300005347 | Ga0070668_100280263 | Ga0070668_1002802633 | 106 |
| 92 | 3300005353 | Ga0070669_100024733 | Ga0070669_1000247333 | 106 |
| 93 | 3300005354 | Ga0070675_100004581 | Ga0070675_1000045814 | 106 |
| 94 | 3300005354 | Ga0070675_100515510 | Ga0070675_1005155102 | 106 |
| 95 | 3300005355 | Ga0070671_100737060 | Ga0070671_1007370602 | 106 |
| 96 | 3300005355 | Ga0070671_101149174 | Ga0070671_1011491742 | 106 |
| 97 | 3300005356 | Ga0070674_100019780 | Ga0070674_1000197805 | 106 |
| 98 | 3300005356 | Ga0070674_100078297 | Ga0070674_1000782973 | 106 |
| 99 | 3300005356 | Ga0070674_100826826 | Ga0070674_1008268261 | 106 |
| 100 | 3300005364 | Ga0070673_100284418 | Ga0070673_1002844183 | 106 |
| 101 | 3300005364 | Ga0070673_101031899 | Ga0070673_1010318992 | 106 |
| 102 | 3300005365 | Ga0070688_100006303 | Ga0070688_1000063037 | 106 |
| 103 | 3300005365 | Ga0070688_100487624 | Ga0070688_1004876242 | 106 |
| 104 | 3300005366 | Ga0070659_100003967 | Ga0070659_1000039678 | 106 |
| 105 | 3300005366 | Ga0070659_100148160 | Ga0070659_1001481601 | 106 |
| 106 | 3300005366 | Ga0070659_100393514 | Ga0070659_1003935142 | 106 |
| 107 | 3300005438 | Ga0070701_10090013 | Ga0070701_100900133 | 106 |
| 108 | 3300005438 | Ga0070701_10753732 | Ga0070701_107537322 | 106 |
| 109 | 3300005440 | Ga0070705_100046152 | Ga0070705_1000461524 | 106 |
| 110 | 3300005440 | Ga0070705_100781955 | Ga0070705_1007819552 | 106 |
| 111 | 3300005441 | Ga0070700_100033148 | Ga0070700_1000331484 | 106 |
| 112 | 3300005441 | Ga0070700_100196938 | Ga0070700_1001969381 | 106 |
| 113 | 3300005441 | Ga0070700_101361389 | Ga0070700_1013613892 | 106 |
| 114 | 3300005444 | Ga0070694_100555456 | Ga0070694_1005554562 | 106 |
| 115 | 3300005444 | Ga0070694_100969277 | Ga0070694_1009692771 | 106 |
| 116 | 3300005444 | Ga0070694_101083890 | Ga0070694_1010838902 | 106 |
| 117 | 3300005444 | Ga0070694_101104676 | Ga0070694_1011046761 | 106 |
| 118 | 3300005445 | Ga0070708_101231157 | Ga0070708_1012311572 | 106 |
| 119 | 3300005445 | Ga0070708_101876357 | Ga0070708_1018763572 | 106 |
| 120 | 3300005455 | Ga0070663_100000006 | Ga0070663_1000000066 | 106 |
| 121 | 3300005455 | Ga0070663_100237780 | Ga0070663_1002377802 | 106 |
| 122 | 3300005455 | Ga0070663_101395441 | Ga0070663_1013954411 | 106 |
| 123 | 3300005457 | Ga0070662_100488787 | Ga0070662_1004887872 | 106 |
| 124 | 3300005458 | Ga0070681_10000198 | Ga0070681_1000019830 | 106 |
| 125 | 3300005458 | Ga0070681_11068917 | Ga0070681_110689172 | 106 |
| 126 | 3300005459 | Ga0068867_100446316 | Ga0068867_1004463161 | 106 |
| 127 | 3300005459 | Ga0068867_101027745 | Ga0068867_1010277452 | 106 |
| 128 | 3300005466 | Ga0070685_10013293 | Ga0070685_100132935 | 106 |
| 129 | 3300005471 | Ga0070698_100219769 | Ga0070698_1002197693 | 106 |
| 130 | 3300005471 | Ga0070698_100268912 | Ga0070698_1002689122 | 106 |
| 131 | 3300005471 | Ga0070698_102115005 | Ga0070698_1021150051 | 106 |
| 132 | 3300005530 | Ga0070679_101201299 | Ga0070679_1012012992 | 106 |
| 133 | 3300005535 | Ga0070684_100413301 | Ga0070684_1004133013 | 106 |
| 134 | 3300005543 | Ga0070672_100049500 | Ga0070672_1000495003 | 106 |
| 135 | 3300005544 | Ga0070686_100203785 | Ga0070686_1002037851 | 106 |
| 136 | 3300005544 | Ga0070686_100411785 | Ga0070686_1004117852 | 106 |
| 137 | 3300005544 | Ga0070686_100720214 | Ga0070686_1007202142 | 106 |
| 138 | 3300005545 | Ga0070695_100298109 | Ga0070695_1002981092 | 106 |
| 139 | 3300005546 | Ga0070696_100041783 | Ga0070696_1000417835 | 106 |
| 140 | 3300005546 | Ga0070696_100185224 | Ga0070696_1001852243 | 106 |
| 141 | 3300005546 | Ga0070696_100521115 | Ga0070696_1005211151 | 106 |
| 142 | 3300005546 | Ga0070696_100525610 | Ga0070696_1005256103 | 106 |
| 143 | 3300005546 | Ga0070696_100677636 | Ga0070696_1006776362 | 106 |
| 144 | 3300005546 | Ga0070696_100766813 | Ga0070696_1007668132 | 106 |
| 145 | 3300005549 | Ga0070704_100059341 | Ga0070704_1000593412 | 106 |
| 146 | 3300005549 | Ga0070704_100300271 | Ga0070704_1003002712 | 106 |
| 147 | 3300005549 | Ga0070704_100618443 | Ga0070704_1006184432 | 106 |
| 148 | 3300005549 | Ga0070704_100834099 | Ga0070704_1008340991 | 106 |
| 149 | 3300005563 | Ga0068855_100008103 | Ga0068855_1000081037 | 106 |
| 150 | 3300005563 | Ga0068855_100483412 | Ga0068855_1004834123 | 106 |
| 151 | 3300005563 | Ga0068855_100730200 | Ga0068855_1007302003 | 106 |
| 152 | 3300005564 | Ga0070664_100000002 | Ga0070664_100000002258 | 106 |
| 153 | 3300005577 | Ga0068857_100071642 | Ga0068857_1000716423 | 106 |
| 154 | 3300005577 | Ga0068857_100093939 | Ga0068857_1000939393 | 106 |
| 155 | 3300005578 | Ga0068854_100000004 | Ga0068854_10000000461 | 106 |
| 156 | 3300005578 | Ga0068854_100713211 | Ga0068854_1007132111 | 106 |
| 157 | 3300005578 | Ga0068854_100993615 | Ga0068854_1009936152 | 106 |
| 158 | 3300005614 | Ga0068856_100003447 | Ga0068856_10000344714 | 106 |
| 159 | 3300005615 | Ga0070702_100110337 | Ga0070702_1001103372 | 106 |
| 160 | 3300005615 | Ga0070702_100395406 | Ga0070702_1003954061 | 106 |
| 161 | 3300005615 | Ga0070702_100601158 | Ga0070702_1006011582 | 106 |
| 162 | 3300005615 | Ga0070702_101081673 | Ga0070702_1010816732 | 106 |
| 163 | 3300005616 | Ga0068852_100055664 | Ga0068852_1000556644 | 106 |
| 164 | 3300005616 | Ga0068852_101056565 | Ga0068852_1010565652 | 106 |
| 165 | 3300005616 | Ga0068852_101648974 | Ga0068852_1016489741 | 106 |
| 166 | 3300005617 | Ga0068859_100746798 | Ga0068859_1007467981 | 106 |
| 167 | 3300005617 | Ga0068859_101978320 | Ga0068859_1019783202 | 106 |
| 168 | 3300005718 | Ga0068866_10321979 | Ga0068866_103219792 | 106 |
| 169 | 3300005718 | Ga0068866_11395815 | Ga0068866_113958152 | 106 |
| 170 | 3300005719 | Ga0068861_100021205 | Ga0068861_1000212051 | 106 |
| 171 | 3300005834 | Ga0068851_10708730 | Ga0068851_107087302 | 106 |
| 172 | 3300005840 | Ga0068870_10086996 | Ga0068870_100869962 | 106 |
| 173 | 3300005840 | Ga0068870_10205810 | Ga0068870_102058103 | 106 |
| 174 | 3300005842 | Ga0068858_100386817 | Ga0068858_1003868173 | 106 |
| 175 | 3300005843 | Ga0068860_100844025 | Ga0068860_1008440252 | 106 |
| 176 | 3300005844 | Ga0068862_101244952 | Ga0068862_1012449522 | 106 |
| 177 | 3300005981 | Ga0081538_10033593 | Ga0081538_100335933 | 106 |
| 178 | 3300006028 | Ga0070717_11083081 | Ga0070717_110830812 | 106 |
| 179 | 3300006178 | Ga0075367_10108825 | Ga0075367_101088253 | 106 |
| 180 | 3300006195 | Ga0075366_10862639 | Ga0075366_108626391 | 106 |
| 181 | 3300006844 | Ga0075428_100149716 | Ga0075428_1001497163 | 106 |
| 182 | 3300006844 | Ga0075428_102222596 | Ga0075428_1022225962 | 106 |
| 183 | 3300006847 | Ga0075431_100739663 | Ga0075431_1007396633 | 106 |
| 184 | 3300006852 | Ga0075433_10014942 | Ga0075433_1001494211 | 106 |
| 185 | 3300006852 | Ga0075433_10109839 | Ga0075433_101098393 | 106 |
| 186 | 3300006852 | Ga0075433_10227719 | Ga0075433_102277192 | 106 |
| 187 | 3300006852 | Ga0075433_10415323 | Ga0075433_104153232 | 106 |
| 188 | 3300006852 | Ga0075433_11805246 | Ga0075433_118052462 | 106 |
| 189 | 3300006871 | Ga0075434_100000073 | Ga0075434_10000007332 | 106 |
| 190 | 3300006871 | Ga0075434_100001176 | Ga0075434_10000117617 | 106 |
| 191 | 3300006871 | Ga0075434_100019885 | Ga0075434_1000198853 | 106 |
| 192 | 3300006871 | Ga0075434_100075855 | Ga0075434_1000758555 | 106 |
| 193 | 3300006871 | Ga0075434_100296357 | Ga0075434_1002963572 | 106 |
| 194 | 3300006871 | Ga0075434_100955287 | Ga0075434_1009552872 | 106 |
| 195 | 3300006881 | Ga0068865_101977635 | Ga0068865_1019776351 | 106 |
| 196 | 3300006914 | Ga0075436_100000205 | Ga0075436_10000020510 | 106 |
| 197 | 3300006914 | Ga0075436_100000352 | Ga0075436_10000035210 | 106 |
| 198 | 3300006914 | Ga0075436_100214012 | Ga0075436_1002140122 | 106 |
| 199 | 3300006914 | Ga0075436_100279283 | Ga0075436_1002792832 | 106 |
| 200 | 3300006914 | Ga0075436_100752945 | Ga0075436_1007529452 | 106 |
| 201 | 3300006931 | Ga0097620_100746780 | Ga0097620_1007467801 | 106 |
| 202 | 3300006931 | Ga0097620_101978139 | Ga0097620_1019781392 | 106 |
| 203 | 3300007076 | Ga0075435_100000302 | Ga0075435_10000030235 | 106 |
| 204 | 3300007076 | Ga0075435_100006291 | Ga0075435_1000062912 | 106 |
| 205 | 3300007076 | Ga0075435_101081743 | Ga0075435_1010817432 | 106 |
| 206 | 3300007265 | Ga0099794_10668363 | Ga0099794_106683631 | 106 |
| 207 | 3300009011 | Ga0105251_10000235 | Ga0105251_1000023517 | 106 |
| 208 | 3300009094 | Ga0111539_10050653 | Ga0111539_100506534 | 106 |
| 209 | 3300009098 | Ga0105245_10259188 | Ga0105245_102591883 | 106 |
| 210 | 3300009147 | Ga0114129_10241625 | Ga0114129_102416254 | 106 |
| 211 | 3300009147 | Ga0114129_10344711 | Ga0114129_103447112 | 106 |
| 212 | 3300009147 | Ga0114129_10913622 | Ga0114129_109136222 | 106 |
| 213 | 3300009147 | Ga0114129_13059416 | Ga0114129_130594162 | 106 |
| 214 | 3300009148 | Ga0105243_10090461 | Ga0105243_100904612 | 106 |
| 215 | 3300009174 | Ga0105241_10224775 | Ga0105241_102247753 | 106 |
| 216 | 3300009174 | Ga0105241_10909822 | Ga0105241_109098222 | 106 |
| 217 | 3300009176 | Ga0105242_10603294 | Ga0105242_106032942 | 106 |
| 218 | 3300009176 | Ga0105242_12819068 | Ga0105242_128190682 | 106 |
| 219 | 3300009545 | Ga0105237_10108140 | Ga0105237_101081403 | 106 |
| 220 | 3300009545 | Ga0105237_10174567 | Ga0105237_101745672 | 106 |
| 221 | 3300009545 | Ga0105237_12167344 | Ga0105237_121673442 | 106 |
| 222 | 3300009551 | Ga0105238_10260771 | Ga0105238_102607713 | 106 |
| 223 | 3300009553 | Ga0105249_10061295 | Ga0105249_100612953 | 106 |
| 224 | 3300009553 | Ga0105249_10412529 | Ga0105249_104125293 | 106 |
| 225 | 3300010159 | Ga0099796_10226747 | Ga0099796_102267472 | 106 |
| 226 | 3300010375 | Ga0105239_11374966 | Ga0105239_113749662 | 106 |
| 227 | 3300012506 | Ga0157324_1035676 | Ga0157324_10356762 | 106 |
| 228 | 3300013045 | Ga0154016_118439 | Ga0154016_1184392 | 106 |
| 229 | 3300013045 | Ga0154016_126409 | Ga0154016_1264092 | 106 |
| 230 | 3300013100 | Ga0157373_10284059 | Ga0157373_102840592 | 106 |
| 231 | 3300013100 | Ga0157373_10977570 | Ga0157373_109775701 | 106 |
| 232 | 3300013102 | Ga0157371_10000116 | Ga0157371_1000011610 | 106 |
| 233 | 3300013104 | Ga0157370_10000113 | Ga0157370_1000011310 | 106 |
| 234 | 3300013104 | Ga0157370_10003535 | Ga0157370_100035356 | 106 |
| 235 | 3300013296 | Ga0157374_10070470 | Ga0157374_100704703 | 106 |
| 236 | 3300013297 | Ga0157378_12234315 | Ga0157378_122343152 | 106 |
| 237 | 3300013306 | Ga0163162_10404034 | Ga0163162_104040342 | 106 |
| 238 | 3300013307 | Ga0157372_10000934 | Ga0157372_1000093410 | 106 |
| 239 | 3300013307 | Ga0157372_10712663 | Ga0157372_107126632 | 106 |
| 240 | 3300013308 | Ga0157375_10284339 | Ga0157375_102843393 | 106 |
| 241 | 3300013308 | Ga0157375_11556615 | Ga0157375_115566152 | 106 |
| 242 | 3300014326 | Ga0157380_10551560 | Ga0157380_105515603 | 106 |
| 243 | 3300014326 | Ga0157380_11204112 | Ga0157380_112041122 | 106 |
| 244 | 3300014497 | Ga0182008_10215370 | Ga0182008_102153703 | 106 |
| 245 | 3300014745 | Ga0157377_10003991 | Ga0157377_100039912 | 106 |
| 246 | 3300014745 | Ga0157377_10303577 | Ga0157377_103035772 | 106 |
| 247 | 3300015261 | Ga0182006_1002957 | Ga0182006_10029574 | 106 |
| 248 | 3300015262 | Ga0182007_10164852 | Ga0182007_101648521 | 106 |
| 249 | 3300017792 | Ga0163161_10111557 | Ga0163161_101115572 | 106 |
| 250 | 3300017792 | Ga0163161_10643358 | Ga0163161_106433582 | 106 |
| 251 | 3300019190 | Ga0184600_143334 | Ga0184600_1433341 | 106 |
| 252 | 3300019192 | Ga0184603_113096 | Ga0184603_1130961 | 106 |
| 253 | 3300020069 | Ga0197907_10096748 | Ga0197907_100967484 | 106 |
| 254 | 3300020069 | Ga0197907_10461614 | Ga0197907_104616142 | 106 |
| 255 | 3300020069 | Ga0197907_11057503 | Ga0197907_110575033 | 106 |
| 256 | 3300020070 | Ga0206356_10486280 | Ga0206356_104862804 | 106 |
| 257 | 3300020070 | Ga0206356_10513374 | Ga0206356_105133743 | 106 |
| 258 | 3300020070 | Ga0206356_10873524 | Ga0206356_108735242 | 106 |
| 259 | 3300020075 | Ga0206349_1662652 | Ga0206349_16626525 | 106 |
| 260 | 3300020076 | Ga0206355_1023336 | Ga0206355_10233364 | 106 |
| 261 | 3300020076 | Ga0206355_1392539 | Ga0206355_13925395 | 106 |
| 262 | 3300020077 | Ga0206351_10684938 | Ga0206351_106849381 | 106 |
| 263 | 3300020077 | Ga0206351_10916833 | Ga0206351_1091683310 | 106 |
| 264 | 3300020078 | Ga0206352_10572019 | Ga0206352_105720192 | 106 |
| 265 | 3300020078 | Ga0206352_10729265 | Ga0206352_107292652 | 106 |
| 266 | 3300020078 | Ga0206352_10974575 | Ga0206352_109745752 | 106 |
| 267 | 3300020078 | Ga0206352_11336802 | Ga0206352_113368023 | 106 |
| 268 | 3300020080 | Ga0206350_10211646 | Ga0206350_102116463 | 106 |
| 269 | 3300020080 | Ga0206350_11498580 | Ga0206350_114985803 | 106 |
| 270 | 3300020081 | Ga0206354_10021521 | Ga0206354_100215217 | 106 |
| 271 | 3300020081 | Ga0206354_10880266 | Ga0206354_108802663 | 106 |
| 272 | 3300020082 | Ga0206353_11167456 | Ga0206353_111674562 | 106 |
| 273 | 3300020082 | Ga0206353_11500459 | Ga0206353_115004593 | 106 |
| 274 | 3300020610 | Ga0154015_1067364 | Ga0154015_10673643 | 106 |
| 275 | 3300020610 | Ga0154015_1128747 | Ga0154015_11287479 | 106 |
| 276 | 3300021361 | Ga0213872_10016326 | Ga0213872_100163264 | 106 |
| 277 | 3300021377 | Ga0213874_10327120 | Ga0213874_103271201 | 106 |
| 278 | 3300021384 | Ga0213876_10296692 | Ga0213876_102966922 | 106 |
| 279 | 3300022467 | Ga0224712_10000044 | Ga0224712_1000004413 | 106 |
| 280 | 3300022467 | Ga0224712_10247596 | Ga0224712_102475961 | 106 |
| 281 | 3300023539 | Ga0247555_103641 | Ga0247555_1036412 | 106 |
| 282 | 3300023672 | Ga0247553_105158 | Ga0247553_1051582 | 106 |
| 283 | 3300025224 | Ga0209784_100003 | Ga0209784_100003411 | 106 |
| 284 | 3300025224 | Ga0209784_101717 | Ga0209784_1017173 | 106 |
| 285 | 3300025225 | Ga0209566_100002 | Ga0209566_1000021454 | 106 |
| 286 | 3300025225 | Ga0209566_100561 | Ga0209566_10056115 | 106 |
| 287 | 3300025226 | Ga0209674_100008 | Ga0209674_100008735 | 106 |
| 288 | 3300025226 | Ga0209674_100122 | Ga0209674_10012260 | 106 |
| 289 | 3300025226 | Ga0209674_104864 | Ga0209674_1048643 | 106 |
| 290 | 3300025228 | Ga0209672_100191 | Ga0209672_10019143 | 106 |
| 291 | 3300025228 | Ga0209672_100262 | Ga0209672_10026231 | 106 |
| 292 | 3300025229 | Ga0209147_100002 | Ga0209147_1000021833 | 106 |
| 293 | 3300025230 | Ga0209563_100004 | Ga0209563_100004867 | 106 |
| 294 | 3300025230 | Ga0209563_114310 | Ga0209563_1143103 | 106 |
| 295 | 3300025242 | Ga0209258_100002 | Ga0209258_1000021833 | 106 |
| 296 | 3300025246 | Ga0209646_1000022 | Ga0209646_1000022176 | 106 |
| 297 | 3300025250 | Ga0209026_1004035 | Ga0209026_10040354 | 106 |
| 298 | 3300025250 | Ga0209026_1012816 | Ga0209026_10128163 | 106 |
| 299 | 3300025253 | Ga0209677_100013 | Ga0209677_100013490 | 106 |
| 300 | 3300025253 | Ga0209677_103383 | Ga0209677_1033837 | 106 |
| 301 | 3300025254 | Ga0209148_1000021 | Ga0209148_1000021583 | 106 |
| 302 | 3300025256 | Ga0209759_1001746 | Ga0209759_10017469 | 106 |
| 303 | 3300025256 | Ga0209759_1009787 | Ga0209759_10097873 | 106 |
| 304 | 3300025256 | Ga0209759_1009842 | Ga0209759_10098423 | 106 |
| 305 | 3300025272 | Ga0209455_1000021 | Ga0209455_1000021420 | 106 |
| 306 | 3300025273 | Ga0209673_1006937 | Ga0209673_10069375 | 106 |
| 307 | 3300025273 | Ga0209673_1120883 | Ga0209673_11208831 | 106 |
| 308 | 3300025284 | Ga0209130_1001018 | Ga0209130_100101810 | 106 |
| 309 | 3300025291 | Ga0209675_1002884 | Ga0209675_10028845 | 106 |
| 310 | 3300025292 | Ga0209676_1004231 | Ga0209676_10042319 | 106 |
| 311 | 3300025295 | Ga0209564_1000003 | Ga0209564_10000031254 | 106 |
| 312 | 3300025295 | Ga0209564_1054880 | Ga0209564_10548801 | 106 |
| 313 | 3300025298 | Ga0209050_1042299 | Ga0209050_10422992 | 106 |
| 314 | 3300025302 | Ga0207426_1005325 | Ga0207426_10053256 | 106 |
| 315 | 3300025303 | Ga0209051_1004959 | Ga0209051_10049592 | 106 |
| 316 | 3300025304 | Ga0209257_1017381 | Ga0209257_10173813 | 106 |
| 317 | 3300025315 | Ga0207697_10188647 | Ga0207697_101886472 | 106 |
| 318 | 3300025321 | Ga0207656_10476970 | Ga0207656_104769701 | 106 |
| 319 | 3300025735 | Ga0207713_1003258 | Ga0207713_10032586 | 106 |
| 320 | 3300025893 | Ga0207682_10165497 | Ga0207682_101654972 | 106 |
| 321 | 3300025898 | Ga0207692_10046539 | Ga0207692_100465393 | 106 |
| 322 | 3300025898 | Ga0207692_10268318 | Ga0207692_102683182 | 106 |
| 323 | 3300025899 | Ga0207642_10019006 | Ga0207642_100190063 | 106 |
| 324 | 3300025899 | Ga0207642_10376384 | Ga0207642_103763842 | 106 |
| 325 | 3300025899 | Ga0207642_10870093 | Ga0207642_108700932 | 106 |
| 326 | 3300025901 | Ga0207688_10058923 | Ga0207688_100589233 | 106 |
| 327 | 3300025901 | Ga0207688_10217995 | Ga0207688_102179951 | 106 |
| 328 | 3300025904 | Ga0207647_10096771 | Ga0207647_100967712 | 106 |
| 329 | 3300025906 | Ga0207699_10817504 | Ga0207699_108175042 | 106 |
| 330 | 3300025907 | Ga0207645_10080293 | Ga0207645_100802932 | 106 |
| 331 | 3300025907 | Ga0207645_10149669 | Ga0207645_101496691 | 106 |
| 332 | 3300025907 | Ga0207645_10350479 | Ga0207645_103504792 | 106 |
| 333 | 3300025908 | Ga0207643_10052674 | Ga0207643_100526742 | 106 |
| 334 | 3300025908 | Ga0207643_10296139 | Ga0207643_102961392 | 106 |
| 335 | 3300025909 | Ga0207705_10004497 | Ga0207705_100044979 | 106 |
| 336 | 3300025909 | Ga0207705_10048443 | Ga0207705_100484432 | 106 |
| 337 | 3300025909 | Ga0207705_10102021 | Ga0207705_101020213 | 106 |
| 338 | 3300025910 | Ga0207684_11338875 | Ga0207684_113388752 | 106 |
| 339 | 3300025911 | Ga0207654_10129305 | Ga0207654_101293052 | 106 |
| 340 | 3300025911 | Ga0207654_10262477 | Ga0207654_102624772 | 106 |
| 341 | 3300025911 | Ga0207654_10444638 | Ga0207654_104446382 | 106 |
| 342 | 3300025911 | Ga0207654_10514987 | Ga0207654_105149872 | 106 |
| 343 | 3300025912 | Ga0207707_10003333 | Ga0207707_1000333317 | 106 |
| 344 | 3300025912 | Ga0207707_10017964 | Ga0207707_100179645 | 106 |
| 345 | 3300025912 | Ga0207707_10352596 | Ga0207707_103525963 | 106 |
| 346 | 3300025912 | Ga0207707_10431661 | Ga0207707_104316612 | 106 |
| 347 | 3300025913 | Ga0207695_10007787 | Ga0207695_100077872 | 106 |
| 348 | 3300025913 | Ga0207695_10167799 | Ga0207695_101677992 | 106 |
| 349 | 3300025913 | Ga0207695_11478049 | Ga0207695_114780491 | 106 |
| 350 | 3300025914 | Ga0207671_10957107 | Ga0207671_109571072 | 106 |
| 351 | 3300025914 | Ga0207671_11416962 | Ga0207671_114169622 | 106 |
| 352 | 3300025915 | Ga0207693_10935222 | Ga0207693_109352222 | 106 |
| 353 | 3300025916 | Ga0207663_10632400 | Ga0207663_106324002 | 106 |
| 354 | 3300025917 | Ga0207660_11295582 | Ga0207660_112955821 | 106 |
| 355 | 3300025917 | Ga0207660_11551235 | Ga0207660_115512352 | 106 |
| 356 | 3300025918 | Ga0207662_10065469 | Ga0207662_100654693 | 106 |
| 357 | 3300025918 | Ga0207662_10074935 | Ga0207662_100749353 | 106 |
| 358 | 3300025918 | Ga0207662_11288732 | Ga0207662_112887322 | 106 |
| 359 | 3300025919 | Ga0207657_10376439 | Ga0207657_103764392 | 106 |
| 360 | 3300025920 | Ga0207649_10000019 | Ga0207649_1000001959 | 106 |
| 361 | 3300025920 | Ga0207649_10514318 | Ga0207649_105143182 | 106 |
| 362 | 3300025922 | Ga0207646_10904070 | Ga0207646_109040702 | 106 |
| 363 | 3300025923 | Ga0207681_10006318 | Ga0207681_100063185 | 106 |
| 364 | 3300025923 | Ga0207681_11626813 | Ga0207681_116268131 | 106 |
| 365 | 3300025924 | Ga0207694_10024154 | Ga0207694_100241543 | 106 |
| 366 | 3300025924 | Ga0207694_10061904 | Ga0207694_100619042 | 106 |
| 367 | 3300025924 | Ga0207694_10840093 | Ga0207694_108400932 | 106 |
| 368 | 3300025926 | Ga0207659_10117562 | Ga0207659_101175623 | 106 |
| 369 | 3300025927 | Ga0207687_10179688 | Ga0207687_101796883 | 106 |
| 370 | 3300025927 | Ga0207687_11510270 | Ga0207687_115102702 | 106 |
| 371 | 3300025928 | Ga0207700_10000495 | Ga0207700_100004959 | 106 |
| 372 | 3300025928 | Ga0207700_10009038 | Ga0207700_100090385 | 106 |
| 373 | 3300025929 | Ga0207664_11280642 | Ga0207664_112806422 | 106 |
| 374 | 3300025931 | Ga0207644_10598831 | Ga0207644_105988312 | 106 |
| 375 | 3300025931 | Ga0207644_10878043 | Ga0207644_108780432 | 106 |
| 376 | 3300025931 | Ga0207644_11664126 | Ga0207644_116641262 | 106 |
| 377 | 3300025932 | Ga0207690_10004220 | Ga0207690_100042205 | 106 |
| 378 | 3300025932 | Ga0207690_10083643 | Ga0207690_100836432 | 106 |
| 379 | 3300025932 | Ga0207690_10092771 | Ga0207690_100927711 | 106 |
| 380 | 3300025932 | Ga0207690_10414985 | Ga0207690_104149851 | 106 |
| 381 | 3300025932 | Ga0207690_11063113 | Ga0207690_110631132 | 106 |
| 382 | 3300025933 | Ga0207706_10818677 | Ga0207706_108186772 | 106 |
| 383 | 3300025933 | Ga0207706_10926708 | Ga0207706_109267082 | 106 |
| 384 | 3300025934 | Ga0207686_10017691 | Ga0207686_100176914 | 106 |
| 385 | 3300025934 | Ga0207686_10341938 | Ga0207686_103419382 | 106 |
| 386 | 3300025934 | Ga0207686_10653498 | Ga0207686_106534982 | 106 |
| 387 | 3300025934 | Ga0207686_10975756 | Ga0207686_109757562 | 106 |
| 388 | 3300025934 | Ga0207686_11642537 | Ga0207686_116425371 | 106 |
| 389 | 3300025935 | Ga0207709_10304272 | Ga0207709_103042721 | 106 |
| 390 | 3300025935 | Ga0207709_10513108 | Ga0207709_105131082 | 106 |
| 391 | 3300025935 | Ga0207709_10732430 | Ga0207709_107324302 | 106 |
| 392 | 3300025936 | Ga0207670_10016847 | Ga0207670_100168471 | 106 |
| 393 | 3300025936 | Ga0207670_10095265 | Ga0207670_100952652 | 106 |
| 394 | 3300025936 | Ga0207670_10162231 | Ga0207670_101622313 | 106 |
| 395 | 3300025936 | Ga0207670_10319587 | Ga0207670_103195871 | 106 |
| 396 | 3300025936 | Ga0207670_10500308 | Ga0207670_105003082 | 106 |
| 397 | 3300025936 | Ga0207670_11183547 | Ga0207670_111835472 | 106 |
| 398 | 3300025936 | Ga0207670_11314179 | Ga0207670_113141792 | 106 |
| 399 | 3300025936 | Ga0207670_11387470 | Ga0207670_113874702 | 106 |
| 400 | 3300025937 | Ga0207669_10003349 | Ga0207669_100033495 | 106 |
| 401 | 3300025937 | Ga0207669_10067218 | Ga0207669_100672182 | 106 |
| 402 | 3300025937 | Ga0207669_10215681 | Ga0207669_102156812 | 106 |
| 403 | 3300025937 | Ga0207669_10589111 | Ga0207669_105891112 | 106 |
| 404 | 3300025937 | Ga0207669_11926550 | Ga0207669_119265501 | 106 |
| 405 | 3300025938 | Ga0207704_10186636 | Ga0207704_101866363 | 106 |
| 406 | 3300025938 | Ga0207704_10419248 | Ga0207704_104192483 | 106 |
| 407 | 3300025938 | Ga0207704_10702915 | Ga0207704_107029151 | 106 |
| 408 | 3300025938 | Ga0207704_11369597 | Ga0207704_113695972 | 106 |
| 409 | 3300025940 | Ga0207691_10009168 | Ga0207691_100091689 | 106 |
| 410 | 3300025940 | Ga0207691_10048698 | Ga0207691_100486981 | 106 |
| 411 | 3300025940 | Ga0207691_10066699 | Ga0207691_100666993 | 106 |
| 412 | 3300025940 | Ga0207691_10089068 | Ga0207691_100890683 | 106 |
| 413 | 3300025941 | Ga0207711_10177084 | Ga0207711_101770842 | 106 |
| 414 | 3300025942 | Ga0207689_10146813 | Ga0207689_101468133 | 106 |
| 415 | 3300025942 | Ga0207689_10348701 | Ga0207689_103487012 | 106 |
| 416 | 3300025945 | Ga0207679_10000001 | Ga0207679_10000001428 | 106 |
| 417 | 3300025949 | Ga0207667_10000448 | Ga0207667_1000044832 | 106 |
| 418 | 3300025949 | Ga0207667_10033006 | Ga0207667_100330065 | 106 |
| 419 | 3300025960 | Ga0207651_10090054 | Ga0207651_100900542 | 106 |
| 420 | 3300025960 | Ga0207651_10874916 | Ga0207651_108749162 | 106 |
| 421 | 3300025960 | Ga0207651_11656330 | Ga0207651_116563301 | 106 |
| 422 | 3300025961 | Ga0207712_10048652 | Ga0207712_100486524 | 106 |
| 423 | 3300025961 | Ga0207712_10311319 | Ga0207712_103113192 | 106 |
| 424 | 3300025972 | Ga0207668_10070816 | Ga0207668_100708163 | 106 |
| 425 | 3300025981 | Ga0207640_10000524 | Ga0207640_1000052420 | 106 |
| 426 | 3300025986 | Ga0207658_10127539 | Ga0207658_101275393 | 106 |
| 427 | 3300026023 | Ga0207677_11385106 | Ga0207677_113851061 | 106 |
| 428 | 3300026035 | Ga0207703_10060947 | Ga0207703_100609474 | 106 |
| 429 | 3300026035 | Ga0207703_10398177 | Ga0207703_103981772 | 106 |
| 430 | 3300026041 | Ga0207639_10009210 | Ga0207639_100092103 | 106 |
| 431 | 3300026041 | Ga0207639_10077667 | Ga0207639_100776672 | 106 |
| 432 | 3300026067 | Ga0207678_10000001 | Ga0207678_100000016 | 106 |
| 433 | 3300026067 | Ga0207678_10270872 | Ga0207678_102708722 | 106 |
| 434 | 3300026067 | Ga0207678_10799333 | Ga0207678_107993332 | 106 |
| 435 | 3300026067 | Ga0207678_11299199 | Ga0207678_112991992 | 106 |
| 436 | 3300026075 | Ga0207708_10109603 | Ga0207708_101096034 | 106 |
| 437 | 3300026075 | Ga0207708_10135070 | Ga0207708_101350703 | 106 |
| 438 | 3300026075 | Ga0207708_10558744 | Ga0207708_105587442 | 106 |
| 439 | 3300026075 | Ga0207708_10730771 | Ga0207708_107307712 | 106 |
| 440 | 3300026075 | Ga0207708_11107100 | Ga0207708_111071002 | 106 |
| 441 | 3300026075 | Ga0207708_11705663 | Ga0207708_117056631 | 106 |
| 442 | 3300026075 | Ga0207708_11994386 | Ga0207708_119943861 | 106 |
| 443 | 3300026078 | Ga0207702_10000009 | Ga0207702_10000009222 | 106 |
| 444 | 3300026078 | Ga0207702_10352718 | Ga0207702_103527181 | 106 |
| 445 | 3300026078 | Ga0207702_11596169 | Ga0207702_115961692 | 106 |
| 446 | 3300026078 | Ga0207702_12044860 | Ga0207702_120448601 | 106 |
| 447 | 3300026089 | Ga0207648_10002987 | Ga0207648_100029873 | 106 |
| 448 | 3300026089 | Ga0207648_10023686 | Ga0207648_100236863 | 106 |
| 449 | 3300026089 | Ga0207648_10329467 | Ga0207648_103294673 | 106 |
| 450 | 3300026089 | Ga0207648_10628130 | Ga0207648_106281301 | 106 |
| 451 | 3300026089 | Ga0207648_11992140 | Ga0207648_119921401 | 106 |
| 452 | 3300026095 | Ga0207676_10226347 | Ga0207676_102263473 | 106 |
| 453 | 3300026116 | Ga0207674_10045617 | Ga0207674_100456173 | 106 |
| 454 | 3300026116 | Ga0207674_10054589 | Ga0207674_100545892 | 106 |
| 455 | 3300026118 | Ga0207675_100000651 | Ga0207675_10000065110 | 106 |
| 456 | 3300026118 | Ga0207675_100750097 | Ga0207675_1007500972 | 106 |
| 457 | 3300026118 | Ga0207675_101326854 | Ga0207675_1013268541 | 106 |
| 458 | 3300026118 | Ga0207675_102621661 | Ga0207675_1026216612 | 106 |
| 459 | 3300026121 | Ga0207683_10429447 | Ga0207683_104294472 | 106 |
| 460 | 3300026121 | Ga0207683_11554482 | Ga0207683_115544822 | 106 |
| 461 | 3300026121 | Ga0207683_12135017 | Ga0207683_121350171 | 106 |
| 462 | 3300026142 | Ga0207698_10009939 | Ga0207698_100099392 | 106 |
| 463 | 3300026142 | Ga0207698_10011610 | Ga0207698_100116103 | 106 |
| 464 | 3300026142 | Ga0207698_10047010 | Ga0207698_100470103 | 106 |
| 465 | 3300027252 | Ga0209973_1067432 | Ga0209973_10674322 | 106 |
| 466 | 3300027360 | Ga0209969_1045956 | Ga0209969_10459562 | 106 |
| 467 | 3300027364 | Ga0209967_1057407 | Ga0209967_10574072 | 106 |
| 468 | 3300027378 | Ga0209981_1026343 | Ga0209981_10263431 | 106 |
| 469 | 3300027395 | Ga0209996_1010049 | Ga0209996_10100492 | 106 |
| 470 | 3300027462 | Ga0210000_1006410 | Ga0210000_10064103 | 106 |
| 471 | 3300027543 | Ga0209999_1014606 | Ga0209999_10146062 | 106 |
| 472 | 3300027543 | Ga0209999_1113214 | Ga0209999_11132142 | 106 |
| 473 | 3300027695 | Ga0209966_1013884 | Ga0209966_10138842 | 106 |
| 474 | 3300027866 | Ga0209813_10228650 | Ga0209813_102286502 | 106 |
| 475 | 3300027876 | Ga0209974_10007790 | Ga0209974_100077904 | 106 |
| 476 | 3300027876 | Ga0209974_10261786 | Ga0209974_102617862 | 106 |
| 477 | 3300027907 | Ga0207428_10010038 | Ga0207428_100100388 | 106 |
| 478 | 3300027907 | Ga0207428_10019374 | Ga0207428_100193742 | 106 |
| 479 | 3300028379 | Ga0268266_10621820 | Ga0268266_106218201 | 106 |
| 480 | 3300028380 | Ga0268265_10000781 | Ga0268265_1000078125 | 106 |
| 481 | 3300028381 | Ga0268264_10890793 | Ga0268264_108907932 | 106 |
| 482 | 3300028381 | Ga0268264_11272816 | Ga0268264_112728162 | 106 |
| 483 | 3300028786 | Ga0307517_10090243 | Ga0307517_100902433 | 106 |
| 484 | 3300028794 | Ga0307515_10005265 | Ga0307515_100052657 | 106 |
| 485 | 3300028800 | Ga0265338_10000437 | Ga0265338_1000043727 | 106 |
| 486 | 3300028800 | Ga0265338_10345137 | Ga0265338_103451372 | 106 |
| 487 | 3300028800 | Ga0265338_10546694 | Ga0265338_105466942 | 106 |
| 488 | 3300030762 | Ga0265775_103433 | Ga0265775_1034331 | 106 |
| 489 | 3300030877 | Ga0265777_120507 | Ga0265777_1205072 | 106 |
| 490 | 3300031247 | Ga0265340_10113759 | Ga0265340_101137593 | 106 |
| 491 | 3300031249 | Ga0265339_10070299 | Ga0265339_100702991 | 106 |
| 492 | 3300031251 | Ga0265327_10108566 | Ga0265327_101085662 | 106 |
| 493 | 3300031507 | Ga0307509_10313403 | Ga0307509_103134032 | 106 |
| 494 | 3300031548 | Ga0307408_100000045 | Ga0307408_10000004561 | 106 |
| 495 | 3300031548 | Ga0307408_100120473 | Ga0307408_1001204733 | 106 |
| 496 | 3300031548 | Ga0307408_100630004 | Ga0307408_1006300042 | 106 |
| 497 | 3300031548 | Ga0307408_101427371 | Ga0307408_1014273712 | 106 |
| 498 | 3300031548 | Ga0307408_101599402 | Ga0307408_1015994021 | 106 |
| 499 | 3300031616 | Ga0307508_10088170 | Ga0307508_100881702 | 106 |
| 500 | 3300031665 | Ga0316575_10006460 | Ga0316575_100064605 | 106 |
| 501 | 3300031665 | Ga0316575_10190708 | Ga0316575_101907082 | 106 |
| 502 | 3300031691 | Ga0316579_10203284 | Ga0316579_102032842 | 106 |
| 503 | 3300031727 | Ga0316576_10002247 | Ga0316576_1000224712 | 106 |
| 504 | 3300031727 | Ga0316576_10093005 | Ga0316576_100930053 | 106 |
| 505 | 3300031728 | Ga0316578_10007566 | Ga0316578_100075665 | 106 |
| 506 | 3300031728 | Ga0316578_10011211 | Ga0316578_100112113 | 106 |
| 507 | 3300031730 | Ga0307516_10000497 | Ga0307516_1000049754 | 106 |
| 508 | 3300031731 | Ga0307405_10278881 | Ga0307405_102788813 | 106 |
| 509 | 3300031731 | Ga0307405_10554047 | Ga0307405_105540472 | 106 |
| 510 | 3300031731 | Ga0307405_10691956 | Ga0307405_106919561 | 106 |
| 511 | 3300031733 | Ga0316577_10355600 | Ga0316577_103556003 | 106 |
| 512 | 3300031733 | Ga0316577_10864253 | Ga0316577_108642532 | 106 |
| 513 | 3300031852 | Ga0307410_11217328 | Ga0307410_112173281 | 106 |
| 514 | 3300031852 | Ga0307410_11792653 | Ga0307410_117926531 | 106 |
| 515 | 3300031901 | Ga0307406_10393856 | Ga0307406_103938562 | 106 |
| 516 | 3300031903 | Ga0307407_10240309 | Ga0307407_102403092 | 106 |
| 517 | 3300031903 | Ga0307407_10308579 | Ga0307407_103085793 | 106 |
| 518 | 3300031903 | Ga0307407_11357904 | Ga0307407_113579041 | 106 |
| 519 | 3300031903 | Ga0307407_11507949 | Ga0307407_115079492 | 106 |
| 520 | 3300031911 | Ga0307412_10857053 | Ga0307412_108570532 | 106 |
| 521 | 3300031911 | Ga0307412_11450827 | Ga0307412_114508271 | 106 |
| 522 | 3300031911 | Ga0307412_11988103 | Ga0307412_119881031 | 106 |
| 523 | 3300031995 | Ga0307409_101229868 | Ga0307409_1012298682 | 106 |
| 524 | 3300032002 | Ga0307416_100110795 | Ga0307416_1001107953 | 106 |
| 525 | 3300032002 | Ga0307416_100285191 | Ga0307416_1002851913 | 106 |
| 526 | 3300032002 | Ga0307416_100438841 | Ga0307416_1004388412 | 106 |
| 527 | 3300032002 | Ga0307416_100901108 | Ga0307416_1009011082 | 106 |
| 528 | 3300032002 | Ga0307416_101752088 | Ga0307416_1017520882 | 106 |
| 529 | 3300032002 | Ga0307416_102269369 | Ga0307416_1022693692 | 106 |
| 530 | 3300032002 | Ga0307416_103573097 | Ga0307416_1035730971 | 106 |
| 531 | 3300032004 | Ga0307414_11105717 | Ga0307414_111057172 | 106 |
| 532 | 3300032005 | Ga0307411_10388379 | Ga0307411_103883792 | 106 |
| 533 | 3300032005 | Ga0307411_10497003 | Ga0307411_104970031 | 106 |
| 534 | 3300032005 | Ga0307411_12320205 | Ga0307411_123202052 | 106 |
| 535 | 3300032126 | Ga0307415_102196916 | Ga0307415_1021969162 | 106 |
| 536 | 3300032137 | Ga0316585_10091901 | Ga0316585_100919012 | 106 |
| 537 | 3300032139 | Ga0316580_10011155 | Ga0316580_100111553 | 106 |
| 538 | 3300032168 | Ga0316593_10003965 | Ga0316593_100039654 | 106 |
| 539 | 3300032168 | Ga0316593_10089441 | Ga0316593_100894411 | 106 |
| 540 | 3300033179 | Ga0307507_10019824 | Ga0307507_100198246 | 106 |
| 541 | 3300033524 | Ga0316592_1134577 | Ga0316592_11345772 | 106 |
| 542 | 3300033527 | Ga0316586_1103683 | Ga0316586_11036832 | 106 |
| 543 | 3300033528 | Ga0316588_1097460 | Ga0316588_10974602 | 106 |
| 544 | 3300033528 | Ga0316588_1123078 | Ga0316588_11230782 | 106 |
| 545 | 3300033529 | Ga0316587_1002090 | Ga0316587_10020902 | 106 |
| 546 | 3300033529 | Ga0316587_1011610 | Ga0316587_10116102 | 106 |
| 547 | 3300033529 | Ga0316587_1019366 | Ga0316587_10193661 | 106 |
| 548 | 3300033541 | Ga0316596_1034527 | Ga0316596_10345272 | 106 |
| 549 | 3300035084 | Ga0373928_0191453 | Ga0373928_0191453_44_367 | 106 |
| 550 | 3300035084 | Ga0373928_0228638 | Ga0373928_0228638_213_536 | 106 |
| 551 | 3300035086 | Ga0373934_0145630 | Ga0373934_0145630_327_647 | 106 |
| 552 | 3300035092 | Ga0373952_0159408 | Ga0373952_0159408_36_362 | 106 |
| 553 | 3300035111 | Ga0373923_0031333 | Ga0373923_0031333_651_974 | 106 |
| 554 | 3300035111 | Ga0373923_0382017 | Ga0373923_0382017_230_550 | 106 |
| 555 | 3300035112 | Ga0373932_0126165 | Ga0373932_0126165_173_496 | 106 |
| 556 | 3300035114 | Ga0373939_0030774 | Ga0373939_0030774_1023_1346 | 106 |
| 557 | 3300035115 | Ga0373941_0413071 | Ga0373941_0413071_68_394 | 106 |
| 558 | 3300035119 | Ga0373956_0000024 | Ga0373956_0000024_21624_21944 | 106 |
| 559 | 3300035119 | Ga0373956_0203203 | Ga0373956_0203203_62_385 | 106 |
| 560 | 3300035119 | Ga0373956_0518955 | Ga0373956_0518955_182_502 | 106 |
| 561 | 3300035120 | Ga0373957_0205695 | Ga0373957_0205695_209_532 | 106 |
| 562 | 3300035172 | Ga0373955_0046538 | Ga0373955_0046538_439_762 | 106 |
| 563 | 3300035172 | Ga0373955_0139157 | Ga0373955_0139157_165_485 | 106 |
| 564 | 3300035242 | Ga0373962_0148338 | Ga0373962_0148338_364_690 | 106 |
| 565 | 3300035398 | Ga0316574_0001833 | Ga0316574_0001833_9370_9693 | 106 |
| 566 | 3300035398 | Ga0316574_0005586 | Ga0316574_0005586_4932_5255 | 106 |
| 567 | 3300035398 | Ga0316574_0052189 | Ga0316574_0052189_1232_1555 | 106 |
| 568 | 3300035398 | Ga0316574_0357223 | Ga0316574_0357223_303_626 | 106 |
| 569 | 3300035398 | Ga0316574_0504742 | Ga0316574_0504742_168_491 | 106 |
| 570 | 3300035410 | Ga0373924_0045660 | Ga0373924_0045660_899_1222 | 106 |
| 571 | 3300035691 | Ga0373931_0091770 | Ga0373931_0091770_1271_1594 | 106 |
| 572 | 3300035691 | Ga0373931_0314507 | Ga0373931_0314507_127_450 | 106 |
| 573 | 3300035691 | Ga0373931_0372930 | Ga0373931_0372930_98_421 | 106 |
| 574 | 3300035691 | Ga0373931_1108584 | Ga0373931_1108584_29_352 | 106 |
| 575 | 3300035695 | Ga0373927_0042117 | Ga0373927_0042117_500_823 | 106 |
| 576 | 3300035724 | Ga0373933_0001797 | Ga0373933_0001797_5940_6260 | 106 |
| 577 | 3300035724 | Ga0373933_0002861 | Ga0373933_0002861_581_904 | 106 |
| 578 | 3300035724 | Ga0373933_0081365 | Ga0373933_0081365_629_952 | 106 |
| 579 | 3300035725 | Ga0373947_0310657 | Ga0373947_0310657_386_709 | 106 |
| 580 | 3300036401 | Ga0373937_0008435 | Ga0373937_0008435_70_390 | 106 |
| 581 | 3300036401 | Ga0373937_0250628 | Ga0373937_0250628_993_1313 | 106 |
| 582 | 3300036401 | Ga0373937_0419245 | Ga0373937_0419245_407_730 | 106 |
| 583 | 3300036401 | Ga0373937_0877475 | Ga0373937_0877475_379_702 | 106 |
| 584 | 3300036647 | Ga0316582_0006883 | Ga0316582_0006883_763_1086 | 106 |
| 585 | 3300036647 | Ga0316582_0021935 | Ga0316582_0021935_1091_1414 | 106 |
| 586 | 3300036712 | Ga0316584_0074316 | Ga0316584_0074316_1466_1789 | 106 |
| 587 | 3300037068 | Ga0373925_0023592 | Ga0373925_0023592_1775_2098 | 106 |
| 588 | 3300037312 | Ga0395899_0004578 | Ga0395899_0004578_1462_1785 | 106 |
| 589 | 3300037312 | Ga0395899_0182624 | Ga0395899_0182624_463_783 | 106 |
| 590 | 3300037418 | Ga0395900_0011866 | Ga0395900_0011866_7293_7613 | 106 |
| 591 | 3300037418 | Ga0395900_1535479 | Ga0395900_1535479_248_568 | 106 |
| 592 | 3300037466 | Ga0395898_0106330 | Ga0395898_0106330_808_1131 | 106 |
| 593 | 3300037471 | Ga0395905_0041433 | Ga0395905_0041433_1992_2315 | 106 |
| 594 | 3300037471 | Ga0395905_0070324 | Ga0395905_0070324_2439_2762 | 106 |
| 595 | 3300038443 | Ga0395901_0000067 | Ga0395901_0000067_51975_52298 | 106 |
| 596 | 3300038443 | Ga0395901_0000133 | Ga0395901_0000133_31082_31405 | 106 |
| 597 | 3300038443 | Ga0395901_0040588 | Ga0395901_0040588_3749_4072 | 106 |
| 598 | 3300038741 | Ga0400488_61282 | Ga0400488_61282_844_1167 | 106 |
| 599 | 3300039062 | Ga0400483_089547 | Ga0400483_089547_40_363 | 106 |
| 600 | 3300039062 | Ga0400483_232620 | Ga0400483_232620_1455_1778 | 106 |
| 601 | 3300039437 | Ga0436365_1415897 | Ga0436365_1415897_178_501 | 106 |
| 602 | 3300039438 | Ga0436360_0397467 | Ga0436360_0397467_117_440 | 106 |
| 603 | 3300039447 | Ga0436361_0175365 | Ga0436361_0175365_2424_2747 | 106 |
| 604 | 3300039447 | Ga0436361_0445788 | Ga0436361_0445788_1462_1785 | 106 |
| 605 | 3300039447 | Ga0436361_0519408 | Ga0436361_0519408_217_540 | 106 |
| 606 | 3300039450 | Ga0436363_1636299 | Ga0436363_1636299_41_364 | 106 |
| 607 | 3300041408 | Ga0439453_0019803 | Ga0439453_0019803_486_812 | 106 |
| 608 | 3300041441 | Ga0451787_551626 | Ga0451787_551626_171_494 | 106 |
| 609 | 3300041451 | Ga0451791_1922986 | Ga0451791_1922986_437_760 | 106 |
| 610 | 3300041452 | Ga0451793_1901220 | Ga0451793_1901220_114_437 | 106 |
| 611 | 3300041459 | Ga0451800_1202501 | Ga0451800_1202501_726_1049 | 106 |
| 612 | 3300041460 | Ga0451802_0617498 | Ga0451802_0617498_437_760 | 106 |
| 613 | 3300041461 | Ga0451805_043617 | Ga0451805_043617_168_491 | 106 |
| 614 | 3300041486 | Ga0451807_0798448 | Ga0451807_0798448_142_465 | 106 |
| 615 | 3300041486 | Ga0451807_1988912 | Ga0451807_1988912_841_1164 | 106 |
| 616 | 3300041486 | Ga0451807_2587691 | Ga0451807_2587691_51_371 | 106 |
| 617 | 3300041492 | Ga0451835_0942726 | Ga0451835_0942726_15_338 | 106 |
| 618 | 3300041494 | Ga0451837_0972705 | Ga0451837_0972705_153_476 | 106 |
| 619 | 3300041505 | Ga0451849_0100067 | Ga0451849_0100067_333_653 | 106 |
| 620 | 3300041505 | Ga0451849_0963451 | Ga0451849_0963451_220_543 | 106 |
| 621 | 3300041512 | Ga0451853_2875636 | Ga0451853_2875636_92_415 | 106 |
| 622 | 3300042001 | Ga0439441_001465 | Ga0439441_001465_2632_2958 | 106 |
| 623 | 3300042001 | Ga0439441_075255 | Ga0439441_075255_207_530 | 106 |
| 624 | 3300042001 | Ga0439441_140780 | Ga0439441_140780_72_395 | 106 |
| 625 | 3300042001 | Ga0439441_157897 | Ga0439441_157897_95_415 | 106 |
| 626 | 3300042006 | Ga0439432_069865 | Ga0439432_069865_273_596 | 106 |
| 627 | 3300042116 | Ga0450912_017126 | Ga0450912_017126_159_485 | 106 |
| 628 | 3300042134 | Ga0450898_087457 | Ga0450898_087457_267_590 | 106 |
| 629 | 3300042156 | Ga0439446_0078567 | Ga0439446_0078567_645_971 | 106 |
| 630 | 3300042156 | Ga0439446_0372046 | Ga0439446_0372046_51_377 | 106 |
| 631 | 3300042436 | Ga0439435_0002787 | Ga0439435_0002787_2545_2871 | 106 |
| 632 | 3300042436 | Ga0439435_0003953 | Ga0439435_0003953_1095_1421 | 106 |
| 633 | 3300042437 | Ga0439444_0119056 | Ga0439444_0119056_135_461 | 106 |
| 634 | 3300042439 | Ga0439464_0013042 | Ga0439464_0013042_952_1275 | 106 |
| 635 | 3300042461 | Ga0439460_0002676 | Ga0439460_0002676_659_985 | 106 |
| 636 | 3300042461 | Ga0439460_0002980 | Ga0439460_0002980_2303_2629 | 106 |
| 637 | 3300042530 | Ga0450916_097199 | Ga0450916_097199_63_389 | 106 |
| 638 | 3300042532 | Ga0450893_0056963 | Ga0450893_0056963_295_621 | 106 |
| 639 | 3300042533 | Ga0450901_004179 | Ga0450901_004179_1121_1444 | 106 |
| 640 | 3300042876 | Ga0451577_0000743 | Ga0451577_0000743_43847_44170 | 106 |
| 641 | 3300042876 | Ga0451577_0130736 | Ga0451577_0130736_168_491 | 106 |
| 642 | 3300042876 | Ga0451577_0264911 | Ga0451577_0264911_1045_1368 | 106 |
| 643 | 3300042876 | Ga0451577_0450751 | Ga0451577_0450751_798_1121 | 106 |
| 644 | 3300042876 | Ga0451577_0590509 | Ga0451577_0590509_670_993 | 106 |
| 645 | 3300042876 | Ga0451577_0760264 | Ga0451577_0760264_177_500 | 106 |
| 646 | 3300042876 | Ga0451577_0794399 | Ga0451577_0794399_22_345 | 106 |
| 647 | 3300044656 | Ga0466969_0035504 | Ga0466969_0035504_692_1015 | 106 |
| 648 | 3300044656 | Ga0466969_0083388 | Ga0466969_0083388_1068_1391 | 106 |
| 649 | 3300044656 | Ga0466969_0125530 | Ga0466969_0125530_781_1104 | 106 |
| 650 | 3300044683 | Ga0466965_0018466 | Ga0466965_0018466_2694_3017 | 106 |
| 651 | 3300044684 | Ga0466966_0000067 | Ga0466966_0000067_65121_65444 | 106 |
| 652 | 3300044684 | Ga0466966_0032486 | Ga0466966_0032486_2178_2501 | 106 |
| 653 | 3300044684 | Ga0466966_0038100 | Ga0466966_0038100_1784_2107 | 106 |
| 654 | 3300044684 | Ga0466966_0717331 | Ga0466966_0717331_36_359 | 106 |
| 655 | 3300044684 | Ga0466966_0849720 | Ga0466966_0849720_10_333 | 106 |
| 656 | 3300044693 | Ga0466961_0000526 | Ga0466961_0000526_21583_21906 | 106 |
| 657 | 3300044693 | Ga0466961_0004076 | Ga0466961_0004076_3369_3692 | 106 |
| 658 | 3300044693 | Ga0466961_0019938 | Ga0466961_0019938_288_611 | 106 |
| 659 | 3300044693 | Ga0466961_0054694 | Ga0466961_0054694_1758_2081 | 106 |
| 660 | 3300044694 | Ga0466963_0053430 | Ga0466963_0053430_244_567 | 106 |
| 661 | 3300044694 | Ga0466963_0056541 | Ga0466963_0056541_1502_1825 | 106 |
| 662 | 3300044706 | Ga0466964_0040415 | Ga0466964_0040415_1106_1429 | 106 |
| 663 | 3300044706 | Ga0466964_0568719 | Ga0466964_0568719_274_597 | 106 |
| 664 | 3300044706 | Ga0466964_0834294 | Ga0466964_0834294_100_423 | 106 |
| 665 | 3300044712 | Ga0453684_0002107 | Ga0453684_0002107_43865_44188 | 106 |
| 666 | 3300044712 | Ga0453684_0002541 | Ga0453684_0002541_20169_20489 | 106 |
| 667 | 3300044712 | Ga0453684_2135829 | Ga0453684_2135829_220_543 | 106 |
| 668 | 3300044719 | Ga0466971_0001855 | Ga0466971_0001855_2502_2825 | 106 |
| 669 | 3300044735 | Ga0466968_0054594 | Ga0466968_0054594_460_783 | 106 |
| 670 | 3300044735 | Ga0466968_0207575 | Ga0466968_0207575_396_719 | 106 |
| 671 | 3300044765 | Ga0466970_0007036 | Ga0466970_0007036_840_1163 | 106 |
| 672 | 3300044765 | Ga0466970_0193481 | Ga0466970_0193481_514_837 | 106 |
| 673 | 3300044765 | Ga0466970_0373307 | Ga0466970_0373307_173_496 | 106 |
| 674 | 3300044842 | Ga0466957_0022761 | Ga0466957_0022761_1514_1837 | 106 |
| 675 | 3300044842 | Ga0466957_0050029 | Ga0466957_0050029_2086_2409 | 106 |
| 676 | 3300044842 | Ga0466957_0191677 | Ga0466957_0191677_488_811 | 106 |
| 677 | 3300045049 | Ga0466959_0003982 | Ga0466959_0003982_9276_9599 | 106 |
| 678 | 3300045049 | Ga0466959_0017713 | Ga0466959_0017713_3020_3343 | 106 |
| 679 | 3300045049 | Ga0466959_0667145 | Ga0466959_0667145_143_466 | 106 |
| 680 | 3300045051 | Ga0451576_0004451 | Ga0451576_0004451_13764_14087 | 106 |
| 681 | 3300045051 | Ga0451576_0017229 | Ga0451576_0017229_7448_7768 | 106 |
| 682 | 3300045051 | Ga0451576_0045166 | Ga0451576_0045166_348_671 | 106 |
| 683 | 3300045051 | Ga0451576_1646353 | Ga0451576_1646353_198_521 | 106 |
| 684 | 3300045836 | Ga0466958_0004016 | Ga0466958_0004016_3671_3994 | 106 |
| 685 | 3300045836 | Ga0466958_0041673 | Ga0466958_0041673_1368_1691 | 106 |
| 686 | 3300045836 | Ga0466958_0373082 | Ga0466958_0373082_130_453 | 106 |
| 687 | 3300045976 | Ga0466967_0281748 | Ga0466967_0281748_321_644 | 106 |
| 688 | 3300045976 | Ga0466967_0895544 | Ga0466967_0895544_374_697 | 106 |
| 689 | 3300045976 | Ga0466967_0955052 | Ga0466967_0955052_303_626 | 106 |
| 690 | 3300046454 | Ga0495592_0001313 | Ga0495592_0001313_10937_11260 | 106 |
| 691 | 3300046454 | Ga0495592_0001592 | Ga0495592_0001592_3648_3968 | 106 |
| 692 | 3300046454 | Ga0495592_0479801 | Ga0495592_0479801_362_685 | 106 |
| 693 | 3300046455 | Ga0495603_0011812 | Ga0495603_0011812_3006_3329 | 106 |
| 694 | 3300046455 | Ga0495603_0040511 | Ga0495603_0040511_2410_2733 | 106 |
| 695 | 3300046455 | Ga0495603_0696925 | Ga0495603_0696925_21_344 | 106 |
| 696 | 3300046457 | Ga0495590_0014064 | Ga0495590_0014064_750_1073 | 106 |
| 697 | 3300046457 | Ga0495590_0355523 | Ga0495590_0355523_36_359 | 106 |
| 698 | 3300046458 | Ga0495591_005751 | Ga0495591_005751_5023_5346 | 106 |
| 699 | 3300046458 | Ga0495591_092749 | Ga0495591_092749_105_428 | 106 |
| 700 | 3300046459 | Ga0495629_0001354 | Ga0495629_0001354_16367_16690 | 106 |
| 701 | 3300046459 | Ga0495629_0008262 | Ga0495629_0008262_6211_6534 | 106 |
| 702 | 3300046459 | Ga0495629_0090926 | Ga0495629_0090926_387_710 | 106 |
| 703 | 3300046459 | Ga0495629_0426703 | Ga0495629_0426703_299_619 | 106 |
| 704 | 3300046461 | Ga0495641_0030091 | Ga0495641_0030091_1004_1327 | 106 |
| 705 | 3300046462 | Ga0495651_0001164 | Ga0495651_0001164_13357_13677 | 106 |
| 706 | 3300046462 | Ga0495651_0003321 | Ga0495651_0003321_9088_9411 | 106 |
| 707 | 3300046462 | Ga0495651_0032641 | Ga0495651_0032641_1792_2115 | 106 |
| 708 | 3300046462 | Ga0495651_0313471 | Ga0495651_0313471_666_989 | 106 |
| 709 | 3300046463 | Ga0495653_0001712 | Ga0495653_0001712_5110_5433 | 106 |
| 710 | 3300046463 | Ga0495653_0055383 | Ga0495653_0055383_271_594 | 106 |
| 711 | 3300046463 | Ga0495653_0417694 | Ga0495653_0417694_220_540 | 106 |
| 712 | 3300046471 | Ga0495650_0005992 | Ga0495650_0005992_7146_7469 | 106 |
| 713 | 3300046471 | Ga0495650_0039110 | Ga0495650_0039110_490_813 | 106 |
| 714 | 3300046472 | Ga0495580_0002474 | Ga0495580_0002474_233_556 | 106 |
| 715 | 3300046472 | Ga0495580_0025511 | Ga0495580_0025511_1160_1483 | 106 |
| 716 | 3300046472 | Ga0495580_0099531 | Ga0495580_0099531_253_576 | 106 |
| 717 | 3300046472 | Ga0495580_0107541 | Ga0495580_0107541_477_815 | 106 |
| 718 | 3300046472 | Ga0495580_0118557 | Ga0495580_0118557_1200_1523 | 106 |
| 719 | 3300046472 | Ga0495580_0291872 | Ga0495580_0291872_469_792 | 106 |
| 720 | 3300046473 | Ga0495582_0017320 | Ga0495582_0017320_2597_2920 | 106 |
| 721 | 3300046473 | Ga0495582_0131448 | Ga0495582_0131448_103_426 | 106 |
| 722 | 3300046473 | Ga0495582_0233271 | Ga0495582_0233271_60_380 | 106 |
| 723 | 3300046475 | Ga0495639_0273857 | Ga0495639_0273857_348_668 | 106 |
| 724 | 3300046476 | Ga0495662_0039184 | Ga0495662_0039184_1337_1657 | 106 |
| 725 | 3300046476 | Ga0495662_0041092 | Ga0495662_0041092_730_1053 | 106 |
| 726 | 3300046476 | Ga0495662_0068173 | Ga0495662_0068173_1293_1616 | 106 |
| 727 | 3300046476 | Ga0495662_0125752 | Ga0495662_0125752_444_764 | 106 |
| 728 | 3300046477 | Ga0495664_0003770 | Ga0495664_0003770_6394_6717 | 106 |
| 729 | 3300046477 | Ga0495664_0275698 | Ga0495664_0275698_358_681 | 106 |
| 730 | 3300046491 | Ga0495584_0147566 | Ga0495584_0147566_343_666 | 106 |
| 731 | 3300046500 | Ga0495596_0032260 | Ga0495596_0032260_851_1174 | 106 |
| 732 | 3300046500 | Ga0495596_0169647 | Ga0495596_0169647_395_718 | 106 |
| 733 | 3300046500 | Ga0495596_0266694 | Ga0495596_0266694_86_409 | 106 |
| 734 | 3300046507 | Ga0495606_0080138 | Ga0495606_0080138_1424_1747 | 106 |
| 735 | 3300046507 | Ga0495606_0251040 | Ga0495606_0251040_10_333 | 106 |
| 736 | 3300046511 | Ga0495608_0003166 | Ga0495608_0003166_1867_2190 | 106 |
| 737 | 3300046511 | Ga0495608_0007794 | Ga0495608_0007794_644_964 | 106 |
| 738 | 3300046511 | Ga0495608_0117916 | Ga0495608_0117916_584_907 | 106 |
| 739 | 3300046511 | Ga0495608_0567513 | Ga0495608_0567513_239_559 | 106 |
| 740 | 3300046511 | Ga0495608_0616736 | Ga0495608_0616736_49_369 | 106 |
| 741 | 3300046514 | Ga0495618_0024676 | Ga0495618_0024676_2422_2745 | 106 |
| 742 | 3300046514 | Ga0495618_0053484 | Ga0495618_0053484_535_855 | 106 |
| 743 | 3300046514 | Ga0495618_0137124 | Ga0495618_0137124_971_1294 | 106 |
| 744 | 3300046515 | Ga0495620_0036525 | Ga0495620_0036525_671_994 | 106 |
| 745 | 3300046515 | Ga0495620_0425052 | Ga0495620_0425052_72_398 | 106 |
| 746 | 3300046516 | Ga0495628_0003126 | Ga0495628_0003126_382_702 | 106 |
| 747 | 3300046516 | Ga0495628_0011513 | Ga0495628_0011513_5111_5434 | 106 |
| 748 | 3300046516 | Ga0495628_0088456 | Ga0495628_0088456_1924_2244 | 106 |
| 749 | 3300046516 | Ga0495628_0121134 | Ga0495628_0121134_1062_1385 | 106 |
| 750 | 3300046516 | Ga0495628_1073780 | Ga0495628_1073780_86_409 | 106 |
| 751 | 3300046517 | Ga0495630_0054008 | Ga0495630_0054008_2423_2743 | 106 |
| 752 | 3300046517 | Ga0495630_0079050 | Ga0495630_0079050_355_678 | 106 |
| 753 | 3300046517 | Ga0495630_0312817 | Ga0495630_0312817_244_567 | 106 |
| 754 | 3300046517 | Ga0495630_0392172 | Ga0495630_0392172_661_984 | 106 |
| 755 | 3300046517 | Ga0495630_0747523 | Ga0495630_0747523_329_652 | 106 |
| 756 | 3300046517 | Ga0495630_0989092 | Ga0495630_0989092_75_395 | 106 |
| 757 | 3300046523 | Ga0495644_0281566 | Ga0495644_0281566_209_535 | 106 |
| 758 | 3300046524 | Ga0495648_0089258 | Ga0495648_0089258_1116_1439 | 106 |
| 759 | 3300046524 | Ga0495648_0116974 | Ga0495648_0116974_271_594 | 106 |
| 760 | 3300046525 | Ga0495663_0099363 | Ga0495663_0099363_17_343 | 106 |
| 761 | 3300046526 | Ga0495666_0004045 | Ga0495666_0004045_6038_6361 | 106 |
| 762 | 3300046526 | Ga0495666_0048114 | Ga0495666_0048114_458_781 | 106 |
| 763 | 3300046526 | Ga0495666_0064344 | Ga0495666_0064344_1157_1480 | 106 |
| 764 | 3300046526 | Ga0495666_0126969 | Ga0495666_0126969_369_689 | 106 |
| 765 | 3300046528 | Ga0495642_0023552 | Ga0495642_0023552_289_609 | 106 |
| 766 | 3300046528 | Ga0495642_0171034 | Ga0495642_0171034_297_620 | 106 |
| 767 | 3300046528 | Ga0495642_0294950 | Ga0495642_0294950_233_559 | 106 |
| 768 | 3300046529 | Ga0495652_0034252 | Ga0495652_0034252_4027_4350 | 106 |
| 769 | 3300046529 | Ga0495652_0106642 | Ga0495652_0106642_154_474 | 106 |
| 770 | 3300046529 | Ga0495652_0168866 | Ga0495652_0168866_233_556 | 106 |
| 771 | 3300046529 | Ga0495652_0308545 | Ga0495652_0308545_71_394 | 106 |
| 772 | 3300046529 | Ga0495652_0311665 | Ga0495652_0311665_585_908 | 106 |
| 773 | 3300046530 | Ga0495654_0096746 | Ga0495654_0096746_821_1144 | 106 |
| 774 | 3300046531 | Ga0495665_0005305 | Ga0495665_0005305_2718_3041 | 106 |
| 775 | 3300046531 | Ga0495665_0009459 | Ga0495665_0009459_470_793 | 106 |
| 776 | 3300046531 | Ga0495665_0280870 | Ga0495665_0280870_140_463 | 106 |
| 777 | 3300046533 | Ga0495640_0009959 | Ga0495640_0009959_6482_6802 | 106 |
| 778 | 3300046533 | Ga0495640_0051399 | Ga0495640_0051399_270_593 | 106 |
| 779 | 3300046533 | Ga0495640_0072910 | Ga0495640_0072910_749_1072 | 106 |
| 780 | 3300046535 | Ga0495586_0001580 | Ga0495586_0001580_11095_11418 | 106 |
| 781 | 3300046535 | Ga0495586_0049093 | Ga0495586_0049093_1588_1908 | 106 |
| 782 | 3300046535 | Ga0495586_0177410 | Ga0495586_0177410_230_553 | 106 |
| 783 | 3300046535 | Ga0495586_0286902 | Ga0495586_0286902_52_372 | 106 |
| 784 | 3300046535 | Ga0495586_0449764 | Ga0495586_0449764_400_723 | 106 |
| 785 | 3300046536 | Ga0495587_0000845 | Ga0495587_0000845_14435_14758 | 106 |
| 786 | 3300046536 | Ga0495587_0029444 | Ga0495587_0029444_390_713 | 106 |
| 787 | 3300046536 | Ga0495587_0054506 | Ga0495587_0054506_1438_1758 | 106 |
| 788 | 3300046537 | Ga0495598_0141111 | Ga0495598_0141111_116_436 | 106 |
| 789 | 3300046537 | Ga0495598_0326362 | Ga0495598_0326362_145_471 | 106 |
| 790 | 3300046537 | Ga0495598_0373275 | Ga0495598_0373275_37_360 | 106 |
| 791 | 3300046538 | Ga0495609_0218860 | Ga0495609_0218860_116_442 | 106 |
| 792 | 3300046539 | Ga0495621_0019326 | Ga0495621_0019326_1469_1792 | 106 |
| 793 | 3300046539 | Ga0495621_0108380 | Ga0495621_0108380_358_684 | 106 |
| 794 | 3300046539 | Ga0495621_0258489 | Ga0495621_0258489_236_556 | 106 |
| 795 | 3300046542 | Ga0495597_0010631 | Ga0495597_0010631_455_778 | 106 |
| 796 | 3300046543 | Ga0495645_0017147 | Ga0495645_0017147_4516_4839 | 106 |
| 797 | 3300046543 | Ga0495645_0065743 | Ga0495645_0065743_323_646 | 106 |
| 798 | 3300046543 | Ga0495645_0217268 | Ga0495645_0217268_306_629 | 106 |
| 799 | 3300046559 | Ga0495667_0049285 | Ga0495667_0049285_1357_1677 | 106 |
| 800 | 3300046559 | Ga0495667_0125134 | Ga0495667_0125134_1236_1559 | 106 |
| 801 | 3300046642 | Ga0495634_0005222 | Ga0495634_0005222_6358_6681 | 106 |
| 802 | 3300046642 | Ga0495634_0014642 | Ga0495634_0014642_5008_5331 | 106 |
| 803 | 3300046642 | Ga0495634_0020851 | Ga0495634_0020851_282_602 | 106 |
| 804 | 3300046642 | Ga0495634_0371027 | Ga0495634_0371027_24_347 | 106 |
| 805 | 3300046663 | Ga0495635_0068023 | Ga0495635_0068023_1534_1854 | 106 |
| 806 | 3300046663 | Ga0495635_0148225 | Ga0495635_0148225_302_625 | 106 |
| 807 | 3300046663 | Ga0495635_0158203 | Ga0495635_0158203_241_564 | 106 |
| 808 | 3300046663 | Ga0495635_0345506 | Ga0495635_0345506_542_862 | 106 |
| 809 | 3300046663 | Ga0495635_0611025 | Ga0495635_0611025_358_681 | 106 |
| 810 | 3300046665 | Ga0495661_0005549 | Ga0495661_0005549_1804_2127 | 106 |
| 811 | 3300046665 | Ga0495661_0017977 | Ga0495661_0017977_179_502 | 106 |
| 812 | 3300046674 | Ga0495588_0285746 | Ga0495588_0285746_210_533 | 106 |
| 813 | 3300046675 | Ga0495657_0201102 | Ga0495657_0201102_870_1193 | 106 |
| 814 | 3300046675 | Ga0495657_0905174 | Ga0495657_0905174_120_443 | 106 |
| 815 | 3300046678 | Ga0495599_0017466 | Ga0495599_0017466_418_774 | 106 |
| 816 | 3300046678 | Ga0495599_0292994 | Ga0495599_0292994_409_732 | 106 |
| 817 | 3300046678 | Ga0495599_0412285 | Ga0495599_0412285_193_516 | 106 |
| 818 | 3300046678 | Ga0495599_0580502 | Ga0495599_0580502_176_496 | 106 |
| 819 | 3300046678 | Ga0495599_0641271 | Ga0495599_0641271_39_359 | 106 |
| 820 | 3300046678 | Ga0495599_0791057 | Ga0495599_0791057_157_480 | 106 |
| 821 | 3300046679 | Ga0495623_0007848 | Ga0495623_0007848_1161_1517 | 106 |
| 822 | 3300046679 | Ga0495623_0080548 | Ga0495623_0080548_815_1138 | 106 |
| 823 | 3300046679 | Ga0495623_0316562 | Ga0495623_0316562_191_514 | 106 |
| 824 | 3300046680 | Ga0495646_0003413 | Ga0495646_0003413_622_945 | 106 |
| 825 | 3300046680 | Ga0495646_0004507 | Ga0495646_0004507_6349_6672 | 106 |
| 826 | 3300046683 | Ga0495658_0017875 | Ga0495658_0017875_1089_1409 | 106 |
| 827 | 3300046683 | Ga0495658_0060519 | Ga0495658_0060519_1679_1999 | 106 |
| 828 | 3300046683 | Ga0495658_0721417 | Ga0495658_0721417_84_407 | 106 |
| 829 | 3300046683 | Ga0495658_0806415 | Ga0495658_0806415_105_428 | 106 |
| 830 | 3300046684 | Ga0495669_0045320 | Ga0495669_0045320_1001_1321 | 106 |
| 831 | 3300046684 | Ga0495669_0242068 | Ga0495669_0242068_301_624 | 106 |
| 832 | 3300046689 | Ga0495613_0019201 | Ga0495613_0019201_3627_3950 | 106 |
| 833 | 3300046689 | Ga0495613_0036939 | Ga0495613_0036939_232_555 | 106 |
| 834 | 3300046689 | Ga0495613_0065036 | Ga0495613_0065036_2335_2655 | 106 |
| 835 | 3300046689 | Ga0495613_0538570 | Ga0495613_0538570_23_346 | 106 |
| 836 | 3300046690 | Ga0495624_0017343 | Ga0495624_0017343_1581_1904 | 106 |
| 837 | 3300046690 | Ga0495624_0094431 | Ga0495624_0094431_1297_1617 | 106 |
| 838 | 3300046690 | Ga0495624_0132745 | Ga0495624_0132745_483_806 | 106 |
| 839 | 3300046690 | Ga0495624_0143973 | Ga0495624_0143973_170_490 | 106 |
| 840 | 3300046690 | Ga0495624_0385279 | Ga0495624_0385279_216_539 | 106 |
| 841 | 3300046690 | Ga0495624_0753769 | Ga0495624_0753769_78_401 | 106 |
| 842 | 3300046691 | Ga0495670_0604992 | Ga0495670_0604992_89_415 | 106 |
| 843 | 3300046692 | Ga0495671_0060933 | Ga0495671_0060933_1061_1384 | 106 |
| 844 | 3300046694 | Ga0495649_0012027 | Ga0495649_0012027_966_1289 | 106 |
| 845 | 3300046694 | Ga0495649_0048027 | Ga0495649_0048027_750_1073 | 106 |
| 846 | 3300046694 | Ga0495649_0075838 | Ga0495649_0075838_694_1017 | 106 |
| 847 | 3300046794 | Ga0495589_0049162 | Ga0495589_0049162_715_1038 | 106 |
| 848 | 3300046794 | Ga0495589_0074606 | Ga0495589_0074606_1028_1351 | 106 |
| 849 | 3300046794 | Ga0495589_0100336 | Ga0495589_0100336_810_1133 | 106 |
| 850 | 3300046794 | Ga0495589_0225410 | Ga0495589_0225410_268_591 | 106 |
| 851 | 3300046794 | Ga0495589_0467800 | Ga0495589_0467800_20_343 | 106 |
| 852 | 3300046809 | Ga0495600_0015117 | Ga0495600_0015117_1055_1378 | 106 |
| 853 | 3300046809 | Ga0495600_0036242 | Ga0495600_0036242_322_642 | 106 |
| 854 | 3300046809 | Ga0495600_0685620 | Ga0495600_0685620_190_513 | 106 |
| 855 | 3300047315 | Ga0495581_0001049 | Ga0495581_0001049_9160_9483 | 106 |
| 856 | 3300047315 | Ga0495581_0010529 | Ga0495581_0010529_4667_4990 | 106 |
| 857 | 3300047315 | Ga0495581_0094740 | Ga0495581_0094740_1344_1667 | 106 |
| 858 | 3300047317 | Ga0495604_0001474 | Ga0495604_0001474_5794_6117 | 106 |
| 859 | 3300047317 | Ga0495604_0008726 | Ga0495604_0008726_1445_1765 | 106 |
| 860 | 3300047317 | Ga0495604_0018792 | Ga0495604_0018792_961_1284 | 106 |
| 861 | 3300047317 | Ga0495604_0026152 | Ga0495604_0026152_3224_3547 | 106 |
| 862 | 3300047317 | Ga0495604_0059228 | Ga0495604_0059228_1490_1846 | 106 |
| 863 | 3300047317 | Ga0495604_0206685 | Ga0495604_0206685_918_1238 | 106 |
| 864 | 3300047317 | Ga0495604_0426244 | Ga0495604_0426244_379_702 | 106 |
| 865 | 3300047318 | Ga0495636_0006341 | Ga0495636_0006341_2044_2364 | 106 |
| 866 | 3300047318 | Ga0495636_0291468 | Ga0495636_0291468_260_586 | 106 |
| 867 | 3300047319 | Ga0495674_0081656 | Ga0495674_0081656_253_576 | 106 |
| 868 | 3300047319 | Ga0495674_0100187 | Ga0495674_0100187_1007_1330 | 106 |
| 869 | 3300047319 | Ga0495674_0720619 | Ga0495674_0720619_174_494 | 106 |
| 870 | 3300047319 | Ga0495674_1022855 | Ga0495674_1022855_71_391 | 106 |
| 871 | 3300047321 | Ga0495676_0254554 | Ga0495676_0254554_355_678 | 106 |
| 872 | 3300047321 | Ga0495676_0589405 | Ga0495676_0589405_266_589 | 106 |
| 873 | 3300047322 | Ga0495680_0001252 | Ga0495680_0001252_8954_9274 | 106 |
| 874 | 3300047322 | Ga0495680_0006154 | Ga0495680_0006154_5794_6117 | 106 |
| 875 | 3300047322 | Ga0495680_0028998 | Ga0495680_0028998_1828_2151 | 106 |
| 876 | 3300047322 | Ga0495680_0367110 | Ga0495680_0367110_605_928 | 106 |
| 877 | 3300047322 | Ga0495680_0872482 | Ga0495680_0872482_223_546 | 106 |
| 878 | 3300047323 | Ga0495683_0002338 | Ga0495683_0002338_9154_9477 | 106 |
| 879 | 3300047323 | Ga0495683_0006981 | Ga0495683_0006981_4717_5040 | 106 |
| 880 | 3300047323 | Ga0495683_0057968 | Ga0495683_0057968_1169_1492 | 106 |
| 881 | 3300047323 | Ga0495683_0366451 | Ga0495683_0366451_132_464 | 106 |
| 882 | 3300047443 | Ga0495687_000078 | Ga0495687_000078_146944_147267 | 106 |
| 883 | 3300047443 | Ga0495687_045152 | Ga0495687_045152_373_696 | 106 |
| 884 | 3300047444 | Ga0495675_0031304 | Ga0495675_0031304_750_1073 | 106 |
| 885 | 3300047444 | Ga0495675_0149692 | Ga0495675_0149692_834_1157 | 106 |
| 886 | 3300047444 | Ga0495675_0160606 | Ga0495675_0160606_189_512 | 106 |
| 887 | 3300047444 | Ga0495675_0187973 | Ga0495675_0187973_749_1069 | 106 |
| 888 | 3300047444 | Ga0495675_0252568 | Ga0495675_0252568_460_783 | 106 |
| 889 | 3300047446 | Ga0495679_006165 | Ga0495679_006165_3296_3619 | 106 |
| 890 | 3300047446 | Ga0495679_022378 | Ga0495679_022378_483_806 | 106 |
| 891 | 3300047446 | Ga0495679_038477 | Ga0495679_038477_1162_1485 | 106 |
| 892 | 3300047469 | Ga0495673_0033340 | Ga0495673_0033340_1135_1458 | 106 |
| 893 | 3300047471 | Ga0495684_0157650 | Ga0495684_0157650_1040_1363 | 106 |
| 894 | 3300047673 | Ga0495593_0008398 | Ga0495593_0008398_1115_1438 | 106 |
| 895 | 3300047673 | Ga0495593_0012595 | Ga0495593_0012595_2244_2567 | 106 |
| 896 | 3300047673 | Ga0495593_0053913 | Ga0495593_0053913_247_567 | 106 |
| 897 | 3300047673 | Ga0495593_0077978 | Ga0495593_0077978_780_1103 | 106 |
| 898 | 3300047673 | Ga0495593_0447735 | Ga0495593_0447735_86_409 | 106 |
| 899 | 3300048088 | Ga0495602_0011608 | Ga0495602_0011608_4686_5009 | 106 |
| 900 | 3300048088 | Ga0495602_0049942 | Ga0495602_0049942_2538_2861 | 106 |
| 901 | 3300048088 | Ga0495602_0153071 | Ga0495602_0153071_390_746 | 106 |
| 902 | 3300048088 | Ga0495602_0193040 | Ga0495602_0193040_700_1023 | 106 |
| 903 | 3300048089 | Ga0495614_0003464 | Ga0495614_0003464_4764_5087 | 106 |
| 904 | 3300048089 | Ga0495614_0051130 | Ga0495614_0051130_424_747 | 106 |
| 905 | 3300048089 | Ga0495614_0107248 | Ga0495614_0107248_302_625 | 106 |
| 906 | 3300048903 | Ga0496100_0008448 | Ga0496100_0008448_2434_2757 | 106 |
| 907 | 3300048904 | Ga0496101_0023297 | Ga0496101_0023297_1888_2211 | 106 |
| 908 | 3300048904 | Ga0496101_0113453 | Ga0496101_0113453_14_337 | 106 |
| 909 | 3300048904 | Ga0496101_0493729 | Ga0496101_0493729_379_702 | 106 |
| 910 | 3300048905 | Ga0496102_0018939 | Ga0496102_0018939_964_1287 | 106 |
| 911 | 3300048905 | Ga0496102_0065386 | Ga0496102_0065386_1029_1352 | 106 |
| 912 | 3300048906 | Ga0496103_0011604 | Ga0496103_0011604_904_1227 | 106 |
| 913 | 3300048906 | Ga0496103_0021032 | Ga0496103_0021032_3357_3680 | 106 |
| 914 | 3300048907 | Ga0496104_0295492 | Ga0496104_0295492_572_895 | 106 |
| 915 | 3300048908 | Ga0496105_0111021 | Ga0496105_0111021_840_1163 | 106 |
| 916 | 3300048909 | Ga0496106_0000023 | Ga0496106_0000023_152086_152463 | 106 |
| 917 | 3300048909 | Ga0496106_0015183 | Ga0496106_0015183_4626_4949 | 106 |
| 918 | 3300048910 | Ga0496107_0270121 | Ga0496107_0270121_651_974 | 106 |
| 919 | 3300048911 | Ga0496108_0099751 | Ga0496108_0099751_1204_1527 | 106 |
| 920 | 3300048911 | Ga0496108_0414784 | Ga0496108_0414784_116_439 | 106 |
| 921 | 3300048912 | Ga0496109_0404606 | Ga0496109_0404606_588_911 | 106 |
| 922 | 3300048913 | Ga0496110_0114538 | Ga0496110_0114538_1358_1681 | 106 |
| 923 | 3300048913 | Ga0496110_0148999 | Ga0496110_0148999_338_661 | 106 |
| 924 | 3300048914 | Ga0496111_0253983 | Ga0496111_0253983_527_850 | 106 |
| 925 | 3300048914 | Ga0496111_0774908 | Ga0496111_0774908_114_437 | 106 |
| 926 | 3300048915 | Ga0496112_0044311 | Ga0496112_0044311_733_1056 | 106 |
| 927 | 3300048916 | Ga0496113_0042009 | Ga0496113_0042009_2757_3080 | 106 |
| 928 | 3300048917 | Ga0496114_0033858 | Ga0496114_0033858_2800_3123 | 106 |
| 929 | 3300048918 | Ga0496115_0006263 | Ga0496115_0006263_6821_7144 | 106 |
| 930 | 3300048919 | Ga0496116_0026332 | Ga0496116_0026332_2783_3106 | 106 |
| 931 | 3300048919 | Ga0496116_0080085 | Ga0496116_0080085_911_1234 | 106 |
| 932 | 3300048920 | Ga0496117_0043089 | Ga0496117_0043089_1502_1825 | 106 |
| 933 | 3300048920 | Ga0496117_0052900 | Ga0496117_0052900_1105_1428 | 106 |
| 934 | 3300048920 | Ga0496117_0075692 | Ga0496117_0075692_870_1193 | 106 |
| 935 | 3300048921 | Ga0496118_0010415 | Ga0496118_0010415_5602_5925 | 106 |
| 936 | 3300048921 | Ga0496118_0023542 | Ga0496118_0023542_4075_4398 | 106 |
| 937 | 3300048921 | Ga0496118_0226382 | Ga0496118_0226382_552_875 | 106 |
| 938 | 3300048922 | Ga0496119_0202909 | Ga0496119_0202909_298_621 | 106 |
| 939 | 3300048924 | Ga0496121_0005179 | Ga0496121_0005179_4975_5352 | 106 |
| 940 | 3300048924 | Ga0496121_0028951 | Ga0496121_0028951_1486_1809 | 106 |
| 941 | 3300048925 | Ga0496122_0010546 | Ga0496122_0010546_814_1137 | 106 |
| 942 | 3300048926 | Ga0496123_0040469 | Ga0496123_0040469_2194_2517 | 106 |
| 943 | 3300048927 | Ga0496124_0032787 | Ga0496124_0032787_3026_3349 | 106 |
| 944 | 3300048927 | Ga0496124_0193818 | Ga0496124_0193818_168_491 | 106 |
| 945 | 3300048928 | Ga0496125_0027893 | Ga0496125_0027893_664_987 | 106 |
| 946 | 3300048929 | Ga0496126_0001279 | Ga0496126_0001279_18959_19282 | 106 |
| 947 | 3300048929 | Ga0496126_0001770 | Ga0496126_0001770_13565_13888 | 106 |
| 948 | 3300048929 | Ga0496126_0043993 | Ga0496126_0043993_1064_1387 | 106 |
| 949 | 3300049129 | Ga0501309_012746 | Ga0501309_012746_606_929 | 106 |
| 950 | 3300049161 | Ga0501305_094306 | Ga0501305_094306_142_462 | 106 |
| 951 | 3300049459 | Ga0495678_185078 | Ga0495678_185078_239_562 | 106 |
| 952 | 3300049514 | Ga0501291_024806 | Ga0501291_024806_262_588 | 106 |
| 953 | 3300049514 | Ga0501291_031963 | Ga0501291_031963_549_875 | 106 |
| 954 | 3300049514 | Ga0501291_097346 | Ga0501291_097346_256_576 | 106 |
| 955 | 3300049520 | Ga0501297_042019 | Ga0501297_042019_237_557 | 106 |
| 956 | 3300049520 | Ga0501297_052237 | Ga0501297_052237_216_542 | 106 |
| 957 | 3300049526 | Ga0501303_008441 | Ga0501303_008441_337_663 | 106 |
| 958 | 3300049527 | Ga0501311_042555 | Ga0501311_042555_110_433 | 106 |
| 959 | 3300049528 | Ga0501312_109184 | Ga0501312_109184_164_487 | 106 |
| 960 | 3300049530 | Ga0501314_030602 | Ga0501314_030602_210_533 | 106 |
| 961 | 3300049568 | Ga0501031_0098236 | Ga0501031_0098236_518_844 | 106 |
| 962 | 3300049568 | Ga0501031_0362808 | Ga0501031_0362808_46_369 | 106 |
| 963 | 3300049569 | Ga0501032_0258858 | Ga0501032_0258858_480_806 | 106 |
| 964 | 3300049570 | Ga0501033_0241590 | Ga0501033_0241590_161_487 | 106 |
| 965 | 3300049571 | Ga0501034_0427120 | Ga0501034_0427120_246_569 | 106 |
| 966 | 3300049571 | Ga0501034_1215936 | Ga0501034_1215936_88_411 | 106 |
| 967 | 3300049572 | Ga0501036_0052878 | Ga0501036_0052878_478_804 | 106 |
| 968 | 3300049572 | Ga0501036_0857819 | Ga0501036_0857819_379_702 | 106 |
| 969 | 3300049572 | Ga0501036_0859596 | Ga0501036_0859596_327_653 | 106 |
| 970 | 3300049573 | Ga0501037_0003038 | Ga0501037_0003038_8482_8805 | 106 |
| 971 | 3300049574 | Ga0501038_0303394 | Ga0501038_0303394_493_819 | 106 |
| 972 | 3300049575 | Ga0501039_0024671 | Ga0501039_0024671_1108_1434 | 106 |
| 973 | 3300049576 | Ga0501040_0003600 | Ga0501040_0003600_8792_9118 | 106 |
| 974 | 3300049576 | Ga0501040_0034644 | Ga0501040_0034644_2719_3045 | 106 |
| 975 | 3300049576 | Ga0501040_0865955 | Ga0501040_0865955_152_475 | 106 |
| 976 | 3300049577 | Ga0501041_0116026 | Ga0501041_0116026_1297_1623 | 106 |
| 977 | 3300049578 | Ga0501042_0396719 | Ga0501042_0396719_69_395 | 106 |
| 978 | 3300049580 | Ga0501046_0098411 | Ga0501046_0098411_695_1018 | 106 |
| 979 | 3300049580 | Ga0501046_0138215 | Ga0501046_0138215_510_836 | 106 |
| 980 | 3300049580 | Ga0501046_0485880 | Ga0501046_0485880_262_588 | 106 |
| 981 | 3300049580 | Ga0501046_0507391 | Ga0501046_0507391_183_506 | 106 |
| 982 | 3300049581 | Ga0501047_0019486 | Ga0501047_0019486_5964_6287 | 106 |
| 983 | 3300049581 | Ga0501047_0167337 | Ga0501047_0167337_860_1183 | 106 |
| 984 | 3300049581 | Ga0501047_1091044 | Ga0501047_1091044_145_468 | 106 |
| 985 | 3300049582 | Ga0501048_1122440 | Ga0501048_1122440_94_420 | 106 |
| 986 | 3300049583 | Ga0501067_0495896 | Ga0501067_0495896_295_618 | 106 |
| 987 | 3300049584 | Ga0501068_0537516 | Ga0501068_0537516_398_724 | 106 |
| 988 | 3300049587 | Ga0501071_0111706 | Ga0501071_0111706_1015_1341 | 106 |
| 989 | 3300049588 | Ga0501072_0008011 | Ga0501072_0008011_6749_7075 | 106 |
| 990 | 3300049588 | Ga0501072_0686394 | Ga0501072_0686394_146_469 | 106 |
| 991 | 3300049590 | Ga0501074_0220060 | Ga0501074_0220060_752_1078 | 106 |
| 992 | 3300049591 | Ga0501075_0076329 | Ga0501075_0076329_1282_1608 | 106 |
| 993 | 3300049592 | Ga0501076_0000290 | Ga0501076_0000290_28631_28957 | 106 |
| 994 | 3300049593 | Ga0501077_0504698 | Ga0501077_0504698_432_752 | 106 |
| 995 | 3300049651 | Ga0501201_010158 | Ga0501201_010158_449_775 | 106 |
| 996 | 3300049652 | Ga0501202_146817 | Ga0501202_146817_205_531 | 106 |
| 997 | 3300049654 | Ga0501207_063540 | Ga0501207_063540_95_418 | 106 |
| 998 | 3300049663 | Ga0501223_122641 | Ga0501223_122641_95_421 | 106 |
| 999 | 3300049679 | Ga0501249_138579 | Ga0501249_138579_232_558 | 106 |
| 1000 | 3300049686 | Ga0501257_235092 | Ga0501257_235092_166_492 | 106 |
| 1001 | 3300049704 | Ga0501221_215760 | Ga0501221_215760_86_406 | 106 |
| 1002 | 3300049705 | Ga0501225_0159976 | Ga0501225_0159976_34_360 | 106 |
| 1003 | 3300049741 | Ga0501079_0085041 | Ga0501079_0085041_68_394 | 106 |
| 1004 | 3300049742 | Ga0501080_0096596 | Ga0501080_0096596_288_611 | 106 |
| 1005 | 3300049742 | Ga0501080_0106464 | Ga0501080_0106464_18_341 | 106 |
| 1006 | 3300049742 | Ga0501080_0333901 | Ga0501080_0333901_426_749 | 106 |
| 1007 | 3300049742 | Ga0501080_0985827 | Ga0501080_0985827_230_556 | 106 |
| 1008 | 3300049743 | Ga0501081_0005740 | Ga0501081_0005740_48_374 | 106 |
| 1009 | 3300049744 | Ga0501083_0656215 | Ga0501083_0656215_221_547 | 106 |
| 1010 | 3300049779 | Ga0501283_018398 | Ga0501283_018398_137_463 | 106 |
| 1011 | 3300049822 | Ga0501035_0527664 | Ga0501035_0527664_159_485 | 106 |
| 1012 | 3300049822 | Ga0501035_1188834 | Ga0501035_1188834_56_382 | 106 |
| 1013 | 3300049823 | Ga0501044_0177984 | Ga0501044_0177984_1696_2019 | 106 |
| 1014 | 3300049823 | Ga0501044_0497465 | Ga0501044_0497465_118_444 | 106 |
| 1015 | 3300049824 | Ga0501045_0167109 | Ga0501045_0167109_75_401 | 106 |
| 1016 | 3300050491 | nmdc:mga00v17_76853_c1 | nmdc:mga00v17_76853_c1_827_1150 | 106 |
| 1017 | 3300050492 | nmdc:mga0yw44_315642_c1 | nmdc:mga0yw44_315642_c1_682_1005 | 106 |
| 1018 | 3300050493 | nmdc:mga0k408_12409_c1 | nmdc:mga0k408_12409_c1_2813_3136 | 106 |
| 1019 | 3300050493 | nmdc:mga0k408_132002_c1 | nmdc:mga0k408_132002_c1_498_821 | 106 |
| 1020 | 3300050494 | nmdc:mga06z11_362980_c1 | nmdc:mga06z11_362980_c1_327_650 | 106 |
| 1021 | 3300050494 | nmdc:mga06z11_898647_c1 | nmdc:mga06z11_898647_c1_12_335 | 106 |
| 1022 | 3300050495 | nmdc:mga04h51_61024_c1 | nmdc:mga04h51_61024_c1_753_1076 | 106 |
| 1023 | 3300050507 | nmdc:mga05p37_2115337_c1 | nmdc:mga05p37_2115337_c1_99_425 | 106 |
| 1024 | 3300050507 | nmdc:mga05p37_222484_c1 | nmdc:mga05p37_222484_c1_1643_1969 | 106 |
| 1025 | 3300050508 | nmdc:mga09592_1117136_c1 | nmdc:mga09592_1117136_c1_165_491 | 106 |
| 1026 | 3300050508 | nmdc:mga09592_712219_c1 | nmdc:mga09592_712219_c1_268_591 | 106 |
| 1027 | 3300050510 | nmdc:mga06r32_446739_c1 | nmdc:mga06r32_446739_c1_450_776 | 106 |
| 1028 | 3300050511 | nmdc:mga08y16_1878441_c1 | nmdc:mga08y16_1878441_c1_190_510 | 106 |
| 1029 | 3300050511 | nmdc:mga08y16_5343_c1 | nmdc:mga08y16_5343_c1_100_423 | 106 |
| 1030 | 3300050511 | nmdc:mga08y16_588427_c1 | nmdc:mga08y16_588427_c1_373_696 | 106 |
| 1031 | 3300050511 | nmdc:mga08y16_729185_c1 | nmdc:mga08y16_729185_c1_362_688 | 106 |
| 1032 | 3300050511 | nmdc:mga08y16_86961_c1 | nmdc:mga08y16_86961_c1_1524_1847 | 106 |
| 1033 | 3300050512 | nmdc:mga0n895_313173_c1 | nmdc:mga0n895_313173_c1_207_527 | 106 |
| 1034 | 3300050512 | nmdc:mga0n895_582_c1 | nmdc:mga0n895_582_c1_14_334 | 106 |
| 1035 | 3300050512 | nmdc:mga0n895_62787_c1 | nmdc:mga0n895_62787_c1_2405_2728 | 106 |
| 1036 | 3300050512 | nmdc:mga0n895_629202_c1 | nmdc:mga0n895_629202_c1_207_530 | 106 |
| 1037 | 3300050512 | nmdc:mga0n895_637282_c1 | nmdc:mga0n895_637282_c1_488_808 | 106 |
| 1038 | 3300050513 | nmdc:mga0rr50_19252_c1 | nmdc:mga0rr50_19252_c1_3526_3849 | 106 |
| 1039 | 3300050513 | nmdc:mga0rr50_218123_c1 | nmdc:mga0rr50_218123_c1_1104_1424 | 106 |
| 1040 | 3300050513 | nmdc:mga0rr50_234962_c1 | nmdc:mga0rr50_234962_c1_894_1217 | 106 |
| 1041 | 3300050513 | nmdc:mga0rr50_273030_c1 | nmdc:mga0rr50_273030_c1_949_1272 | 106 |
| 1042 | 3300050513 | nmdc:mga0rr50_3282_c1 | nmdc:mga0rr50_3282_c1_7820_8140 | 106 |
| 1043 | 3300050513 | nmdc:mga0rr50_665357_c1 | nmdc:mga0rr50_665357_c1_367_687 | 106 |
| 1044 | 3300050513 | nmdc:mga0rr50_871708_c1 | nmdc:mga0rr50_871708_c1_188_508 | 106 |
| 1045 | 3300050514 | nmdc:mga08x19_1199325_c1 | nmdc:mga08x19_1199325_c1_162_482 | 106 |
| 1046 | 3300050514 | nmdc:mga08x19_1858_c1 | nmdc:mga08x19_1858_c1_6766_7086 | 106 |
| 1047 | 3300050514 | nmdc:mga08x19_250421_c1 | nmdc:mga08x19_250421_c1_887_1207 | 106 |
| 1048 | 3300050514 | nmdc:mga08x19_269_c1 | nmdc:mga08x19_269_c1_31_354 | 106 |
| 1049 | 3300050514 | nmdc:mga08x19_5533_c1 | nmdc:mga08x19_5533_c1_2566_2889 | 106 |
| 1050 | 3300050515 | nmdc:mga0a205_107303_c1 | nmdc:mga0a205_107303_c1_2212_2535 | 106 |
| 1051 | 3300050515 | nmdc:mga0a205_12708_c1 | nmdc:mga0a205_12708_c1_2308_2628 | 106 |
| 1052 | 3300050515 | nmdc:mga0a205_428_c1 | nmdc:mga0a205_428_c1_30959_31282 | 106 |
| 1053 | 3300050515 | nmdc:mga0a205_956344_c1 | nmdc:mga0a205_956344_c1_218_541 | 106 |
| 1054 | 3300050516 | nmdc:mga0sz30_138726_c1 | nmdc:mga0sz30_138726_c1_97_420 | 106 |
| 1055 | 3300050516 | nmdc:mga0sz30_19086_c1 | nmdc:mga0sz30_19086_c1_2180_2503 | 106 |
| 1056 | 3300053077 | Ga0495601_0079602 | Ga0495601_0079602_108_428 | 106 |
| 1057 | 3300053077 | Ga0495601_0235706 | Ga0495601_0235706_737_1057 | 106 |
| 1058 | 3300053077 | Ga0495601_0569482 | Ga0495601_0569482_319_642 | 106 |
| 1059 | 3300053078 | Ga0495612_0459003 | Ga0495612_0459003_219_539 | 106 |
| 1060 | 3300053085 | Ga0495619_0694822 | Ga0495619_0694822_324_647 | 106 |
| 1061 | 3300053146 | Ga0500588_0244235 | Ga0500588_0244235_190_513 | 106 |
| 1062 | 3300053153 | Ga0500616_0286137 | Ga0500616_0286137_316_639 | 106 |
| 1063 | 3300053158 | Ga0500627_0127791 | Ga0500627_0127791_664_987 | 106 |
| 1064 | 3300053178 | Ga0500637_0508192 | Ga0500637_0508192_86_409 | 106 |
| 1065 | 3300054114 | Ga0501084_0227805 | Ga0501084_0227805_1069_1389 | 106 |
| 1066 | 3300054114 | Ga0501084_0805497 | Ga0501084_0805497_247_573 | 106 |
| 1067 | 3300054114 | Ga0501084_0905061 | Ga0501084_0905061_166_489 | 106 |
| 1068 | 3300059477 | Ga0587084_000186 | Ga0587084_000186_2500_2820 | 106 |
| 1069 | 3300059477 | Ga0587084_032074 | Ga0587084_032074_173_496 | 106 |
| 1070 | 3300059477 | Ga0587084_078057 | Ga0587084_078057_248_568 | 106 |
| 1071 | 3300059492 | Ga0587073_0005556 | Ga0587073_0005556_705_1025 | 106 |
| 1072 | 3300059504 | Ga0587082_013997 | Ga0587082_013997_502_822 | 106 |
| 1073 | 3300059508 | Ga0587088_000182 | Ga0587088_000182_2502_2822 | 106 |
| 1074 | 3300059508 | Ga0587088_015464 | Ga0587088_015464_450_773 | 106 |
| 1075 | 3300059511 | Ga0587091_011293 | Ga0587091_011293_621_941 | 106 |
| 1076 | 3300059624 | Ga0587109_170298 | Ga0587109_170298_121_444 | 106 |
| 1077 | 3300059630 | Ga0587128_001876 | Ga0587128_001876_1529_1849 | 106 |
| 1078 | 3300059630 | Ga0587128_144159 | Ga0587128_144159_62_448 | 106 |
| 1079 | 3300059640 | Ga0587067_000236 | Ga0587067_000236_2595_2915 | 106 |
| 1080 | 3300059641 | Ga0587068_002388 | Ga0587068_002388_1349_1669 | 106 |
| 1081 | 3300059643 | Ga0587072_000335 | Ga0587072_000335_3355_3675 | 106 |
| 1082 | 3300059644 | Ga0587075_011493 | Ga0587075_011493_700_1020 | 106 |
| 1083 | 3300059645 | Ga0587076_011609 | Ga0587076_011609_484_804 | 106 |
| 1084 | 3300059648 | Ga0587100_009542 | Ga0587100_009542_422_742 | 106 |
| 1085 | 3300059650 | Ga0587104_001168 | Ga0587104_001168_608_928 | 106 |
| 1086 | 3300060346 | Ga0587111_0007854 | Ga0587111_0007854_831_1151 | 106 |
| 1087 | 3300060353 | Ga0501082_0083800 | Ga0501082_0083800_967_1293 | 106 |
| 1088 | 3300060353 | Ga0501082_1047968 | Ga0501082_1047968_121_447 | 106 |
| 1089 | 3300061719 | Ga0466962_0000364 | Ga0466962_0000364_16283_16606 | 106 |
| 1090 | 3300061719 | Ga0466962_0007045 | Ga0466962_0007045_2904_3227 | 106 |
| 1091 | 3300061719 | Ga0466962_0657091 | Ga0466962_0657091_80_403 | 106 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1r94-assembly1.cif.gz_A | crystal structure of isca (mercury derivative) | 0.9327 | 2 | 96 |
| 2d2a-assembly2.cif.gz_B-2 | crystal structure of escherichia coli sufa involved in biosynthesis of iron-sulfur clusters | 0.9325 | 2 | 94 |
| 1s98-assembly1.cif.gz_A | e.coli isca crystal structure to 2.3 a | 0.9168 | 1 | 97 |
| 1s98-assembly1.cif.gz_A | e.coli isca crystal structure to 2.3 a | 0.908 | 1 | 97 |
| 1r94-assembly1.cif.gz_A | crystal structure of isca (mercury derivative) | 0.9055 | 2 | 96 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I3ITR1_24_129_2.60.300.12 | Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain | 0.9507 | 1 | 106 | 2.60.300.12 |
| 2d2aB01 | Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain | 0.9328 | 1 | 94 | 2.60.300.12 |
| af_P77667_17_122_2.60.300.12 | Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain | 0.9319 | 1 | 106 | 2.60.300.12 |
| af_P78859_82_189_2.60.300.12 | Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain | 0.9282 | 1 | 106 | 2.60.300.12 |
| 2d2aB01 | Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain | 0.9231 | 1 | 94 | 2.60.300.12 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A318GUV1-F1-model_v4 | Iron-binding protein IscA (Iron-sulfur cluster assembly protein) | 0.9875 | 1 | 106 |
GO:0005829
GO:0016226 GO:0051537 GO:0097428 |
| AF-A0A545SJU6-F1-model_v4 | Iron-binding protein IscA (Iron-sulfur cluster assembly protein) | 0.986 | 1 | 106 |
GO:0003700
GO:0005829 GO:0016226 GO:0051537 |
| AF-A0A7J7AI40-F1-model_v4 | deleted | 0.9855 | 1 | 106 |
|
| AF-Q8GLE6-F1-model_v4 | Iron-binding protein IscA (Iron-sulfur cluster assembly protein) | 0.979 | 1 | 106 |
GO:0005506
GO:0005829 GO:0016226 GO:0051537 GO:0097428 |
| AF-A0A7U6KQS0-F1-model_v4 | Iron-binding protein IscA | 0.979 | 1 | 81 |
GO:0005829
GO:0016226 GO:0051537 GO:0097428 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar