F489890

General Info

Members Datasets Scaffolds Average Seq Length
1091 562 1053 107

Family's Representative Sequence

Representative Sequence 3300047323|Ga0495683_0366451|Ga0495683_0366451_132_464
Length 110
Sequence MLTCTQAAAKRIACHLAEHPTAVGLRIGVRTSGCSGLAYTFEVCSELGADDNVVDTEGVRLIVSNRDLVFLKGSELHYERHGLNSTFQVRNPQEVARCGCGESFTVRERT

Samples

Sample ID Description Type Environment
1 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
2 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
3 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
4 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
5 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
6 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
7 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
8 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
9 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
10 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
11 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
12 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
13 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
14 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
15 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
16 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
17 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
18 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
19 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
20 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
21 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
22 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
23 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
24 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
25 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
26 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
27 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
28 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
29 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
30 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
31 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
32 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
33 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
34 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
35 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
36 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
37 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
38 3300003479 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_06_lowP_mix1_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
39 3300003558 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_10_fullP_mix1_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
40 3300003565 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_16_lowP_mix3_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
41 3300003567 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
42 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
43 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
44 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
45 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
46 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
47 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
48 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
49 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
50 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
51 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
52 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
53 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
54 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
55 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
56 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
57 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
58 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
59 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
60 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
61 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
62 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
63 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
64 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
65 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
66 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
67 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
68 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
69 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
70 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
71 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
72 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
73 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
74 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
75 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
76 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
77 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
78 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
79 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
80 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
81 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
82 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
83 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
84 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
85 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
86 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
87 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
88 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
89 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
90 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
91 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
92 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
93 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
94 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
95 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
96 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
97 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
98 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
99 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
100 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
101 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
102 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
103 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
104 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
105 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
106 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
107 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
108 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
109 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
110 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
111 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
112 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
113 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
114 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
115 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
116 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
117 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
118 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
119 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
120 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
121 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
122 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
123 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
124 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
125 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
126 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
127 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
128 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
129 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
130 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
131 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
132 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
133 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
134 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
135 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
136 3300013045 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
137 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
138 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
139 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
140 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
141 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
142 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
143 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
144 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
145 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
146 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
147 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
148 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
149 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
150 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
151 3300019190 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300019192 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
154 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
155 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
156 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
157 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
158 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
159 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
160 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
161 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
162 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
164 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
165 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
166 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
167 3300023539 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300023672 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
177 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
178 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
181 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
183 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
184 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
185 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
186 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
187 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
188 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
189 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
190 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
191 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
252 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
253 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
254 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
255 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
256 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
257 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
258 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
259 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
260 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
261 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
262 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
266 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
267 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
268 3300030762 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
269 3300030877 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
270 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
271 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
272 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
273 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
274 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
275 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
276 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
277 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
278 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
279 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
280 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
281 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
282 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
283 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
284 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
285 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
286 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
287 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
288 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
289 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
290 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
291 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
292 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
293 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
294 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
295 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
296 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
297 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
298 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
299 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
300 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
301 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
302 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
303 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
304 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
305 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
306 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
307 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
308 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
309 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
310 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
311 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
312 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
313 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
314 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
315 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
316 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
317 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
318 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
319 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
320 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
321 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
322 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
323 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
324 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
325 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
326 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
327 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
328 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
329 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
330 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
331 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
332 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
333 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
334 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
335 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
336 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
337 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
338 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
339 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
340 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
341 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
342 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
343 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
344 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
345 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
346 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
347 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
348 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
349 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
350 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
351 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
352 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
353 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
354 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
355 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
356 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
357 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
358 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
359 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
360 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
361 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
362 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
363 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
364 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
365 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
366 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
367 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
368 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
369 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
370 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
371 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
372 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
373 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
374 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
375 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
376 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
377 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
378 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
379 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
380 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
381 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
382 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
383 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
384 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
385 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
386 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
387 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
388 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
389 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
390 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
391 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
392 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
393 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
394 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
395 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
396 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
397 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
398 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
399 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
400 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
401 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
402 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
403 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
404 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
405 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
406 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
407 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
408 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
409 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
410 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
411 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
412 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
413 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
414 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
415 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
416 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
417 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
418 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
419 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
420 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
421 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
422 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
423 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
424 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
425 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
426 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
427 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
428 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
429 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
430 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
431 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
432 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
433 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
434 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
435 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
436 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
437 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
438 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
439 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
440 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
441 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
442 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
443 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
444 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
445 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
446 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
447 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
448 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
449 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
450 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
451 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
452 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
453 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
454 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
455 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
456 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
457 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
458 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
459 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
460 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
461 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
462 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
463 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
464 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
465 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
466 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
467 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
468 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
469 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
470 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
471 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
472 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
473 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
474 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
475 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
476 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
477 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
478 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
479 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
480 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
481 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
482 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
483 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
484 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
485 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
486 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
487 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
488 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
489 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
490 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
491 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
492 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
493 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
494 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
495 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
496 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
497 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
498 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
499 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
500 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
501 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
502 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
503 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
504 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
505 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
506 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
507 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
508 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
509 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
510 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
511 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
512 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
513 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
514 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
515 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
516 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
517 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
518 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
519 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
520 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
521 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
522 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
523 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
524 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
525 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
526 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
527 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
528 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
529 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
530 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
531 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
532 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
533 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
534 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
535 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
536 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
537 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
538 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
539 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
540 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
541 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
542 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
543 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
544 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
545 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
546 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
547 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
548 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
549 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
550 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
551 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
552 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
553 3300059650 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
554 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
555 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
556 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
557 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
558 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
559 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
560 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
561 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
562 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.55
Metatranscriptomes 6.97
Isolates 3.48

Biome Distribution

Category Percentage (%)
Aerial Root 0.09
Bulb 0
Endosphere 5.32
Nodule 0.64
Rhizoplane 3.21
Rhizosphere 84.69
Stem 0
Stem Tuber 0
Unclassified 6.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000304 3300001979 Bacteria 20859
2 JGI24740J21852_10000783 3300001979 Bacteria 13957
3 JGI24739J22299_10026729 3300001989 Bacteria 2023
4 JGI24735J21928_10000592 3300002067 Bacteria 12758
5 JGI25156J39149_1004627 3300002705 Bacteria 4148
6 JGI25156J39149_1013980 3300002705 Bacteria 1676
7 JGI25154J39366_1000649 3300002738 Bacteria 16270
8 Ga0006556J51387_1030706 3300003479 Bacteria 2642
9 Ga0006558J51389_1031326 3300003558 Bacteria 851
10 Ga0006560J51390_1025704 3300003565 Bacteria 1511
11 Ga0006554J51385_1045016 3300003567 Bacteria 736
12 Ga0055538_1012937 3300003751 Bacteria 580
13 Ga0055539_1000034 3300003752 Bacteria 223400
14 Ga0055533_1002398 3300003756 Bacteria 4273
15 Ga0055532_1000002 3300003758 Bacteria 576000
16 Ga0055525_1000313 3300003759 Bacteria 39508
17 Ga0055525_1000473 3300003759 Bacteria 22055
18 Ga0055527_1000923 3300003760 Bacteria 7271
19 Ga0055542_1003748 3300003762 Bacteria 3967
20 Ga0055529_1000028 3300003763 Bacteria 287650
21 Ga0055534_1000984 3300003784 Bacteria 12593
22 Ga0055531_10033129 3300003794 Bacteria 1671
23 Ga0055541_1003150 3300003841 Bacteria 3155
24 Ga0055543_1003665 3300004625 Bacteria 4423
25 Ga0058859_11623198 3300004798 Bacteria 528
26 Ga0058859_11781410 3300004798 Bacteria 563
27 Ga0058860_12150010 3300004801 Bacteria 647
28 Ga0058862_12823266 3300004803 Bacteria 1286
29 Ga0065165_1000613 3300005262 Bacteria 51836
30 Ga0065707_10057951 3300005295 Bacteria 623
31 Ga0070658_10002480 3300005327 Bacteria 15419
32 Ga0070683_101505761 3300005329 Bacteria 647
33 Ga0070690_100989682 3300005330 Bacteria 662
34 Ga0068869_100050869 3300005334 Bacteria 3004
35 Ga0068869_100128505 3300005334 Bacteria 1945
36 Ga0068869_101145432 3300005334 Bacteria 682
37 Ga0070666_10073819 3300005335 Bacteria 2324
38 Ga0068868_100458728 3300005338 Bacteria 1110
39 Ga0068868_101402616 3300005338 Bacteria 652
40 Ga0070689_100012797 3300005340 Bacteria 6056
41 Ga0070689_100151335 3300005340 Bacteria 1871
42 Ga0070689_100423690 3300005340 Bacteria 1128
43 Ga0070689_101285639 3300005340 Bacteria 658
44 Ga0070691_10183806 3300005341 Bacteria 1089
45 Ga0070661_100000013 3300005344 Bacteria 163010
46 Ga0070692_10775184 3300005345 Bacteria 652
47 Ga0070668_100280263 3300005347 Bacteria 1392
48 Ga0070669_100024733 3300005353 Bacteria 4308
49 Ga0070675_100004581 3300005354 Bacteria 10556
50 Ga0070675_100515510 3300005354 Bacteria 1078
51 Ga0070671_100737060 3300005355 Bacteria 856
52 Ga0070671_101149174 3300005355 Bacteria 683
53 Ga0070674_100019780 3300005356 Bacteria 4284
54 Ga0070674_100078297 3300005356 Bacteria 2355
55 Ga0070674_100826826 3300005356 Bacteria 802
56 Ga0070673_100284418 3300005364 Bacteria 1451
57 Ga0070673_101031899 3300005364 Bacteria 766
58 Ga0070688_100006303 3300005365 Bacteria 6333
59 Ga0070688_100487624 3300005365 Bacteria 927
60 Ga0070659_100003967 3300005366 Bacteria 10534
61 Ga0070659_100148160 3300005366 Bacteria 1913
62 Ga0070659_100393514 3300005366 Bacteria 1169
63 Ga0070701_10090013 3300005438 Bacteria 1679
64 Ga0070701_10753732 3300005438 Bacteria 660
65 Ga0070705_100046152 3300005440 Bacteria 2510
66 Ga0070705_100781955 3300005440 Bacteria 758
67 Ga0070700_100033148 3300005441 Bacteria 3109
68 Ga0070700_100196938 3300005441 Bacteria 1413
69 Ga0070700_101361389 3300005441 Bacteria 599
70 Ga0070694_100555456 3300005444 Bacteria 920
71 Ga0070694_100969277 3300005444 Bacteria 705
72 Ga0070694_101083890 3300005444 Bacteria 668
73 Ga0070694_101104676 3300005444 Bacteria 661
74 Ga0070708_101231157 3300005445 Bacteria 700
75 Ga0070708_101876357 3300005445 Bacteria 556
76 Ga0070663_100000006 3300005455 Bacteria 208068
77 Ga0070663_100237780 3300005455 Bacteria 1436
78 Ga0070663_101395441 3300005455 Bacteria 620
79 Ga0070662_100488787 3300005457 Bacteria 1025
80 Ga0070681_10000198 3300005458 Bacteria 47037
81 Ga0070681_11068917 3300005458 Bacteria 728
82 Ga0068867_100446316 3300005459 Bacteria 1101
83 Ga0068867_101027745 3300005459 Bacteria 749
84 Ga0070685_10013293 3300005466 Bacteria 4339
85 Ga0070698_100219769 3300005471 Bacteria 1834
86 Ga0070698_100268912 3300005471 Bacteria 1636
87 Ga0070698_102115005 3300005471 Bacteria 516
88 Ga0070679_101201299 3300005530 Bacteria 704
89 Ga0070684_100413301 3300005535 Bacteria 1245
90 Ga0070672_100049500 3300005543 Bacteria 3269
91 Ga0070686_100203785 3300005544 Bacteria 1420
92 Ga0070686_100411785 3300005544 Bacteria 1031
93 Ga0070686_100720214 3300005544 Bacteria 797
94 Ga0070695_100298109 3300005545 Bacteria 1190
95 Ga0070696_100041783 3300005546 Bacteria 3168
96 Ga0070696_100185224 3300005546 Bacteria 1546
97 Ga0070696_100521115 3300005546 Bacteria 948
98 Ga0070696_100525610 3300005546 Bacteria 945
99 Ga0070696_100677636 3300005546 Bacteria 838
100 Ga0070696_100766813 3300005546 Bacteria 791
101 Ga0070704_100059341 3300005549 Bacteria 2729
102 Ga0070704_100300271 3300005549 Bacteria 1338
103 Ga0070704_100618443 3300005549 Bacteria 953
104 Ga0070704_100834099 3300005549 Bacteria 826
105 Ga0068855_100008103 3300005563 Bacteria 12696
106 Ga0068855_100483412 3300005563 Bacteria 1348
107 Ga0068855_100730200 3300005563 Bacteria 1058
108 Ga0070664_100000002 3300005564 Bacteria 458815
109 Ga0068857_100071642 3300005577 Bacteria 3088
110 Ga0068857_100093939 3300005577 Bacteria 2685
111 Ga0068854_100000004 3300005578 Bacteria 216381
112 Ga0068854_100713211 3300005578 Bacteria 867
113 Ga0068854_100993615 3300005578 Bacteria 743
114 Ga0068856_100003447 3300005614 Bacteria 15991
115 Ga0070702_100110337 3300005615 Bacteria 1704
116 Ga0070702_100395406 3300005615 Bacteria 987
117 Ga0070702_100601158 3300005615 Bacteria 824
118 Ga0070702_101081673 3300005615 Bacteria 640
119 Ga0068852_100055664 3300005616 Bacteria 3415
120 Ga0068852_101056565 3300005616 Bacteria 831
121 Ga0068852_101648974 3300005616 Bacteria 664
122 Ga0068859_100746798 3300005617 Bacteria 1067
123 Ga0068859_101978320 3300005617 Bacteria 644
124 Ga0068866_10321979 3300005718 Bacteria 973
125 Ga0068866_11395815 3300005718 Bacteria 512
126 Ga0068861_100021205 3300005719 Bacteria 4669
127 Ga0068851_10708730 3300005834 Bacteria 620
128 Ga0068870_10086996 3300005840 Bacteria 1739
129 Ga0068870_10205810 3300005840 Bacteria 1196
130 Ga0068858_100386817 3300005842 Bacteria 1343
131 Ga0068860_100844025 3300005843 Bacteria 930
132 Ga0068862_101244952 3300005844 Bacteria 744
133 Ga0081538_10033593 3300005981 Bacteria 3411
134 Ga0070717_11083081 3300006028 Bacteria 730
135 Ga0075367_10108825 3300006178 Bacteria 1699
136 Ga0075366_10862639 3300006195 Bacteria 564
137 Ga0075428_100149716 3300006844 Bacteria 2535
138 Ga0075428_102222596 3300006844 Bacteria 566
139 Ga0075431_100739663 3300006847 Bacteria 959
140 Ga0075433_10014942 3300006852 Bacteria 6354
141 Ga0075433_10109839 3300006852 Bacteria 2446
142 Ga0075433_10227719 3300006852 Bacteria 1655
143 Ga0075433_10415323 3300006852 Bacteria 1187
144 Ga0075433_11805246 3300006852 Bacteria 526
145 Ga0075434_100000073 3300006871 Bacteria 52987
146 Ga0075434_100001176 3300006871 Bacteria 21677
147 Ga0075434_100019885 3300006871 Bacteria 6503
148 Ga0075434_100075855 3300006871 Bacteria 3357
149 Ga0075434_100296357 3300006871 Bacteria 1637
150 Ga0075434_100955287 3300006871 Bacteria 871
151 Ga0068865_101977635 3300006881 Bacteria 529
152 Ga0075436_100000205 3300006914 Bacteria 36621
153 Ga0075436_100000352 3300006914 Bacteria 29413
154 Ga0075436_100214012 3300006914 Bacteria 1367
155 Ga0075436_100279283 3300006914 Bacteria 1194
156 Ga0075436_100752945 3300006914 Bacteria 724
157 Ga0097620_100746780 3300006931 Bacteria 1067
158 Ga0097620_101978139 3300006931 Bacteria 644
159 Ga0075435_100000302 3300007076 Bacteria 30480
160 Ga0075435_100006291 3300007076 Bacteria 8385
161 Ga0075435_101081743 3300007076 Bacteria 701
162 Ga0099794_10668363 3300007265 Bacteria 552
163 Ga0105251_10000235 3300009011 Bacteria 55832
164 Ga0111539_10050653 3300009094 Bacteria 4947
165 Ga0105245_10259188 3300009098 Bacteria 1692
166 Ga0114129_10241625 3300009147 Bacteria 2427
167 Ga0114129_10344711 3300009147 Bacteria 1975
168 Ga0114129_10913622 3300009147 Bacteria 1111
169 Ga0114129_13059416 3300009147 Bacteria 548
170 Ga0105243_10090461 3300009148 Bacteria 2519
171 Ga0105241_10224775 3300009174 Bacteria 1580
172 Ga0105241_10909822 3300009174 Bacteria 818
173 Ga0105242_10603294 3300009176 Bacteria 1061
174 Ga0105242_12819068 3300009176 Bacteria 536
175 Ga0105237_10108140 3300009545 Bacteria 2773
176 Ga0105237_10174567 3300009545 Bacteria 2149
177 Ga0105237_12167344 3300009545 Bacteria 565
178 Ga0105238_10260771 3300009551 Bacteria 1712
179 Ga0105249_10061295 3300009553 Bacteria 3452
180 Ga0105249_10412529 3300009553 Bacteria 1383
181 Ga0099796_10226747 3300010159 Bacteria 768
182 Ga0105239_11374966 3300010375 Bacteria 815
183 Ga0157324_1035676 3300012506 Bacteria 586
184 Ga0154016_118439 3300013045 Bacteria 769
185 Ga0154016_126409 3300013045 Bacteria 2884
186 Ga0157373_10284059 3300013100 Bacteria 1173
187 Ga0157373_10977570 3300013100 Bacteria 631
188 Ga0157371_10000116 3300013102 Bacteria 121387
189 Ga0157370_10000113 3300013104 Bacteria 94213
190 Ga0157370_10003535 3300013104 Bacteria 18305
191 Ga0157374_10070470 3300013296 Bacteria 3294
192 Ga0157378_12234315 3300013297 Bacteria 598
193 Ga0163162_10404034 3300013306 Bacteria 1499
194 Ga0157372_10000934 3300013307 Bacteria 31887
195 Ga0157372_10712663 3300013307 Bacteria 1167
196 Ga0157375_10284339 3300013308 Bacteria 1817
197 Ga0157375_11556615 3300013308 Bacteria 781
198 Ga0157380_10551560 3300014326 Bacteria 1131
199 Ga0157380_11204112 3300014326 Bacteria 801
200 Ga0182008_10215370 3300014497 Bacteria 981
201 Ga0157377_10003991 3300014745 Bacteria 6733
202 Ga0157377_10303577 3300014745 Bacteria 1054
203 Ga0182006_1002957 3300015261 Bacteria 8978
204 Ga0182007_10164852 3300015262 Bacteria 759
205 Ga0163161_10111557 3300017792 Bacteria 2045
206 Ga0163161_10643358 3300017792 Bacteria 878
207 Ga0184600_143334 3300019190 Bacteria 521
208 Ga0184603_113096 3300019192 Bacteria 588
209 Ga0197907_10096748 3300020069 Bacteria 3077
210 Ga0197907_10461614 3300020069 Bacteria 796
211 Ga0197907_11057503 3300020069 Bacteria 3277
212 Ga0206356_10486280 3300020070 Bacteria 4370
213 Ga0206356_10513374 3300020070 Bacteria 4308
214 Ga0206356_10873524 3300020070 Bacteria 686
215 Ga0206349_1662652 3300020075 Bacteria 3098
216 Ga0206355_1023336 3300020076 Bacteria 5596
217 Ga0206355_1392539 3300020076 Bacteria 3458
218 Ga0206351_10684938 3300020077 Bacteria 2798
219 Ga0206351_10916833 3300020077 Bacteria 8214
220 Ga0206352_10572019 3300020078 Bacteria 703
221 Ga0206352_10729265 3300020078 Bacteria 687
222 Ga0206352_10974575 3300020078 Bacteria 2310
223 Ga0206352_11336802 3300020078 Bacteria 1136
224 Ga0206350_10211646 3300020080 Bacteria 4550
225 Ga0206350_11498580 3300020080 Bacteria 1292
226 Ga0206354_10021521 3300020081 Bacteria 9191
227 Ga0206354_10880266 3300020081 Bacteria 1036
228 Ga0206353_11167456 3300020082 Bacteria 890
229 Ga0206353_11500459 3300020082 Bacteria 5453
230 Ga0154015_1067364 3300020610 Bacteria 2589
231 Ga0154015_1128747 3300020610 Bacteria 11172
232 Ga0213872_10016326 3300021361 Bacteria 3447
233 Ga0213874_10327120 3300021377 Bacteria 582
234 Ga0213876_10296692 3300021384 Bacteria 859
235 Ga0224712_10000044 3300022467 Bacteria 19276
236 Ga0224712_10247596 3300022467 Bacteria 822
237 Ga0247555_103641 3300023539 Bacteria 549
238 Ga0247553_105158 3300023672 Bacteria 674
239 Ga0209784_100003 3300025224 Bacteria 1379451
240 Ga0209784_101717 3300025224 Bacteria 2627
241 Ga0209566_100002 3300025225 Bacteria 2614868
242 Ga0209566_100561 3300025225 Bacteria 24375
243 Ga0209674_100008 3300025226 Bacteria 1076909
244 Ga0209674_100122 3300025226 Bacteria 131720
245 Ga0209674_104864 3300025226 Bacteria 2102
246 Ga0209672_100191 3300025228 Bacteria 49747
247 Ga0209672_100262 3300025228 Bacteria 38958
248 Ga0209147_100002 3300025229 Bacteria 2158988
249 Ga0209563_100004 3300025230 Bacteria 1814108
250 Ga0209563_114310 3300025230 Bacteria 1022
251 Ga0209258_100002 3300025242 Bacteria 2158988
252 Ga0209646_1000022 3300025246 Bacteria 446621
253 Ga0209026_1004035 3300025250 Bacteria 4545
254 Ga0209026_1012816 3300025250 Bacteria 1448
255 Ga0209677_100013 3300025253 Bacteria 548200
256 Ga0209677_103383 3300025253 Bacteria 5220
257 Ga0209148_1000021 3300025254 Bacteria 714645
258 Ga0209759_1001746 3300025256 Bacteria 11158
259 Ga0209759_1009787 3300025256 Bacteria 2868
260 Ga0209759_1009842 3300025256 Bacteria 2857
261 Ga0209455_1000021 3300025272 Bacteria 699993
262 Ga0209673_1006937 3300025273 Bacteria 5353
263 Ga0209673_1120883 3300025273 Bacteria 534
264 Ga0209130_1001018 3300025284 Bacteria 21612
265 Ga0209675_1002884 3300025291 Bacteria 8522
266 Ga0209676_1004231 3300025292 Bacteria 8115
267 Ga0209564_1000003 3300025295 Bacteria 1585848
268 Ga0209564_1054880 3300025295 Bacteria 937
269 Ga0209050_1042299 3300025298 Bacteria 1245
270 Ga0207426_1005325 3300025302 Bacteria 5910
271 Ga0209051_1004959 3300025303 Bacteria 7955
272 Ga0209257_1017381 3300025304 Bacteria 2837
273 Ga0207697_10188647 3300025315 Bacteria 905
274 Ga0207656_10476970 3300025321 Bacteria 632
275 Ga0207713_1003258 3300025735 Bacteria 11184
276 Ga0207682_10165497 3300025893 Bacteria 1004
277 Ga0207692_10046539 3300025898 Bacteria 2175
278 Ga0207692_10268318 3300025898 Bacteria 1028
279 Ga0207642_10019006 3300025899 Bacteria 2651
280 Ga0207642_10376384 3300025899 Bacteria 844
281 Ga0207642_10870093 3300025899 Bacteria 576
282 Ga0207688_10058923 3300025901 Bacteria 2162
283 Ga0207688_10217995 3300025901 Bacteria 1149
284 Ga0207647_10096771 3300025904 Bacteria 1756
285 Ga0207699_10817504 3300025906 Bacteria 685
286 Ga0207645_10080293 3300025907 Bacteria 2091
287 Ga0207645_10149669 3300025907 Bacteria 1523
288 Ga0207645_10350479 3300025907 Bacteria 988
289 Ga0207643_10052674 3300025908 Bacteria 2312
290 Ga0207643_10296139 3300025908 Bacteria 1006
291 Ga0207705_10004497 3300025909 Bacteria 10541
292 Ga0207705_10048443 3300025909 Bacteria 3057
293 Ga0207705_10102021 3300025909 Bacteria 2111
294 Ga0207684_11338875 3300025910 Bacteria 588
295 Ga0207654_10129305 3300025911 Bacteria 1596
296 Ga0207654_10262477 3300025911 Bacteria 1162
297 Ga0207654_10444638 3300025911 Bacteria 908
298 Ga0207654_10514987 3300025911 Bacteria 846
299 Ga0207707_10003333 3300025912 Bacteria 14259
300 Ga0207707_10017964 3300025912 Bacteria 6165
301 Ga0207707_10352596 3300025912 Bacteria 1268
302 Ga0207707_10431661 3300025912 Bacteria 1128
303 Ga0207695_10007787 3300025913 Bacteria 13564
304 Ga0207695_10167799 3300025913 Bacteria 2122
305 Ga0207695_11478049 3300025913 Bacteria 560
306 Ga0207671_10957107 3300025914 Bacteria 676
307 Ga0207671_11416962 3300025914 Bacteria 538
308 Ga0207693_10935222 3300025915 Bacteria 664
309 Ga0207663_10632400 3300025916 Bacteria 843
310 Ga0207660_11295582 3300025917 Bacteria 592
311 Ga0207660_11551235 3300025917 Bacteria 534
312 Ga0207662_10065469 3300025918 Bacteria 2188
313 Ga0207662_10074935 3300025918 Bacteria 2055
314 Ga0207662_11288732 3300025918 Bacteria 519
315 Ga0207657_10376439 3300025919 Bacteria 1118
316 Ga0207649_10000019 3300025920 Bacteria 212682
317 Ga0207649_10514318 3300025920 Bacteria 912
318 Ga0207646_10904070 3300025922 Bacteria 783
319 Ga0207681_10006318 3300025923 Bacteria 7273
320 Ga0207681_11626813 3300025923 Bacteria 540
321 Ga0207694_10024154 3300025924 Bacteria 4616
322 Ga0207694_10061904 3300025924 Bacteria 2913
323 Ga0207694_10840093 3300025924 Bacteria 776
324 Ga0207659_10117562 3300025926 Bacteria 2032
325 Ga0207687_10179688 3300025927 Bacteria 1638
326 Ga0207687_11510270 3300025927 Bacteria 577
327 Ga0207700_10000495 3300025928 Bacteria 23059
328 Ga0207700_10009038 3300025928 Bacteria 6203
329 Ga0207664_11280642 3300025929 Bacteria 652
330 Ga0207644_10598831 3300025931 Bacteria 915
331 Ga0207644_10878043 3300025931 Bacteria 751
332 Ga0207644_11664126 3300025931 Bacteria 535
333 Ga0207690_10004220 3300025932 Bacteria 8494
334 Ga0207690_10083643 3300025932 Bacteria 2235
335 Ga0207690_10092771 3300025932 Bacteria 2138
336 Ga0207690_10414985 3300025932 Bacteria 1076
337 Ga0207690_11063113 3300025932 Bacteria 674
338 Ga0207706_10818677 3300025933 Bacteria 790
339 Ga0207706_10926708 3300025933 Bacteria 735
340 Ga0207686_10017691 3300025934 Bacteria 4020
341 Ga0207686_10341938 3300025934 Bacteria 1124
342 Ga0207686_10653498 3300025934 Bacteria 832
343 Ga0207686_10975756 3300025934 Bacteria 687
344 Ga0207686_11642537 3300025934 Bacteria 531
345 Ga0207709_10304272 3300025935 Bacteria 1187
346 Ga0207709_10513108 3300025935 Bacteria 937
347 Ga0207709_10732430 3300025935 Bacteria 794
348 Ga0207670_10016847 3300025936 Bacteria 4403
349 Ga0207670_10095265 3300025936 Bacteria 2114
350 Ga0207670_10162231 3300025936 Bacteria 1669
351 Ga0207670_10319587 3300025936 Bacteria 1221
352 Ga0207670_10500308 3300025936 Bacteria 987
353 Ga0207670_11183547 3300025936 Bacteria 647
354 Ga0207670_11314179 3300025936 Bacteria 613
355 Ga0207670_11387470 3300025936 Bacteria 596
356 Ga0207669_10003349 3300025937 Bacteria 6939
357 Ga0207669_10067218 3300025937 Bacteria 2233
358 Ga0207669_10215681 3300025937 Bacteria 1404
359 Ga0207669_10589111 3300025937 Bacteria 902
360 Ga0207669_11926550 3300025937 Bacteria 505
361 Ga0207704_10186636 3300025938 Bacteria 1504
362 Ga0207704_10419248 3300025938 Bacteria 1061
363 Ga0207704_10702915 3300025938 Bacteria 837
364 Ga0207704_11369597 3300025938 Bacteria 606
365 Ga0207691_10009168 3300025940 Bacteria 9498
366 Ga0207691_10048698 3300025940 Bacteria 3884
367 Ga0207691_10066699 3300025940 Bacteria 3256
368 Ga0207691_10089068 3300025940 Bacteria 2768
369 Ga0207711_10177084 3300025941 Bacteria 1938
370 Ga0207689_10146813 3300025942 Bacteria 1943
371 Ga0207689_10348701 3300025942 Bacteria 1230
372 Ga0207679_10000001 3300025945 Bacteria 777444
373 Ga0207667_10000448 3300025949 Bacteria 55202
374 Ga0207667_10033006 3300025949 Bacteria 5571
375 Ga0207651_10090054 3300025960 Bacteria 2242
376 Ga0207651_10874916 3300025960 Bacteria 799
377 Ga0207651_11656330 3300025960 Bacteria 576
378 Ga0207712_10048652 3300025961 Bacteria 2950
379 Ga0207712_10311319 3300025961 Bacteria 1296
380 Ga0207668_10070816 3300025972 Bacteria 2488
381 Ga0207640_10000524 3300025981 Bacteria 23157
382 Ga0207658_10127539 3300025986 Bacteria 2039
383 Ga0207677_11385106 3300026023 Bacteria 647
384 Ga0207703_10060947 3300026035 Bacteria 3087
385 Ga0207703_10398177 3300026035 Bacteria 1277
386 Ga0207639_10009210 3300026041 Bacteria 6806
387 Ga0207639_10077667 3300026041 Bacteria 2618
388 Ga0207678_10000001 3300026067 Bacteria 433184
389 Ga0207678_10270872 3300026067 Bacteria 1456
390 Ga0207678_10799333 3300026067 Bacteria 833
391 Ga0207678_11299199 3300026067 Bacteria 644
392 Ga0207708_10109603 3300026075 Bacteria 2142
393 Ga0207708_10135070 3300026075 Bacteria 1931
394 Ga0207708_10558744 3300026075 Bacteria 966
395 Ga0207708_10730771 3300026075 Bacteria 848
396 Ga0207708_11107100 3300026075 Bacteria 691
397 Ga0207708_11705663 3300026075 Bacteria 553
398 Ga0207708_11994386 3300026075 Bacteria 508
399 Ga0207702_10000009 3300026078 Bacteria 305906
400 Ga0207702_10352718 3300026078 Bacteria 1408
401 Ga0207702_11596169 3300026078 Bacteria 646
402 Ga0207702_12044860 3300026078 Bacteria 563
403 Ga0207648_10002987 3300026089 Bacteria 17871
404 Ga0207648_10023686 3300026089 Bacteria 5495
405 Ga0207648_10329467 3300026089 Bacteria 1373
406 Ga0207648_10628130 3300026089 Bacteria 992
407 Ga0207648_11992140 3300026089 Bacteria 542
408 Ga0207676_10226347 3300026095 Bacteria 1669
409 Ga0207674_10045617 3300026116 Bacteria 4507
410 Ga0207674_10054589 3300026116 Bacteria 4067
411 Ga0207675_100000651 3300026118 Bacteria 34173
412 Ga0207675_100750097 3300026118 Bacteria 987
413 Ga0207675_101326854 3300026118 Bacteria 740
414 Ga0207675_102621661 3300026118 Bacteria 513
415 Ga0207683_10429447 3300026121 Bacteria 1217
416 Ga0207683_11554482 3300026121 Bacteria 610
417 Ga0207683_12135017 3300026121 Bacteria 508
418 Ga0207698_10009939 3300026142 Bacteria 6086
419 Ga0207698_10011610 3300026142 Bacteria 5720
420 Ga0207698_10047010 3300026142 Bacteria 3265
421 Ga0209973_1067432 3300027252 Bacteria 557
422 Ga0209969_1045956 3300027360 Bacteria 682
423 Ga0209967_1057407 3300027364 Bacteria 602
424 Ga0209981_1026343 3300027378 Bacteria 844
425 Ga0209996_1010049 3300027395 Bacteria 1252
426 Ga0210000_1006410 3300027462 Bacteria 1713
427 Ga0209999_1014606 3300027543 Bacteria 1426
428 Ga0209999_1113214 3300027543 Bacteria 531
429 Ga0209966_1013884 3300027695 Bacteria 1497
430 Ga0209813_10228650 3300027866 Bacteria 699
431 Ga0209974_10007790 3300027876 Bacteria 3682
432 Ga0209974_10261786 3300027876 Bacteria 653
433 Ga0207428_10010038 3300027907 Bacteria 8474
434 Ga0207428_10019374 3300027907 Bacteria 5803
435 Ga0268266_10621820 3300028379 Bacteria 1038
436 Ga0268265_10000781 3300028380 Bacteria 30469
437 Ga0268264_10890793 3300028381 Bacteria 893
438 Ga0268264_11272816 3300028381 Bacteria 745
439 Ga0307517_10090243 3300028786 Bacteria 2516
440 Ga0307515_10005265 3300028794 Bacteria 26299
441 Ga0265338_10000437 3300028800 Bacteria 74941
442 Ga0265338_10345137 3300028800 Bacteria 1072
443 Ga0265338_10546694 3300028800 Bacteria 811
444 Ga0265775_103433 3300030762 Bacteria 856
445 Ga0265777_120507 3300030877 Bacteria 544
446 Ga0265340_10113759 3300031247 Bacteria 1249
447 Ga0265339_10070299 3300031249 Bacteria 1867
448 Ga0265327_10108566 3300031251 Bacteria 1329
449 Ga0307509_10313403 3300031507 Bacteria 1310
450 Ga0307408_100000045 3300031548 Bacteria 169484
451 Ga0307408_100120473 3300031548 Bacteria 2032
452 Ga0307408_100630004 3300031548 Bacteria 956
453 Ga0307408_101427371 3300031548 Bacteria 652
454 Ga0307408_101599402 3300031548 Bacteria 619
455 Ga0307508_10088170 3300031616 Bacteria 2687
456 Ga0316575_10006460 3300031665 Bacteria 4219
457 Ga0316575_10190708 3300031665 Bacteria 852
458 Ga0316579_10203284 3300031691 Bacteria 958
459 Ga0316576_10002247 3300031727 Bacteria 10925
460 Ga0316576_10093005 3300031727 Bacteria 2247
461 Ga0316578_10007566 3300031728 Bacteria 5457
462 Ga0316578_10011211 3300031728 Bacteria 4679
463 Ga0307516_10000497 3300031730 Bacteria 52295
464 Ga0307405_10278881 3300031731 Bacteria 1257
465 Ga0307405_10554047 3300031731 Bacteria 931
466 Ga0307405_10691956 3300031731 Bacteria 843
467 Ga0316577_10355600 3300031733 Bacteria 831
468 Ga0316577_10864253 3300031733 Bacteria 513
469 Ga0307410_11217328 3300031852 Bacteria 656
470 Ga0307410_11792653 3300031852 Bacteria 545
471 Ga0307406_10393856 3300031901 Bacteria 1096
472 Ga0307407_10240309 3300031903 Bacteria 1235
473 Ga0307407_10308579 3300031903 Bacteria 1106
474 Ga0307407_11357904 3300031903 Bacteria 559
475 Ga0307407_11507949 3300031903 Bacteria 532
476 Ga0307412_10857053 3300031911 Bacteria 793
477 Ga0307412_11450827 3300031911 Bacteria 622
478 Ga0307412_11988103 3300031911 Bacteria 538
479 Ga0307409_101229868 3300031995 Bacteria 773
480 Ga0307416_100110795 3300032002 Bacteria 2418
481 Ga0307416_100285191 3300032002 Bacteria 1631
482 Ga0307416_100438841 3300032002 Bacteria 1355
483 Ga0307416_100901108 3300032002 Bacteria 984
484 Ga0307416_101752088 3300032002 Bacteria 725
485 Ga0307416_102269369 3300032002 Bacteria 643
486 Ga0307416_103573097 3300032002 Bacteria 520
487 Ga0307414_11105717 3300032004 Bacteria 732
488 Ga0307411_10388379 3300032005 Bacteria 1150
489 Ga0307411_10497003 3300032005 Bacteria 1030
490 Ga0307411_12320205 3300032005 Bacteria 504
491 Ga0307415_102196916 3300032126 Bacteria 540
492 Ga0316585_10091901 3300032137 Bacteria 992
493 Ga0316580_10011155 3300032139 Bacteria 2723
494 Ga0316593_10003965 3300032168 Bacteria 3743
495 Ga0316593_10089441 3300032168 Bacteria 1083
496 Ga0307507_10019824 3300033179 Bacteria 7557
497 Ga0316592_1134577 3300033524 Bacteria 578
498 Ga0316586_1103683 3300033527 Bacteria 545
499 Ga0316588_1097460 3300033528 Bacteria 735
500 Ga0316588_1123078 3300033528 Bacteria 657
501 Ga0316587_1002090 3300033529 Bacteria 2610
502 Ga0316587_1011610 3300033529 Bacteria 1424
503 Ga0316587_1019366 3300033529 Bacteria 1150
504 Ga0316596_1034527 3300033541 Bacteria 1321
505 Ga0373928_0191453 3300035084 Bacteria 586
506 Ga0373928_0228638 3300035084 Bacteria 547
507 Ga0373934_0145630 3300035086 Bacteria 969
508 Ga0373952_0159408 3300035092 Bacteria 638
509 Ga0373923_0031333 3300035111 Bacteria 2143
510 Ga0373923_0382017 3300035111 Bacteria 676
511 Ga0373932_0126165 3300035112 Bacteria 858
512 Ga0373939_0030774 3300035114 Bacteria 1546
513 Ga0373941_0413071 3300035115 Bacteria 560
514 Ga0373956_0000024 3300035119 Bacteria 47805
515 Ga0373956_0203203 3300035119 Bacteria 939
516 Ga0373956_0518955 3300035119 Bacteria 569
517 Ga0373957_0205695 3300035120 Bacteria 821
518 Ga0373955_0046538 3300035172 Bacteria 2345
519 Ga0373955_0139157 3300035172 Bacteria 1422
520 Ga0373962_0148338 3300035242 Bacteria 766
521 Ga0316574_0001833 3300035398 Bacteria 10353
522 Ga0316574_0005586 3300035398 Bacteria 6719
523 Ga0316574_0052189 3300035398 Bacteria 2549
524 Ga0316574_0357223 3300035398 Bacteria 924
525 Ga0316574_0504742 3300035398 Bacteria 754
526 Ga0373924_0045660 3300035410 Bacteria 1802
527 Ga0373931_0091770 3300035691 Bacteria 1693
528 Ga0373931_0314507 3300035691 Bacteria 971
529 Ga0373931_0372930 3300035691 Bacteria 898
530 Ga0373931_1108584 3300035691 Bacteria 539
531 Ga0373927_0042117 3300035695 Bacteria 2960
532 Ga0373933_0001797 3300035724 Bacteria 12425
533 Ga0373933_0002861 3300035724 Bacteria 9637
534 Ga0373933_0081365 3300035724 Bacteria 1987
535 Ga0373947_0310657 3300035725 Bacteria 1053
536 Ga0373937_0008435 3300036401 Bacteria 8956
537 Ga0373937_0250628 3300036401 Bacteria 1669
538 Ga0373937_0419245 3300036401 Bacteria 1270
539 Ga0373937_0877475 3300036401 Bacteria 846
540 Ga0316582_0006883 3300036647 Bacteria 6013
541 Ga0316582_0021935 3300036647 Bacteria 3783
542 Ga0316584_0074316 3300036712 Bacteria 2548
543 Ga0373925_0023592 3300037068 Bacteria 4489
544 Ga0395899_0004578 3300037312 Bacteria 10779
545 Ga0395899_0182624 3300037312 Bacteria 1472
546 Ga0395900_0011866 3300037418 Bacteria 8912
547 Ga0395900_1535479 3300037418 Bacteria 578
548 Ga0395898_0106330 3300037466 Bacteria 2691
549 Ga0395905_0041433 3300037471 Bacteria 4321
550 Ga0395905_0070324 3300037471 Bacteria 3279
551 Ga0395901_0000067 3300038443 Bacteria 144966
552 Ga0395901_0000133 3300038443 Bacteria 96281
553 Ga0395901_0040588 3300038443 Bacteria 4821
554 Ga0400488_49855 3300038741 Bacteria 1276
555 Ga0400488_61282 3300038741 Bacteria 1247
556 Ga0400483_089547 3300039062 Bacteria 1114
557 Ga0400483_166330 3300039062 Bacteria 1540
558 Ga0400483_232620 3300039062 Bacteria 2105
559 Ga0436365_1415897 3300039437 Bacteria 1117
560 Ga0436360_0397467 3300039438 Bacteria 519
561 Ga0436361_0175365 3300039447 Bacteria 3447
562 Ga0436361_0445788 3300039447 Bacteria 9657
563 Ga0436361_0519408 3300039447 Bacteria 562
564 Ga0436363_1636299 3300039450 Bacteria 594
565 Ga0439453_0019803 3300041408 Bacteria 1201
566 Ga0451787_551626 3300041441 Bacteria 591
567 Ga0451791_1922986 3300041451 Bacteria 1218
568 Ga0451793_1901220 3300041452 Bacteria 510
569 Ga0451800_1202501 3300041459 Bacteria 1197
570 Ga0451802_0617498 3300041460 Bacteria 895
571 Ga0451805_043617 3300041461 Bacteria 792
572 Ga0451807_0798448 3300041486 Bacteria 1149
573 Ga0451807_1988912 3300041486 Bacteria 1548
574 Ga0451807_2587691 3300041486 Bacteria 518
575 Ga0451835_0942726 3300041492 Bacteria 511
576 Ga0451837_0972705 3300041494 Bacteria 553
577 Ga0451849_0100067 3300041505 Bacteria 671
578 Ga0451849_0963451 3300041505 Bacteria 580
579 Ga0451853_2875636 3300041512 Bacteria 538
580 Ga0439441_001465 3300042001 Bacteria 3090
581 Ga0439441_075255 3300042001 Bacteria 729
582 Ga0439441_140780 3300042001 Bacteria 564
583 Ga0439441_157897 3300042001 Bacteria 537
584 Ga0439432_069865 3300042006 Bacteria 1072
585 Ga0450912_017126 3300042116 Bacteria 676
586 Ga0450898_087457 3300042134 Bacteria 640
587 Ga0439446_0078567 3300042156 Bacteria 1019
588 Ga0439446_0372046 3300042156 Bacteria 512
589 Ga0439435_0002787 3300042436 Bacteria 3530
590 Ga0439435_0003953 3300042436 Bacteria 3145
591 Ga0439444_0119056 3300042437 Bacteria 614
592 Ga0439464_0013042 3300042439 Bacteria 2220
593 Ga0439460_0002676 3300042461 Bacteria 4298
594 Ga0439460_0002980 3300042461 Bacteria 4085
595 Ga0450916_097199 3300042530 Bacteria 519
596 Ga0450893_0056963 3300042532 Bacteria 741
597 Ga0450901_004179 3300042533 Bacteria 1495
598 Ga0451577_0000743 3300042876 Bacteria 50109
599 Ga0451577_0130736 3300042876 Bacteria 2252
600 Ga0451577_0264911 3300042876 Bacteria 1556
601 Ga0451577_0450751 3300042876 Bacteria 1168
602 Ga0451577_0590509 3300042876 Bacteria 1008
603 Ga0451577_0760264 3300042876 Bacteria 876
604 Ga0451577_0794399 3300042876 Bacteria 855
605 Ga0466969_0035504 3300044656 Bacteria 2521
606 Ga0466969_0083388 3300044656 Bacteria 1522
607 Ga0466969_0125530 3300044656 Bacteria 1192
608 Ga0466972_0380629 3300044658 Bacteria 661
609 Ga0466965_0018466 3300044683 Bacteria 3343
610 Ga0466966_0000067 3300044684 Bacteria 69077
611 Ga0466966_0032486 3300044684 Bacteria 3382
612 Ga0466966_0038100 3300044684 Bacteria 3098
613 Ga0466966_0717331 3300044684 Bacteria 603
614 Ga0466966_0849720 3300044684 Bacteria 550
615 Ga0466961_0000526 3300044693 Bacteria 24271
616 Ga0466961_0004076 3300044693 Bacteria 9134
617 Ga0466961_0019938 3300044693 Bacteria 4316
618 Ga0466961_0054694 3300044693 Bacteria 2545
619 Ga0466963_0053430 3300044694 Bacteria 2682
620 Ga0466963_0056541 3300044694 Bacteria 2611
621 Ga0466964_0040415 3300044706 Bacteria 1883
622 Ga0466964_0568719 3300044706 Bacteria 618
623 Ga0466964_0834294 3300044706 Bacteria 523
624 Ga0453684_0002107 3300044712 Bacteria 50213
625 Ga0453684_0002541 3300044712 Bacteria 43926
626 Ga0453684_2135829 3300044712 Bacteria 561
627 Ga0466971_0001855 3300044719 Bacteria 8989
628 Ga0466968_0054594 3300044735 Bacteria 1713
629 Ga0466968_0207575 3300044735 Bacteria 919
630 Ga0466970_0007036 3300044765 Bacteria 5631
631 Ga0466970_0193481 3300044765 Bacteria 1131
632 Ga0466970_0373307 3300044765 Bacteria 811
633 Ga0466957_0022761 3300044842 Bacteria 3699
634 Ga0466957_0050029 3300044842 Bacteria 2542
635 Ga0466957_0191677 3300044842 Bacteria 1339
636 Ga0466959_0003982 3300045049 Bacteria 9816
637 Ga0466959_0017713 3300045049 Bacteria 5224
638 Ga0466959_0667145 3300045049 Bacteria 698
639 Ga0451576_0004451 3300045051 Bacteria 18188
640 Ga0451576_0017229 3300045051 Bacteria 7947
641 Ga0451576_0045166 3300045051 Bacteria 4641
642 Ga0451576_1646353 3300045051 Bacteria 665
643 Ga0466958_0004016 3300045836 Bacteria 7711
644 Ga0466958_0041673 3300045836 Bacteria 2762
645 Ga0466958_0373082 3300045836 Bacteria 919
646 Ga0466967_0281748 3300045976 Bacteria 1595
647 Ga0466967_0895544 3300045976 Bacteria 882
648 Ga0466967_0955052 3300045976 Bacteria 853
649 Ga0495592_0001313 3300046454 Bacteria 17257
650 Ga0495592_0001592 3300046454 Bacteria 15869
651 Ga0495592_0479801 3300046454 Bacteria 775
652 Ga0495603_0011812 3300046455 Bacteria 5284
653 Ga0495603_0040511 3300046455 Bacteria 2788
654 Ga0495603_0654510 3300046455 Bacteria 601
655 Ga0495603_0696925 3300046455 Bacteria 581
656 Ga0495590_0014064 3300046457 Bacteria 2930
657 Ga0495590_0355523 3300046457 Bacteria 557
658 Ga0495591_005751 3300046458 Bacteria 5651
659 Ga0495591_092749 3300046458 Bacteria 756
660 Ga0495629_0001354 3300046459 Bacteria 19293
661 Ga0495629_0008262 3300046459 Bacteria 7654
662 Ga0495629_0090926 3300046459 Bacteria 2129
663 Ga0495629_0426703 3300046459 Bacteria 899
664 Ga0495641_0030091 3300046461 Bacteria 2608
665 Ga0495651_0001164 3300046462 Bacteria 20299
666 Ga0495651_0003321 3300046462 Bacteria 12354
667 Ga0495651_0032641 3300046462 Bacteria 4060
668 Ga0495651_0313471 3300046462 Bacteria 1048
669 Ga0495653_0001712 3300046463 Bacteria 17277
670 Ga0495653_0055383 3300046463 Bacteria 3026
671 Ga0495653_0417694 3300046463 Bacteria 849
672 Ga0495650_0005992 3300046471 Bacteria 7698
673 Ga0495650_0039110 3300046471 Bacteria 2049
674 Ga0495580_0002474 3300046472 Bacteria 16116
675 Ga0495580_0025511 3300046472 Bacteria 4320
676 Ga0495580_0099531 3300046472 Bacteria 2022
677 Ga0495580_0107541 3300046472 Bacteria 1937
678 Ga0495580_0118557 3300046472 Bacteria 1837
679 Ga0495580_0291872 3300046472 Bacteria 1111
680 Ga0495582_0017320 3300046473 Bacteria 3943
681 Ga0495582_0131448 3300046473 Bacteria 1414
682 Ga0495582_0233271 3300046473 Bacteria 1054
683 Ga0495639_0273857 3300046475 Bacteria 838
684 Ga0495662_0039184 3300046476 Bacteria 2289
685 Ga0495662_0041092 3300046476 Bacteria 2233
686 Ga0495662_0068173 3300046476 Bacteria 1722
687 Ga0495662_0125752 3300046476 Bacteria 1259
688 Ga0495664_0003770 3300046477 Bacteria 8269
689 Ga0495664_0275698 3300046477 Bacteria 1016
690 Ga0495584_0147566 3300046491 Bacteria 1195
691 Ga0495596_0032260 3300046500 Bacteria 2089
692 Ga0495596_0169647 3300046500 Bacteria 848
693 Ga0495596_0266694 3300046500 Bacteria 665
694 Ga0495606_0080138 3300046507 Bacteria 2032
695 Ga0495606_0251040 3300046507 Bacteria 981
696 Ga0495608_0003166 3300046511 Bacteria 11770
697 Ga0495608_0007794 3300046511 Bacteria 7537
698 Ga0495608_0117916 3300046511 Bacteria 1703
699 Ga0495608_0567513 3300046511 Bacteria 683
700 Ga0495608_0616736 3300046511 Bacteria 650
701 Ga0495618_0024676 3300046514 Bacteria 3725
702 Ga0495618_0053484 3300046514 Bacteria 2553
703 Ga0495618_0137124 3300046514 Bacteria 1565
704 Ga0495620_0036525 3300046515 Bacteria 2197
705 Ga0495620_0425052 3300046515 Bacteria 503
706 Ga0495628_0003126 3300046516 Bacteria 14870
707 Ga0495628_0011513 3300046516 Bacteria 7477
708 Ga0495628_0088456 3300046516 Bacteria 2400
709 Ga0495628_0121134 3300046516 Bacteria 2006
710 Ga0495628_1073780 3300046516 Bacteria 551
711 Ga0495630_0054008 3300046517 Bacteria 3009
712 Ga0495630_0079050 3300046517 Bacteria 2481
713 Ga0495630_0312817 3300046517 Bacteria 1200
714 Ga0495630_0392172 3300046517 Bacteria 1063
715 Ga0495630_0747523 3300046517 Bacteria 747
716 Ga0495630_0989092 3300046517 Bacteria 639
717 Ga0495644_0281566 3300046523 Bacteria 649
718 Ga0495648_0089258 3300046524 Bacteria 1730
719 Ga0495648_0116974 3300046524 Bacteria 1439
720 Ga0495663_0099363 3300046525 Bacteria 957
721 Ga0495666_0004045 3300046526 Bacteria 7413
722 Ga0495666_0048114 3300046526 Bacteria 2054
723 Ga0495666_0064344 3300046526 Bacteria 1750
724 Ga0495666_0126969 3300046526 Bacteria 1192
725 Ga0495642_0023552 3300046528 Bacteria 2431
726 Ga0495642_0171034 3300046528 Bacteria 944
727 Ga0495642_0294950 3300046528 Bacteria 710
728 Ga0495652_0034252 3300046529 Bacteria 4427
729 Ga0495652_0106642 3300046529 Bacteria 2262
730 Ga0495652_0168866 3300046529 Bacteria 1690
731 Ga0495652_0308545 3300046529 Bacteria 1147
732 Ga0495652_0311665 3300046529 Bacteria 1140
733 Ga0495654_0096746 3300046530 Bacteria 1364
734 Ga0495665_0005305 3300046531 Bacteria 6945
735 Ga0495665_0009459 3300046531 Bacteria 5275
736 Ga0495665_0280870 3300046531 Bacteria 854
737 Ga0495640_0009959 3300046533 Bacteria 7369
738 Ga0495640_0051399 3300046533 Bacteria 2833
739 Ga0495640_0072910 3300046533 Bacteria 2299
740 Ga0495586_0001580 3300046535 Bacteria 12553
741 Ga0495586_0049093 3300046535 Bacteria 2281
742 Ga0495586_0177410 3300046535 Bacteria 1205
743 Ga0495586_0286902 3300046535 Bacteria 942
744 Ga0495586_0449764 3300046535 Bacteria 742
745 Ga0495587_0000845 3300046536 Bacteria 20252
746 Ga0495587_0029444 3300046536 Bacteria 3333
747 Ga0495587_0054506 3300046536 Bacteria 2356
748 Ga0495598_0141111 3300046537 Bacteria 834
749 Ga0495598_0326362 3300046537 Bacteria 586
750 Ga0495598_0373275 3300046537 Bacteria 553
751 Ga0495609_0218860 3300046538 Bacteria 791
752 Ga0495621_0019326 3300046539 Bacteria 2224
753 Ga0495621_0108380 3300046539 Bacteria 1063
754 Ga0495621_0258489 3300046539 Bacteria 713
755 Ga0495597_0010631 3300046542 Bacteria 4488
756 Ga0495645_0017147 3300046543 Bacteria 5187
757 Ga0495645_0065743 3300046543 Bacteria 2623
758 Ga0495645_0217268 3300046543 Bacteria 1287
759 Ga0495667_0049285 3300046559 Bacteria 2780
760 Ga0495667_0125134 3300046559 Bacteria 1659
761 Ga0495634_0005222 3300046642 Bacteria 10032
762 Ga0495634_0014642 3300046642 Bacteria 5649
763 Ga0495634_0020851 3300046642 Bacteria 4642
764 Ga0495634_0371027 3300046642 Bacteria 854
765 Ga0495635_0068023 3300046663 Bacteria 2443
766 Ga0495635_0148225 3300046663 Bacteria 1597
767 Ga0495635_0158203 3300046663 Bacteria 1542
768 Ga0495635_0345506 3300046663 Bacteria 993
769 Ga0495635_0611025 3300046663 Bacteria 711
770 Ga0495661_0005549 3300046665 Bacteria 8950
771 Ga0495661_0017977 3300046665 Bacteria 4658
772 Ga0495588_0285746 3300046674 Bacteria 869
773 Ga0495657_0201102 3300046675 Bacteria 1214
774 Ga0495657_0905174 3300046675 Bacteria 501
775 Ga0495599_0017466 3300046678 Bacteria 4459
776 Ga0495599_0292994 3300046678 Bacteria 983
777 Ga0495599_0412285 3300046678 Bacteria 803
778 Ga0495599_0580502 3300046678 Bacteria 654
779 Ga0495599_0641271 3300046678 Bacteria 616
780 Ga0495599_0791057 3300046678 Bacteria 542
781 Ga0495623_0007848 3300046679 Bacteria 6940
782 Ga0495623_0080548 3300046679 Bacteria 2015
783 Ga0495623_0316562 3300046679 Bacteria 858
784 Ga0495646_0003413 3300046680 Bacteria 9871
785 Ga0495646_0004507 3300046680 Bacteria 8768
786 Ga0495658_0017875 3300046683 Bacteria 3675
787 Ga0495658_0060519 3300046683 Bacteria 2172
788 Ga0495658_0721417 3300046683 Bacteria 639
789 Ga0495658_0806415 3300046683 Bacteria 601
790 Ga0495669_0045320 3300046684 Bacteria 1960
791 Ga0495669_0242068 3300046684 Bacteria 866
792 Ga0495613_0019201 3300046689 Bacteria 5095
793 Ga0495613_0036939 3300046689 Bacteria 3621
794 Ga0495613_0065036 3300046689 Bacteria 2666
795 Ga0495613_0538570 3300046689 Bacteria 782
796 Ga0495624_0017343 3300046690 Bacteria 4835
797 Ga0495624_0094431 3300046690 Bacteria 1844
798 Ga0495624_0132745 3300046690 Bacteria 1526
799 Ga0495624_0143973 3300046690 Bacteria 1459
800 Ga0495624_0385279 3300046690 Bacteria 842
801 Ga0495624_0753769 3300046690 Bacteria 576
802 Ga0495670_0604992 3300046691 Bacteria 597
803 Ga0495671_0060933 3300046692 Bacteria 1862
804 Ga0495649_0012027 3300046694 Bacteria 5055
805 Ga0495649_0048027 3300046694 Bacteria 2320
806 Ga0495649_0075838 3300046694 Bacteria 1800
807 Ga0495589_0049162 3300046794 Bacteria 2087
808 Ga0495589_0074606 3300046794 Bacteria 1654
809 Ga0495589_0100336 3300046794 Bacteria 1401
810 Ga0495589_0225410 3300046794 Bacteria 880
811 Ga0495589_0467800 3300046794 Bacteria 576
812 Ga0495600_0015117 3300046809 Bacteria 4875
813 Ga0495600_0036242 3300046809 Bacteria 3205
814 Ga0495600_0685620 3300046809 Bacteria 617
815 Ga0495581_0001049 3300047315 Bacteria 14962
816 Ga0495581_0010529 3300047315 Bacteria 5346
817 Ga0495581_0094740 3300047315 Bacteria 1733
818 Ga0495604_0001474 3300047317 Bacteria 19379
819 Ga0495604_0008726 3300047317 Bacteria 8014
820 Ga0495604_0018792 3300047317 Bacteria 5534
821 Ga0495604_0026152 3300047317 Bacteria 4646
822 Ga0495604_0059228 3300047317 Bacteria 2936
823 Ga0495604_0206685 3300047317 Bacteria 1358
824 Ga0495604_0426244 3300047317 Bacteria 870
825 Ga0495636_0006341 3300047318 Bacteria 4646
826 Ga0495636_0291468 3300047318 Bacteria 762
827 Ga0495674_0081656 3300047319 Bacteria 2772
828 Ga0495674_0100187 3300047319 Bacteria 2465
829 Ga0495674_0720619 3300047319 Bacteria 781
830 Ga0495674_1022855 3300047319 Bacteria 632
831 Ga0495676_0254554 3300047321 Bacteria 1196
832 Ga0495676_0589405 3300047321 Bacteria 725
833 Ga0495680_0001252 3300047322 Bacteria 27832
834 Ga0495680_0006154 3300047322 Bacteria 11193
835 Ga0495680_0028998 3300047322 Bacteria 4535
836 Ga0495680_0258368 3300047322 Bacteria 1232
837 Ga0495680_0367110 3300047322 Bacteria 999
838 Ga0495680_0872482 3300047322 Bacteria 583
839 Ga0495683_0002338 3300047323 Bacteria 11515
840 Ga0495683_0006981 3300047323 Bacteria 6132
841 Ga0495683_0057968 3300047323 Bacteria 1924
842 Ga0495683_0366451 3300047323 Unclassified 605
843 Ga0495687_000078 3300047443 Bacteria 148202
844 Ga0495687_045152 3300047443 Bacteria 1910
845 Ga0495675_0031304 3300047444 Bacteria 3396
846 Ga0495675_0149692 3300047444 Bacteria 1442
847 Ga0495675_0160606 3300047444 Bacteria 1384
848 Ga0495675_0187973 3300047444 Bacteria 1262
849 Ga0495675_0252568 3300047444 Bacteria 1058
850 Ga0495679_006165 3300047446 Bacteria 5214
851 Ga0495679_022378 3300047446 Bacteria 2163
852 Ga0495679_038477 3300047446 Bacteria 1498
853 Ga0495673_0033340 3300047469 Bacteria 2391
854 Ga0495684_0157650 3300047471 Bacteria 1695
855 Ga0495593_0008398 3300047673 Bacteria 6005
856 Ga0495593_0012595 3300047673 Bacteria 4829
857 Ga0495593_0053913 3300047673 Bacteria 2121
858 Ga0495593_0077978 3300047673 Bacteria 1716
859 Ga0495593_0447735 3300047673 Bacteria 646
860 Ga0495602_0011608 3300048088 Bacteria 9101
861 Ga0495602_0049942 3300048088 Bacteria 3742
862 Ga0495602_0153071 3300048088 Bacteria 1810
863 Ga0495602_0193040 3300048088 Bacteria 1559
864 Ga0495614_0003464 3300048089 Bacteria 7057
865 Ga0495614_0051130 3300048089 Bacteria 1771
866 Ga0495614_0107248 3300048089 Bacteria 1224
867 Ga0496100_0008448 3300048903 Bacteria 5741
868 Ga0496101_0023297 3300048904 Bacteria 4275
869 Ga0496101_0113453 3300048904 Bacteria 2042
870 Ga0496101_0493729 3300048904 Bacteria 967
871 Ga0496102_0018939 3300048905 Bacteria 6056
872 Ga0496102_0065386 3300048905 Bacteria 3333
873 Ga0496103_0011604 3300048906 Bacteria 5224
874 Ga0496103_0021032 3300048906 Bacteria 3924
875 Ga0496104_0295492 3300048907 Bacteria 1532
876 Ga0496105_0111021 3300048908 Bacteria 2263
877 Ga0496106_0000023 3300048909 Bacteria 165457
878 Ga0496106_0015183 3300048909 Bacteria 5700
879 Ga0496107_0270121 3300048910 Bacteria 1266
880 Ga0496108_0099751 3300048911 Bacteria 2476
881 Ga0496108_0414784 3300048911 Bacteria 1176
882 Ga0496109_0404606 3300048912 Bacteria 1289
883 Ga0496110_0114538 3300048913 Bacteria 2426
884 Ga0496110_0148999 3300048913 Bacteria 2118
885 Ga0496111_0253983 3300048914 Bacteria 1304
886 Ga0496111_0774908 3300048914 Bacteria 695
887 Ga0496112_0044311 3300048915 Bacteria 4359
888 Ga0496113_0042009 3300048916 Bacteria 3377
889 Ga0496114_0033858 3300048917 Bacteria 4212
890 Ga0496115_0006263 3300048918 Bacteria 8705
891 Ga0496116_0026332 3300048919 Bacteria 4257
892 Ga0496116_0080085 3300048919 Bacteria 2029
893 Ga0496117_0043089 3300048920 Bacteria 3286
894 Ga0496117_0052900 3300048920 Bacteria 2858
895 Ga0496117_0075692 3300048920 Bacteria 2235
896 Ga0496118_0010415 3300048921 Bacteria 9214
897 Ga0496118_0023542 3300048921 Bacteria 5346
898 Ga0496118_0226382 3300048921 Bacteria 1083
899 Ga0496119_0202909 3300048922 Bacteria 1025
900 Ga0496121_0005179 3300048924 Bacteria 16904
901 Ga0496121_0028951 3300048924 Bacteria 5141
902 Ga0496122_0010546 3300048925 Bacteria 9498
903 Ga0496123_0040469 3300048926 Bacteria 3245
904 Ga0496124_0032787 3300048927 Bacteria 4581
905 Ga0496124_0193818 3300048927 Bacteria 1552
906 Ga0496125_0027893 3300048928 Bacteria 5109
907 Ga0496126_0001279 3300048929 Bacteria 40379
908 Ga0496126_0001770 3300048929 Bacteria 31970
909 Ga0496126_0043993 3300048929 Bacteria 4115
910 Ga0501309_012746 3300049129 Bacteria 1111
911 Ga0501305_094306 3300049161 Bacteria 551
912 Ga0495678_185078 3300049459 Bacteria 651
913 Ga0501291_024806 3300049514 Bacteria 977
914 Ga0501291_031963 3300049514 Bacteria 892
915 Ga0501291_097346 3300049514 Bacteria 609
916 Ga0501297_042019 3300049520 Bacteria 647
917 Ga0501297_052237 3300049520 Bacteria 604
918 Ga0501303_008441 3300049526 Bacteria 936
919 Ga0501311_042555 3300049527 Bacteria 692
920 Ga0501312_109184 3300049528 Bacteria 526
921 Ga0501314_030602 3300049530 Bacteria 597
922 Ga0501031_0098236 3300049568 Bacteria 1911
923 Ga0501031_0362808 3300049568 Bacteria 937
924 Ga0501032_0258858 3300049569 Bacteria 1129
925 Ga0501033_0241590 3300049570 Bacteria 1281
926 Ga0501034_0409979 3300049571 Bacteria 1277
927 Ga0501034_0427120 3300049571 Bacteria 1245
928 Ga0501034_1215936 3300049571 Bacteria 632
929 Ga0501036_0052878 3300049572 Bacteria 3440
930 Ga0501036_0857819 3300049572 Bacteria 746
931 Ga0501036_0859596 3300049572 Bacteria 745
932 Ga0501037_0003038 3300049573 Bacteria 12180
933 Ga0501038_0303394 3300049574 Bacteria 1253
934 Ga0501039_0024671 3300049575 Bacteria 4619
935 Ga0501040_0003600 3300049576 Bacteria 10021
936 Ga0501040_0034644 3300049576 Bacteria 3420
937 Ga0501040_0865955 3300049576 Bacteria 654
938 Ga0501041_0116026 3300049577 Bacteria 1662
939 Ga0501042_0396719 3300049578 Bacteria 999
940 Ga0501046_0098411 3300049580 Bacteria 2246
941 Ga0501046_0138215 3300049580 Bacteria 1845
942 Ga0501046_0485880 3300049580 Bacteria 886
943 Ga0501046_0507391 3300049580 Bacteria 863
944 Ga0501047_0019486 3300049581 Bacteria 6508
945 Ga0501047_0167337 3300049581 Bacteria 2068
946 Ga0501047_1091044 3300049581 Bacteria 611
947 Ga0501048_1122440 3300049582 Bacteria 566
948 Ga0501067_0495896 3300049583 Bacteria 683
949 Ga0501068_0537516 3300049584 Bacteria 759
950 Ga0501071_0111706 3300049587 Bacteria 2020
951 Ga0501072_0008011 3300049588 Bacteria 8018
952 Ga0501072_0686394 3300049588 Bacteria 805
953 Ga0501074_0220060 3300049590 Bacteria 1352
954 Ga0501075_0076329 3300049591 Bacteria 2534
955 Ga0501076_0000290 3300049592 Bacteria 31327
956 Ga0501077_0504698 3300049593 Bacteria 776
957 Ga0501201_010158 3300049651 Bacteria 920
958 Ga0501202_146817 3300049652 Bacteria 614
959 Ga0501207_063540 3300049654 Bacteria 681
960 Ga0501223_122641 3300049663 Bacteria 550
961 Ga0501249_138579 3300049679 Bacteria 604
962 Ga0501257_235092 3300049686 Bacteria 538
963 Ga0501221_215760 3300049704 Bacteria 539
964 Ga0501225_0159976 3300049705 Bacteria 692
965 Ga0501079_0085041 3300049741 Bacteria 2448
966 Ga0501080_0096596 3300049742 Bacteria 2743
967 Ga0501080_0106464 3300049742 Bacteria 2599
968 Ga0501080_0333901 3300049742 Bacteria 1370
969 Ga0501080_0985827 3300049742 Bacteria 731
970 Ga0501081_0005740 3300049743 Bacteria 8036
971 Ga0501083_0656215 3300049744 Bacteria 682
972 Ga0501283_018398 3300049779 Bacteria 1099
973 Ga0501035_0527664 3300049822 Bacteria 969
974 Ga0501035_1188834 3300049822 Bacteria 592
975 Ga0501044_0177984 3300049823 Bacteria 2095
976 Ga0501044_0497465 3300049823 Bacteria 1121
977 Ga0501045_0167109 3300049824 Bacteria 1638
978 nmdc:mga00v17_76853_c1 3300050491 Bacteria 2078
979 nmdc:mga0yw44_315642_c1 3300050492 Bacteria 1049
980 nmdc:mga0k408_12409_c1 3300050493 Bacteria 4657
981 nmdc:mga0k408_132002_c1 3300050493 Bacteria 1483
982 nmdc:mga06z11_362980_c1 3300050494 Bacteria 868
983 nmdc:mga06z11_898647_c1 3300050494 Bacteria 540
984 nmdc:mga04h51_61024_c1 3300050495 Bacteria 1292
985 nmdc:mga05p37_2115337_c1 3300050507 Bacteria 527
986 nmdc:mga05p37_222484_c1 3300050507 Bacteria 2277
987 nmdc:mga09592_1117136_c1 3300050508 Bacteria 655
988 nmdc:mga09592_712219_c1 3300050508 Bacteria 854
989 nmdc:mga06r32_446739_c1 3300050510 Bacteria 1273
990 nmdc:mga08y16_1878441_c1 3300050511 Bacteria 550
991 nmdc:mga08y16_5343_c1 3300050511 Bacteria 13436
992 nmdc:mga08y16_588427_c1 3300050511 Bacteria 1123
993 nmdc:mga08y16_729185_c1 3300050511 Bacteria 989
994 nmdc:mga08y16_86961_c1 3300050511 Bacteria 3257
995 nmdc:mga0n895_313173_c1 3300050512 Bacteria 1591
996 nmdc:mga0n895_582_c1 3300050512 Bacteria 25135
997 nmdc:mga0n895_62787_c1 3300050512 Bacteria 3673
998 nmdc:mga0n895_629202_c1 3300050512 Bacteria 1073
999 nmdc:mga0n895_637282_c1 3300050512 Bacteria 1066
1000 nmdc:mga0rr50_19252_c1 3300050513 Bacteria 4603
1001 nmdc:mga0rr50_218123_c1 3300050513 Bacteria 1574
1002 nmdc:mga0rr50_234962_c1 3300050513 Bacteria 1518
1003 nmdc:mga0rr50_273030_c1 3300050513 Bacteria 1409
1004 nmdc:mga0rr50_3282_c1 3300050513 Bacteria 9282
1005 nmdc:mga0rr50_665357_c1 3300050513 Bacteria 889
1006 nmdc:mga0rr50_871708_c1 3300050513 Bacteria 768
1007 nmdc:mga08x19_1199325_c1 3300050514 Bacteria 538
1008 nmdc:mga08x19_1858_c1 3300050514 Bacteria 12938
1009 nmdc:mga08x19_250421_c1 3300050514 Bacteria 1223
1010 nmdc:mga08x19_269_c1 3300050514 Bacteria 39443
1011 nmdc:mga08x19_5533_c1 3300050514 Bacteria 7469
1012 nmdc:mga0a205_107303_c1 3300050515 Bacteria 2690
1013 nmdc:mga0a205_12708_c1 3300050515 Bacteria 7802
1014 nmdc:mga0a205_428_c1 3300050515 Bacteria 32380
1015 nmdc:mga0a205_956344_c1 3300050515 Bacteria 703
1016 nmdc:mga0sz30_138726_c1 3300050516 Bacteria 1073
1017 nmdc:mga0sz30_19086_c1 3300050516 Bacteria 2750
1018 Ga0495601_0079602 3300053077 Bacteria 2101
1019 Ga0495601_0235706 3300053077 Bacteria 1195
1020 Ga0495601_0569482 3300053077 Bacteria 728
1021 Ga0495612_0459003 3300053078 Bacteria 582
1022 Ga0495619_0694822 3300053085 Bacteria 692
1023 Ga0500588_0244235 3300053146 Bacteria 673
1024 Ga0500616_0286137 3300053153 Bacteria 690
1025 Ga0500627_0127791 3300053158 Bacteria 1147
1026 Ga0500637_0508192 3300053178 Bacteria 595
1027 Ga0501084_0227805 3300054114 Bacteria 1573
1028 Ga0501084_0805497 3300054114 Bacteria 791
1029 Ga0501084_0905061 3300054114 Bacteria 742
1030 Ga0587084_000186 3300059477 Bacteria 3994
1031 Ga0587084_032074 3300059477 Bacteria 851
1032 Ga0587084_078057 3300059477 Bacteria 637
1033 Ga0587073_0005556 3300059492 Bacteria 1885
1034 Ga0587082_013997 3300059504 Bacteria 1218
1035 Ga0587088_000182 3300059508 Bacteria 4154
1036 Ga0587088_015464 3300059508 Bacteria 1202
1037 Ga0587091_011293 3300059511 Bacteria 1390
1038 Ga0587109_170298 3300059624 Bacteria 550
1039 Ga0587128_001876 3300059630 Bacteria 2085
1040 Ga0587128_144159 3300059630 Bacteria 537
1041 Ga0587067_000236 3300059640 Bacteria 4271
1042 Ga0587068_002388 3300059641 Bacteria 2276
1043 Ga0587072_000335 3300059643 Bacteria 4494
1044 Ga0587075_011493 3300059644 Bacteria 1188
1045 Ga0587076_011609 3300059645 Bacteria 1299
1046 Ga0587100_009542 3300059648 Bacteria 803
1047 Ga0587104_001168 3300059650 Bacteria 1343
1048 Ga0587111_0007854 3300060346 Bacteria 1749
1049 Ga0501082_0083800 3300060353 Bacteria 2750
1050 Ga0501082_1047968 3300060353 Bacteria 713
1051 Ga0466962_0000364 3300061719 Bacteria 19522
1052 Ga0466962_0007045 3300061719 Bacteria 5388
1053 Ga0466962_0657091 3300061719 Bacteria 536

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300038741 Ga0400488_49855 Ga0400488_49855_624_935 103
2 3300039062 Ga0400483_166330 Ga0400483_166330_361_672 103
3 3300044658 Ga0466972_0380629 Ga0466972_0380629_19_330 103
4 3300046455 Ga0495603_0654510 Ga0495603_0654510_12_323 103
5 3300047322 Ga0495680_0258368 Ga0495680_0258368_910_1221 103
6 3300049571 Ga0501034_0409979 Ga0501034_0409979_134_445 103
7 iso_pu_bacteria 2501025501 2501072653 103
8 iso_pu_bacteria 2501025504 2501410535 103
9 iso_pu_bacteria 2510065045 2510251512 103
10 iso_pu_bacteria 2510917014 2511096997 103
11 iso_pu_bacteria 2510917015 2511103807 103
12 iso_pu_bacteria 2512047030 2512345530 103
13 iso_pu_bacteria 2515154122 2515680816 103
14 iso_pu_bacteria 2515154189 2516019474 103
15 iso_pu_bacteria 2554235231 2555245487 103
16 iso_pu_bacteria 2600254954 2600442501 103
17 iso_pu_bacteria 2600255067 2600812110 103
18 iso_pu_bacteria 2600255389 2602012436 103
19 iso_pu_bacteria 2718217991 2719640626 103
20 iso_pu_bacteria 2721755763 2723878537 103
21 iso_pu_bacteria 2806310737 2807406683 103
22 iso_pu_bacteria 2806310745 2807455015 103
23 iso_pu_bacteria 2808606373 2808906873 103
24 iso_pu_bacteria 2808606384 2808972719 103
25 iso_pu_bacteria 2808606390 2809007701 103
26 iso_pu_bacteria 2808606391 2809014759 103
27 iso_pu_bacteria 2842324504 2842328623 103
28 iso_pu_bacteria 2842348783 2842352939 103
29 iso_pu_bacteria 2842454564 2842458716 103
30 iso_pu_bacteria 2883087390 2883093068 103
31 iso_pu_bacteria 2885270888 2885272974 103
32 iso_pu_bacteria 2887375801 2887379270 103
33 iso_pu_bacteria 2902682994 2902683730 103
34 iso_pu_bacteria 2917832318 2917835057 103
35 iso_pu_bacteria 2919125081 2919128999 103
36 iso_pu_bacteria 2928115317 2928116399 103
37 iso_pu_bacteria 2984504281 2984507808 103
38 iso_pu_bacteria 3007861166 3007866032 103
39 iso_pu_bacteria 8011350971 8011353515 103
40 iso_pu_bacteria 8016728285 8016730040 103
41 iso_pu_bacteria 8034962539 8034964213 103
42 iso_pu_bacteria 8054929484 8054934350 103
43 iso_pu_bacteria 8056115690 8056120445 103
44 iso_pu_bacteria 8056120720 8056121729 103
45 3300001979 JGI24740J21852_10000304 JGI24740J21852_100003044 106
46 3300001979 JGI24740J21852_10000783 JGI24740J21852_1000078311 106
47 3300001989 JGI24739J22299_10026729 JGI24739J22299_100267292 106
48 3300002067 JGI24735J21928_10000592 JGI24735J21928_1000059210 106
49 3300002705 JGI25156J39149_1004627 JGI25156J39149_10046273 106
50 3300002705 JGI25156J39149_1013980 JGI25156J39149_10139803 106
51 3300002738 JGI25154J39366_1000649 JGI25154J39366_10006497 106
52 3300003479 Ga0006556J51387_1030706 Ga0006556J51387_10307063 106
53 3300003558 Ga0006558J51389_1031326 Ga0006558J51389_10313262 106
54 3300003565 Ga0006560J51390_1025704 Ga0006560J51390_10257043 106
55 3300003567 Ga0006554J51385_1045016 Ga0006554J51385_10450162 106
56 3300003751 Ga0055538_1012937 Ga0055538_10129371 106
57 3300003752 Ga0055539_1000034 Ga0055539_1000034109 106
58 3300003756 Ga0055533_1002398 Ga0055533_10023984 106
59 3300003758 Ga0055532_1000002 Ga0055532_1000002303 106
60 3300003759 Ga0055525_1000313 Ga0055525_100031317 106
61 3300003759 Ga0055525_1000473 Ga0055525_10004734 106
62 3300003760 Ga0055527_1000923 Ga0055527_10009235 106
63 3300003762 Ga0055542_1003748 Ga0055542_10037484 106
64 3300003763 Ga0055529_1000028 Ga0055529_1000028145 106
65 3300003784 Ga0055534_1000984 Ga0055534_100098413 106
66 3300003794 Ga0055531_10033129 Ga0055531_100331292 106
67 3300003841 Ga0055541_1003150 Ga0055541_10031504 106
68 3300004625 Ga0055543_1003665 Ga0055543_10036653 106
69 3300004798 Ga0058859_11623198 Ga0058859_116231982 106
70 3300004798 Ga0058859_11781410 Ga0058859_117814102 106
71 3300004801 Ga0058860_12150010 Ga0058860_121500102 106
72 3300004803 Ga0058862_12823266 Ga0058862_128232662 106
73 3300005262 Ga0065165_1000613 Ga0065165_10006139 106
74 3300005295 Ga0065707_10057951 Ga0065707_100579511 106
75 3300005327 Ga0070658_10002480 Ga0070658_1000248013 106
76 3300005329 Ga0070683_101505761 Ga0070683_1015057611 106
77 3300005330 Ga0070690_100989682 Ga0070690_1009896821 106
78 3300005334 Ga0068869_100050869 Ga0068869_1000508693 106
79 3300005334 Ga0068869_100128505 Ga0068869_1001285053 106
80 3300005334 Ga0068869_101145432 Ga0068869_1011454321 106
81 3300005335 Ga0070666_10073819 Ga0070666_100738193 106
82 3300005338 Ga0068868_100458728 Ga0068868_1004587283 106
83 3300005338 Ga0068868_101402616 Ga0068868_1014026161 106
84 3300005340 Ga0070689_100012797 Ga0070689_1000127973 106
85 3300005340 Ga0070689_100151335 Ga0070689_1001513353 106
86 3300005340 Ga0070689_100423690 Ga0070689_1004236902 106
87 3300005340 Ga0070689_101285639 Ga0070689_1012856392 106
88 3300005341 Ga0070691_10183806 Ga0070691_101838062 106
89 3300005344 Ga0070661_100000013 Ga0070661_100000013105 106
90 3300005345 Ga0070692_10775184 Ga0070692_107751841 106
91 3300005347 Ga0070668_100280263 Ga0070668_1002802633 106
92 3300005353 Ga0070669_100024733 Ga0070669_1000247333 106
93 3300005354 Ga0070675_100004581 Ga0070675_1000045814 106
94 3300005354 Ga0070675_100515510 Ga0070675_1005155102 106
95 3300005355 Ga0070671_100737060 Ga0070671_1007370602 106
96 3300005355 Ga0070671_101149174 Ga0070671_1011491742 106
97 3300005356 Ga0070674_100019780 Ga0070674_1000197805 106
98 3300005356 Ga0070674_100078297 Ga0070674_1000782973 106
99 3300005356 Ga0070674_100826826 Ga0070674_1008268261 106
100 3300005364 Ga0070673_100284418 Ga0070673_1002844183 106
101 3300005364 Ga0070673_101031899 Ga0070673_1010318992 106
102 3300005365 Ga0070688_100006303 Ga0070688_1000063037 106
103 3300005365 Ga0070688_100487624 Ga0070688_1004876242 106
104 3300005366 Ga0070659_100003967 Ga0070659_1000039678 106
105 3300005366 Ga0070659_100148160 Ga0070659_1001481601 106
106 3300005366 Ga0070659_100393514 Ga0070659_1003935142 106
107 3300005438 Ga0070701_10090013 Ga0070701_100900133 106
108 3300005438 Ga0070701_10753732 Ga0070701_107537322 106
109 3300005440 Ga0070705_100046152 Ga0070705_1000461524 106
110 3300005440 Ga0070705_100781955 Ga0070705_1007819552 106
111 3300005441 Ga0070700_100033148 Ga0070700_1000331484 106
112 3300005441 Ga0070700_100196938 Ga0070700_1001969381 106
113 3300005441 Ga0070700_101361389 Ga0070700_1013613892 106
114 3300005444 Ga0070694_100555456 Ga0070694_1005554562 106
115 3300005444 Ga0070694_100969277 Ga0070694_1009692771 106
116 3300005444 Ga0070694_101083890 Ga0070694_1010838902 106
117 3300005444 Ga0070694_101104676 Ga0070694_1011046761 106
118 3300005445 Ga0070708_101231157 Ga0070708_1012311572 106
119 3300005445 Ga0070708_101876357 Ga0070708_1018763572 106
120 3300005455 Ga0070663_100000006 Ga0070663_1000000066 106
121 3300005455 Ga0070663_100237780 Ga0070663_1002377802 106
122 3300005455 Ga0070663_101395441 Ga0070663_1013954411 106
123 3300005457 Ga0070662_100488787 Ga0070662_1004887872 106
124 3300005458 Ga0070681_10000198 Ga0070681_1000019830 106
125 3300005458 Ga0070681_11068917 Ga0070681_110689172 106
126 3300005459 Ga0068867_100446316 Ga0068867_1004463161 106
127 3300005459 Ga0068867_101027745 Ga0068867_1010277452 106
128 3300005466 Ga0070685_10013293 Ga0070685_100132935 106
129 3300005471 Ga0070698_100219769 Ga0070698_1002197693 106
130 3300005471 Ga0070698_100268912 Ga0070698_1002689122 106
131 3300005471 Ga0070698_102115005 Ga0070698_1021150051 106
132 3300005530 Ga0070679_101201299 Ga0070679_1012012992 106
133 3300005535 Ga0070684_100413301 Ga0070684_1004133013 106
134 3300005543 Ga0070672_100049500 Ga0070672_1000495003 106
135 3300005544 Ga0070686_100203785 Ga0070686_1002037851 106
136 3300005544 Ga0070686_100411785 Ga0070686_1004117852 106
137 3300005544 Ga0070686_100720214 Ga0070686_1007202142 106
138 3300005545 Ga0070695_100298109 Ga0070695_1002981092 106
139 3300005546 Ga0070696_100041783 Ga0070696_1000417835 106
140 3300005546 Ga0070696_100185224 Ga0070696_1001852243 106
141 3300005546 Ga0070696_100521115 Ga0070696_1005211151 106
142 3300005546 Ga0070696_100525610 Ga0070696_1005256103 106
143 3300005546 Ga0070696_100677636 Ga0070696_1006776362 106
144 3300005546 Ga0070696_100766813 Ga0070696_1007668132 106
145 3300005549 Ga0070704_100059341 Ga0070704_1000593412 106
146 3300005549 Ga0070704_100300271 Ga0070704_1003002712 106
147 3300005549 Ga0070704_100618443 Ga0070704_1006184432 106
148 3300005549 Ga0070704_100834099 Ga0070704_1008340991 106
149 3300005563 Ga0068855_100008103 Ga0068855_1000081037 106
150 3300005563 Ga0068855_100483412 Ga0068855_1004834123 106
151 3300005563 Ga0068855_100730200 Ga0068855_1007302003 106
152 3300005564 Ga0070664_100000002 Ga0070664_100000002258 106
153 3300005577 Ga0068857_100071642 Ga0068857_1000716423 106
154 3300005577 Ga0068857_100093939 Ga0068857_1000939393 106
155 3300005578 Ga0068854_100000004 Ga0068854_10000000461 106
156 3300005578 Ga0068854_100713211 Ga0068854_1007132111 106
157 3300005578 Ga0068854_100993615 Ga0068854_1009936152 106
158 3300005614 Ga0068856_100003447 Ga0068856_10000344714 106
159 3300005615 Ga0070702_100110337 Ga0070702_1001103372 106
160 3300005615 Ga0070702_100395406 Ga0070702_1003954061 106
161 3300005615 Ga0070702_100601158 Ga0070702_1006011582 106
162 3300005615 Ga0070702_101081673 Ga0070702_1010816732 106
163 3300005616 Ga0068852_100055664 Ga0068852_1000556644 106
164 3300005616 Ga0068852_101056565 Ga0068852_1010565652 106
165 3300005616 Ga0068852_101648974 Ga0068852_1016489741 106
166 3300005617 Ga0068859_100746798 Ga0068859_1007467981 106
167 3300005617 Ga0068859_101978320 Ga0068859_1019783202 106
168 3300005718 Ga0068866_10321979 Ga0068866_103219792 106
169 3300005718 Ga0068866_11395815 Ga0068866_113958152 106
170 3300005719 Ga0068861_100021205 Ga0068861_1000212051 106
171 3300005834 Ga0068851_10708730 Ga0068851_107087302 106
172 3300005840 Ga0068870_10086996 Ga0068870_100869962 106
173 3300005840 Ga0068870_10205810 Ga0068870_102058103 106
174 3300005842 Ga0068858_100386817 Ga0068858_1003868173 106
175 3300005843 Ga0068860_100844025 Ga0068860_1008440252 106
176 3300005844 Ga0068862_101244952 Ga0068862_1012449522 106
177 3300005981 Ga0081538_10033593 Ga0081538_100335933 106
178 3300006028 Ga0070717_11083081 Ga0070717_110830812 106
179 3300006178 Ga0075367_10108825 Ga0075367_101088253 106
180 3300006195 Ga0075366_10862639 Ga0075366_108626391 106
181 3300006844 Ga0075428_100149716 Ga0075428_1001497163 106
182 3300006844 Ga0075428_102222596 Ga0075428_1022225962 106
183 3300006847 Ga0075431_100739663 Ga0075431_1007396633 106
184 3300006852 Ga0075433_10014942 Ga0075433_1001494211 106
185 3300006852 Ga0075433_10109839 Ga0075433_101098393 106
186 3300006852 Ga0075433_10227719 Ga0075433_102277192 106
187 3300006852 Ga0075433_10415323 Ga0075433_104153232 106
188 3300006852 Ga0075433_11805246 Ga0075433_118052462 106
189 3300006871 Ga0075434_100000073 Ga0075434_10000007332 106
190 3300006871 Ga0075434_100001176 Ga0075434_10000117617 106
191 3300006871 Ga0075434_100019885 Ga0075434_1000198853 106
192 3300006871 Ga0075434_100075855 Ga0075434_1000758555 106
193 3300006871 Ga0075434_100296357 Ga0075434_1002963572 106
194 3300006871 Ga0075434_100955287 Ga0075434_1009552872 106
195 3300006881 Ga0068865_101977635 Ga0068865_1019776351 106
196 3300006914 Ga0075436_100000205 Ga0075436_10000020510 106
197 3300006914 Ga0075436_100000352 Ga0075436_10000035210 106
198 3300006914 Ga0075436_100214012 Ga0075436_1002140122 106
199 3300006914 Ga0075436_100279283 Ga0075436_1002792832 106
200 3300006914 Ga0075436_100752945 Ga0075436_1007529452 106
201 3300006931 Ga0097620_100746780 Ga0097620_1007467801 106
202 3300006931 Ga0097620_101978139 Ga0097620_1019781392 106
203 3300007076 Ga0075435_100000302 Ga0075435_10000030235 106
204 3300007076 Ga0075435_100006291 Ga0075435_1000062912 106
205 3300007076 Ga0075435_101081743 Ga0075435_1010817432 106
206 3300007265 Ga0099794_10668363 Ga0099794_106683631 106
207 3300009011 Ga0105251_10000235 Ga0105251_1000023517 106
208 3300009094 Ga0111539_10050653 Ga0111539_100506534 106
209 3300009098 Ga0105245_10259188 Ga0105245_102591883 106
210 3300009147 Ga0114129_10241625 Ga0114129_102416254 106
211 3300009147 Ga0114129_10344711 Ga0114129_103447112 106
212 3300009147 Ga0114129_10913622 Ga0114129_109136222 106
213 3300009147 Ga0114129_13059416 Ga0114129_130594162 106
214 3300009148 Ga0105243_10090461 Ga0105243_100904612 106
215 3300009174 Ga0105241_10224775 Ga0105241_102247753 106
216 3300009174 Ga0105241_10909822 Ga0105241_109098222 106
217 3300009176 Ga0105242_10603294 Ga0105242_106032942 106
218 3300009176 Ga0105242_12819068 Ga0105242_128190682 106
219 3300009545 Ga0105237_10108140 Ga0105237_101081403 106
220 3300009545 Ga0105237_10174567 Ga0105237_101745672 106
221 3300009545 Ga0105237_12167344 Ga0105237_121673442 106
222 3300009551 Ga0105238_10260771 Ga0105238_102607713 106
223 3300009553 Ga0105249_10061295 Ga0105249_100612953 106
224 3300009553 Ga0105249_10412529 Ga0105249_104125293 106
225 3300010159 Ga0099796_10226747 Ga0099796_102267472 106
226 3300010375 Ga0105239_11374966 Ga0105239_113749662 106
227 3300012506 Ga0157324_1035676 Ga0157324_10356762 106
228 3300013045 Ga0154016_118439 Ga0154016_1184392 106
229 3300013045 Ga0154016_126409 Ga0154016_1264092 106
230 3300013100 Ga0157373_10284059 Ga0157373_102840592 106
231 3300013100 Ga0157373_10977570 Ga0157373_109775701 106
232 3300013102 Ga0157371_10000116 Ga0157371_1000011610 106
233 3300013104 Ga0157370_10000113 Ga0157370_1000011310 106
234 3300013104 Ga0157370_10003535 Ga0157370_100035356 106
235 3300013296 Ga0157374_10070470 Ga0157374_100704703 106
236 3300013297 Ga0157378_12234315 Ga0157378_122343152 106
237 3300013306 Ga0163162_10404034 Ga0163162_104040342 106
238 3300013307 Ga0157372_10000934 Ga0157372_1000093410 106
239 3300013307 Ga0157372_10712663 Ga0157372_107126632 106
240 3300013308 Ga0157375_10284339 Ga0157375_102843393 106
241 3300013308 Ga0157375_11556615 Ga0157375_115566152 106
242 3300014326 Ga0157380_10551560 Ga0157380_105515603 106
243 3300014326 Ga0157380_11204112 Ga0157380_112041122 106
244 3300014497 Ga0182008_10215370 Ga0182008_102153703 106
245 3300014745 Ga0157377_10003991 Ga0157377_100039912 106
246 3300014745 Ga0157377_10303577 Ga0157377_103035772 106
247 3300015261 Ga0182006_1002957 Ga0182006_10029574 106
248 3300015262 Ga0182007_10164852 Ga0182007_101648521 106
249 3300017792 Ga0163161_10111557 Ga0163161_101115572 106
250 3300017792 Ga0163161_10643358 Ga0163161_106433582 106
251 3300019190 Ga0184600_143334 Ga0184600_1433341 106
252 3300019192 Ga0184603_113096 Ga0184603_1130961 106
253 3300020069 Ga0197907_10096748 Ga0197907_100967484 106
254 3300020069 Ga0197907_10461614 Ga0197907_104616142 106
255 3300020069 Ga0197907_11057503 Ga0197907_110575033 106
256 3300020070 Ga0206356_10486280 Ga0206356_104862804 106
257 3300020070 Ga0206356_10513374 Ga0206356_105133743 106
258 3300020070 Ga0206356_10873524 Ga0206356_108735242 106
259 3300020075 Ga0206349_1662652 Ga0206349_16626525 106
260 3300020076 Ga0206355_1023336 Ga0206355_10233364 106
261 3300020076 Ga0206355_1392539 Ga0206355_13925395 106
262 3300020077 Ga0206351_10684938 Ga0206351_106849381 106
263 3300020077 Ga0206351_10916833 Ga0206351_1091683310 106
264 3300020078 Ga0206352_10572019 Ga0206352_105720192 106
265 3300020078 Ga0206352_10729265 Ga0206352_107292652 106
266 3300020078 Ga0206352_10974575 Ga0206352_109745752 106
267 3300020078 Ga0206352_11336802 Ga0206352_113368023 106
268 3300020080 Ga0206350_10211646 Ga0206350_102116463 106
269 3300020080 Ga0206350_11498580 Ga0206350_114985803 106
270 3300020081 Ga0206354_10021521 Ga0206354_100215217 106
271 3300020081 Ga0206354_10880266 Ga0206354_108802663 106
272 3300020082 Ga0206353_11167456 Ga0206353_111674562 106
273 3300020082 Ga0206353_11500459 Ga0206353_115004593 106
274 3300020610 Ga0154015_1067364 Ga0154015_10673643 106
275 3300020610 Ga0154015_1128747 Ga0154015_11287479 106
276 3300021361 Ga0213872_10016326 Ga0213872_100163264 106
277 3300021377 Ga0213874_10327120 Ga0213874_103271201 106
278 3300021384 Ga0213876_10296692 Ga0213876_102966922 106
279 3300022467 Ga0224712_10000044 Ga0224712_1000004413 106
280 3300022467 Ga0224712_10247596 Ga0224712_102475961 106
281 3300023539 Ga0247555_103641 Ga0247555_1036412 106
282 3300023672 Ga0247553_105158 Ga0247553_1051582 106
283 3300025224 Ga0209784_100003 Ga0209784_100003411 106
284 3300025224 Ga0209784_101717 Ga0209784_1017173 106
285 3300025225 Ga0209566_100002 Ga0209566_1000021454 106
286 3300025225 Ga0209566_100561 Ga0209566_10056115 106
287 3300025226 Ga0209674_100008 Ga0209674_100008735 106
288 3300025226 Ga0209674_100122 Ga0209674_10012260 106
289 3300025226 Ga0209674_104864 Ga0209674_1048643 106
290 3300025228 Ga0209672_100191 Ga0209672_10019143 106
291 3300025228 Ga0209672_100262 Ga0209672_10026231 106
292 3300025229 Ga0209147_100002 Ga0209147_1000021833 106
293 3300025230 Ga0209563_100004 Ga0209563_100004867 106
294 3300025230 Ga0209563_114310 Ga0209563_1143103 106
295 3300025242 Ga0209258_100002 Ga0209258_1000021833 106
296 3300025246 Ga0209646_1000022 Ga0209646_1000022176 106
297 3300025250 Ga0209026_1004035 Ga0209026_10040354 106
298 3300025250 Ga0209026_1012816 Ga0209026_10128163 106
299 3300025253 Ga0209677_100013 Ga0209677_100013490 106
300 3300025253 Ga0209677_103383 Ga0209677_1033837 106
301 3300025254 Ga0209148_1000021 Ga0209148_1000021583 106
302 3300025256 Ga0209759_1001746 Ga0209759_10017469 106
303 3300025256 Ga0209759_1009787 Ga0209759_10097873 106
304 3300025256 Ga0209759_1009842 Ga0209759_10098423 106
305 3300025272 Ga0209455_1000021 Ga0209455_1000021420 106
306 3300025273 Ga0209673_1006937 Ga0209673_10069375 106
307 3300025273 Ga0209673_1120883 Ga0209673_11208831 106
308 3300025284 Ga0209130_1001018 Ga0209130_100101810 106
309 3300025291 Ga0209675_1002884 Ga0209675_10028845 106
310 3300025292 Ga0209676_1004231 Ga0209676_10042319 106
311 3300025295 Ga0209564_1000003 Ga0209564_10000031254 106
312 3300025295 Ga0209564_1054880 Ga0209564_10548801 106
313 3300025298 Ga0209050_1042299 Ga0209050_10422992 106
314 3300025302 Ga0207426_1005325 Ga0207426_10053256 106
315 3300025303 Ga0209051_1004959 Ga0209051_10049592 106
316 3300025304 Ga0209257_1017381 Ga0209257_10173813 106
317 3300025315 Ga0207697_10188647 Ga0207697_101886472 106
318 3300025321 Ga0207656_10476970 Ga0207656_104769701 106
319 3300025735 Ga0207713_1003258 Ga0207713_10032586 106
320 3300025893 Ga0207682_10165497 Ga0207682_101654972 106
321 3300025898 Ga0207692_10046539 Ga0207692_100465393 106
322 3300025898 Ga0207692_10268318 Ga0207692_102683182 106
323 3300025899 Ga0207642_10019006 Ga0207642_100190063 106
324 3300025899 Ga0207642_10376384 Ga0207642_103763842 106
325 3300025899 Ga0207642_10870093 Ga0207642_108700932 106
326 3300025901 Ga0207688_10058923 Ga0207688_100589233 106
327 3300025901 Ga0207688_10217995 Ga0207688_102179951 106
328 3300025904 Ga0207647_10096771 Ga0207647_100967712 106
329 3300025906 Ga0207699_10817504 Ga0207699_108175042 106
330 3300025907 Ga0207645_10080293 Ga0207645_100802932 106
331 3300025907 Ga0207645_10149669 Ga0207645_101496691 106
332 3300025907 Ga0207645_10350479 Ga0207645_103504792 106
333 3300025908 Ga0207643_10052674 Ga0207643_100526742 106
334 3300025908 Ga0207643_10296139 Ga0207643_102961392 106
335 3300025909 Ga0207705_10004497 Ga0207705_100044979 106
336 3300025909 Ga0207705_10048443 Ga0207705_100484432 106
337 3300025909 Ga0207705_10102021 Ga0207705_101020213 106
338 3300025910 Ga0207684_11338875 Ga0207684_113388752 106
339 3300025911 Ga0207654_10129305 Ga0207654_101293052 106
340 3300025911 Ga0207654_10262477 Ga0207654_102624772 106
341 3300025911 Ga0207654_10444638 Ga0207654_104446382 106
342 3300025911 Ga0207654_10514987 Ga0207654_105149872 106
343 3300025912 Ga0207707_10003333 Ga0207707_1000333317 106
344 3300025912 Ga0207707_10017964 Ga0207707_100179645 106
345 3300025912 Ga0207707_10352596 Ga0207707_103525963 106
346 3300025912 Ga0207707_10431661 Ga0207707_104316612 106
347 3300025913 Ga0207695_10007787 Ga0207695_100077872 106
348 3300025913 Ga0207695_10167799 Ga0207695_101677992 106
349 3300025913 Ga0207695_11478049 Ga0207695_114780491 106
350 3300025914 Ga0207671_10957107 Ga0207671_109571072 106
351 3300025914 Ga0207671_11416962 Ga0207671_114169622 106
352 3300025915 Ga0207693_10935222 Ga0207693_109352222 106
353 3300025916 Ga0207663_10632400 Ga0207663_106324002 106
354 3300025917 Ga0207660_11295582 Ga0207660_112955821 106
355 3300025917 Ga0207660_11551235 Ga0207660_115512352 106
356 3300025918 Ga0207662_10065469 Ga0207662_100654693 106
357 3300025918 Ga0207662_10074935 Ga0207662_100749353 106
358 3300025918 Ga0207662_11288732 Ga0207662_112887322 106
359 3300025919 Ga0207657_10376439 Ga0207657_103764392 106
360 3300025920 Ga0207649_10000019 Ga0207649_1000001959 106
361 3300025920 Ga0207649_10514318 Ga0207649_105143182 106
362 3300025922 Ga0207646_10904070 Ga0207646_109040702 106
363 3300025923 Ga0207681_10006318 Ga0207681_100063185 106
364 3300025923 Ga0207681_11626813 Ga0207681_116268131 106
365 3300025924 Ga0207694_10024154 Ga0207694_100241543 106
366 3300025924 Ga0207694_10061904 Ga0207694_100619042 106
367 3300025924 Ga0207694_10840093 Ga0207694_108400932 106
368 3300025926 Ga0207659_10117562 Ga0207659_101175623 106
369 3300025927 Ga0207687_10179688 Ga0207687_101796883 106
370 3300025927 Ga0207687_11510270 Ga0207687_115102702 106
371 3300025928 Ga0207700_10000495 Ga0207700_100004959 106
372 3300025928 Ga0207700_10009038 Ga0207700_100090385 106
373 3300025929 Ga0207664_11280642 Ga0207664_112806422 106
374 3300025931 Ga0207644_10598831 Ga0207644_105988312 106
375 3300025931 Ga0207644_10878043 Ga0207644_108780432 106
376 3300025931 Ga0207644_11664126 Ga0207644_116641262 106
377 3300025932 Ga0207690_10004220 Ga0207690_100042205 106
378 3300025932 Ga0207690_10083643 Ga0207690_100836432 106
379 3300025932 Ga0207690_10092771 Ga0207690_100927711 106
380 3300025932 Ga0207690_10414985 Ga0207690_104149851 106
381 3300025932 Ga0207690_11063113 Ga0207690_110631132 106
382 3300025933 Ga0207706_10818677 Ga0207706_108186772 106
383 3300025933 Ga0207706_10926708 Ga0207706_109267082 106
384 3300025934 Ga0207686_10017691 Ga0207686_100176914 106
385 3300025934 Ga0207686_10341938 Ga0207686_103419382 106
386 3300025934 Ga0207686_10653498 Ga0207686_106534982 106
387 3300025934 Ga0207686_10975756 Ga0207686_109757562 106
388 3300025934 Ga0207686_11642537 Ga0207686_116425371 106
389 3300025935 Ga0207709_10304272 Ga0207709_103042721 106
390 3300025935 Ga0207709_10513108 Ga0207709_105131082 106
391 3300025935 Ga0207709_10732430 Ga0207709_107324302 106
392 3300025936 Ga0207670_10016847 Ga0207670_100168471 106
393 3300025936 Ga0207670_10095265 Ga0207670_100952652 106
394 3300025936 Ga0207670_10162231 Ga0207670_101622313 106
395 3300025936 Ga0207670_10319587 Ga0207670_103195871 106
396 3300025936 Ga0207670_10500308 Ga0207670_105003082 106
397 3300025936 Ga0207670_11183547 Ga0207670_111835472 106
398 3300025936 Ga0207670_11314179 Ga0207670_113141792 106
399 3300025936 Ga0207670_11387470 Ga0207670_113874702 106
400 3300025937 Ga0207669_10003349 Ga0207669_100033495 106
401 3300025937 Ga0207669_10067218 Ga0207669_100672182 106
402 3300025937 Ga0207669_10215681 Ga0207669_102156812 106
403 3300025937 Ga0207669_10589111 Ga0207669_105891112 106
404 3300025937 Ga0207669_11926550 Ga0207669_119265501 106
405 3300025938 Ga0207704_10186636 Ga0207704_101866363 106
406 3300025938 Ga0207704_10419248 Ga0207704_104192483 106
407 3300025938 Ga0207704_10702915 Ga0207704_107029151 106
408 3300025938 Ga0207704_11369597 Ga0207704_113695972 106
409 3300025940 Ga0207691_10009168 Ga0207691_100091689 106
410 3300025940 Ga0207691_10048698 Ga0207691_100486981 106
411 3300025940 Ga0207691_10066699 Ga0207691_100666993 106
412 3300025940 Ga0207691_10089068 Ga0207691_100890683 106
413 3300025941 Ga0207711_10177084 Ga0207711_101770842 106
414 3300025942 Ga0207689_10146813 Ga0207689_101468133 106
415 3300025942 Ga0207689_10348701 Ga0207689_103487012 106
416 3300025945 Ga0207679_10000001 Ga0207679_10000001428 106
417 3300025949 Ga0207667_10000448 Ga0207667_1000044832 106
418 3300025949 Ga0207667_10033006 Ga0207667_100330065 106
419 3300025960 Ga0207651_10090054 Ga0207651_100900542 106
420 3300025960 Ga0207651_10874916 Ga0207651_108749162 106
421 3300025960 Ga0207651_11656330 Ga0207651_116563301 106
422 3300025961 Ga0207712_10048652 Ga0207712_100486524 106
423 3300025961 Ga0207712_10311319 Ga0207712_103113192 106
424 3300025972 Ga0207668_10070816 Ga0207668_100708163 106
425 3300025981 Ga0207640_10000524 Ga0207640_1000052420 106
426 3300025986 Ga0207658_10127539 Ga0207658_101275393 106
427 3300026023 Ga0207677_11385106 Ga0207677_113851061 106
428 3300026035 Ga0207703_10060947 Ga0207703_100609474 106
429 3300026035 Ga0207703_10398177 Ga0207703_103981772 106
430 3300026041 Ga0207639_10009210 Ga0207639_100092103 106
431 3300026041 Ga0207639_10077667 Ga0207639_100776672 106
432 3300026067 Ga0207678_10000001 Ga0207678_100000016 106
433 3300026067 Ga0207678_10270872 Ga0207678_102708722 106
434 3300026067 Ga0207678_10799333 Ga0207678_107993332 106
435 3300026067 Ga0207678_11299199 Ga0207678_112991992 106
436 3300026075 Ga0207708_10109603 Ga0207708_101096034 106
437 3300026075 Ga0207708_10135070 Ga0207708_101350703 106
438 3300026075 Ga0207708_10558744 Ga0207708_105587442 106
439 3300026075 Ga0207708_10730771 Ga0207708_107307712 106
440 3300026075 Ga0207708_11107100 Ga0207708_111071002 106
441 3300026075 Ga0207708_11705663 Ga0207708_117056631 106
442 3300026075 Ga0207708_11994386 Ga0207708_119943861 106
443 3300026078 Ga0207702_10000009 Ga0207702_10000009222 106
444 3300026078 Ga0207702_10352718 Ga0207702_103527181 106
445 3300026078 Ga0207702_11596169 Ga0207702_115961692 106
446 3300026078 Ga0207702_12044860 Ga0207702_120448601 106
447 3300026089 Ga0207648_10002987 Ga0207648_100029873 106
448 3300026089 Ga0207648_10023686 Ga0207648_100236863 106
449 3300026089 Ga0207648_10329467 Ga0207648_103294673 106
450 3300026089 Ga0207648_10628130 Ga0207648_106281301 106
451 3300026089 Ga0207648_11992140 Ga0207648_119921401 106
452 3300026095 Ga0207676_10226347 Ga0207676_102263473 106
453 3300026116 Ga0207674_10045617 Ga0207674_100456173 106
454 3300026116 Ga0207674_10054589 Ga0207674_100545892 106
455 3300026118 Ga0207675_100000651 Ga0207675_10000065110 106
456 3300026118 Ga0207675_100750097 Ga0207675_1007500972 106
457 3300026118 Ga0207675_101326854 Ga0207675_1013268541 106
458 3300026118 Ga0207675_102621661 Ga0207675_1026216612 106
459 3300026121 Ga0207683_10429447 Ga0207683_104294472 106
460 3300026121 Ga0207683_11554482 Ga0207683_115544822 106
461 3300026121 Ga0207683_12135017 Ga0207683_121350171 106
462 3300026142 Ga0207698_10009939 Ga0207698_100099392 106
463 3300026142 Ga0207698_10011610 Ga0207698_100116103 106
464 3300026142 Ga0207698_10047010 Ga0207698_100470103 106
465 3300027252 Ga0209973_1067432 Ga0209973_10674322 106
466 3300027360 Ga0209969_1045956 Ga0209969_10459562 106
467 3300027364 Ga0209967_1057407 Ga0209967_10574072 106
468 3300027378 Ga0209981_1026343 Ga0209981_10263431 106
469 3300027395 Ga0209996_1010049 Ga0209996_10100492 106
470 3300027462 Ga0210000_1006410 Ga0210000_10064103 106
471 3300027543 Ga0209999_1014606 Ga0209999_10146062 106
472 3300027543 Ga0209999_1113214 Ga0209999_11132142 106
473 3300027695 Ga0209966_1013884 Ga0209966_10138842 106
474 3300027866 Ga0209813_10228650 Ga0209813_102286502 106
475 3300027876 Ga0209974_10007790 Ga0209974_100077904 106
476 3300027876 Ga0209974_10261786 Ga0209974_102617862 106
477 3300027907 Ga0207428_10010038 Ga0207428_100100388 106
478 3300027907 Ga0207428_10019374 Ga0207428_100193742 106
479 3300028379 Ga0268266_10621820 Ga0268266_106218201 106
480 3300028380 Ga0268265_10000781 Ga0268265_1000078125 106
481 3300028381 Ga0268264_10890793 Ga0268264_108907932 106
482 3300028381 Ga0268264_11272816 Ga0268264_112728162 106
483 3300028786 Ga0307517_10090243 Ga0307517_100902433 106
484 3300028794 Ga0307515_10005265 Ga0307515_100052657 106
485 3300028800 Ga0265338_10000437 Ga0265338_1000043727 106
486 3300028800 Ga0265338_10345137 Ga0265338_103451372 106
487 3300028800 Ga0265338_10546694 Ga0265338_105466942 106
488 3300030762 Ga0265775_103433 Ga0265775_1034331 106
489 3300030877 Ga0265777_120507 Ga0265777_1205072 106
490 3300031247 Ga0265340_10113759 Ga0265340_101137593 106
491 3300031249 Ga0265339_10070299 Ga0265339_100702991 106
492 3300031251 Ga0265327_10108566 Ga0265327_101085662 106
493 3300031507 Ga0307509_10313403 Ga0307509_103134032 106
494 3300031548 Ga0307408_100000045 Ga0307408_10000004561 106
495 3300031548 Ga0307408_100120473 Ga0307408_1001204733 106
496 3300031548 Ga0307408_100630004 Ga0307408_1006300042 106
497 3300031548 Ga0307408_101427371 Ga0307408_1014273712 106
498 3300031548 Ga0307408_101599402 Ga0307408_1015994021 106
499 3300031616 Ga0307508_10088170 Ga0307508_100881702 106
500 3300031665 Ga0316575_10006460 Ga0316575_100064605 106
501 3300031665 Ga0316575_10190708 Ga0316575_101907082 106
502 3300031691 Ga0316579_10203284 Ga0316579_102032842 106
503 3300031727 Ga0316576_10002247 Ga0316576_1000224712 106
504 3300031727 Ga0316576_10093005 Ga0316576_100930053 106
505 3300031728 Ga0316578_10007566 Ga0316578_100075665 106
506 3300031728 Ga0316578_10011211 Ga0316578_100112113 106
507 3300031730 Ga0307516_10000497 Ga0307516_1000049754 106
508 3300031731 Ga0307405_10278881 Ga0307405_102788813 106
509 3300031731 Ga0307405_10554047 Ga0307405_105540472 106
510 3300031731 Ga0307405_10691956 Ga0307405_106919561 106
511 3300031733 Ga0316577_10355600 Ga0316577_103556003 106
512 3300031733 Ga0316577_10864253 Ga0316577_108642532 106
513 3300031852 Ga0307410_11217328 Ga0307410_112173281 106
514 3300031852 Ga0307410_11792653 Ga0307410_117926531 106
515 3300031901 Ga0307406_10393856 Ga0307406_103938562 106
516 3300031903 Ga0307407_10240309 Ga0307407_102403092 106
517 3300031903 Ga0307407_10308579 Ga0307407_103085793 106
518 3300031903 Ga0307407_11357904 Ga0307407_113579041 106
519 3300031903 Ga0307407_11507949 Ga0307407_115079492 106
520 3300031911 Ga0307412_10857053 Ga0307412_108570532 106
521 3300031911 Ga0307412_11450827 Ga0307412_114508271 106
522 3300031911 Ga0307412_11988103 Ga0307412_119881031 106
523 3300031995 Ga0307409_101229868 Ga0307409_1012298682 106
524 3300032002 Ga0307416_100110795 Ga0307416_1001107953 106
525 3300032002 Ga0307416_100285191 Ga0307416_1002851913 106
526 3300032002 Ga0307416_100438841 Ga0307416_1004388412 106
527 3300032002 Ga0307416_100901108 Ga0307416_1009011082 106
528 3300032002 Ga0307416_101752088 Ga0307416_1017520882 106
529 3300032002 Ga0307416_102269369 Ga0307416_1022693692 106
530 3300032002 Ga0307416_103573097 Ga0307416_1035730971 106
531 3300032004 Ga0307414_11105717 Ga0307414_111057172 106
532 3300032005 Ga0307411_10388379 Ga0307411_103883792 106
533 3300032005 Ga0307411_10497003 Ga0307411_104970031 106
534 3300032005 Ga0307411_12320205 Ga0307411_123202052 106
535 3300032126 Ga0307415_102196916 Ga0307415_1021969162 106
536 3300032137 Ga0316585_10091901 Ga0316585_100919012 106
537 3300032139 Ga0316580_10011155 Ga0316580_100111553 106
538 3300032168 Ga0316593_10003965 Ga0316593_100039654 106
539 3300032168 Ga0316593_10089441 Ga0316593_100894411 106
540 3300033179 Ga0307507_10019824 Ga0307507_100198246 106
541 3300033524 Ga0316592_1134577 Ga0316592_11345772 106
542 3300033527 Ga0316586_1103683 Ga0316586_11036832 106
543 3300033528 Ga0316588_1097460 Ga0316588_10974602 106
544 3300033528 Ga0316588_1123078 Ga0316588_11230782 106
545 3300033529 Ga0316587_1002090 Ga0316587_10020902 106
546 3300033529 Ga0316587_1011610 Ga0316587_10116102 106
547 3300033529 Ga0316587_1019366 Ga0316587_10193661 106
548 3300033541 Ga0316596_1034527 Ga0316596_10345272 106
549 3300035084 Ga0373928_0191453 Ga0373928_0191453_44_367 106
550 3300035084 Ga0373928_0228638 Ga0373928_0228638_213_536 106
551 3300035086 Ga0373934_0145630 Ga0373934_0145630_327_647 106
552 3300035092 Ga0373952_0159408 Ga0373952_0159408_36_362 106
553 3300035111 Ga0373923_0031333 Ga0373923_0031333_651_974 106
554 3300035111 Ga0373923_0382017 Ga0373923_0382017_230_550 106
555 3300035112 Ga0373932_0126165 Ga0373932_0126165_173_496 106
556 3300035114 Ga0373939_0030774 Ga0373939_0030774_1023_1346 106
557 3300035115 Ga0373941_0413071 Ga0373941_0413071_68_394 106
558 3300035119 Ga0373956_0000024 Ga0373956_0000024_21624_21944 106
559 3300035119 Ga0373956_0203203 Ga0373956_0203203_62_385 106
560 3300035119 Ga0373956_0518955 Ga0373956_0518955_182_502 106
561 3300035120 Ga0373957_0205695 Ga0373957_0205695_209_532 106
562 3300035172 Ga0373955_0046538 Ga0373955_0046538_439_762 106
563 3300035172 Ga0373955_0139157 Ga0373955_0139157_165_485 106
564 3300035242 Ga0373962_0148338 Ga0373962_0148338_364_690 106
565 3300035398 Ga0316574_0001833 Ga0316574_0001833_9370_9693 106
566 3300035398 Ga0316574_0005586 Ga0316574_0005586_4932_5255 106
567 3300035398 Ga0316574_0052189 Ga0316574_0052189_1232_1555 106
568 3300035398 Ga0316574_0357223 Ga0316574_0357223_303_626 106
569 3300035398 Ga0316574_0504742 Ga0316574_0504742_168_491 106
570 3300035410 Ga0373924_0045660 Ga0373924_0045660_899_1222 106
571 3300035691 Ga0373931_0091770 Ga0373931_0091770_1271_1594 106
572 3300035691 Ga0373931_0314507 Ga0373931_0314507_127_450 106
573 3300035691 Ga0373931_0372930 Ga0373931_0372930_98_421 106
574 3300035691 Ga0373931_1108584 Ga0373931_1108584_29_352 106
575 3300035695 Ga0373927_0042117 Ga0373927_0042117_500_823 106
576 3300035724 Ga0373933_0001797 Ga0373933_0001797_5940_6260 106
577 3300035724 Ga0373933_0002861 Ga0373933_0002861_581_904 106
578 3300035724 Ga0373933_0081365 Ga0373933_0081365_629_952 106
579 3300035725 Ga0373947_0310657 Ga0373947_0310657_386_709 106
580 3300036401 Ga0373937_0008435 Ga0373937_0008435_70_390 106
581 3300036401 Ga0373937_0250628 Ga0373937_0250628_993_1313 106
582 3300036401 Ga0373937_0419245 Ga0373937_0419245_407_730 106
583 3300036401 Ga0373937_0877475 Ga0373937_0877475_379_702 106
584 3300036647 Ga0316582_0006883 Ga0316582_0006883_763_1086 106
585 3300036647 Ga0316582_0021935 Ga0316582_0021935_1091_1414 106
586 3300036712 Ga0316584_0074316 Ga0316584_0074316_1466_1789 106
587 3300037068 Ga0373925_0023592 Ga0373925_0023592_1775_2098 106
588 3300037312 Ga0395899_0004578 Ga0395899_0004578_1462_1785 106
589 3300037312 Ga0395899_0182624 Ga0395899_0182624_463_783 106
590 3300037418 Ga0395900_0011866 Ga0395900_0011866_7293_7613 106
591 3300037418 Ga0395900_1535479 Ga0395900_1535479_248_568 106
592 3300037466 Ga0395898_0106330 Ga0395898_0106330_808_1131 106
593 3300037471 Ga0395905_0041433 Ga0395905_0041433_1992_2315 106
594 3300037471 Ga0395905_0070324 Ga0395905_0070324_2439_2762 106
595 3300038443 Ga0395901_0000067 Ga0395901_0000067_51975_52298 106
596 3300038443 Ga0395901_0000133 Ga0395901_0000133_31082_31405 106
597 3300038443 Ga0395901_0040588 Ga0395901_0040588_3749_4072 106
598 3300038741 Ga0400488_61282 Ga0400488_61282_844_1167 106
599 3300039062 Ga0400483_089547 Ga0400483_089547_40_363 106
600 3300039062 Ga0400483_232620 Ga0400483_232620_1455_1778 106
601 3300039437 Ga0436365_1415897 Ga0436365_1415897_178_501 106
602 3300039438 Ga0436360_0397467 Ga0436360_0397467_117_440 106
603 3300039447 Ga0436361_0175365 Ga0436361_0175365_2424_2747 106
604 3300039447 Ga0436361_0445788 Ga0436361_0445788_1462_1785 106
605 3300039447 Ga0436361_0519408 Ga0436361_0519408_217_540 106
606 3300039450 Ga0436363_1636299 Ga0436363_1636299_41_364 106
607 3300041408 Ga0439453_0019803 Ga0439453_0019803_486_812 106
608 3300041441 Ga0451787_551626 Ga0451787_551626_171_494 106
609 3300041451 Ga0451791_1922986 Ga0451791_1922986_437_760 106
610 3300041452 Ga0451793_1901220 Ga0451793_1901220_114_437 106
611 3300041459 Ga0451800_1202501 Ga0451800_1202501_726_1049 106
612 3300041460 Ga0451802_0617498 Ga0451802_0617498_437_760 106
613 3300041461 Ga0451805_043617 Ga0451805_043617_168_491 106
614 3300041486 Ga0451807_0798448 Ga0451807_0798448_142_465 106
615 3300041486 Ga0451807_1988912 Ga0451807_1988912_841_1164 106
616 3300041486 Ga0451807_2587691 Ga0451807_2587691_51_371 106
617 3300041492 Ga0451835_0942726 Ga0451835_0942726_15_338 106
618 3300041494 Ga0451837_0972705 Ga0451837_0972705_153_476 106
619 3300041505 Ga0451849_0100067 Ga0451849_0100067_333_653 106
620 3300041505 Ga0451849_0963451 Ga0451849_0963451_220_543 106
621 3300041512 Ga0451853_2875636 Ga0451853_2875636_92_415 106
622 3300042001 Ga0439441_001465 Ga0439441_001465_2632_2958 106
623 3300042001 Ga0439441_075255 Ga0439441_075255_207_530 106
624 3300042001 Ga0439441_140780 Ga0439441_140780_72_395 106
625 3300042001 Ga0439441_157897 Ga0439441_157897_95_415 106
626 3300042006 Ga0439432_069865 Ga0439432_069865_273_596 106
627 3300042116 Ga0450912_017126 Ga0450912_017126_159_485 106
628 3300042134 Ga0450898_087457 Ga0450898_087457_267_590 106
629 3300042156 Ga0439446_0078567 Ga0439446_0078567_645_971 106
630 3300042156 Ga0439446_0372046 Ga0439446_0372046_51_377 106
631 3300042436 Ga0439435_0002787 Ga0439435_0002787_2545_2871 106
632 3300042436 Ga0439435_0003953 Ga0439435_0003953_1095_1421 106
633 3300042437 Ga0439444_0119056 Ga0439444_0119056_135_461 106
634 3300042439 Ga0439464_0013042 Ga0439464_0013042_952_1275 106
635 3300042461 Ga0439460_0002676 Ga0439460_0002676_659_985 106
636 3300042461 Ga0439460_0002980 Ga0439460_0002980_2303_2629 106
637 3300042530 Ga0450916_097199 Ga0450916_097199_63_389 106
638 3300042532 Ga0450893_0056963 Ga0450893_0056963_295_621 106
639 3300042533 Ga0450901_004179 Ga0450901_004179_1121_1444 106
640 3300042876 Ga0451577_0000743 Ga0451577_0000743_43847_44170 106
641 3300042876 Ga0451577_0130736 Ga0451577_0130736_168_491 106
642 3300042876 Ga0451577_0264911 Ga0451577_0264911_1045_1368 106
643 3300042876 Ga0451577_0450751 Ga0451577_0450751_798_1121 106
644 3300042876 Ga0451577_0590509 Ga0451577_0590509_670_993 106
645 3300042876 Ga0451577_0760264 Ga0451577_0760264_177_500 106
646 3300042876 Ga0451577_0794399 Ga0451577_0794399_22_345 106
647 3300044656 Ga0466969_0035504 Ga0466969_0035504_692_1015 106
648 3300044656 Ga0466969_0083388 Ga0466969_0083388_1068_1391 106
649 3300044656 Ga0466969_0125530 Ga0466969_0125530_781_1104 106
650 3300044683 Ga0466965_0018466 Ga0466965_0018466_2694_3017 106
651 3300044684 Ga0466966_0000067 Ga0466966_0000067_65121_65444 106
652 3300044684 Ga0466966_0032486 Ga0466966_0032486_2178_2501 106
653 3300044684 Ga0466966_0038100 Ga0466966_0038100_1784_2107 106
654 3300044684 Ga0466966_0717331 Ga0466966_0717331_36_359 106
655 3300044684 Ga0466966_0849720 Ga0466966_0849720_10_333 106
656 3300044693 Ga0466961_0000526 Ga0466961_0000526_21583_21906 106
657 3300044693 Ga0466961_0004076 Ga0466961_0004076_3369_3692 106
658 3300044693 Ga0466961_0019938 Ga0466961_0019938_288_611 106
659 3300044693 Ga0466961_0054694 Ga0466961_0054694_1758_2081 106
660 3300044694 Ga0466963_0053430 Ga0466963_0053430_244_567 106
661 3300044694 Ga0466963_0056541 Ga0466963_0056541_1502_1825 106
662 3300044706 Ga0466964_0040415 Ga0466964_0040415_1106_1429 106
663 3300044706 Ga0466964_0568719 Ga0466964_0568719_274_597 106
664 3300044706 Ga0466964_0834294 Ga0466964_0834294_100_423 106
665 3300044712 Ga0453684_0002107 Ga0453684_0002107_43865_44188 106
666 3300044712 Ga0453684_0002541 Ga0453684_0002541_20169_20489 106
667 3300044712 Ga0453684_2135829 Ga0453684_2135829_220_543 106
668 3300044719 Ga0466971_0001855 Ga0466971_0001855_2502_2825 106
669 3300044735 Ga0466968_0054594 Ga0466968_0054594_460_783 106
670 3300044735 Ga0466968_0207575 Ga0466968_0207575_396_719 106
671 3300044765 Ga0466970_0007036 Ga0466970_0007036_840_1163 106
672 3300044765 Ga0466970_0193481 Ga0466970_0193481_514_837 106
673 3300044765 Ga0466970_0373307 Ga0466970_0373307_173_496 106
674 3300044842 Ga0466957_0022761 Ga0466957_0022761_1514_1837 106
675 3300044842 Ga0466957_0050029 Ga0466957_0050029_2086_2409 106
676 3300044842 Ga0466957_0191677 Ga0466957_0191677_488_811 106
677 3300045049 Ga0466959_0003982 Ga0466959_0003982_9276_9599 106
678 3300045049 Ga0466959_0017713 Ga0466959_0017713_3020_3343 106
679 3300045049 Ga0466959_0667145 Ga0466959_0667145_143_466 106
680 3300045051 Ga0451576_0004451 Ga0451576_0004451_13764_14087 106
681 3300045051 Ga0451576_0017229 Ga0451576_0017229_7448_7768 106
682 3300045051 Ga0451576_0045166 Ga0451576_0045166_348_671 106
683 3300045051 Ga0451576_1646353 Ga0451576_1646353_198_521 106
684 3300045836 Ga0466958_0004016 Ga0466958_0004016_3671_3994 106
685 3300045836 Ga0466958_0041673 Ga0466958_0041673_1368_1691 106
686 3300045836 Ga0466958_0373082 Ga0466958_0373082_130_453 106
687 3300045976 Ga0466967_0281748 Ga0466967_0281748_321_644 106
688 3300045976 Ga0466967_0895544 Ga0466967_0895544_374_697 106
689 3300045976 Ga0466967_0955052 Ga0466967_0955052_303_626 106
690 3300046454 Ga0495592_0001313 Ga0495592_0001313_10937_11260 106
691 3300046454 Ga0495592_0001592 Ga0495592_0001592_3648_3968 106
692 3300046454 Ga0495592_0479801 Ga0495592_0479801_362_685 106
693 3300046455 Ga0495603_0011812 Ga0495603_0011812_3006_3329 106
694 3300046455 Ga0495603_0040511 Ga0495603_0040511_2410_2733 106
695 3300046455 Ga0495603_0696925 Ga0495603_0696925_21_344 106
696 3300046457 Ga0495590_0014064 Ga0495590_0014064_750_1073 106
697 3300046457 Ga0495590_0355523 Ga0495590_0355523_36_359 106
698 3300046458 Ga0495591_005751 Ga0495591_005751_5023_5346 106
699 3300046458 Ga0495591_092749 Ga0495591_092749_105_428 106
700 3300046459 Ga0495629_0001354 Ga0495629_0001354_16367_16690 106
701 3300046459 Ga0495629_0008262 Ga0495629_0008262_6211_6534 106
702 3300046459 Ga0495629_0090926 Ga0495629_0090926_387_710 106
703 3300046459 Ga0495629_0426703 Ga0495629_0426703_299_619 106
704 3300046461 Ga0495641_0030091 Ga0495641_0030091_1004_1327 106
705 3300046462 Ga0495651_0001164 Ga0495651_0001164_13357_13677 106
706 3300046462 Ga0495651_0003321 Ga0495651_0003321_9088_9411 106
707 3300046462 Ga0495651_0032641 Ga0495651_0032641_1792_2115 106
708 3300046462 Ga0495651_0313471 Ga0495651_0313471_666_989 106
709 3300046463 Ga0495653_0001712 Ga0495653_0001712_5110_5433 106
710 3300046463 Ga0495653_0055383 Ga0495653_0055383_271_594 106
711 3300046463 Ga0495653_0417694 Ga0495653_0417694_220_540 106
712 3300046471 Ga0495650_0005992 Ga0495650_0005992_7146_7469 106
713 3300046471 Ga0495650_0039110 Ga0495650_0039110_490_813 106
714 3300046472 Ga0495580_0002474 Ga0495580_0002474_233_556 106
715 3300046472 Ga0495580_0025511 Ga0495580_0025511_1160_1483 106
716 3300046472 Ga0495580_0099531 Ga0495580_0099531_253_576 106
717 3300046472 Ga0495580_0107541 Ga0495580_0107541_477_815 106
718 3300046472 Ga0495580_0118557 Ga0495580_0118557_1200_1523 106
719 3300046472 Ga0495580_0291872 Ga0495580_0291872_469_792 106
720 3300046473 Ga0495582_0017320 Ga0495582_0017320_2597_2920 106
721 3300046473 Ga0495582_0131448 Ga0495582_0131448_103_426 106
722 3300046473 Ga0495582_0233271 Ga0495582_0233271_60_380 106
723 3300046475 Ga0495639_0273857 Ga0495639_0273857_348_668 106
724 3300046476 Ga0495662_0039184 Ga0495662_0039184_1337_1657 106
725 3300046476 Ga0495662_0041092 Ga0495662_0041092_730_1053 106
726 3300046476 Ga0495662_0068173 Ga0495662_0068173_1293_1616 106
727 3300046476 Ga0495662_0125752 Ga0495662_0125752_444_764 106
728 3300046477 Ga0495664_0003770 Ga0495664_0003770_6394_6717 106
729 3300046477 Ga0495664_0275698 Ga0495664_0275698_358_681 106
730 3300046491 Ga0495584_0147566 Ga0495584_0147566_343_666 106
731 3300046500 Ga0495596_0032260 Ga0495596_0032260_851_1174 106
732 3300046500 Ga0495596_0169647 Ga0495596_0169647_395_718 106
733 3300046500 Ga0495596_0266694 Ga0495596_0266694_86_409 106
734 3300046507 Ga0495606_0080138 Ga0495606_0080138_1424_1747 106
735 3300046507 Ga0495606_0251040 Ga0495606_0251040_10_333 106
736 3300046511 Ga0495608_0003166 Ga0495608_0003166_1867_2190 106
737 3300046511 Ga0495608_0007794 Ga0495608_0007794_644_964 106
738 3300046511 Ga0495608_0117916 Ga0495608_0117916_584_907 106
739 3300046511 Ga0495608_0567513 Ga0495608_0567513_239_559 106
740 3300046511 Ga0495608_0616736 Ga0495608_0616736_49_369 106
741 3300046514 Ga0495618_0024676 Ga0495618_0024676_2422_2745 106
742 3300046514 Ga0495618_0053484 Ga0495618_0053484_535_855 106
743 3300046514 Ga0495618_0137124 Ga0495618_0137124_971_1294 106
744 3300046515 Ga0495620_0036525 Ga0495620_0036525_671_994 106
745 3300046515 Ga0495620_0425052 Ga0495620_0425052_72_398 106
746 3300046516 Ga0495628_0003126 Ga0495628_0003126_382_702 106
747 3300046516 Ga0495628_0011513 Ga0495628_0011513_5111_5434 106
748 3300046516 Ga0495628_0088456 Ga0495628_0088456_1924_2244 106
749 3300046516 Ga0495628_0121134 Ga0495628_0121134_1062_1385 106
750 3300046516 Ga0495628_1073780 Ga0495628_1073780_86_409 106
751 3300046517 Ga0495630_0054008 Ga0495630_0054008_2423_2743 106
752 3300046517 Ga0495630_0079050 Ga0495630_0079050_355_678 106
753 3300046517 Ga0495630_0312817 Ga0495630_0312817_244_567 106
754 3300046517 Ga0495630_0392172 Ga0495630_0392172_661_984 106
755 3300046517 Ga0495630_0747523 Ga0495630_0747523_329_652 106
756 3300046517 Ga0495630_0989092 Ga0495630_0989092_75_395 106
757 3300046523 Ga0495644_0281566 Ga0495644_0281566_209_535 106
758 3300046524 Ga0495648_0089258 Ga0495648_0089258_1116_1439 106
759 3300046524 Ga0495648_0116974 Ga0495648_0116974_271_594 106
760 3300046525 Ga0495663_0099363 Ga0495663_0099363_17_343 106
761 3300046526 Ga0495666_0004045 Ga0495666_0004045_6038_6361 106
762 3300046526 Ga0495666_0048114 Ga0495666_0048114_458_781 106
763 3300046526 Ga0495666_0064344 Ga0495666_0064344_1157_1480 106
764 3300046526 Ga0495666_0126969 Ga0495666_0126969_369_689 106
765 3300046528 Ga0495642_0023552 Ga0495642_0023552_289_609 106
766 3300046528 Ga0495642_0171034 Ga0495642_0171034_297_620 106
767 3300046528 Ga0495642_0294950 Ga0495642_0294950_233_559 106
768 3300046529 Ga0495652_0034252 Ga0495652_0034252_4027_4350 106
769 3300046529 Ga0495652_0106642 Ga0495652_0106642_154_474 106
770 3300046529 Ga0495652_0168866 Ga0495652_0168866_233_556 106
771 3300046529 Ga0495652_0308545 Ga0495652_0308545_71_394 106
772 3300046529 Ga0495652_0311665 Ga0495652_0311665_585_908 106
773 3300046530 Ga0495654_0096746 Ga0495654_0096746_821_1144 106
774 3300046531 Ga0495665_0005305 Ga0495665_0005305_2718_3041 106
775 3300046531 Ga0495665_0009459 Ga0495665_0009459_470_793 106
776 3300046531 Ga0495665_0280870 Ga0495665_0280870_140_463 106
777 3300046533 Ga0495640_0009959 Ga0495640_0009959_6482_6802 106
778 3300046533 Ga0495640_0051399 Ga0495640_0051399_270_593 106
779 3300046533 Ga0495640_0072910 Ga0495640_0072910_749_1072 106
780 3300046535 Ga0495586_0001580 Ga0495586_0001580_11095_11418 106
781 3300046535 Ga0495586_0049093 Ga0495586_0049093_1588_1908 106
782 3300046535 Ga0495586_0177410 Ga0495586_0177410_230_553 106
783 3300046535 Ga0495586_0286902 Ga0495586_0286902_52_372 106
784 3300046535 Ga0495586_0449764 Ga0495586_0449764_400_723 106
785 3300046536 Ga0495587_0000845 Ga0495587_0000845_14435_14758 106
786 3300046536 Ga0495587_0029444 Ga0495587_0029444_390_713 106
787 3300046536 Ga0495587_0054506 Ga0495587_0054506_1438_1758 106
788 3300046537 Ga0495598_0141111 Ga0495598_0141111_116_436 106
789 3300046537 Ga0495598_0326362 Ga0495598_0326362_145_471 106
790 3300046537 Ga0495598_0373275 Ga0495598_0373275_37_360 106
791 3300046538 Ga0495609_0218860 Ga0495609_0218860_116_442 106
792 3300046539 Ga0495621_0019326 Ga0495621_0019326_1469_1792 106
793 3300046539 Ga0495621_0108380 Ga0495621_0108380_358_684 106
794 3300046539 Ga0495621_0258489 Ga0495621_0258489_236_556 106
795 3300046542 Ga0495597_0010631 Ga0495597_0010631_455_778 106
796 3300046543 Ga0495645_0017147 Ga0495645_0017147_4516_4839 106
797 3300046543 Ga0495645_0065743 Ga0495645_0065743_323_646 106
798 3300046543 Ga0495645_0217268 Ga0495645_0217268_306_629 106
799 3300046559 Ga0495667_0049285 Ga0495667_0049285_1357_1677 106
800 3300046559 Ga0495667_0125134 Ga0495667_0125134_1236_1559 106
801 3300046642 Ga0495634_0005222 Ga0495634_0005222_6358_6681 106
802 3300046642 Ga0495634_0014642 Ga0495634_0014642_5008_5331 106
803 3300046642 Ga0495634_0020851 Ga0495634_0020851_282_602 106
804 3300046642 Ga0495634_0371027 Ga0495634_0371027_24_347 106
805 3300046663 Ga0495635_0068023 Ga0495635_0068023_1534_1854 106
806 3300046663 Ga0495635_0148225 Ga0495635_0148225_302_625 106
807 3300046663 Ga0495635_0158203 Ga0495635_0158203_241_564 106
808 3300046663 Ga0495635_0345506 Ga0495635_0345506_542_862 106
809 3300046663 Ga0495635_0611025 Ga0495635_0611025_358_681 106
810 3300046665 Ga0495661_0005549 Ga0495661_0005549_1804_2127 106
811 3300046665 Ga0495661_0017977 Ga0495661_0017977_179_502 106
812 3300046674 Ga0495588_0285746 Ga0495588_0285746_210_533 106
813 3300046675 Ga0495657_0201102 Ga0495657_0201102_870_1193 106
814 3300046675 Ga0495657_0905174 Ga0495657_0905174_120_443 106
815 3300046678 Ga0495599_0017466 Ga0495599_0017466_418_774 106
816 3300046678 Ga0495599_0292994 Ga0495599_0292994_409_732 106
817 3300046678 Ga0495599_0412285 Ga0495599_0412285_193_516 106
818 3300046678 Ga0495599_0580502 Ga0495599_0580502_176_496 106
819 3300046678 Ga0495599_0641271 Ga0495599_0641271_39_359 106
820 3300046678 Ga0495599_0791057 Ga0495599_0791057_157_480 106
821 3300046679 Ga0495623_0007848 Ga0495623_0007848_1161_1517 106
822 3300046679 Ga0495623_0080548 Ga0495623_0080548_815_1138 106
823 3300046679 Ga0495623_0316562 Ga0495623_0316562_191_514 106
824 3300046680 Ga0495646_0003413 Ga0495646_0003413_622_945 106
825 3300046680 Ga0495646_0004507 Ga0495646_0004507_6349_6672 106
826 3300046683 Ga0495658_0017875 Ga0495658_0017875_1089_1409 106
827 3300046683 Ga0495658_0060519 Ga0495658_0060519_1679_1999 106
828 3300046683 Ga0495658_0721417 Ga0495658_0721417_84_407 106
829 3300046683 Ga0495658_0806415 Ga0495658_0806415_105_428 106
830 3300046684 Ga0495669_0045320 Ga0495669_0045320_1001_1321 106
831 3300046684 Ga0495669_0242068 Ga0495669_0242068_301_624 106
832 3300046689 Ga0495613_0019201 Ga0495613_0019201_3627_3950 106
833 3300046689 Ga0495613_0036939 Ga0495613_0036939_232_555 106
834 3300046689 Ga0495613_0065036 Ga0495613_0065036_2335_2655 106
835 3300046689 Ga0495613_0538570 Ga0495613_0538570_23_346 106
836 3300046690 Ga0495624_0017343 Ga0495624_0017343_1581_1904 106
837 3300046690 Ga0495624_0094431 Ga0495624_0094431_1297_1617 106
838 3300046690 Ga0495624_0132745 Ga0495624_0132745_483_806 106
839 3300046690 Ga0495624_0143973 Ga0495624_0143973_170_490 106
840 3300046690 Ga0495624_0385279 Ga0495624_0385279_216_539 106
841 3300046690 Ga0495624_0753769 Ga0495624_0753769_78_401 106
842 3300046691 Ga0495670_0604992 Ga0495670_0604992_89_415 106
843 3300046692 Ga0495671_0060933 Ga0495671_0060933_1061_1384 106
844 3300046694 Ga0495649_0012027 Ga0495649_0012027_966_1289 106
845 3300046694 Ga0495649_0048027 Ga0495649_0048027_750_1073 106
846 3300046694 Ga0495649_0075838 Ga0495649_0075838_694_1017 106
847 3300046794 Ga0495589_0049162 Ga0495589_0049162_715_1038 106
848 3300046794 Ga0495589_0074606 Ga0495589_0074606_1028_1351 106
849 3300046794 Ga0495589_0100336 Ga0495589_0100336_810_1133 106
850 3300046794 Ga0495589_0225410 Ga0495589_0225410_268_591 106
851 3300046794 Ga0495589_0467800 Ga0495589_0467800_20_343 106
852 3300046809 Ga0495600_0015117 Ga0495600_0015117_1055_1378 106
853 3300046809 Ga0495600_0036242 Ga0495600_0036242_322_642 106
854 3300046809 Ga0495600_0685620 Ga0495600_0685620_190_513 106
855 3300047315 Ga0495581_0001049 Ga0495581_0001049_9160_9483 106
856 3300047315 Ga0495581_0010529 Ga0495581_0010529_4667_4990 106
857 3300047315 Ga0495581_0094740 Ga0495581_0094740_1344_1667 106
858 3300047317 Ga0495604_0001474 Ga0495604_0001474_5794_6117 106
859 3300047317 Ga0495604_0008726 Ga0495604_0008726_1445_1765 106
860 3300047317 Ga0495604_0018792 Ga0495604_0018792_961_1284 106
861 3300047317 Ga0495604_0026152 Ga0495604_0026152_3224_3547 106
862 3300047317 Ga0495604_0059228 Ga0495604_0059228_1490_1846 106
863 3300047317 Ga0495604_0206685 Ga0495604_0206685_918_1238 106
864 3300047317 Ga0495604_0426244 Ga0495604_0426244_379_702 106
865 3300047318 Ga0495636_0006341 Ga0495636_0006341_2044_2364 106
866 3300047318 Ga0495636_0291468 Ga0495636_0291468_260_586 106
867 3300047319 Ga0495674_0081656 Ga0495674_0081656_253_576 106
868 3300047319 Ga0495674_0100187 Ga0495674_0100187_1007_1330 106
869 3300047319 Ga0495674_0720619 Ga0495674_0720619_174_494 106
870 3300047319 Ga0495674_1022855 Ga0495674_1022855_71_391 106
871 3300047321 Ga0495676_0254554 Ga0495676_0254554_355_678 106
872 3300047321 Ga0495676_0589405 Ga0495676_0589405_266_589 106
873 3300047322 Ga0495680_0001252 Ga0495680_0001252_8954_9274 106
874 3300047322 Ga0495680_0006154 Ga0495680_0006154_5794_6117 106
875 3300047322 Ga0495680_0028998 Ga0495680_0028998_1828_2151 106
876 3300047322 Ga0495680_0367110 Ga0495680_0367110_605_928 106
877 3300047322 Ga0495680_0872482 Ga0495680_0872482_223_546 106
878 3300047323 Ga0495683_0002338 Ga0495683_0002338_9154_9477 106
879 3300047323 Ga0495683_0006981 Ga0495683_0006981_4717_5040 106
880 3300047323 Ga0495683_0057968 Ga0495683_0057968_1169_1492 106
881 3300047323 Ga0495683_0366451 Ga0495683_0366451_132_464 106
882 3300047443 Ga0495687_000078 Ga0495687_000078_146944_147267 106
883 3300047443 Ga0495687_045152 Ga0495687_045152_373_696 106
884 3300047444 Ga0495675_0031304 Ga0495675_0031304_750_1073 106
885 3300047444 Ga0495675_0149692 Ga0495675_0149692_834_1157 106
886 3300047444 Ga0495675_0160606 Ga0495675_0160606_189_512 106
887 3300047444 Ga0495675_0187973 Ga0495675_0187973_749_1069 106
888 3300047444 Ga0495675_0252568 Ga0495675_0252568_460_783 106
889 3300047446 Ga0495679_006165 Ga0495679_006165_3296_3619 106
890 3300047446 Ga0495679_022378 Ga0495679_022378_483_806 106
891 3300047446 Ga0495679_038477 Ga0495679_038477_1162_1485 106
892 3300047469 Ga0495673_0033340 Ga0495673_0033340_1135_1458 106
893 3300047471 Ga0495684_0157650 Ga0495684_0157650_1040_1363 106
894 3300047673 Ga0495593_0008398 Ga0495593_0008398_1115_1438 106
895 3300047673 Ga0495593_0012595 Ga0495593_0012595_2244_2567 106
896 3300047673 Ga0495593_0053913 Ga0495593_0053913_247_567 106
897 3300047673 Ga0495593_0077978 Ga0495593_0077978_780_1103 106
898 3300047673 Ga0495593_0447735 Ga0495593_0447735_86_409 106
899 3300048088 Ga0495602_0011608 Ga0495602_0011608_4686_5009 106
900 3300048088 Ga0495602_0049942 Ga0495602_0049942_2538_2861 106
901 3300048088 Ga0495602_0153071 Ga0495602_0153071_390_746 106
902 3300048088 Ga0495602_0193040 Ga0495602_0193040_700_1023 106
903 3300048089 Ga0495614_0003464 Ga0495614_0003464_4764_5087 106
904 3300048089 Ga0495614_0051130 Ga0495614_0051130_424_747 106
905 3300048089 Ga0495614_0107248 Ga0495614_0107248_302_625 106
906 3300048903 Ga0496100_0008448 Ga0496100_0008448_2434_2757 106
907 3300048904 Ga0496101_0023297 Ga0496101_0023297_1888_2211 106
908 3300048904 Ga0496101_0113453 Ga0496101_0113453_14_337 106
909 3300048904 Ga0496101_0493729 Ga0496101_0493729_379_702 106
910 3300048905 Ga0496102_0018939 Ga0496102_0018939_964_1287 106
911 3300048905 Ga0496102_0065386 Ga0496102_0065386_1029_1352 106
912 3300048906 Ga0496103_0011604 Ga0496103_0011604_904_1227 106
913 3300048906 Ga0496103_0021032 Ga0496103_0021032_3357_3680 106
914 3300048907 Ga0496104_0295492 Ga0496104_0295492_572_895 106
915 3300048908 Ga0496105_0111021 Ga0496105_0111021_840_1163 106
916 3300048909 Ga0496106_0000023 Ga0496106_0000023_152086_152463 106
917 3300048909 Ga0496106_0015183 Ga0496106_0015183_4626_4949 106
918 3300048910 Ga0496107_0270121 Ga0496107_0270121_651_974 106
919 3300048911 Ga0496108_0099751 Ga0496108_0099751_1204_1527 106
920 3300048911 Ga0496108_0414784 Ga0496108_0414784_116_439 106
921 3300048912 Ga0496109_0404606 Ga0496109_0404606_588_911 106
922 3300048913 Ga0496110_0114538 Ga0496110_0114538_1358_1681 106
923 3300048913 Ga0496110_0148999 Ga0496110_0148999_338_661 106
924 3300048914 Ga0496111_0253983 Ga0496111_0253983_527_850 106
925 3300048914 Ga0496111_0774908 Ga0496111_0774908_114_437 106
926 3300048915 Ga0496112_0044311 Ga0496112_0044311_733_1056 106
927 3300048916 Ga0496113_0042009 Ga0496113_0042009_2757_3080 106
928 3300048917 Ga0496114_0033858 Ga0496114_0033858_2800_3123 106
929 3300048918 Ga0496115_0006263 Ga0496115_0006263_6821_7144 106
930 3300048919 Ga0496116_0026332 Ga0496116_0026332_2783_3106 106
931 3300048919 Ga0496116_0080085 Ga0496116_0080085_911_1234 106
932 3300048920 Ga0496117_0043089 Ga0496117_0043089_1502_1825 106
933 3300048920 Ga0496117_0052900 Ga0496117_0052900_1105_1428 106
934 3300048920 Ga0496117_0075692 Ga0496117_0075692_870_1193 106
935 3300048921 Ga0496118_0010415 Ga0496118_0010415_5602_5925 106
936 3300048921 Ga0496118_0023542 Ga0496118_0023542_4075_4398 106
937 3300048921 Ga0496118_0226382 Ga0496118_0226382_552_875 106
938 3300048922 Ga0496119_0202909 Ga0496119_0202909_298_621 106
939 3300048924 Ga0496121_0005179 Ga0496121_0005179_4975_5352 106
940 3300048924 Ga0496121_0028951 Ga0496121_0028951_1486_1809 106
941 3300048925 Ga0496122_0010546 Ga0496122_0010546_814_1137 106
942 3300048926 Ga0496123_0040469 Ga0496123_0040469_2194_2517 106
943 3300048927 Ga0496124_0032787 Ga0496124_0032787_3026_3349 106
944 3300048927 Ga0496124_0193818 Ga0496124_0193818_168_491 106
945 3300048928 Ga0496125_0027893 Ga0496125_0027893_664_987 106
946 3300048929 Ga0496126_0001279 Ga0496126_0001279_18959_19282 106
947 3300048929 Ga0496126_0001770 Ga0496126_0001770_13565_13888 106
948 3300048929 Ga0496126_0043993 Ga0496126_0043993_1064_1387 106
949 3300049129 Ga0501309_012746 Ga0501309_012746_606_929 106
950 3300049161 Ga0501305_094306 Ga0501305_094306_142_462 106
951 3300049459 Ga0495678_185078 Ga0495678_185078_239_562 106
952 3300049514 Ga0501291_024806 Ga0501291_024806_262_588 106
953 3300049514 Ga0501291_031963 Ga0501291_031963_549_875 106
954 3300049514 Ga0501291_097346 Ga0501291_097346_256_576 106
955 3300049520 Ga0501297_042019 Ga0501297_042019_237_557 106
956 3300049520 Ga0501297_052237 Ga0501297_052237_216_542 106
957 3300049526 Ga0501303_008441 Ga0501303_008441_337_663 106
958 3300049527 Ga0501311_042555 Ga0501311_042555_110_433 106
959 3300049528 Ga0501312_109184 Ga0501312_109184_164_487 106
960 3300049530 Ga0501314_030602 Ga0501314_030602_210_533 106
961 3300049568 Ga0501031_0098236 Ga0501031_0098236_518_844 106
962 3300049568 Ga0501031_0362808 Ga0501031_0362808_46_369 106
963 3300049569 Ga0501032_0258858 Ga0501032_0258858_480_806 106
964 3300049570 Ga0501033_0241590 Ga0501033_0241590_161_487 106
965 3300049571 Ga0501034_0427120 Ga0501034_0427120_246_569 106
966 3300049571 Ga0501034_1215936 Ga0501034_1215936_88_411 106
967 3300049572 Ga0501036_0052878 Ga0501036_0052878_478_804 106
968 3300049572 Ga0501036_0857819 Ga0501036_0857819_379_702 106
969 3300049572 Ga0501036_0859596 Ga0501036_0859596_327_653 106
970 3300049573 Ga0501037_0003038 Ga0501037_0003038_8482_8805 106
971 3300049574 Ga0501038_0303394 Ga0501038_0303394_493_819 106
972 3300049575 Ga0501039_0024671 Ga0501039_0024671_1108_1434 106
973 3300049576 Ga0501040_0003600 Ga0501040_0003600_8792_9118 106
974 3300049576 Ga0501040_0034644 Ga0501040_0034644_2719_3045 106
975 3300049576 Ga0501040_0865955 Ga0501040_0865955_152_475 106
976 3300049577 Ga0501041_0116026 Ga0501041_0116026_1297_1623 106
977 3300049578 Ga0501042_0396719 Ga0501042_0396719_69_395 106
978 3300049580 Ga0501046_0098411 Ga0501046_0098411_695_1018 106
979 3300049580 Ga0501046_0138215 Ga0501046_0138215_510_836 106
980 3300049580 Ga0501046_0485880 Ga0501046_0485880_262_588 106
981 3300049580 Ga0501046_0507391 Ga0501046_0507391_183_506 106
982 3300049581 Ga0501047_0019486 Ga0501047_0019486_5964_6287 106
983 3300049581 Ga0501047_0167337 Ga0501047_0167337_860_1183 106
984 3300049581 Ga0501047_1091044 Ga0501047_1091044_145_468 106
985 3300049582 Ga0501048_1122440 Ga0501048_1122440_94_420 106
986 3300049583 Ga0501067_0495896 Ga0501067_0495896_295_618 106
987 3300049584 Ga0501068_0537516 Ga0501068_0537516_398_724 106
988 3300049587 Ga0501071_0111706 Ga0501071_0111706_1015_1341 106
989 3300049588 Ga0501072_0008011 Ga0501072_0008011_6749_7075 106
990 3300049588 Ga0501072_0686394 Ga0501072_0686394_146_469 106
991 3300049590 Ga0501074_0220060 Ga0501074_0220060_752_1078 106
992 3300049591 Ga0501075_0076329 Ga0501075_0076329_1282_1608 106
993 3300049592 Ga0501076_0000290 Ga0501076_0000290_28631_28957 106
994 3300049593 Ga0501077_0504698 Ga0501077_0504698_432_752 106
995 3300049651 Ga0501201_010158 Ga0501201_010158_449_775 106
996 3300049652 Ga0501202_146817 Ga0501202_146817_205_531 106
997 3300049654 Ga0501207_063540 Ga0501207_063540_95_418 106
998 3300049663 Ga0501223_122641 Ga0501223_122641_95_421 106
999 3300049679 Ga0501249_138579 Ga0501249_138579_232_558 106
1000 3300049686 Ga0501257_235092 Ga0501257_235092_166_492 106
1001 3300049704 Ga0501221_215760 Ga0501221_215760_86_406 106
1002 3300049705 Ga0501225_0159976 Ga0501225_0159976_34_360 106
1003 3300049741 Ga0501079_0085041 Ga0501079_0085041_68_394 106
1004 3300049742 Ga0501080_0096596 Ga0501080_0096596_288_611 106
1005 3300049742 Ga0501080_0106464 Ga0501080_0106464_18_341 106
1006 3300049742 Ga0501080_0333901 Ga0501080_0333901_426_749 106
1007 3300049742 Ga0501080_0985827 Ga0501080_0985827_230_556 106
1008 3300049743 Ga0501081_0005740 Ga0501081_0005740_48_374 106
1009 3300049744 Ga0501083_0656215 Ga0501083_0656215_221_547 106
1010 3300049779 Ga0501283_018398 Ga0501283_018398_137_463 106
1011 3300049822 Ga0501035_0527664 Ga0501035_0527664_159_485 106
1012 3300049822 Ga0501035_1188834 Ga0501035_1188834_56_382 106
1013 3300049823 Ga0501044_0177984 Ga0501044_0177984_1696_2019 106
1014 3300049823 Ga0501044_0497465 Ga0501044_0497465_118_444 106
1015 3300049824 Ga0501045_0167109 Ga0501045_0167109_75_401 106
1016 3300050491 nmdc:mga00v17_76853_c1 nmdc:mga00v17_76853_c1_827_1150 106
1017 3300050492 nmdc:mga0yw44_315642_c1 nmdc:mga0yw44_315642_c1_682_1005 106
1018 3300050493 nmdc:mga0k408_12409_c1 nmdc:mga0k408_12409_c1_2813_3136 106
1019 3300050493 nmdc:mga0k408_132002_c1 nmdc:mga0k408_132002_c1_498_821 106
1020 3300050494 nmdc:mga06z11_362980_c1 nmdc:mga06z11_362980_c1_327_650 106
1021 3300050494 nmdc:mga06z11_898647_c1 nmdc:mga06z11_898647_c1_12_335 106
1022 3300050495 nmdc:mga04h51_61024_c1 nmdc:mga04h51_61024_c1_753_1076 106
1023 3300050507 nmdc:mga05p37_2115337_c1 nmdc:mga05p37_2115337_c1_99_425 106
1024 3300050507 nmdc:mga05p37_222484_c1 nmdc:mga05p37_222484_c1_1643_1969 106
1025 3300050508 nmdc:mga09592_1117136_c1 nmdc:mga09592_1117136_c1_165_491 106
1026 3300050508 nmdc:mga09592_712219_c1 nmdc:mga09592_712219_c1_268_591 106
1027 3300050510 nmdc:mga06r32_446739_c1 nmdc:mga06r32_446739_c1_450_776 106
1028 3300050511 nmdc:mga08y16_1878441_c1 nmdc:mga08y16_1878441_c1_190_510 106
1029 3300050511 nmdc:mga08y16_5343_c1 nmdc:mga08y16_5343_c1_100_423 106
1030 3300050511 nmdc:mga08y16_588427_c1 nmdc:mga08y16_588427_c1_373_696 106
1031 3300050511 nmdc:mga08y16_729185_c1 nmdc:mga08y16_729185_c1_362_688 106
1032 3300050511 nmdc:mga08y16_86961_c1 nmdc:mga08y16_86961_c1_1524_1847 106
1033 3300050512 nmdc:mga0n895_313173_c1 nmdc:mga0n895_313173_c1_207_527 106
1034 3300050512 nmdc:mga0n895_582_c1 nmdc:mga0n895_582_c1_14_334 106
1035 3300050512 nmdc:mga0n895_62787_c1 nmdc:mga0n895_62787_c1_2405_2728 106
1036 3300050512 nmdc:mga0n895_629202_c1 nmdc:mga0n895_629202_c1_207_530 106
1037 3300050512 nmdc:mga0n895_637282_c1 nmdc:mga0n895_637282_c1_488_808 106
1038 3300050513 nmdc:mga0rr50_19252_c1 nmdc:mga0rr50_19252_c1_3526_3849 106
1039 3300050513 nmdc:mga0rr50_218123_c1 nmdc:mga0rr50_218123_c1_1104_1424 106
1040 3300050513 nmdc:mga0rr50_234962_c1 nmdc:mga0rr50_234962_c1_894_1217 106
1041 3300050513 nmdc:mga0rr50_273030_c1 nmdc:mga0rr50_273030_c1_949_1272 106
1042 3300050513 nmdc:mga0rr50_3282_c1 nmdc:mga0rr50_3282_c1_7820_8140 106
1043 3300050513 nmdc:mga0rr50_665357_c1 nmdc:mga0rr50_665357_c1_367_687 106
1044 3300050513 nmdc:mga0rr50_871708_c1 nmdc:mga0rr50_871708_c1_188_508 106
1045 3300050514 nmdc:mga08x19_1199325_c1 nmdc:mga08x19_1199325_c1_162_482 106
1046 3300050514 nmdc:mga08x19_1858_c1 nmdc:mga08x19_1858_c1_6766_7086 106
1047 3300050514 nmdc:mga08x19_250421_c1 nmdc:mga08x19_250421_c1_887_1207 106
1048 3300050514 nmdc:mga08x19_269_c1 nmdc:mga08x19_269_c1_31_354 106
1049 3300050514 nmdc:mga08x19_5533_c1 nmdc:mga08x19_5533_c1_2566_2889 106
1050 3300050515 nmdc:mga0a205_107303_c1 nmdc:mga0a205_107303_c1_2212_2535 106
1051 3300050515 nmdc:mga0a205_12708_c1 nmdc:mga0a205_12708_c1_2308_2628 106
1052 3300050515 nmdc:mga0a205_428_c1 nmdc:mga0a205_428_c1_30959_31282 106
1053 3300050515 nmdc:mga0a205_956344_c1 nmdc:mga0a205_956344_c1_218_541 106
1054 3300050516 nmdc:mga0sz30_138726_c1 nmdc:mga0sz30_138726_c1_97_420 106
1055 3300050516 nmdc:mga0sz30_19086_c1 nmdc:mga0sz30_19086_c1_2180_2503 106
1056 3300053077 Ga0495601_0079602 Ga0495601_0079602_108_428 106
1057 3300053077 Ga0495601_0235706 Ga0495601_0235706_737_1057 106
1058 3300053077 Ga0495601_0569482 Ga0495601_0569482_319_642 106
1059 3300053078 Ga0495612_0459003 Ga0495612_0459003_219_539 106
1060 3300053085 Ga0495619_0694822 Ga0495619_0694822_324_647 106
1061 3300053146 Ga0500588_0244235 Ga0500588_0244235_190_513 106
1062 3300053153 Ga0500616_0286137 Ga0500616_0286137_316_639 106
1063 3300053158 Ga0500627_0127791 Ga0500627_0127791_664_987 106
1064 3300053178 Ga0500637_0508192 Ga0500637_0508192_86_409 106
1065 3300054114 Ga0501084_0227805 Ga0501084_0227805_1069_1389 106
1066 3300054114 Ga0501084_0805497 Ga0501084_0805497_247_573 106
1067 3300054114 Ga0501084_0905061 Ga0501084_0905061_166_489 106
1068 3300059477 Ga0587084_000186 Ga0587084_000186_2500_2820 106
1069 3300059477 Ga0587084_032074 Ga0587084_032074_173_496 106
1070 3300059477 Ga0587084_078057 Ga0587084_078057_248_568 106
1071 3300059492 Ga0587073_0005556 Ga0587073_0005556_705_1025 106
1072 3300059504 Ga0587082_013997 Ga0587082_013997_502_822 106
1073 3300059508 Ga0587088_000182 Ga0587088_000182_2502_2822 106
1074 3300059508 Ga0587088_015464 Ga0587088_015464_450_773 106
1075 3300059511 Ga0587091_011293 Ga0587091_011293_621_941 106
1076 3300059624 Ga0587109_170298 Ga0587109_170298_121_444 106
1077 3300059630 Ga0587128_001876 Ga0587128_001876_1529_1849 106
1078 3300059630 Ga0587128_144159 Ga0587128_144159_62_448 106
1079 3300059640 Ga0587067_000236 Ga0587067_000236_2595_2915 106
1080 3300059641 Ga0587068_002388 Ga0587068_002388_1349_1669 106
1081 3300059643 Ga0587072_000335 Ga0587072_000335_3355_3675 106
1082 3300059644 Ga0587075_011493 Ga0587075_011493_700_1020 106
1083 3300059645 Ga0587076_011609 Ga0587076_011609_484_804 106
1084 3300059648 Ga0587100_009542 Ga0587100_009542_422_742 106
1085 3300059650 Ga0587104_001168 Ga0587104_001168_608_928 106
1086 3300060346 Ga0587111_0007854 Ga0587111_0007854_831_1151 106
1087 3300060353 Ga0501082_0083800 Ga0501082_0083800_967_1293 106
1088 3300060353 Ga0501082_1047968 Ga0501082_1047968_121_447 106
1089 3300061719 Ga0466962_0000364 Ga0466962_0000364_16283_16606 106
1090 3300061719 Ga0466962_0007045 Ga0466962_0007045_2904_3227 106
1091 3300061719 Ga0466962_0657091 Ga0466962_0657091_80_403 106

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01521

Fe-S_biosyn

Iron-sulphur cluster biosynthesis

1

102

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1r94-assembly1.cif.gz_A crystal structure of isca (mercury derivative) 0.9327 2 96
2d2a-assembly2.cif.gz_B-2 crystal structure of escherichia coli sufa involved in biosynthesis of iron-sulfur clusters 0.9325 2 94
1s98-assembly1.cif.gz_A e.coli isca crystal structure to 2.3 a 0.9168 1 97
1s98-assembly1.cif.gz_A e.coli isca crystal structure to 2.3 a 0.908 1 97
1r94-assembly1.cif.gz_A crystal structure of isca (mercury derivative) 0.9055 2 96
ID Description Score Start End Superfamily
af_I3ITR1_24_129_2.60.300.12 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.9507 1 106 2.60.300.12
2d2aB01 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.9328 1 94 2.60.300.12
af_P77667_17_122_2.60.300.12 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.9319 1 106 2.60.300.12
af_P78859_82_189_2.60.300.12 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.9282 1 106 2.60.300.12
2d2aB01 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.9231 1 94 2.60.300.12
ID Description Score Start End GO Terms
AF-A0A318GUV1-F1-model_v4 Iron-binding protein IscA (Iron-sulfur cluster assembly protein) 0.9875 1 106 GO:0005829
GO:0016226
GO:0051537
GO:0097428
AF-A0A545SJU6-F1-model_v4 Iron-binding protein IscA (Iron-sulfur cluster assembly protein) 0.986 1 106 GO:0003700
GO:0005829
GO:0016226
GO:0051537
AF-A0A7J7AI40-F1-model_v4 deleted 0.9855 1 106
AF-Q8GLE6-F1-model_v4 Iron-binding protein IscA (Iron-sulfur cluster assembly protein) 0.979 1 106 GO:0005506
GO:0005829
GO:0016226
GO:0051537
GO:0097428
AF-A0A7U6KQS0-F1-model_v4 Iron-binding protein IscA 0.979 1 81 GO:0005829
GO:0016226
GO:0051537
GO:0097428

Feature Viewer

pLDDT pTM Quality
92.1 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map