F489109
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1053 | 474 | 2106 | 88 |
Family's Representative Sequence
| Representative Sequence | 3300006028|Ga0070717_10393022|Ga0070717_103930222 |
| Length | 103 |
| Sequence | MASTKAQGSSNNGRDSHGQRLGVKRYGGEVVTAGMVIMRQRGTQILPGLNVGLGKDHTLFAKINGVVTFEWARKDKKRASVYPVGDARNVTAKMHAKAAAAAK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 4 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 5 | 3300003289 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_19 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 6 | 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 7 | 3300003568 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 8 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 9 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 10 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 11 | 3300003735 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 12 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 13 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 14 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 15 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 16 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 26 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 57 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 68 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 69 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 70 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 71 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 72 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 73 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 74 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 75 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 76 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 77 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 80 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 81 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 83 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 84 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 85 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 86 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 87 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 88 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 89 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 90 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 91 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 93 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 94 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009835 | Sorghum rhizosphere soil microbial communities under drought stress in Albany, CA - sample B | Metatranscriptome | Rhizosphere |
| 109 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 110 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 113 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 124 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 128 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 130 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 131 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 132 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 133 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 134 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 135 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 136 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 137 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 138 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 139 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 140 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 141 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 142 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 143 | 3300023309 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctcc.R1 | Metatranscriptome | Rhizosphere |
| 144 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 207 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 208 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 209 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 210 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 211 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 212 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 213 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 214 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 215 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 216 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 217 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 218 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 219 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 220 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 221 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 222 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 223 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 224 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 225 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 226 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 227 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 228 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 229 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 230 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 231 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 232 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 233 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 234 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 235 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 236 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 237 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 238 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 239 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 240 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 241 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 242 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 243 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 244 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 245 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 246 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 247 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 248 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 249 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 250 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 251 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 252 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 253 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 254 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 255 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 256 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 257 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 258 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 259 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 260 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 261 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 262 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 263 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 264 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 265 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 266 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 267 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 268 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 269 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 270 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 271 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 272 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 273 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 274 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 275 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 276 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 277 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 278 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 279 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 280 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 281 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 282 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 283 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 284 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 285 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 286 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 287 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 288 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 289 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 290 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 291 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 292 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 293 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 294 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 295 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 296 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 297 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 298 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 299 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 300 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 301 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 302 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 303 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 304 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 305 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 306 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 307 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 308 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 309 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 310 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 311 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 312 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 313 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 314 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 315 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 316 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 317 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 318 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 319 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 320 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 353 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 354 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 355 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 356 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 357 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 358 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 359 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 360 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 361 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 362 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 363 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 364 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 365 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 366 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 367 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 368 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 369 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 370 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 371 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 372 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 373 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 374 | 3300049131 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 375 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 376 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 377 | 3300049526 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control | Metagenome | Rhizosphere |
| 378 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 379 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 380 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 381 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 382 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 383 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 384 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 385 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 386 | 3300049556 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 387 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 388 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 389 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 390 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 391 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 392 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 393 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 394 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 395 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 396 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 397 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 398 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 399 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 400 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 401 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 402 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 403 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 404 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 405 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 406 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 407 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 408 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 409 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 410 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 411 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 412 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 413 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 414 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 415 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 416 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 417 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 418 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 419 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 420 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 421 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 422 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 423 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 424 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 425 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 426 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 427 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 428 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 429 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 430 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 431 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 432 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 433 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 434 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 435 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 436 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 437 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 438 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 439 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 440 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 441 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 442 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 443 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 444 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 445 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 446 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 447 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 448 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 449 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 450 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 451 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 452 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 453 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 454 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 455 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 456 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 457 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 458 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 459 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 460 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 461 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 462 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 463 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 464 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 465 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 466 | 2837268691 | Jiangella endophytica KE2-3 | Isolate | Rhizosphere |
| 467 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 468 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 469 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 470 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 471 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 472 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 473 | 8002745576 | Marinomonas spartinae USM8 | Isolate | Rhizosphere |
| 474 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 81.39 |
| Metatranscriptomes | 16.24 |
| Isolates | 2.37 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.23 |
| Nodule | 0.57 |
| Rhizoplane | 2.18 |
| Rhizosphere | 91.64 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.56 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070717_10393022 | 3300006028 | Bacteria | 1245 |
| 2 | SwRhRL2b_contig_2708226 | 2162886007 | Bacteria | 1004 |
| 3 | LJQas_1009264 | 3300000549 | Bacteria | 1187 |
| 4 | LJQas_1033958 | 3300000549 | Bacteria | 599 |
| 5 | JGI25406J46586_10009537 | 3300003203 | Bacteria | 4346 |
| 6 | Ga0006776J48906_103232 | 3300003289 | Bacteria | 523 |
| 7 | Ga0006777J48905_1012391 | 3300003308 | Bacteria | 629 |
| 8 | Ga0006781J51513_1004544 | 3300003568 | Bacteria | 642 |
| 9 | Ga0007410J51695_1038747 | 3300003574 | Bacteria | 592 |
| 10 | Ga0007429J51699_1011333 | 3300003579 | Bacteria | 660 |
| 11 | Ga0007429J51699_1037612 | 3300003579 | Bacteria | 594 |
| 12 | Ga0032354_1011911 | 3300003693 | Bacteria | 673 |
| 13 | Ga0006780_1006521 | 3300003735 | Bacteria | 1709 |
| 14 | Ga0006780_1006522 | 3300003735 | Bacteria | 719 |
| 15 | Ga0006780_1008494 | 3300003735 | Bacteria | 705 |
| 16 | Ga0058859_11478734 | 3300004798 | Bacteria | 554 |
| 17 | Ga0058863_11884972 | 3300004799 | Bacteria | 646 |
| 18 | Ga0058863_11890991 | 3300004799 | Bacteria | 1053 |
| 19 | Ga0058861_10021431 | 3300004800 | Bacteria | 745 |
| 20 | Ga0058861_11788698 | 3300004800 | Bacteria | 671 |
| 21 | Ga0058861_12020855 | 3300004800 | Bacteria | 1009 |
| 22 | Ga0058862_10029435 | 3300004803 | Bacteria | 829 |
| 23 | Ga0058862_12517167 | 3300004803 | Bacteria | 667 |
| 24 | Ga0058862_12786174 | 3300004803 | Bacteria | 560 |
| 25 | Ga0065714_10017840 | 3300005288 | Bacteria | 1849 |
| 26 | Ga0065715_10006688 | 3300005293 | Bacteria | 3052 |
| 27 | Ga0070658_10241354 | 3300005327 | Bacteria | 1531 |
| 28 | Ga0070658_11256342 | 3300005327 | Bacteria | 643 |
| 29 | Ga0070676_11601975 | 3300005328 | Bacteria | 503 |
| 30 | Ga0070683_100311273 | 3300005329 | Bacteria | 1498 |
| 31 | Ga0070683_100341662 | 3300005329 | Bacteria | 1425 |
| 32 | Ga0070683_101094309 | 3300005329 | Bacteria | 765 |
| 33 | Ga0070683_102387910 | 3300005329 | Bacteria | 507 |
| 34 | Ga0070690_100618998 | 3300005330 | Bacteria | 824 |
| 35 | Ga0070690_101131023 | 3300005330 | Bacteria | 622 |
| 36 | Ga0070670_100830022 | 3300005331 | Bacteria | 836 |
| 37 | Ga0070670_101437369 | 3300005331 | Bacteria | 633 |
| 38 | Ga0070680_100008411 | 3300005336 | Bacteria | 7903 |
| 39 | Ga0070680_100196074 | 3300005336 | Bacteria | 1702 |
| 40 | Ga0070680_100254337 | 3300005336 | Bacteria | 1486 |
| 41 | Ga0070680_100281626 | 3300005336 | Bacteria | 1409 |
| 42 | Ga0070680_100507075 | 3300005336 | Bacteria | 1032 |
| 43 | Ga0070680_100637339 | 3300005336 | Bacteria | 915 |
| 44 | Ga0070680_101737394 | 3300005336 | Bacteria | 541 |
| 45 | Ga0070682_100886692 | 3300005337 | Bacteria | 732 |
| 46 | Ga0068868_101443624 | 3300005338 | Bacteria | 643 |
| 47 | Ga0070660_101119657 | 3300005339 | Bacteria | 667 |
| 48 | Ga0070689_100343094 | 3300005340 | Bacteria | 1251 |
| 49 | Ga0070689_100933875 | 3300005340 | Bacteria | 769 |
| 50 | Ga0070689_101154870 | 3300005340 | Bacteria | 694 |
| 51 | Ga0070689_101965144 | 3300005340 | Unclassified | 535 |
| 52 | Ga0070692_10931536 | 3300005345 | Bacteria | 603 |
| 53 | Ga0070668_100938522 | 3300005347 | Bacteria | 775 |
| 54 | Ga0070669_100115761 | 3300005353 | Bacteria | 2040 |
| 55 | Ga0070669_101039073 | 3300005353 | Bacteria | 704 |
| 56 | Ga0070675_101760336 | 3300005354 | Bacteria | 572 |
| 57 | Ga0070674_100437537 | 3300005356 | Bacteria | 1077 |
| 58 | Ga0070673_100777904 | 3300005364 | Bacteria | 883 |
| 59 | Ga0070688_100200084 | 3300005365 | Unclassified | 1397 |
| 60 | Ga0070688_100362437 | 3300005365 | Bacteria | 1064 |
| 61 | Ga0070688_100719008 | 3300005365 | Bacteria | 775 |
| 62 | Ga0070688_101005979 | 3300005365 | Bacteria | 662 |
| 63 | Ga0070659_100467693 | 3300005366 | Bacteria | 1071 |
| 64 | Ga0070659_101711380 | 3300005366 | Bacteria | 562 |
| 65 | Ga0070667_100341294 | 3300005367 | Bacteria | 1355 |
| 66 | Ga0070709_11141124 | 3300005434 | Bacteria | 624 |
| 67 | Ga0070709_11220376 | 3300005434 | Bacteria | 605 |
| 68 | Ga0070714_100162264 | 3300005435 | Bacteria | 2023 |
| 69 | Ga0070714_100466994 | 3300005435 | Bacteria | 1200 |
| 70 | Ga0070714_100675076 | 3300005435 | Bacteria | 996 |
| 71 | Ga0070714_100873003 | 3300005435 | Bacteria | 873 |
| 72 | Ga0070713_100241199 | 3300005436 | Bacteria | 1646 |
| 73 | Ga0070713_100511581 | 3300005436 | Bacteria | 1134 |
| 74 | Ga0070713_100768049 | 3300005436 | Bacteria | 923 |
| 75 | Ga0070713_101279495 | 3300005436 | Bacteria | 710 |
| 76 | Ga0070713_101394420 | 3300005436 | Bacteria | 680 |
| 77 | Ga0070713_101926152 | 3300005436 | Bacteria | 573 |
| 78 | Ga0070710_10264854 | 3300005437 | Bacteria | 1109 |
| 79 | Ga0070711_100188700 | 3300005439 | Bacteria | 1583 |
| 80 | Ga0070711_100481076 | 3300005439 | Bacteria | 1021 |
| 81 | Ga0070711_100707549 | 3300005439 | Bacteria | 849 |
| 82 | Ga0070700_101924643 | 3300005441 | Bacteria | 512 |
| 83 | Ga0070694_100730392 | 3300005444 | Bacteria | 807 |
| 84 | Ga0070694_101116214 | 3300005444 | Bacteria | 658 |
| 85 | Ga0070708_100072299 | 3300005445 | Bacteria | 3107 |
| 86 | Ga0070663_100995326 | 3300005455 | Bacteria | 729 |
| 87 | Ga0070663_101134920 | 3300005455 | Bacteria | 685 |
| 88 | Ga0070663_101179891 | 3300005455 | Bacteria | 672 |
| 89 | Ga0070678_100404525 | 3300005456 | Bacteria | 1187 |
| 90 | Ga0070678_101000023 | 3300005456 | Bacteria | 769 |
| 91 | Ga0070678_101386202 | 3300005456 | Bacteria | 656 |
| 92 | Ga0070678_101533212 | 3300005456 | Bacteria | 624 |
| 93 | Ga0070662_100087504 | 3300005457 | Bacteria | 2332 |
| 94 | Ga0070681_10000028 | 3300005458 | Bacteria | 104446 |
| 95 | Ga0070681_10106665 | 3300005458 | Bacteria | 2743 |
| 96 | Ga0070681_10176243 | 3300005458 | Bacteria | 2060 |
| 97 | Ga0070681_10279357 | 3300005458 | Bacteria | 1581 |
| 98 | Ga0070681_10835306 | 3300005458 | Bacteria | 839 |
| 99 | Ga0070681_11152427 | 3300005458 | Bacteria | 697 |
| 100 | Ga0070681_11444508 | 3300005458 | Bacteria | 612 |
| 101 | Ga0070681_11508865 | 3300005458 | Bacteria | 597 |
| 102 | Ga0070681_11650991 | 3300005458 | Bacteria | 567 |
| 103 | Ga0070706_100152322 | 3300005467 | Bacteria | 2158 |
| 104 | Ga0070706_100692368 | 3300005467 | Bacteria | 945 |
| 105 | Ga0070707_100238202 | 3300005468 | Bacteria | 1771 |
| 106 | Ga0070707_100519330 | 3300005468 | Bacteria | 1153 |
| 107 | Ga0070707_102193157 | 3300005468 | Bacteria | 520 |
| 108 | Ga0070698_100072539 | 3300005471 | Bacteria | 3451 |
| 109 | Ga0070698_100278081 | 3300005471 | Bacteria | 1606 |
| 110 | Ga0070698_101927376 | 3300005471 | Bacteria | 544 |
| 111 | Ga0070699_100888133 | 3300005518 | Bacteria | 816 |
| 112 | Ga0070699_101315620 | 3300005518 | Bacteria | 663 |
| 113 | Ga0070699_101865088 | 3300005518 | Bacteria | 550 |
| 114 | Ga0070679_100000092 | 3300005530 | Bacteria | 68394 |
| 115 | Ga0070679_100029227 | 3300005530 | Bacteria | 5438 |
| 116 | Ga0070679_100062565 | 3300005530 | Bacteria | 3711 |
| 117 | Ga0070679_100080867 | 3300005530 | Bacteria | 3239 |
| 118 | Ga0070679_100084518 | 3300005530 | Bacteria | 3162 |
| 119 | Ga0070679_100524385 | 3300005530 | Bacteria | 1128 |
| 120 | Ga0070679_100595635 | 3300005530 | Bacteria | 1049 |
| 121 | Ga0070679_100789737 | 3300005530 | Bacteria | 893 |
| 122 | Ga0070679_100794366 | 3300005530 | Bacteria | 890 |
| 123 | Ga0070679_101244797 | 3300005530 | Bacteria | 690 |
| 124 | Ga0070684_100401414 | 3300005535 | Bacteria | 1264 |
| 125 | Ga0070684_101083368 | 3300005535 | Bacteria | 753 |
| 126 | Ga0070684_101243371 | 3300005535 | Bacteria | 700 |
| 127 | Ga0070697_100164746 | 3300005536 | Bacteria | 1874 |
| 128 | Ga0070697_100600854 | 3300005536 | Bacteria | 967 |
| 129 | Ga0070697_100616233 | 3300005536 | Bacteria | 954 |
| 130 | Ga0070697_101424906 | 3300005536 | Bacteria | 619 |
| 131 | Ga0068853_101699998 | 3300005539 | Bacteria | 612 |
| 132 | Ga0070672_101282264 | 3300005543 | Bacteria | 654 |
| 133 | Ga0070672_101934847 | 3300005543 | Bacteria | 531 |
| 134 | Ga0070686_100876321 | 3300005544 | Bacteria | 729 |
| 135 | Ga0070665_100500695 | 3300005548 | Bacteria | 1226 |
| 136 | Ga0070665_100635325 | 3300005548 | Bacteria | 1081 |
| 137 | Ga0070704_100982436 | 3300005549 | Bacteria | 763 |
| 138 | Ga0070704_101870888 | 3300005549 | Bacteria | 556 |
| 139 | Ga0068855_100526221 | 3300005563 | Bacteria | 1282 |
| 140 | Ga0068855_100945849 | 3300005563 | Bacteria | 908 |
| 141 | Ga0068855_101400585 | 3300005563 | Bacteria | 721 |
| 142 | Ga0070664_100236744 | 3300005564 | Bacteria | 1638 |
| 143 | Ga0070664_100322139 | 3300005564 | Bacteria | 1401 |
| 144 | Ga0070664_102255163 | 3300005564 | Bacteria | 517 |
| 145 | Ga0068857_101177483 | 3300005577 | Bacteria | 742 |
| 146 | Ga0068857_101746137 | 3300005577 | Bacteria | 609 |
| 147 | Ga0068856_100024043 | 3300005614 | Bacteria | 5929 |
| 148 | Ga0068856_100405109 | 3300005614 | Bacteria | 1383 |
| 149 | Ga0068856_100590823 | 3300005614 | Bacteria | 1131 |
| 150 | Ga0068856_100818816 | 3300005614 | Bacteria | 950 |
| 151 | Ga0070702_100538362 | 3300005615 | Bacteria | 865 |
| 152 | Ga0070702_100614966 | 3300005615 | Bacteria | 817 |
| 153 | Ga0070702_100732494 | 3300005615 | Bacteria | 757 |
| 154 | Ga0068852_100097923 | 3300005616 | Bacteria | 2640 |
| 155 | Ga0068852_100624380 | 3300005616 | Bacteria | 1083 |
| 156 | Ga0068859_100491680 | 3300005617 | Bacteria | 1322 |
| 157 | Ga0068864_100080993 | 3300005618 | Bacteria | 2845 |
| 158 | Ga0068864_100812419 | 3300005618 | Bacteria | 920 |
| 159 | Ga0068863_100023910 | 3300005841 | Bacteria | 5831 |
| 160 | Ga0068863_100250664 | 3300005841 | Bacteria | 1710 |
| 161 | Ga0068858_100879515 | 3300005842 | Bacteria | 876 |
| 162 | Ga0068860_101561098 | 3300005843 | Bacteria | 682 |
| 163 | Ga0068862_101155792 | 3300005844 | Bacteria | 771 |
| 164 | Ga0081540_1004309 | 3300005983 | Bacteria | 10900 |
| 165 | Ga0081539_10000682 | 3300005985 | Bacteria | 67986 |
| 166 | Ga0081539_10230178 | 3300005985 | Bacteria | 837 |
| 167 | Ga0070717_10163155 | 3300006028 | Bacteria | 1934 |
| 168 | Ga0070717_10283457 | 3300006028 | Bacteria | 1470 |
| 169 | Ga0070717_10843886 | 3300006028 | Bacteria | 834 |
| 170 | Ga0070717_11298537 | 3300006028 | Bacteria | 662 |
| 171 | Ga0075365_10260066 | 3300006038 | Bacteria | 1220 |
| 172 | Ga0075364_10177057 | 3300006051 | Bacteria | 1443 |
| 173 | Ga0070716_100011423 | 3300006173 | Bacteria | 4471 |
| 174 | Ga0070716_100880331 | 3300006173 | Bacteria | 700 |
| 175 | Ga0070712_101531799 | 3300006175 | Bacteria | 583 |
| 176 | Ga0075362_10683745 | 3300006177 | Bacteria | 534 |
| 177 | Ga0075366_10151174 | 3300006195 | Bacteria | 1406 |
| 178 | Ga0097621_100951626 | 3300006237 | Bacteria | 802 |
| 179 | Ga0097621_101355377 | 3300006237 | Bacteria | 673 |
| 180 | Ga0075370_10022435 | 3300006353 | Bacteria | 3467 |
| 181 | Ga0068871_100290965 | 3300006358 | Unclassified | 1431 |
| 182 | Ga0075428_100267781 | 3300006844 | Bacteria | 1839 |
| 183 | Ga0075428_100709312 | 3300006844 | Bacteria | 1072 |
| 184 | Ga0075430_101815649 | 3300006846 | Bacteria | 500 |
| 185 | Ga0075431_100025713 | 3300006847 | Bacteria | 6033 |
| 186 | Ga0075431_100068735 | 3300006847 | Bacteria | 3655 |
| 187 | Ga0075431_100272814 | 3300006847 | Bacteria | 1714 |
| 188 | Ga0075434_100962076 | 3300006871 | Bacteria | 868 |
| 189 | Ga0075434_102140820 | 3300006871 | Bacteria | 564 |
| 190 | Ga0075429_100160149 | 3300006880 | Bacteria | 1971 |
| 191 | Ga0075429_100333478 | 3300006880 | Bacteria | 1328 |
| 192 | Ga0068865_101429745 | 3300006881 | Bacteria | 618 |
| 193 | Ga0075436_100017398 | 3300006914 | Bacteria | 4921 |
| 194 | Ga0075436_100041301 | 3300006914 | Bacteria | 3182 |
| 195 | Ga0097620_100491659 | 3300006931 | Bacteria | 1322 |
| 196 | Ga0097620_100501488 | 3300006931 | Bacteria | 1309 |
| 197 | Ga0075435_100042586 | 3300007076 | Bacteria | 3633 |
| 198 | Ga0099795_10005421 | 3300007788 | Bacteria | 3392 |
| 199 | Ga0099795_10073481 | 3300007788 | Bacteria | 1294 |
| 200 | Ga0105251_10453735 | 3300009011 | Bacteria | 595 |
| 201 | Ga0105244_10535353 | 3300009036 | Bacteria | 540 |
| 202 | Ga0105240_10026434 | 3300009093 | Bacteria | 7615 |
| 203 | Ga0105240_10249805 | 3300009093 | Bacteria | 2052 |
| 204 | Ga0105240_10580859 | 3300009093 | Bacteria | 1236 |
| 205 | Ga0105240_10784105 | 3300009093 | Bacteria | 1033 |
| 206 | Ga0111539_10764867 | 3300009094 | Bacteria | 1124 |
| 207 | Ga0111539_11868521 | 3300009094 | Bacteria | 696 |
| 208 | Ga0105245_10261294 | 3300009098 | Bacteria | 1685 |
| 209 | Ga0105245_10815767 | 3300009098 | Bacteria | 972 |
| 210 | Ga0105245_11009173 | 3300009098 | Bacteria | 877 |
| 211 | Ga0105247_10178272 | 3300009101 | Bacteria | 1417 |
| 212 | Ga0114129_10007220 | 3300009147 | Bacteria | 15817 |
| 213 | Ga0114129_11399887 | 3300009147 | Bacteria | 863 |
| 214 | Ga0105243_10535957 | 3300009148 | Bacteria | 1116 |
| 215 | Ga0105243_11720441 | 3300009148 | Bacteria | 656 |
| 216 | Ga0105241_10331359 | 3300009174 | Bacteria | 1316 |
| 217 | Ga0105241_10799143 | 3300009174 | Bacteria | 869 |
| 218 | Ga0105242_11268295 | 3300009176 | Bacteria | 759 |
| 219 | Ga0105248_10212790 | 3300009177 | Bacteria | 2178 |
| 220 | Ga0105248_11249296 | 3300009177 | Bacteria | 840 |
| 221 | Ga0105237_10048424 | 3300009545 | Bacteria | 4272 |
| 222 | Ga0105237_12192833 | 3300009545 | Bacteria | 562 |
| 223 | Ga0105238_10293171 | 3300009551 | Bacteria | 1609 |
| 224 | Ga0105238_10414836 | 3300009551 | Bacteria | 1340 |
| 225 | Ga0105238_10927828 | 3300009551 | Bacteria | 890 |
| 226 | Ga0105238_12611750 | 3300009551 | Bacteria | 541 |
| 227 | Ga0105249_11851369 | 3300009553 | Bacteria | 676 |
| 228 | Ga0130084_1090083 | 3300009835 | Bacteria | 664 |
| 229 | Ga0099796_10058034 | 3300010159 | Bacteria | 1363 |
| 230 | Ga0099796_10080722 | 3300010159 | Bacteria | 1192 |
| 231 | Ga0105239_10816659 | 3300010375 | Bacteria | 1068 |
| 232 | Ga0105246_10068437 | 3300011119 | Bacteria | 2490 |
| 233 | Ga0105246_10626000 | 3300011119 | Bacteria | 933 |
| 234 | Ga0157313_1000260 | 3300012503 | Bacteria | 2465 |
| 235 | Ga0157371_10427337 | 3300013102 | Bacteria | 972 |
| 236 | Ga0157370_10196288 | 3300013104 | Bacteria | 1873 |
| 237 | Ga0157370_11036367 | 3300013104 | Bacteria | 742 |
| 238 | Ga0157370_11582748 | 3300013104 | Unclassified | 589 |
| 239 | Ga0157369_10167634 | 3300013105 | Bacteria | 2315 |
| 240 | Ga0157369_10236478 | 3300013105 | Bacteria | 1909 |
| 241 | Ga0157369_10449235 | 3300013105 | Bacteria | 1335 |
| 242 | Ga0157369_11495199 | 3300013105 | Bacteria | 687 |
| 243 | Ga0157369_12167423 | 3300013105 | Bacteria | 563 |
| 244 | Ga0157374_10329139 | 3300013296 | Bacteria | 1515 |
| 245 | Ga0157374_11348512 | 3300013296 | Bacteria | 736 |
| 246 | Ga0157374_12516480 | 3300013296 | Bacteria | 542 |
| 247 | Ga0157378_10292349 | 3300013297 | Bacteria | 1574 |
| 248 | Ga0157378_11789777 | 3300013297 | Bacteria | 662 |
| 249 | Ga0157378_12151672 | 3300013297 | Bacteria | 609 |
| 250 | Ga0163162_10424979 | 3300013306 | Bacteria | 1461 |
| 251 | Ga0163162_11394749 | 3300013306 | Bacteria | 797 |
| 252 | Ga0157372_10290305 | 3300013307 | Bacteria | 1902 |
| 253 | Ga0157372_10832444 | 3300013307 | Bacteria | 1072 |
| 254 | Ga0157372_11071462 | 3300013307 | Bacteria | 933 |
| 255 | Ga0157372_11835422 | 3300013307 | Bacteria | 697 |
| 256 | Ga0157372_11948704 | 3300013307 | Bacteria | 675 |
| 257 | Ga0157372_12868707 | 3300013307 | Bacteria | 552 |
| 258 | Ga0157372_13095415 | 3300013307 | Bacteria | 531 |
| 259 | Ga0157372_13414242 | 3300013307 | Bacteria | 505 |
| 260 | Ga0157375_10625322 | 3300013308 | Bacteria | 1234 |
| 261 | Ga0157375_12184903 | 3300013308 | Bacteria | 659 |
| 262 | Ga0163163_10304059 | 3300014325 | Bacteria | 1647 |
| 263 | Ga0163163_10729459 | 3300014325 | Bacteria | 1054 |
| 264 | Ga0163163_11876218 | 3300014325 | Bacteria | 659 |
| 265 | Ga0157380_12054963 | 3300014326 | Bacteria | 634 |
| 266 | Ga0157380_12809773 | 3300014326 | Bacteria | 553 |
| 267 | Ga0182008_10027574 | 3300014497 | Bacteria | 2876 |
| 268 | Ga0182008_10150466 | 3300014497 | Bacteria | 1167 |
| 269 | Ga0182008_10323467 | 3300014497 | Bacteria | 812 |
| 270 | Ga0182008_10640171 | 3300014497 | Bacteria | 601 |
| 271 | Ga0157377_10579156 | 3300014745 | Bacteria | 797 |
| 272 | Ga0157379_10296056 | 3300014968 | Bacteria | 1474 |
| 273 | Ga0157379_10683831 | 3300014968 | Bacteria | 962 |
| 274 | Ga0157379_10732300 | 3300014968 | Bacteria | 930 |
| 275 | Ga0157376_11357085 | 3300014969 | Bacteria | 742 |
| 276 | Ga0157376_12779127 | 3300014969 | Bacteria | 529 |
| 277 | Ga0157376_12869350 | 3300014969 | Bacteria | 522 |
| 278 | Ga0182005_1023773 | 3300015265 | Bacteria | 1674 |
| 279 | Ga0163161_10625705 | 3300017792 | Bacteria | 890 |
| 280 | Ga0163161_11055182 | 3300017792 | Bacteria | 696 |
| 281 | Ga0197907_10406821 | 3300020069 | Bacteria | 885 |
| 282 | Ga0197907_10478756 | 3300020069 | Bacteria | 712 |
| 283 | Ga0197907_10515808 | 3300020069 | Bacteria | 1650 |
| 284 | Ga0197907_10769917 | 3300020069 | Bacteria | 713 |
| 285 | Ga0197907_10831860 | 3300020069 | Bacteria | 737 |
| 286 | Ga0197907_10906054 | 3300020069 | Bacteria | 1180 |
| 287 | Ga0197907_10952012 | 3300020069 | Bacteria | 612 |
| 288 | Ga0197907_11289850 | 3300020069 | Bacteria | 789 |
| 289 | Ga0197907_11433083 | 3300020069 | Bacteria | 845 |
| 290 | Ga0206356_10098207 | 3300020070 | Bacteria | 639 |
| 291 | Ga0206356_10112665 | 3300020070 | Bacteria | 726 |
| 292 | Ga0206356_10118500 | 3300020070 | Bacteria | 677 |
| 293 | Ga0206356_10199490 | 3300020070 | Bacteria | 777 |
| 294 | Ga0206356_10367413 | 3300020070 | Bacteria | 1027 |
| 295 | Ga0206356_10476900 | 3300020070 | Bacteria | 1171 |
| 296 | Ga0206356_10609589 | 3300020070 | Bacteria | 529 |
| 297 | Ga0206356_10620570 | 3300020070 | Bacteria | 1006 |
| 298 | Ga0206356_10766589 | 3300020070 | Bacteria | 954 |
| 299 | Ga0206356_11126089 | 3300020070 | Bacteria | 598 |
| 300 | Ga0206356_11592613 | 3300020070 | Bacteria | 835 |
| 301 | Ga0206356_11827344 | 3300020070 | Bacteria | 849 |
| 302 | Ga0206356_11912411 | 3300020070 | Bacteria | 801 |
| 303 | Ga0206349_1223975 | 3300020075 | Bacteria | 1014 |
| 304 | Ga0206349_1304958 | 3300020075 | Bacteria | 664 |
| 305 | Ga0206349_1307432 | 3300020075 | Bacteria | 565 |
| 306 | Ga0206349_1795798 | 3300020075 | Bacteria | 510 |
| 307 | Ga0206349_1928615 | 3300020075 | Bacteria | 653 |
| 308 | Ga0206355_1240335 | 3300020076 | Bacteria | 550 |
| 309 | Ga0206355_1311754 | 3300020076 | Bacteria | 862 |
| 310 | Ga0206355_1550074 | 3300020076 | Bacteria | 507 |
| 311 | Ga0206355_1647933 | 3300020076 | Bacteria | 516 |
| 312 | Ga0206351_10069959 | 3300020077 | Unclassified | 819 |
| 313 | Ga0206351_10276363 | 3300020077 | Bacteria | 606 |
| 314 | Ga0206351_10716824 | 3300020077 | Bacteria | 621 |
| 315 | Ga0206351_10843227 | 3300020077 | Bacteria | 620 |
| 316 | Ga0206351_10855027 | 3300020077 | Bacteria | 945 |
| 317 | Ga0206351_10992582 | 3300020077 | Bacteria | 764 |
| 318 | Ga0206352_10212532 | 3300020078 | Bacteria | 1112 |
| 319 | Ga0206352_10558699 | 3300020078 | Bacteria | 762 |
| 320 | Ga0206352_10575761 | 3300020078 | Bacteria | 909 |
| 321 | Ga0206352_11310539 | 3300020078 | Bacteria | 551 |
| 322 | Ga0206350_10147246 | 3300020080 | Bacteria | 901 |
| 323 | Ga0206350_10196722 | 3300020080 | Bacteria | 1144 |
| 324 | Ga0206350_10402406 | 3300020080 | Bacteria | 623 |
| 325 | Ga0206350_10487997 | 3300020080 | Bacteria | 585 |
| 326 | Ga0206350_10697263 | 3300020080 | Bacteria | 729 |
| 327 | Ga0206354_10393317 | 3300020081 | Bacteria | 1116 |
| 328 | Ga0206354_10395330 | 3300020081 | Bacteria | 837 |
| 329 | Ga0206354_10964643 | 3300020081 | Bacteria | 2443 |
| 330 | Ga0206354_11184638 | 3300020081 | Bacteria | 633 |
| 331 | Ga0206354_11215295 | 3300020081 | Bacteria | 3229 |
| 332 | Ga0206354_11595272 | 3300020081 | Bacteria | 817 |
| 333 | Ga0206353_10558440 | 3300020082 | Bacteria | 508 |
| 334 | Ga0206353_10848610 | 3300020082 | Bacteria | 1353 |
| 335 | Ga0206353_11042105 | 3300020082 | Bacteria | 2410 |
| 336 | Ga0206353_11068100 | 3300020082 | Bacteria | 2293 |
| 337 | Ga0206353_11092044 | 3300020082 | Bacteria | 1151 |
| 338 | Ga0206353_11438092 | 3300020082 | Bacteria | 599 |
| 339 | Ga0206353_11481534 | 3300020082 | Bacteria | 1944 |
| 340 | Ga0206353_11956454 | 3300020082 | Bacteria | 847 |
| 341 | Ga0154015_1201380 | 3300020610 | Bacteria | 819 |
| 342 | Ga0154015_1262035 | 3300020610 | Bacteria | 634 |
| 343 | Ga0154015_1606074 | 3300020610 | Bacteria | 657 |
| 344 | Ga0154015_1629110 | 3300020610 | Bacteria | 608 |
| 345 | Ga0213874_10094303 | 3300021377 | Bacteria | 987 |
| 346 | Ga0213876_10037165 | 3300021384 | Bacteria | 2569 |
| 347 | Ga0213876_10448867 | 3300021384 | Bacteria | 686 |
| 348 | Ga0213875_10000615 | 3300021388 | Bacteria | 28752 |
| 349 | Ga0213875_10001186 | 3300021388 | Bacteria | 17826 |
| 350 | Ga0213875_10266563 | 3300021388 | Bacteria | 808 |
| 351 | Ga0213875_10412719 | 3300021388 | Bacteria | 644 |
| 352 | Ga0224712_10110938 | 3300022467 | Bacteria | 1176 |
| 353 | Ga0224712_10171710 | 3300022467 | Bacteria | 973 |
| 354 | Ga0224712_10207099 | 3300022467 | Bacteria | 893 |
| 355 | Ga0224712_10284314 | 3300022467 | Bacteria | 771 |
| 356 | Ga0224712_10291278 | 3300022467 | Bacteria | 762 |
| 357 | Ga0224712_10299038 | 3300022467 | Bacteria | 752 |
| 358 | Ga0224712_10316594 | 3300022467 | Bacteria | 732 |
| 359 | Ga0224712_10320558 | 3300022467 | Bacteria | 728 |
| 360 | Ga0224712_10427613 | 3300022467 | Bacteria | 634 |
| 361 | Ga0224712_10531577 | 3300022467 | Bacteria | 570 |
| 362 | Ga0256744_106735 | 3300023309 | Bacteria | 840 |
| 363 | Ga0207696_1084120 | 3300025711 | Bacteria | 877 |
| 364 | Ga0207655_1094961 | 3300025728 | Bacteria | 1041 |
| 365 | Ga0207713_1001777 | 3300025735 | Bacteria | 16489 |
| 366 | Ga0207682_10416738 | 3300025893 | Bacteria | 635 |
| 367 | Ga0207642_10807183 | 3300025899 | Bacteria | 597 |
| 368 | Ga0207710_10493867 | 3300025900 | Bacteria | 635 |
| 369 | Ga0207688_11011175 | 3300025901 | Bacteria | 525 |
| 370 | Ga0207699_10141173 | 3300025906 | Bacteria | 1583 |
| 371 | Ga0207705_10316856 | 3300025909 | Bacteria | 1198 |
| 372 | Ga0207705_10366980 | 3300025909 | Bacteria | 1111 |
| 373 | Ga0207705_11023085 | 3300025909 | Bacteria | 638 |
| 374 | Ga0207684_11067781 | 3300025910 | Bacteria | 673 |
| 375 | Ga0207684_11495836 | 3300025910 | Bacteria | 550 |
| 376 | Ga0207707_10000584 | 3300025912 | Bacteria | 37030 |
| 377 | Ga0207707_10046626 | 3300025912 | Bacteria | 3775 |
| 378 | Ga0207707_10251711 | 3300025912 | Bacteria | 1534 |
| 379 | Ga0207707_10311873 | 3300025912 | Bacteria | 1359 |
| 380 | Ga0207707_10494254 | 3300025912 | Bacteria | 1044 |
| 381 | Ga0207707_11153308 | 3300025912 | Bacteria | 629 |
| 382 | Ga0207707_11275011 | 3300025912 | Bacteria | 591 |
| 383 | Ga0207707_11381083 | 3300025912 | Bacteria | 563 |
| 384 | Ga0207707_11405460 | 3300025912 | Bacteria | 556 |
| 385 | Ga0207695_10213125 | 3300025913 | Bacteria | 1841 |
| 386 | Ga0207695_10219474 | 3300025913 | Unclassified | 1809 |
| 387 | Ga0207695_11080116 | 3300025913 | Bacteria | 682 |
| 388 | Ga0207671_10020279 | 3300025914 | Bacteria | 5063 |
| 389 | Ga0207693_10080900 | 3300025915 | Bacteria | 2543 |
| 390 | Ga0207693_11096898 | 3300025915 | Bacteria | 605 |
| 391 | Ga0207663_10611649 | 3300025916 | Bacteria | 857 |
| 392 | Ga0207660_10000533 | 3300025917 | Bacteria | 25452 |
| 393 | Ga0207660_10094365 | 3300025917 | Bacteria | 2224 |
| 394 | Ga0207660_10096255 | 3300025917 | Bacteria | 2204 |
| 395 | Ga0207660_10291510 | 3300025917 | Bacteria | 1298 |
| 396 | Ga0207660_11030742 | 3300025917 | Unclassified | 671 |
| 397 | Ga0207660_11290092 | 3300025917 | Bacteria | 593 |
| 398 | Ga0207660_11437351 | 3300025917 | Bacteria | 558 |
| 399 | Ga0207657_10306188 | 3300025919 | Bacteria | 1258 |
| 400 | Ga0207649_10953642 | 3300025920 | Bacteria | 674 |
| 401 | Ga0207652_10000092 | 3300025921 | Bacteria | 98391 |
| 402 | Ga0207652_10006782 | 3300025921 | Bacteria | 9234 |
| 403 | Ga0207652_10176750 | 3300025921 | Bacteria | 1917 |
| 404 | Ga0207652_10245676 | 3300025921 | Bacteria | 1614 |
| 405 | Ga0207652_10309097 | 3300025921 | Bacteria | 1427 |
| 406 | Ga0207652_10313792 | 3300025921 | Bacteria | 1415 |
| 407 | Ga0207652_10583624 | 3300025921 | Bacteria | 1003 |
| 408 | Ga0207652_11277598 | 3300025921 | Bacteria | 636 |
| 409 | Ga0207646_10142985 | 3300025922 | Bacteria | 2155 |
| 410 | Ga0207646_10449608 | 3300025922 | Bacteria | 1163 |
| 411 | Ga0207646_11107057 | 3300025922 | Bacteria | 697 |
| 412 | Ga0207681_10836055 | 3300025923 | Bacteria | 770 |
| 413 | Ga0207694_10300125 | 3300025924 | Bacteria | 1322 |
| 414 | Ga0207694_10592168 | 3300025924 | Bacteria | 932 |
| 415 | Ga0207650_10934502 | 3300025925 | Bacteria | 737 |
| 416 | Ga0207650_11486474 | 3300025925 | Bacteria | 576 |
| 417 | Ga0207659_10456923 | 3300025926 | Bacteria | 1076 |
| 418 | Ga0207659_10546160 | 3300025926 | Bacteria | 985 |
| 419 | Ga0207687_10778830 | 3300025927 | Bacteria | 815 |
| 420 | Ga0207687_11187786 | 3300025927 | Bacteria | 656 |
| 421 | Ga0207700_10043031 | 3300025928 | Bacteria | 3315 |
| 422 | Ga0207700_10205227 | 3300025928 | Bacteria | 1663 |
| 423 | Ga0207700_10850449 | 3300025928 | Bacteria | 816 |
| 424 | Ga0207700_11262225 | 3300025928 | Bacteria | 659 |
| 425 | Ga0207700_11522231 | 3300025928 | Bacteria | 593 |
| 426 | Ga0207664_10072702 | 3300025929 | Bacteria | 2773 |
| 427 | Ga0207664_10097512 | 3300025929 | Bacteria | 2422 |
| 428 | Ga0207664_10149767 | 3300025929 | Bacteria | 1981 |
| 429 | Ga0207664_10190983 | 3300025929 | Bacteria | 1763 |
| 430 | Ga0207664_10673415 | 3300025929 | Bacteria | 930 |
| 431 | Ga0207664_11287199 | 3300025929 | Bacteria | 650 |
| 432 | Ga0207664_11485652 | 3300025929 | Bacteria | 599 |
| 433 | Ga0207644_10107281 | 3300025931 | Bacteria | 2107 |
| 434 | Ga0207690_10366883 | 3300025932 | Bacteria | 1142 |
| 435 | Ga0207690_10419284 | 3300025932 | Bacteria | 1071 |
| 436 | Ga0207706_10167834 | 3300025933 | Bacteria | 1929 |
| 437 | Ga0207706_10372934 | 3300025933 | Bacteria | 1239 |
| 438 | Ga0207706_10417972 | 3300025933 | Bacteria | 1162 |
| 439 | Ga0207709_10165129 | 3300025935 | Bacteria | 1548 |
| 440 | Ga0207670_10295409 | 3300025936 | Bacteria | 1267 |
| 441 | Ga0207670_10599118 | 3300025936 | Bacteria | 905 |
| 442 | Ga0207670_11314085 | 3300025936 | Bacteria | 613 |
| 443 | Ga0207670_11580868 | 3300025936 | Unclassified | 558 |
| 444 | Ga0207669_11470512 | 3300025937 | Bacteria | 581 |
| 445 | Ga0207704_10705457 | 3300025938 | Bacteria | 836 |
| 446 | Ga0207665_10007124 | 3300025939 | Bacteria | 7403 |
| 447 | Ga0207665_10185402 | 3300025939 | Bacteria | 1509 |
| 448 | Ga0207711_10539672 | 3300025941 | Bacteria | 1088 |
| 449 | Ga0207661_10236664 | 3300025944 | Bacteria | 1619 |
| 450 | Ga0207661_10684280 | 3300025944 | Unclassified | 943 |
| 451 | Ga0207679_10239452 | 3300025945 | Bacteria | 1537 |
| 452 | Ga0207679_11795864 | 3300025945 | Bacteria | 560 |
| 453 | Ga0207667_10613788 | 3300025949 | Bacteria | 1096 |
| 454 | Ga0207667_11474231 | 3300025949 | Bacteria | 652 |
| 455 | Ga0207667_11569406 | 3300025949 | Bacteria | 628 |
| 456 | Ga0207712_11410193 | 3300025961 | Bacteria | 623 |
| 457 | Ga0207712_11556920 | 3300025961 | Bacteria | 592 |
| 458 | Ga0207640_10667515 | 3300025981 | Bacteria | 888 |
| 459 | Ga0207640_11081302 | 3300025981 | Bacteria | 709 |
| 460 | Ga0207677_10708569 | 3300026023 | Bacteria | 894 |
| 461 | Ga0207703_10814745 | 3300026035 | Bacteria | 892 |
| 462 | Ga0207703_11098649 | 3300026035 | Bacteria | 764 |
| 463 | Ga0207703_11860188 | 3300026035 | Bacteria | 578 |
| 464 | Ga0207639_11118327 | 3300026041 | Bacteria | 739 |
| 465 | Ga0207639_12083042 | 3300026041 | Bacteria | 528 |
| 466 | Ga0207678_10327848 | 3300026067 | Bacteria | 1318 |
| 467 | Ga0207678_11175299 | 3300026067 | Bacteria | 679 |
| 468 | Ga0207678_11645101 | 3300026067 | Bacteria | 565 |
| 469 | Ga0207708_10350443 | 3300026075 | Bacteria | 1211 |
| 470 | Ga0207708_10511955 | 3300026075 | Bacteria | 1007 |
| 471 | Ga0207702_10230790 | 3300026078 | Bacteria | 1730 |
| 472 | Ga0207702_10296670 | 3300026078 | Bacteria | 1533 |
| 473 | Ga0207702_10587224 | 3300026078 | Bacteria | 1092 |
| 474 | Ga0207641_10063495 | 3300026088 | Bacteria | 3154 |
| 475 | Ga0207641_10584304 | 3300026088 | Bacteria | 1092 |
| 476 | Ga0207676_10296215 | 3300026095 | Bacteria | 1475 |
| 477 | Ga0207676_10798269 | 3300026095 | Bacteria | 921 |
| 478 | Ga0207676_11937149 | 3300026095 | Bacteria | 588 |
| 479 | Ga0207674_10250658 | 3300026116 | Bacteria | 1717 |
| 480 | Ga0207674_10610647 | 3300026116 | Bacteria | 1053 |
| 481 | Ga0207674_11023874 | 3300026116 | Bacteria | 795 |
| 482 | Ga0207683_10203579 | 3300026121 | Bacteria | 1800 |
| 483 | Ga0207683_10319514 | 3300026121 | Bacteria | 1422 |
| 484 | Ga0207683_11458947 | 3300026121 | Bacteria | 632 |
| 485 | Ga0209969_1026630 | 3300027360 | Bacteria | 875 |
| 486 | Ga0209981_1010438 | 3300027378 | Bacteria | 1274 |
| 487 | Ga0209179_1027274 | 3300027512 | Bacteria | 1151 |
| 488 | Ga0209968_1009840 | 3300027526 | Bacteria | 1466 |
| 489 | Ga0209999_1005895 | 3300027543 | Bacteria | 2203 |
| 490 | Ga0209982_1016465 | 3300027552 | Bacteria | 1124 |
| 491 | Ga0210002_1032425 | 3300027617 | Bacteria | 871 |
| 492 | Ga0209966_1074084 | 3300027695 | Bacteria | 749 |
| 493 | Ga0209974_10014857 | 3300027876 | Bacteria | 2585 |
| 494 | Ga0268266_10487636 | 3300028379 | Bacteria | 1175 |
| 495 | Ga0268266_10845016 | 3300028379 | Bacteria | 885 |
| 496 | Ga0268265_11084284 | 3300028380 | Bacteria | 794 |
| 497 | Ga0265337_1019915 | 3300028556 | Unclassified | 2109 |
| 498 | Ga0265337_1150680 | 3300028556 | Bacteria | 630 |
| 499 | Ga0265326_10156197 | 3300028558 | Bacteria | 652 |
| 500 | Ga0265336_10011537 | 3300028666 | Unclassified | 2999 |
| 501 | Ga0265336_10213078 | 3300028666 | Bacteria | 574 |
| 502 | Ga0265338_10004574 | 3300028800 | Bacteria | 18611 |
| 503 | Ga0265338_10168144 | 3300028800 | Bacteria | 1685 |
| 504 | Ga0265338_10622045 | 3300028800 | Bacteria | 751 |
| 505 | Ga0265763_1055331 | 3300030763 | Bacteria | 508 |
| 506 | Ga0265330_10121909 | 3300031235 | Bacteria | 1111 |
| 507 | Ga0265332_10409833 | 3300031238 | Bacteria | 560 |
| 508 | Ga0265320_10314666 | 3300031240 | Bacteria | 692 |
| 509 | Ga0265339_10538710 | 3300031249 | Bacteria | 537 |
| 510 | Ga0265327_10000067 | 3300031251 | Bacteria | 221289 |
| 511 | Ga0265327_10004149 | 3300031251 | Bacteria | 13076 |
| 512 | Ga0265327_10011608 | 3300031251 | Bacteria | 6043 |
| 513 | Ga0265327_10141435 | 3300031251 | Bacteria | 1124 |
| 514 | Ga0265316_10052910 | 3300031344 | Bacteria | 3183 |
| 515 | Ga0265316_10450785 | 3300031344 | Bacteria | 923 |
| 516 | Ga0307513_10082362 | 3300031456 | Bacteria | 3313 |
| 517 | Ga0307408_100826775 | 3300031548 | Bacteria | 843 |
| 518 | Ga0307408_101441333 | 3300031548 | Bacteria | 649 |
| 519 | Ga0307508_10027405 | 3300031616 | Bacteria | 5157 |
| 520 | Ga0307508_10571319 | 3300031616 | Bacteria | 730 |
| 521 | Ga0316575_10004351 | 3300031665 | Bacteria | 4980 |
| 522 | Ga0316575_10139113 | 3300031665 | Bacteria | 998 |
| 523 | Ga0316579_10261263 | 3300031691 | Unclassified | 837 |
| 524 | Ga0316579_10397479 | 3300031691 | Bacteria | 666 |
| 525 | Ga0316579_10409096 | 3300031691 | Unclassified | 656 |
| 526 | Ga0265314_10237624 | 3300031711 | Bacteria | 1053 |
| 527 | Ga0265342_10040927 | 3300031712 | Bacteria | 2808 |
| 528 | Ga0265342_10185085 | 3300031712 | Bacteria | 1139 |
| 529 | Ga0265342_10274952 | 3300031712 | Bacteria | 893 |
| 530 | Ga0316576_10000084 | 3300031727 | Bacteria | 32624 |
| 531 | Ga0316576_10008056 | 3300031727 | Bacteria | 6684 |
| 532 | Ga0316576_10075389 | 3300031727 | Bacteria | 2495 |
| 533 | Ga0316576_10472204 | 3300031727 | Bacteria | 925 |
| 534 | Ga0316576_10542960 | 3300031727 | Bacteria | 852 |
| 535 | Ga0316576_10612615 | 3300031727 | Unclassified | 794 |
| 536 | Ga0316576_10740691 | 3300031727 | Bacteria | 710 |
| 537 | Ga0316576_11169675 | 3300031727 | Bacteria | 544 |
| 538 | Ga0316578_10001418 | 3300031728 | Bacteria | 9702 |
| 539 | Ga0316578_10041078 | 3300031728 | Bacteria | 2677 |
| 540 | Ga0316578_10264588 | 3300031728 | Bacteria | 1031 |
| 541 | Ga0316578_10340022 | 3300031728 | Bacteria | 894 |
| 542 | Ga0316578_10778068 | 3300031728 | Bacteria | 555 |
| 543 | Ga0316578_10797582 | 3300031728 | Bacteria | 547 |
| 544 | Ga0307405_10048648 | 3300031731 | Bacteria | 2616 |
| 545 | Ga0316577_10000019 | 3300031733 | Bacteria | 35179 |
| 546 | Ga0316577_10001425 | 3300031733 | Bacteria | 11299 |
| 547 | Ga0316577_10024900 | 3300031733 | Bacteria | 3328 |
| 548 | Ga0316577_10025071 | 3300031733 | Bacteria | 3317 |
| 549 | Ga0316577_10050159 | 3300031733 | Bacteria | 2329 |
| 550 | Ga0316577_10058738 | 3300031733 | Bacteria | 2148 |
| 551 | Ga0316577_10072040 | 3300031733 | Bacteria | 1929 |
| 552 | Ga0307413_10342383 | 3300031824 | Bacteria | 1150 |
| 553 | Ga0307413_10674438 | 3300031824 | Bacteria | 855 |
| 554 | Ga0307410_10166113 | 3300031852 | Bacteria | 1658 |
| 555 | Ga0307410_10345352 | 3300031852 | Bacteria | 1187 |
| 556 | Ga0307410_10655088 | 3300031852 | Bacteria | 881 |
| 557 | Ga0307406_10032565 | 3300031901 | Bacteria | 3183 |
| 558 | Ga0307406_10143535 | 3300031901 | Bacteria | 1693 |
| 559 | Ga0307406_10177186 | 3300031901 | Bacteria | 1549 |
| 560 | Ga0307406_10667629 | 3300031901 | Bacteria | 864 |
| 561 | Ga0307406_10858207 | 3300031901 | Bacteria | 770 |
| 562 | Ga0307407_10112997 | 3300031903 | Bacteria | 1708 |
| 563 | Ga0307407_10145711 | 3300031903 | Bacteria | 1533 |
| 564 | Ga0307407_10921455 | 3300031903 | Bacteria | 671 |
| 565 | Ga0307407_11064187 | 3300031903 | Bacteria | 627 |
| 566 | Ga0307412_10144736 | 3300031911 | Bacteria | 1745 |
| 567 | Ga0307412_10194667 | 3300031911 | Bacteria | 1535 |
| 568 | Ga0307412_10201899 | 3300031911 | Bacteria | 1510 |
| 569 | Ga0307409_100126564 | 3300031995 | Bacteria | 2174 |
| 570 | Ga0307409_100137310 | 3300031995 | Bacteria | 2100 |
| 571 | Ga0307409_100196515 | 3300031995 | Bacteria | 1800 |
| 572 | Ga0307409_100224818 | 3300031995 | Bacteria | 1697 |
| 573 | Ga0307409_100602477 | 3300031995 | Bacteria | 1086 |
| 574 | Ga0307409_101300755 | 3300031995 | Bacteria | 752 |
| 575 | Ga0307409_101817587 | 3300031995 | Bacteria | 638 |
| 576 | Ga0307409_101828938 | 3300031995 | Bacteria | 636 |
| 577 | Ga0307409_102187226 | 3300031995 | Bacteria | 583 |
| 578 | Ga0307409_102295428 | 3300031995 | Bacteria | 569 |
| 579 | Ga0307416_100709939 | 3300032002 | Bacteria | 1095 |
| 580 | Ga0307416_101872005 | 3300032002 | Bacteria | 703 |
| 581 | Ga0307416_101972677 | 3300032002 | Bacteria | 686 |
| 582 | Ga0307416_102058835 | 3300032002 | Bacteria | 673 |
| 583 | Ga0307416_102088886 | 3300032002 | Bacteria | 668 |
| 584 | Ga0307414_10035189 | 3300032004 | Bacteria | 3330 |
| 585 | Ga0307414_10038299 | 3300032004 | Bacteria | 3219 |
| 586 | Ga0307414_10073222 | 3300032004 | Bacteria | 2477 |
| 587 | Ga0307414_11132015 | 3300032004 | Bacteria | 723 |
| 588 | Ga0307414_11842676 | 3300032004 | Bacteria | 564 |
| 589 | Ga0307411_10121707 | 3300032005 | Bacteria | 1889 |
| 590 | Ga0307411_10148068 | 3300032005 | Bacteria | 1741 |
| 591 | Ga0307411_11964466 | 3300032005 | Bacteria | 545 |
| 592 | Ga0307415_100134788 | 3300032126 | Bacteria | 1876 |
| 593 | Ga0307415_100191393 | 3300032126 | Bacteria | 1615 |
| 594 | Ga0307415_101729521 | 3300032126 | Bacteria | 604 |
| 595 | Ga0307415_101748991 | 3300032126 | Bacteria | 600 |
| 596 | Ga0307415_101828668 | 3300032126 | Bacteria | 588 |
| 597 | Ga0307415_102176557 | 3300032126 | Bacteria | 542 |
| 598 | Ga0307415_102273842 | 3300032126 | Bacteria | 531 |
| 599 | Ga0316583_10005213 | 3300032133 | Bacteria | 4660 |
| 600 | Ga0316583_10173345 | 3300032133 | Bacteria | 750 |
| 601 | Ga0316583_10202301 | 3300032133 | Bacteria | 689 |
| 602 | Ga0316585_10000385 | 3300032137 | Bacteria | 10252 |
| 603 | Ga0316585_10002483 | 3300032137 | Bacteria | 4974 |
| 604 | Ga0316585_10087353 | 3300032137 | Bacteria | 1018 |
| 605 | Ga0316585_10193046 | 3300032137 | Bacteria | 673 |
| 606 | Ga0316580_10001806 | 3300032139 | Bacteria | 5732 |
| 607 | Ga0316580_10002999 | 3300032139 | Bacteria | 4742 |
| 608 | Ga0316580_10143768 | 3300032139 | Bacteria | 732 |
| 609 | Ga0316593_10033414 | 3300032168 | Bacteria | 1684 |
| 610 | Ga0316593_10053490 | 3300032168 | Bacteria | 1368 |
| 611 | Ga0316593_10063762 | 3300032168 | Bacteria | 1264 |
| 612 | Ga0316593_10064615 | 3300032168 | Bacteria | 1256 |
| 613 | Ga0316593_10124721 | 3300032168 | Bacteria | 926 |
| 614 | Ga0316593_10135634 | 3300032168 | Bacteria | 890 |
| 615 | Ga0316593_10162027 | 3300032168 | Bacteria | 817 |
| 616 | Ga0316593_10164674 | 3300032168 | Bacteria | 811 |
| 617 | Ga0316593_10181662 | 3300032168 | Unclassified | 773 |
| 618 | Ga0316593_10367128 | 3300032168 | Bacteria | 553 |
| 619 | Ga0316593_10376829 | 3300032168 | Unclassified | 546 |
| 620 | Ga0316592_1015961 | 3300033524 | Bacteria | 1567 |
| 621 | Ga0316592_1018872 | 3300033524 | Bacteria | 1456 |
| 622 | Ga0316592_1029346 | 3300033524 | Bacteria | 1193 |
| 623 | Ga0316592_1045756 | 3300033524 | Bacteria | 974 |
| 624 | Ga0316592_1059328 | 3300033524 | Bacteria | 858 |
| 625 | Ga0316586_1011407 | 3300033527 | Bacteria | 1361 |
| 626 | Ga0316586_1040230 | 3300033527 | Bacteria | 820 |
| 627 | Ga0316586_1070506 | 3300033527 | Bacteria | 643 |
| 628 | Ga0316588_1024559 | 3300033528 | Bacteria | 1387 |
| 629 | Ga0316588_1050008 | 3300033528 | Bacteria | 1012 |
| 630 | Ga0316588_1060981 | 3300033528 | Bacteria | 920 |
| 631 | Ga0316588_1081704 | 3300033528 | Bacteria | 801 |
| 632 | Ga0316587_1067308 | 3300033529 | Bacteria | 668 |
| 633 | Ga0316587_1068251 | 3300033529 | Bacteria | 664 |
| 634 | Ga0316596_1016638 | 3300033541 | Bacteria | 1844 |
| 635 | Ga0316596_1021561 | 3300033541 | Bacteria | 1643 |
| 636 | Ga0316596_1031158 | 3300033541 | Bacteria | 1384 |
| 637 | Ga0316596_1032577 | 3300033541 | Bacteria | 1356 |
| 638 | Ga0316596_1065344 | 3300033541 | Bacteria | 972 |
| 639 | Ga0316596_1066060 | 3300033541 | Bacteria | 967 |
| 640 | Ga0316596_1068235 | 3300033541 | Bacteria | 951 |
| 641 | Ga0316596_1071025 | 3300033541 | Unclassified | 932 |
| 642 | Ga0316596_1079361 | 3300033541 | Bacteria | 882 |
| 643 | Ga0316596_1081574 | 3300033541 | Bacteria | 869 |
| 644 | Ga0316596_1115326 | 3300033541 | Unclassified | 730 |
| 645 | Ga0316596_1126610 | 3300033541 | Bacteria | 696 |
| 646 | Ga0316596_1170719 | 3300033541 | Bacteria | 600 |
| 647 | Ga0373930_0049504 | 3300034816 | Bacteria | 914 |
| 648 | Ga0373959_0166904 | 3300034820 | Bacteria | 565 |
| 649 | Ga0373926_0015576 | 3300035083 | Bacteria | 2592 |
| 650 | Ga0373926_0366649 | 3300035083 | Bacteria | 566 |
| 651 | Ga0373928_0086941 | 3300035084 | Bacteria | 797 |
| 652 | Ga0373928_0225712 | 3300035084 | Unclassified | 549 |
| 653 | Ga0373940_0119284 | 3300035088 | Bacteria | 817 |
| 654 | Ga0373932_0036064 | 3300035112 | Bacteria | 1402 |
| 655 | Ga0373936_0509482 | 3300035113 | Bacteria | 560 |
| 656 | Ga0373939_0079682 | 3300035114 | Bacteria | 1085 |
| 657 | Ga0373941_0038593 | 3300035115 | Bacteria | 1463 |
| 658 | Ga0373941_0072986 | 3300035115 | Bacteria | 1143 |
| 659 | Ga0373954_0343964 | 3300035118 | Bacteria | 737 |
| 660 | Ga0373956_0278485 | 3300035119 | Bacteria | 796 |
| 661 | Ga0373957_0388099 | 3300035120 | Bacteria | 600 |
| 662 | Ga0373960_0391170 | 3300035121 | Bacteria | 535 |
| 663 | Ga0373943_0281301 | 3300035170 | Bacteria | 941 |
| 664 | Ga0373943_0405107 | 3300035170 | Bacteria | 788 |
| 665 | Ga0373946_0644426 | 3300035171 | Bacteria | 551 |
| 666 | Ga0373955_0065584 | 3300035172 | Bacteria | 2016 |
| 667 | Ga0316574_0030395 | 3300035398 | Bacteria | 3271 |
| 668 | Ga0316574_0054640 | 3300035398 | Bacteria | 2494 |
| 669 | Ga0316574_0064233 | 3300035398 | Unclassified | 2309 |
| 670 | Ga0316574_0602011 | 3300035398 | Bacteria | 679 |
| 671 | Ga0316574_0631897 | 3300035398 | Bacteria | 660 |
| 672 | Ga0316574_0895400 | 3300035398 | Bacteria | 537 |
| 673 | Ga0316574_1000456 | 3300035398 | Bacteria | 503 |
| 674 | Ga0373931_0007124 | 3300035691 | Bacteria | 5259 |
| 675 | Ga0373931_0025954 | 3300035691 | Bacteria | 2977 |
| 676 | Ga0373931_0866174 | 3300035691 | Bacteria | 605 |
| 677 | Ga0373931_0868492 | 3300035691 | Bacteria | 605 |
| 678 | Ga0373935_0986997 | 3300035692 | Bacteria | 625 |
| 679 | Ga0373927_0216322 | 3300035695 | Bacteria | 1259 |
| 680 | Ga0373927_0462047 | 3300035695 | Bacteria | 838 |
| 681 | Ga0373927_1183836 | 3300035695 | Bacteria | 504 |
| 682 | Ga0373933_0038013 | 3300035724 | Bacteria | 2827 |
| 683 | Ga0373933_0606778 | 3300035724 | Bacteria | 719 |
| 684 | Ga0373947_0152637 | 3300035725 | Bacteria | 1488 |
| 685 | Ga0373947_0248589 | 3300035725 | Bacteria | 1175 |
| 686 | Ga0373937_0002155 | 3300036401 | Bacteria | 16482 |
| 687 | Ga0373937_0008457 | 3300036401 | Bacteria | 8945 |
| 688 | Ga0373937_1058555 | 3300036401 | Bacteria | 760 |
| 689 | Ga0373937_1178266 | 3300036401 | Unclassified | 715 |
| 690 | Ga0316582_0000072 | 3300036647 | Bacteria | 25632 |
| 691 | Ga0316582_0000333 | 3300036647 | Bacteria | 16618 |
| 692 | Ga0316582_0029641 | 3300036647 | Bacteria | 3326 |
| 693 | Ga0316582_0051089 | 3300036647 | Bacteria | 2622 |
| 694 | Ga0316582_0640447 | 3300036647 | Bacteria | 731 |
| 695 | Ga0316584_0004528 | 3300036712 | Bacteria | 9201 |
| 696 | Ga0316584_0006234 | 3300036712 | Bacteria | 8075 |
| 697 | Ga0316584_0010371 | 3300036712 | Bacteria | 6508 |
| 698 | Ga0316584_0036121 | 3300036712 | Bacteria | 3667 |
| 699 | Ga0316584_0081897 | 3300036712 | Bacteria | 2417 |
| 700 | Ga0316584_0096540 | 3300036712 | Bacteria | 2213 |
| 701 | Ga0316584_0225028 | 3300036712 | Bacteria | 1377 |
| 702 | Ga0316584_0393626 | 3300036712 | Bacteria | 988 |
| 703 | Ga0316584_0555749 | 3300036712 | Bacteria | 801 |
| 704 | Ga0373925_0049724 | 3300037068 | Bacteria | 3125 |
| 705 | Ga0395899_0005116 | 3300037312 | Bacteria | 10204 |
| 706 | Ga0395899_0511266 | 3300037312 | Bacteria | 778 |
| 707 | Ga0395900_0070247 | 3300037418 | Bacteria | 3600 |
| 708 | Ga0395900_0325826 | 3300037418 | Bacteria | 1515 |
| 709 | Ga0395900_0740869 | 3300037418 | Bacteria | 914 |
| 710 | Ga0395900_0955678 | 3300037418 | Bacteria | 778 |
| 711 | Ga0395900_1216390 | 3300037418 | Bacteria | 668 |
| 712 | Ga0395898_0058321 | 3300037466 | Bacteria | 3758 |
| 713 | Ga0395898_0113648 | 3300037466 | Bacteria | 2595 |
| 714 | Ga0395898_0163979 | 3300037466 | Bacteria | 2126 |
| 715 | Ga0395898_1374517 | 3300037466 | Bacteria | 634 |
| 716 | Ga0395905_0578158 | 3300037471 | Bacteria | 1025 |
| 717 | Ga0316581_0018989 | 3300037588 | Bacteria | 2001 |
| 718 | Ga0436364_0053954 | 3300037853 | Bacteria | 1889 |
| 719 | Ga0436364_0088803 | 3300037853 | Bacteria | 812 |
| 720 | Ga0436364_0259249 | 3300037853 | Bacteria | 81192 |
| 721 | Ga0436364_0287928 | 3300037853 | Bacteria | 1623 |
| 722 | Ga0436364_0335253 | 3300037853 | Bacteria | 76277 |
| 723 | Ga0436364_0646869 | 3300037853 | Bacteria | 738 |
| 724 | Ga0436364_1146099 | 3300037853 | Bacteria | 15147 |
| 725 | Ga0395901_0156061 | 3300038443 | Bacteria | 2397 |
| 726 | Ga0395901_0237868 | 3300038443 | Bacteria | 1900 |
| 727 | Ga0395901_1114730 | 3300038443 | Bacteria | 759 |
| 728 | Ga0395901_1918841 | 3300038443 | Bacteria | 539 |
| 729 | Ga0395901_1992590 | 3300038443 | Bacteria | 527 |
| 730 | Ga0400488_47748 | 3300038741 | Bacteria | 1801 |
| 731 | Ga0400488_50168 | 3300038741 | Bacteria | 1291 |
| 732 | Ga0400489_13001 | 3300039093 | Bacteria | 10435 |
| 733 | Ga0400487_25766 | 3300039110 | Bacteria | 1387 |
| 734 | Ga0436365_0629779 | 3300039437 | Bacteria | 1176 |
| 735 | Ga0436365_1092364 | 3300039437 | Bacteria | 933 |
| 736 | Ga0436365_1102338 | 3300039437 | Bacteria | 1567 |
| 737 | Ga0436365_1102958 | 3300039437 | Bacteria | 866 |
| 738 | Ga0436365_1241481 | 3300039437 | Bacteria | 847 |
| 739 | Ga0436365_1339253 | 3300039437 | Bacteria | 6213 |
| 740 | Ga0436365_1548100 | 3300039437 | Bacteria | 1044 |
| 741 | Ga0436360_0203097 | 3300039438 | Bacteria | 1292 |
| 742 | Ga0436360_0254951 | 3300039438 | Bacteria | 662 |
| 743 | Ga0436360_0349850 | 3300039438 | Bacteria | 1116 |
| 744 | Ga0436360_0851683 | 3300039438 | Bacteria | 628 |
| 745 | Ga0436361_0816314 | 3300039447 | Bacteria | 683 |
| 746 | Ga0436363_0062905 | 3300039450 | Bacteria | 2312 |
| 747 | Ga0436363_0690294 | 3300039450 | Bacteria | 555 |
| 748 | Ga0436363_1272931 | 3300039450 | Bacteria | 796 |
| 749 | Ga0436362_0302776 | 3300039453 | Bacteria | 3371 |
| 750 | Ga0436362_0871893 | 3300039453 | Bacteria | 586 |
| 751 | Ga0439439_0143748 | 3300041406 | Bacteria | 675 |
| 752 | Ga0439453_0073309 | 3300041408 | Bacteria | 728 |
| 753 | Ga0439465_0322514 | 3300041413 | Bacteria | 580 |
| 754 | Ga0451789_0261361 | 3300041443 | Bacteria | 563 |
| 755 | Ga0439441_119733 | 3300042001 | Bacteria | 603 |
| 756 | Ga0439448_0030111 | 3300042005 | Bacteria | 1720 |
| 757 | Ga0439448_0054596 | 3300042005 | Bacteria | 1313 |
| 758 | Ga0439448_0142639 | 3300042005 | Bacteria | 829 |
| 759 | Ga0439432_037858 | 3300042006 | Bacteria | 1537 |
| 760 | Ga0439450_022457 | 3300042008 | Bacteria | 1362 |
| 761 | Ga0439450_191313 | 3300042008 | Bacteria | 545 |
| 762 | Ga0439455_0011759 | 3300042012 | Bacteria | 1952 |
| 763 | Ga0439463_039473 | 3300042016 | Bacteria | 1198 |
| 764 | Ga0450920_125303 | 3300042122 | Bacteria | 540 |
| 765 | Ga0450888_002305 | 3300042126 | Bacteria | 1879 |
| 766 | Ga0450905_045808 | 3300042142 | Bacteria | 704 |
| 767 | Ga0439458_0002485 | 3300042157 | Bacteria | 4483 |
| 768 | Ga0439464_0049463 | 3300042439 | Bacteria | 1213 |
| 769 | Ga0439464_0097919 | 3300042439 | Bacteria | 889 |
| 770 | Ga0439460_0005254 | 3300042461 | Bacteria | 3173 |
| 771 | Ga0439460_0374861 | 3300042461 | Bacteria | 504 |
| 772 | Ga0451577_0167217 | 3300042876 | Bacteria | 1981 |
| 773 | Ga0451577_0431394 | 3300042876 | Bacteria | 1197 |
| 774 | Ga0439440_0217672 | 3300042993 | Bacteria | 572 |
| 775 | Ga0466965_0086124 | 3300044683 | Bacteria | 1593 |
| 776 | Ga0466965_0141894 | 3300044683 | Bacteria | 1251 |
| 777 | Ga0466965_0304011 | 3300044683 | Bacteria | 866 |
| 778 | Ga0466965_0334020 | 3300044683 | Bacteria | 827 |
| 779 | Ga0466965_0372249 | 3300044683 | Bacteria | 785 |
| 780 | Ga0466965_0746480 | 3300044683 | Bacteria | 564 |
| 781 | Ga0466966_0068535 | 3300044684 | Bacteria | 2227 |
| 782 | Ga0466966_0116988 | 3300044684 | Bacteria | 1640 |
| 783 | Ga0466966_0158096 | 3300044684 | Bacteria | 1380 |
| 784 | Ga0466966_0968263 | 3300044684 | Bacteria | 513 |
| 785 | Ga0466961_0034795 | 3300044693 | Bacteria | 3234 |
| 786 | Ga0466961_0166202 | 3300044693 | Bacteria | 1373 |
| 787 | Ga0466961_0202773 | 3300044693 | Bacteria | 1226 |
| 788 | Ga0466961_0391104 | 3300044693 | Bacteria | 844 |
| 789 | Ga0466961_0814336 | 3300044693 | Bacteria | 557 |
| 790 | Ga0466963_0165271 | 3300044694 | Bacteria | 1541 |
| 791 | Ga0466963_0226003 | 3300044694 | Bacteria | 1311 |
| 792 | Ga0466963_0347578 | 3300044694 | Bacteria | 1044 |
| 793 | Ga0466963_0611396 | 3300044694 | Bacteria | 770 |
| 794 | Ga0466963_0635468 | 3300044694 | Bacteria | 753 |
| 795 | Ga0466963_0882003 | 3300044694 | Bacteria | 631 |
| 796 | Ga0466963_1321179 | 3300044694 | Bacteria | 506 |
| 797 | Ga0466964_0309843 | 3300044706 | Bacteria | 799 |
| 798 | Ga0466964_0338655 | 3300044706 | Bacteria | 769 |
| 799 | Ga0466964_0393964 | 3300044706 | Bacteria | 722 |
| 800 | Ga0453684_0000172 | 3300044712 | Bacteria | 285975 |
| 801 | Ga0453684_0043460 | 3300044712 | Bacteria | 6038 |
| 802 | Ga0453684_0112383 | 3300044712 | Bacteria | 3307 |
| 803 | Ga0453684_2429882 | 3300044712 | Bacteria | 518 |
| 804 | Ga0466971_0088779 | 3300044719 | Bacteria | 1414 |
| 805 | Ga0466970_0045751 | 3300044765 | Bacteria | 2331 |
| 806 | Ga0466970_0489459 | 3300044765 | Bacteria | 707 |
| 807 | Ga0466957_0058510 | 3300044842 | Bacteria | 2361 |
| 808 | Ga0466957_0176337 | 3300044842 | Bacteria | 1394 |
| 809 | Ga0466957_0410151 | 3300044842 | Bacteria | 928 |
| 810 | Ga0466957_0977178 | 3300044842 | Bacteria | 607 |
| 811 | Ga0466957_1145979 | 3300044842 | Bacteria | 561 |
| 812 | Ga0466960_0057849 | 3300044901 | Bacteria | 1892 |
| 813 | Ga0466960_0350769 | 3300044901 | Bacteria | 841 |
| 814 | Ga0466959_0034988 | 3300045049 | Bacteria | 3715 |
| 815 | Ga0466959_0318895 | 3300045049 | Bacteria | 1063 |
| 816 | Ga0466959_0397209 | 3300045049 | Bacteria | 937 |
| 817 | Ga0466959_0518013 | 3300045049 | Bacteria | 805 |
| 818 | Ga0451576_0004532 | 3300045051 | Bacteria | 17987 |
| 819 | Ga0451576_0004555 | 3300045051 | Bacteria | 17938 |
| 820 | Ga0451576_0590940 | 3300045051 | Bacteria | 1167 |
| 821 | Ga0451576_1499329 | 3300045051 | Bacteria | 701 |
| 822 | Ga0451576_1768609 | 3300045051 | Bacteria | 639 |
| 823 | Ga0466958_0179691 | 3300045836 | Bacteria | 1342 |
| 824 | Ga0466958_0325340 | 3300045836 | Bacteria | 988 |
| 825 | Ga0466958_0454841 | 3300045836 | Bacteria | 829 |
| 826 | Ga0466958_0697268 | 3300045836 | Bacteria | 661 |
| 827 | Ga0466958_0700709 | 3300045836 | Bacteria | 660 |
| 828 | Ga0466958_1040961 | 3300045836 | Bacteria | 534 |
| 829 | Ga0466958_1101165 | 3300045836 | Bacteria | 518 |
| 830 | Ga0466967_0000625 | 3300045976 | Bacteria | 17693 |
| 831 | Ga0466967_0181381 | 3300045976 | Bacteria | 1986 |
| 832 | Ga0466967_0324423 | 3300045976 | Bacteria | 1485 |
| 833 | Ga0466967_0431649 | 3300045976 | Bacteria | 1285 |
| 834 | Ga0466967_0551541 | 3300045976 | Bacteria | 1134 |
| 835 | Ga0466967_1095912 | 3300045976 | Bacteria | 793 |
| 836 | Ga0466967_1173575 | 3300045976 | Bacteria | 765 |
| 837 | Ga0466967_2046771 | 3300045976 | Bacteria | 569 |
| 838 | Ga0466967_2596926 | 3300045976 | Bacteria | 501 |
| 839 | Ga0495590_0240734 | 3300046457 | Bacteria | 672 |
| 840 | Ga0495653_0322127 | 3300046463 | Bacteria | 1001 |
| 841 | Ga0495653_0707381 | 3300046463 | Bacteria | 611 |
| 842 | Ga0495580_0273777 | 3300046472 | Bacteria | 1152 |
| 843 | Ga0495580_0377213 | 3300046472 | Bacteria | 958 |
| 844 | Ga0495580_0491899 | 3300046472 | Bacteria | 819 |
| 845 | Ga0495582_0844769 | 3300046473 | Bacteria | 529 |
| 846 | Ga0495639_0012646 | 3300046475 | Bacteria | 3642 |
| 847 | Ga0495664_0563049 | 3300046477 | Bacteria | 679 |
| 848 | Ga0495584_0561171 | 3300046491 | Bacteria | 582 |
| 849 | Ga0495585_0289287 | 3300046492 | Bacteria | 808 |
| 850 | Ga0495607_0347968 | 3300046501 | Bacteria | 685 |
| 851 | Ga0495620_0231694 | 3300046515 | Bacteria | 706 |
| 852 | Ga0495630_0818673 | 3300046517 | Bacteria | 711 |
| 853 | Ga0495630_1423589 | 3300046517 | Bacteria | 521 |
| 854 | Ga0495631_0064850 | 3300046518 | Bacteria | 1581 |
| 855 | Ga0495663_0026688 | 3300046525 | Bacteria | 1692 |
| 856 | Ga0495666_0057518 | 3300046526 | Unclassified | 1861 |
| 857 | Ga0495642_0491522 | 3300046528 | Bacteria | 543 |
| 858 | Ga0495665_0403825 | 3300046531 | Bacteria | 693 |
| 859 | Ga0495656_0080882 | 3300046615 | Bacteria | 1466 |
| 860 | Ga0495656_0653356 | 3300046615 | Bacteria | 564 |
| 861 | Ga0495668_0228072 | 3300046616 | Bacteria | 1020 |
| 862 | Ga0495635_0185844 | 3300046663 | Bacteria | 1412 |
| 863 | Ga0495661_0543568 | 3300046665 | Bacteria | 550 |
| 864 | Ga0495669_0007054 | 3300046684 | Bacteria | 4704 |
| 865 | Ga0495613_0387712 | 3300046689 | Bacteria | 954 |
| 866 | Ga0495613_0626467 | 3300046689 | Bacteria | 714 |
| 867 | Ga0495671_0344502 | 3300046692 | Bacteria | 715 |
| 868 | Ga0495636_0040093 | 3300047318 | Bacteria | 1941 |
| 869 | Ga0495672_0006230 | 3300047320 | Bacteria | 9300 |
| 870 | Ga0495676_0033948 | 3300047321 | Bacteria | 4287 |
| 871 | Ga0495675_0416186 | 3300047444 | Bacteria | 782 |
| 872 | Ga0495677_0041532 | 3300047445 | Bacteria | 1683 |
| 873 | Ga0495685_105432 | 3300047447 | Bacteria | 930 |
| 874 | Ga0495686_0001038 | 3300047472 | Bacteria | 33340 |
| 875 | Ga0495593_0628130 | 3300047673 | Bacteria | 539 |
| 876 | Ga0495626_0369444 | 3300048091 | Bacteria | 558 |
| 877 | Ga0496100_0608501 | 3300048903 | Bacteria | 849 |
| 878 | Ga0496102_0488261 | 3300048905 | Bacteria | 1153 |
| 879 | Ga0496102_1112826 | 3300048905 | Bacteria | 710 |
| 880 | Ga0496103_0301503 | 3300048906 | Bacteria | 1031 |
| 881 | Ga0496104_0173411 | 3300048907 | Bacteria | 2067 |
| 882 | Ga0496104_0323469 | 3300048907 | Bacteria | 1455 |
| 883 | Ga0496105_0711633 | 3300048908 | Bacteria | 770 |
| 884 | Ga0496108_0848060 | 3300048911 | Bacteria | 786 |
| 885 | Ga0496108_1708803 | 3300048911 | Bacteria | 518 |
| 886 | Ga0496109_0492531 | 3300048912 | Bacteria | 1157 |
| 887 | Ga0496109_1323301 | 3300048912 | Unclassified | 656 |
| 888 | Ga0496110_0737018 | 3300048913 | Bacteria | 888 |
| 889 | Ga0496110_1263773 | 3300048913 | Bacteria | 647 |
| 890 | Ga0496111_0783858 | 3300048914 | Bacteria | 690 |
| 891 | Ga0496111_0934907 | 3300048914 | Bacteria | 623 |
| 892 | Ga0496112_0102484 | 3300048915 | Bacteria | 2832 |
| 893 | Ga0496112_0210902 | 3300048915 | Bacteria | 1899 |
| 894 | Ga0496112_0582861 | 3300048915 | Bacteria | 1051 |
| 895 | Ga0496113_0043903 | 3300048916 | Bacteria | 3310 |
| 896 | Ga0496113_0768248 | 3300048916 | Bacteria | 767 |
| 897 | Ga0496113_1192964 | 3300048916 | Bacteria | 594 |
| 898 | Ga0496115_0781562 | 3300048918 | Bacteria | 744 |
| 899 | Ga0496117_0034577 | 3300048920 | Bacteria | 3805 |
| 900 | Ga0496118_0007338 | 3300048921 | Bacteria | 11722 |
| 901 | Ga0496120_0186452 | 3300048923 | Bacteria | 1014 |
| 902 | Ga0496121_0702437 | 3300048924 | Bacteria | 608 |
| 903 | Ga0496122_0001160 | 3300048925 | Bacteria | 45119 |
| 904 | Ga0496124_0009571 | 3300048927 | Bacteria | 9954 |
| 905 | Ga0496125_0000094 | 3300048928 | Bacteria | 208341 |
| 906 | Ga0501306_024116 | 3300049127 | Bacteria | 867 |
| 907 | Ga0501308_013227 | 3300049128 | Bacteria | 952 |
| 908 | Ga0501308_027979 | 3300049128 | Bacteria | 743 |
| 909 | Ga0501309_070204 | 3300049129 | Bacteria | 575 |
| 910 | Ga0501341_06994 | 3300049131 | Bacteria | 701 |
| 911 | Ga0501305_020255 | 3300049161 | Bacteria | 976 |
| 912 | Ga0501307_057619 | 3300049162 | Bacteria | 596 |
| 913 | Ga0501307_060301 | 3300049162 | Bacteria | 587 |
| 914 | Ga0501303_055156 | 3300049526 | Bacteria | 531 |
| 915 | Ga0501311_022396 | 3300049527 | Bacteria | 868 |
| 916 | Ga0501312_051571 | 3300049528 | Bacteria | 695 |
| 917 | Ga0501312_087513 | 3300049528 | Bacteria | 571 |
| 918 | Ga0501314_020764 | 3300049530 | Bacteria | 681 |
| 919 | Ga0501314_022026 | 3300049530 | Bacteria | 668 |
| 920 | Ga0501315_042473 | 3300049531 | Bacteria | 692 |
| 921 | Ga0501315_042590 | 3300049531 | Bacteria | 691 |
| 922 | Ga0501317_005251 | 3300049533 | Bacteria | 1380 |
| 923 | Ga0501317_021604 | 3300049533 | Bacteria | 876 |
| 924 | Ga0501318_010062 | 3300049534 | Bacteria | 1042 |
| 925 | Ga0501319_011382 | 3300049535 | Bacteria | 718 |
| 926 | Ga0501319_011919 | 3300049535 | Bacteria | 707 |
| 927 | Ga0501322_002304 | 3300049538 | Bacteria | 1160 |
| 928 | Ga0501322_009573 | 3300049538 | Bacteria | 736 |
| 929 | Ga0501322_010107 | 3300049538 | Bacteria | 723 |
| 930 | Ga0501340_010992 | 3300049556 | Bacteria | 670 |
| 931 | Ga0501031_0554744 | 3300049568 | Bacteria | 740 |
| 932 | Ga0501031_0683632 | 3300049568 | Unclassified | 659 |
| 933 | Ga0501032_0269102 | 3300049569 | Bacteria | 1104 |
| 934 | Ga0501032_0500961 | 3300049569 | Bacteria | 776 |
| 935 | Ga0501032_0532006 | 3300049569 | Unclassified | 750 |
| 936 | Ga0501033_0647293 | 3300049570 | Bacteria | 722 |
| 937 | Ga0501037_0068611 | 3300049573 | Bacteria | 2582 |
| 938 | Ga0501038_1217369 | 3300049574 | Unclassified | 546 |
| 939 | Ga0501039_0100696 | 3300049575 | Bacteria | 2255 |
| 940 | Ga0501040_0622419 | 3300049576 | Bacteria | 780 |
| 941 | Ga0501041_0002243 | 3300049577 | Bacteria | 10926 |
| 942 | Ga0501042_0989942 | 3300049578 | Bacteria | 613 |
| 943 | Ga0501042_1057783 | 3300049578 | Bacteria | 592 |
| 944 | Ga0501042_1206685 | 3300049578 | Bacteria | 552 |
| 945 | Ga0501043_0361135 | 3300049579 | Bacteria | 1102 |
| 946 | Ga0501043_0436213 | 3300049579 | Unclassified | 986 |
| 947 | Ga0501043_0802410 | 3300049579 | Bacteria | 681 |
| 948 | Ga0501047_0014394 | 3300049581 | Bacteria | 7523 |
| 949 | Ga0501047_0184397 | 3300049581 | Bacteria | 1953 |
| 950 | Ga0501047_0241900 | 3300049581 | Bacteria | 1655 |
| 951 | Ga0501047_0351219 | 3300049581 | Bacteria | 1311 |
| 952 | Ga0501047_1094350 | 3300049581 | Bacteria | 610 |
| 953 | Ga0501048_0063131 | 3300049582 | Bacteria | 2621 |
| 954 | Ga0501068_0134020 | 3300049584 | Bacteria | 1550 |
| 955 | Ga0501068_1011133 | 3300049584 | Bacteria | 549 |
| 956 | Ga0501069_0056554 | 3300049585 | Bacteria | 2186 |
| 957 | Ga0501070_0001672 | 3300049586 | Bacteria | 19654 |
| 958 | Ga0501070_0145986 | 3300049586 | Bacteria | 1952 |
| 959 | Ga0501070_0454163 | 3300049586 | Bacteria | 1033 |
| 960 | Ga0501071_0048281 | 3300049587 | Bacteria | 3061 |
| 961 | Ga0501073_0005789 | 3300049589 | Bacteria | 9238 |
| 962 | Ga0501073_0383035 | 3300049589 | Bacteria | 972 |
| 963 | Ga0501074_0008563 | 3300049590 | Bacteria | 7410 |
| 964 | Ga0501074_0258440 | 3300049590 | Bacteria | 1238 |
| 965 | Ga0501075_0030005 | 3300049591 | Bacteria | 4024 |
| 966 | Ga0501076_0018225 | 3300049592 | Bacteria | 5348 |
| 967 | Ga0501077_0011967 | 3300049593 | Bacteria | 5428 |
| 968 | Ga0501077_0335059 | 3300049593 | Bacteria | 965 |
| 969 | Ga0501206_113205 | 3300049653 | Bacteria | 504 |
| 970 | Ga0501243_001637 | 3300049675 | Bacteria | 3226 |
| 971 | Ga0501079_0003679 | 3300049741 | Bacteria | 11300 |
| 972 | Ga0501079_0019517 | 3300049741 | Bacteria | 5178 |
| 973 | Ga0501080_0015230 | 3300049742 | Bacteria | 7087 |
| 974 | Ga0501080_0115403 | 3300049742 | Bacteria | 2490 |
| 975 | Ga0501081_0033925 | 3300049743 | Bacteria | 3470 |
| 976 | Ga0501081_1025940 | 3300049743 | Bacteria | 624 |
| 977 | Ga0501081_1146826 | 3300049743 | Bacteria | 588 |
| 978 | Ga0501083_0265301 | 3300049744 | Bacteria | 1117 |
| 979 | Ga0501241_123517 | 3300049758 | Bacteria | 577 |
| 980 | Ga0501271_022312 | 3300049768 | Bacteria | 740 |
| 981 | Ga0501282_006822 | 3300049778 | Bacteria | 1220 |
| 982 | Ga0501035_1406765 | 3300049822 | Bacteria | 534 |
| 983 | Ga0501035_1449728 | 3300049822 | Bacteria | 525 |
| 984 | Ga0501044_0168333 | 3300049823 | Bacteria | 2164 |
| 985 | Ga0501044_0278248 | 3300049823 | Bacteria | 1608 |
| 986 | Ga0501044_0856927 | 3300049823 | Bacteria | 785 |
| 987 | Ga0501044_1259121 | 3300049823 | Bacteria | 607 |
| 988 | Ga0501212_122359 | 3300049851 | Bacteria | 506 |
| 989 | nmdc:mga00v17_134291_c1 | 3300050491 | Bacteria | 1583 |
| 990 | nmdc:mga0yw44_256029_c1 | 3300050492 | Bacteria | 1166 |
| 991 | nmdc:mga0yw44_915685_c1 | 3300050492 | Bacteria | 594 |
| 992 | nmdc:mga0k408_310713_c1 | 3300050493 | Bacteria | 941 |
| 993 | nmdc:mga07m45_32747_c1 | 3300050496 | Bacteria | 2883 |
| 994 | nmdc:mga05p37_69462_c1 | 3300050507 | Bacteria | 4333 |
| 995 | nmdc:mga09592_1184977_c1 | 3300050508 | Bacteria | 632 |
| 996 | nmdc:mga09592_307899_c1 | 3300050508 | Bacteria | 1373 |
| 997 | nmdc:mga0qj67_1283558_c1 | 3300050509 | Bacteria | 568 |
| 998 | nmdc:mga06r32_1093626_c1 | 3300050510 | Bacteria | 746 |
| 999 | nmdc:mga06r32_38923_c1 | 3300050510 | Bacteria | 4508 |
| 1000 | nmdc:mga06r32_59733_c1 | 3300050510 | Bacteria | 3668 |
| 1001 | nmdc:mga0n895_1691524_c1 | 3300050512 | Bacteria | 595 |
| 1002 | nmdc:mga0n895_744964_c1 | 3300050512 | Bacteria | 973 |
| 1003 | nmdc:mga0n895_869913_c1 | 3300050512 | Bacteria | 888 |
| 1004 | nmdc:mga0rr50_118698_c1 | 3300050513 | Bacteria | 2102 |
| 1005 | nmdc:mga08x19_135737_c1 | 3300050514 | Bacteria | 1658 |
| 1006 | nmdc:mga08x19_6846_c1 | 3300050514 | Bacteria | 6770 |
| 1007 | Ga0500562_059626 | 3300053108 | Bacteria | 1025 |
| 1008 | Ga0500616_0004725 | 3300053153 | Bacteria | 9587 |
| 1009 | Ga0500587_006564 | 3300053739 | Bacteria | 1539 |
| 1010 | Ga0501084_0033293 | 3300054114 | Bacteria | 4311 |
| 1011 | Ga0501084_0234423 | 3300054114 | Bacteria | 1549 |
| 1012 | Ga0587093_076037 | 3300059478 | Bacteria | 572 |
| 1013 | Ga0587066_068844 | 3300059490 | Bacteria | 740 |
| 1014 | Ga0587070_197286 | 3300059491 | Bacteria | 533 |
| 1015 | Ga0587073_0110888 | 3300059492 | Bacteria | 727 |
| 1016 | Ga0587088_039423 | 3300059508 | Bacteria | 883 |
| 1017 | Ga0587091_131366 | 3300059511 | Bacteria | 618 |
| 1018 | Ga0587106_067524 | 3300059605 | Bacteria | 670 |
| 1019 | Ga0587062_079349 | 3300059639 | Bacteria | 607 |
| 1020 | Ga0587075_011854 | 3300059644 | Bacteria | 1175 |
| 1021 | Ga0587076_091728 | 3300059645 | Bacteria | 665 |
| 1022 | Ga0587078_032166 | 3300059646 | Bacteria | 712 |
| 1023 | Ga0587114_051436 | 3300059655 | Bacteria | 699 |
| 1024 | Ga0587111_0184431 | 3300060346 | Bacteria | 582 |
| 1025 | Ga0466962_0040787 | 3300061719 | Bacteria | 2221 |
| 1026 | Ga0466962_0175028 | 3300061719 | Bacteria | 1045 |
| 1027 | Ga0466962_0425359 | 3300061719 | Bacteria | 667 |
| 1028 | Ga0530510_1326480 | 3300061734 | Bacteria | 552 |
| 1029 | 2511255820 | 2511231004 | Bacteria | 6669789 |
| 1030 | 2511276351 | 2511231008 | Bacteria | 6624100 |
| 1031 | 2511325713 | 2511231016 | Bacteria | 6704427 |
| 1032 | 2511338294 | 2511231018 | Bacteria | 6436256 |
| 1033 | 2511343081 | 2511231019 | Bacteria | 6520662 |
| 1034 | 2511361163 | 2511231022 | Bacteria | 6719296 |
| 1035 | 2621297571 | 2619619299 | Bacteria | 6649820 |
| 1036 | 2738671082 | 2738541265 | Bacteria | 6594665 |
| 1037 | 2738749476 | 2738541282 | Bacteria | 6593925 |
| 1038 | 2738858516 | 2738541303 | Bacteria | 6591772 |
| 1039 | 2774121751 | 2773857670 | Bacteria | 6407454 |
| 1040 | 2784317832 | 2784132072 | Bacteria | 6596533 |
| 1041 | 2808930805 | 2808606377 | Bacteria | 6646337 |
| 1042 | 2808952927 | 2808606381 | Bacteria | 6646461 |
| 1043 | 2808959252 | 2808606382 | Bacteria | 6841132 |
| 1044 | 2817493300 | 2816332298 | Bacteria | 6852809 |
| 1045 | 2837272115 | 2837268691 | Bacteria | 7850704 |
| 1046 | 2860343823 | 2860339153 | Bacteria | 6846989 |
| 1047 | 2919461806 | 2919456309 | Bacteria | 6586567 |
| 1048 | 2931397493 | 2931396565 | Bacteria | 7251677 |
| 1049 | 2945966219 | 2945961074 | Bacteria | 7342064 |
| 1050 | 3007516630 | 3007511990 | Bacteria | 6481491 |
| 1051 | 3007621459 | 3007619802 | Bacteria | 6411688 |
| 1052 | 8002748011 | 8002745576 | Bacteria | 4840272 |
| 1053 | 8056157137 | 8056155041 | Bacteria | 6486948 |
| 1054 | Ga0070717_10393022 | |||
| 1055 | SwRhRL2b_contig_2708226 | |||
| 1056 | LJQas_1009264 | |||
| 1057 | LJQas_1033958 | |||
| 1058 | JGI25406J46586_10009537 | |||
| 1059 | Ga0006776J48906_103232 | |||
| 1060 | Ga0006777J48905_1012391 | |||
| 1061 | Ga0006781J51513_1004544 | |||
| 1062 | Ga0007410J51695_1038747 | |||
| 1063 | Ga0007429J51699_1011333 | |||
| 1064 | Ga0007429J51699_1037612 | |||
| 1065 | Ga0032354_1011911 | |||
| 1066 | Ga0006780_1006521 | |||
| 1067 | Ga0006780_1006522 | |||
| 1068 | Ga0006780_1008494 | |||
| 1069 | Ga0058859_11478734 | |||
| 1070 | Ga0058863_11884972 | |||
| 1071 | Ga0058863_11890991 | |||
| 1072 | Ga0058861_10021431 | |||
| 1073 | Ga0058861_11788698 | |||
| 1074 | Ga0058861_12020855 | |||
| 1075 | Ga0058862_10029435 | |||
| 1076 | Ga0058862_12517167 | |||
| 1077 | Ga0058862_12786174 | |||
| 1078 | Ga0065714_10017840 | |||
| 1079 | Ga0065715_10006688 | |||
| 1080 | Ga0070658_10241354 | |||
| 1081 | Ga0070658_11256342 | |||
| 1082 | Ga0070676_11601975 | |||
| 1083 | Ga0070683_100311273 | |||
| 1084 | Ga0070683_100341662 | |||
| 1085 | Ga0070683_101094309 | |||
| 1086 | Ga0070683_102387910 | |||
| 1087 | Ga0070690_100618998 | |||
| 1088 | Ga0070690_101131023 | |||
| 1089 | Ga0070670_100830022 | |||
| 1090 | Ga0070670_101437369 | |||
| 1091 | Ga0070680_100008411 | |||
| 1092 | Ga0070680_100196074 | |||
| 1093 | Ga0070680_100254337 | |||
| 1094 | Ga0070680_100281626 | |||
| 1095 | Ga0070680_100507075 | |||
| 1096 | Ga0070680_100637339 | |||
| 1097 | Ga0070680_101737394 | |||
| 1098 | Ga0070682_100886692 | |||
| 1099 | Ga0068868_101443624 | |||
| 1100 | Ga0070660_101119657 | |||
| 1101 | Ga0070689_100343094 | |||
| 1102 | Ga0070689_100933875 | |||
| 1103 | Ga0070689_101154870 | |||
| 1104 | Ga0070689_101965144 | |||
| 1105 | Ga0070692_10931536 | |||
| 1106 | Ga0070668_100938522 | |||
| 1107 | Ga0070669_100115761 | |||
| 1108 | Ga0070669_101039073 | |||
| 1109 | Ga0070675_101760336 | |||
| 1110 | Ga0070674_100437537 | |||
| 1111 | Ga0070673_100777904 | |||
| 1112 | Ga0070688_100200084 | |||
| 1113 | Ga0070688_100362437 | |||
| 1114 | Ga0070688_100719008 | |||
| 1115 | Ga0070688_101005979 | |||
| 1116 | Ga0070659_100467693 | |||
| 1117 | Ga0070659_101711380 | |||
| 1118 | Ga0070667_100341294 | |||
| 1119 | Ga0070709_11141124 | |||
| 1120 | Ga0070709_11220376 | |||
| 1121 | Ga0070714_100162264 | |||
| 1122 | Ga0070714_100466994 | |||
| 1123 | Ga0070714_100675076 | |||
| 1124 | Ga0070714_100873003 | |||
| 1125 | Ga0070713_100241199 | |||
| 1126 | Ga0070713_100511581 | |||
| 1127 | Ga0070713_100768049 | |||
| 1128 | Ga0070713_101279495 | |||
| 1129 | Ga0070713_101394420 | |||
| 1130 | Ga0070713_101926152 | |||
| 1131 | Ga0070710_10264854 | |||
| 1132 | Ga0070711_100188700 | |||
| 1133 | Ga0070711_100481076 | |||
| 1134 | Ga0070711_100707549 | |||
| 1135 | Ga0070700_101924643 | |||
| 1136 | Ga0070694_100730392 | |||
| 1137 | Ga0070694_101116214 | |||
| 1138 | Ga0070708_100072299 | |||
| 1139 | Ga0070663_100995326 | |||
| 1140 | Ga0070663_101134920 | |||
| 1141 | Ga0070663_101179891 | |||
| 1142 | Ga0070678_100404525 | |||
| 1143 | Ga0070678_101000023 | |||
| 1144 | Ga0070678_101386202 | |||
| 1145 | Ga0070678_101533212 | |||
| 1146 | Ga0070662_100087504 | |||
| 1147 | Ga0070681_10000028 | |||
| 1148 | Ga0070681_10106665 | |||
| 1149 | Ga0070681_10176243 | |||
| 1150 | Ga0070681_10279357 | |||
| 1151 | Ga0070681_10835306 | |||
| 1152 | Ga0070681_11152427 | |||
| 1153 | Ga0070681_11444508 | |||
| 1154 | Ga0070681_11508865 | |||
| 1155 | Ga0070681_11650991 | |||
| 1156 | Ga0070706_100152322 | |||
| 1157 | Ga0070706_100692368 | |||
| 1158 | Ga0070707_100238202 | |||
| 1159 | Ga0070707_100519330 | |||
| 1160 | Ga0070707_102193157 | |||
| 1161 | Ga0070698_100072539 | |||
| 1162 | Ga0070698_100278081 | |||
| 1163 | Ga0070698_101927376 | |||
| 1164 | Ga0070699_100888133 | |||
| 1165 | Ga0070699_101315620 | |||
| 1166 | Ga0070699_101865088 | |||
| 1167 | Ga0070679_100000092 | |||
| 1168 | Ga0070679_100029227 | |||
| 1169 | Ga0070679_100062565 | |||
| 1170 | Ga0070679_100080867 | |||
| 1171 | Ga0070679_100084518 | |||
| 1172 | Ga0070679_100524385 | |||
| 1173 | Ga0070679_100595635 | |||
| 1174 | Ga0070679_100789737 | |||
| 1175 | Ga0070679_100794366 | |||
| 1176 | Ga0070679_101244797 | |||
| 1177 | Ga0070684_100401414 | |||
| 1178 | Ga0070684_101083368 | |||
| 1179 | Ga0070684_101243371 | |||
| 1180 | Ga0070697_100164746 | |||
| 1181 | Ga0070697_100600854 | |||
| 1182 | Ga0070697_100616233 | |||
| 1183 | Ga0070697_101424906 | |||
| 1184 | Ga0068853_101699998 | |||
| 1185 | Ga0070672_101282264 | |||
| 1186 | Ga0070672_101934847 | |||
| 1187 | Ga0070686_100876321 | |||
| 1188 | Ga0070665_100500695 | |||
| 1189 | Ga0070665_100635325 | |||
| 1190 | Ga0070704_100982436 | |||
| 1191 | Ga0070704_101870888 | |||
| 1192 | Ga0068855_100526221 | |||
| 1193 | Ga0068855_100945849 | |||
| 1194 | Ga0068855_101400585 | |||
| 1195 | Ga0070664_100236744 | |||
| 1196 | Ga0070664_100322139 | |||
| 1197 | Ga0070664_102255163 | |||
| 1198 | Ga0068857_101177483 | |||
| 1199 | Ga0068857_101746137 | |||
| 1200 | Ga0068856_100024043 | |||
| 1201 | Ga0068856_100405109 | |||
| 1202 | Ga0068856_100590823 | |||
| 1203 | Ga0068856_100818816 | |||
| 1204 | Ga0070702_100538362 | |||
| 1205 | Ga0070702_100614966 | |||
| 1206 | Ga0070702_100732494 | |||
| 1207 | Ga0068852_100097923 | |||
| 1208 | Ga0068852_100624380 | |||
| 1209 | Ga0068859_100491680 | |||
| 1210 | Ga0068864_100080993 | |||
| 1211 | Ga0068864_100812419 | |||
| 1212 | Ga0068863_100023910 | |||
| 1213 | Ga0068863_100250664 | |||
| 1214 | Ga0068858_100879515 | |||
| 1215 | Ga0068860_101561098 | |||
| 1216 | Ga0068862_101155792 | |||
| 1217 | Ga0081540_1004309 | |||
| 1218 | Ga0081539_10000682 | |||
| 1219 | Ga0081539_10230178 | |||
| 1220 | Ga0070717_10163155 | |||
| 1221 | Ga0070717_10283457 | |||
| 1222 | Ga0070717_10843886 | |||
| 1223 | Ga0070717_11298537 | |||
| 1224 | Ga0075365_10260066 | |||
| 1225 | Ga0075364_10177057 | |||
| 1226 | Ga0070716_100011423 | |||
| 1227 | Ga0070716_100880331 | |||
| 1228 | Ga0070712_101531799 | |||
| 1229 | Ga0075362_10683745 | |||
| 1230 | Ga0075366_10151174 | |||
| 1231 | Ga0097621_100951626 | |||
| 1232 | Ga0097621_101355377 | |||
| 1233 | Ga0075370_10022435 | |||
| 1234 | Ga0068871_100290965 | |||
| 1235 | Ga0075428_100267781 | |||
| 1236 | Ga0075428_100709312 | |||
| 1237 | Ga0075430_101815649 | |||
| 1238 | Ga0075431_100025713 | |||
| 1239 | Ga0075431_100068735 | |||
| 1240 | Ga0075431_100272814 | |||
| 1241 | Ga0075434_100962076 | |||
| 1242 | Ga0075434_102140820 | |||
| 1243 | Ga0075429_100160149 | |||
| 1244 | Ga0075429_100333478 | |||
| 1245 | Ga0068865_101429745 | |||
| 1246 | Ga0075436_100017398 | |||
| 1247 | Ga0075436_100041301 | |||
| 1248 | Ga0097620_100491659 | |||
| 1249 | Ga0097620_100501488 | |||
| 1250 | Ga0075435_100042586 | |||
| 1251 | Ga0099795_10005421 | |||
| 1252 | Ga0099795_10073481 | |||
| 1253 | Ga0105251_10453735 | |||
| 1254 | Ga0105244_10535353 | |||
| 1255 | Ga0105240_10026434 | |||
| 1256 | Ga0105240_10249805 | |||
| 1257 | Ga0105240_10580859 | |||
| 1258 | Ga0105240_10784105 | |||
| 1259 | Ga0111539_10764867 | |||
| 1260 | Ga0111539_11868521 | |||
| 1261 | Ga0105245_10261294 | |||
| 1262 | Ga0105245_10815767 | |||
| 1263 | Ga0105245_11009173 | |||
| 1264 | Ga0105247_10178272 | |||
| 1265 | Ga0114129_10007220 | |||
| 1266 | Ga0114129_11399887 | |||
| 1267 | Ga0105243_10535957 | |||
| 1268 | Ga0105243_11720441 | |||
| 1269 | Ga0105241_10331359 | |||
| 1270 | Ga0105241_10799143 | |||
| 1271 | Ga0105242_11268295 | |||
| 1272 | Ga0105248_10212790 | |||
| 1273 | Ga0105248_11249296 | |||
| 1274 | Ga0105237_10048424 | |||
| 1275 | Ga0105237_12192833 | |||
| 1276 | Ga0105238_10293171 | |||
| 1277 | Ga0105238_10414836 | |||
| 1278 | Ga0105238_10927828 | |||
| 1279 | Ga0105238_12611750 | |||
| 1280 | Ga0105249_11851369 | |||
| 1281 | Ga0130084_1090083 | |||
| 1282 | Ga0099796_10058034 | |||
| 1283 | Ga0099796_10080722 | |||
| 1284 | Ga0105239_10816659 | |||
| 1285 | Ga0105246_10068437 | |||
| 1286 | Ga0105246_10626000 | |||
| 1287 | Ga0157313_1000260 | |||
| 1288 | Ga0157371_10427337 | |||
| 1289 | Ga0157370_10196288 | |||
| 1290 | Ga0157370_11036367 | |||
| 1291 | Ga0157370_11582748 | |||
| 1292 | Ga0157369_10167634 | |||
| 1293 | Ga0157369_10236478 | |||
| 1294 | Ga0157369_10449235 | |||
| 1295 | Ga0157369_11495199 | |||
| 1296 | Ga0157369_12167423 | |||
| 1297 | Ga0157374_10329139 | |||
| 1298 | Ga0157374_11348512 | |||
| 1299 | Ga0157374_12516480 | |||
| 1300 | Ga0157378_10292349 | |||
| 1301 | Ga0157378_11789777 | |||
| 1302 | Ga0157378_12151672 | |||
| 1303 | Ga0163162_10424979 | |||
| 1304 | Ga0163162_11394749 | |||
| 1305 | Ga0157372_10290305 | |||
| 1306 | Ga0157372_10832444 | |||
| 1307 | Ga0157372_11071462 | |||
| 1308 | Ga0157372_11835422 | |||
| 1309 | Ga0157372_11948704 | |||
| 1310 | Ga0157372_12868707 | |||
| 1311 | Ga0157372_13095415 | |||
| 1312 | Ga0157372_13414242 | |||
| 1313 | Ga0157375_10625322 | |||
| 1314 | Ga0157375_12184903 | |||
| 1315 | Ga0163163_10304059 | |||
| 1316 | Ga0163163_10729459 | |||
| 1317 | Ga0163163_11876218 | |||
| 1318 | Ga0157380_12054963 | |||
| 1319 | Ga0157380_12809773 | |||
| 1320 | Ga0182008_10027574 | |||
| 1321 | Ga0182008_10150466 | |||
| 1322 | Ga0182008_10323467 | |||
| 1323 | Ga0182008_10640171 | |||
| 1324 | Ga0157377_10579156 | |||
| 1325 | Ga0157379_10296056 | |||
| 1326 | Ga0157379_10683831 | |||
| 1327 | Ga0157379_10732300 | |||
| 1328 | Ga0157376_11357085 | |||
| 1329 | Ga0157376_12779127 | |||
| 1330 | Ga0157376_12869350 | |||
| 1331 | Ga0182005_1023773 | |||
| 1332 | Ga0163161_10625705 | |||
| 1333 | Ga0163161_11055182 | |||
| 1334 | Ga0197907_10406821 | |||
| 1335 | Ga0197907_10478756 | |||
| 1336 | Ga0197907_10515808 | |||
| 1337 | Ga0197907_10769917 | |||
| 1338 | Ga0197907_10831860 | |||
| 1339 | Ga0197907_10906054 | |||
| 1340 | Ga0197907_10952012 | |||
| 1341 | Ga0197907_11289850 | |||
| 1342 | Ga0197907_11433083 | |||
| 1343 | Ga0206356_10098207 | |||
| 1344 | Ga0206356_10112665 | |||
| 1345 | Ga0206356_10118500 | |||
| 1346 | Ga0206356_10199490 | |||
| 1347 | Ga0206356_10367413 | |||
| 1348 | Ga0206356_10476900 | |||
| 1349 | Ga0206356_10609589 | |||
| 1350 | Ga0206356_10620570 | |||
| 1351 | Ga0206356_10766589 | |||
| 1352 | Ga0206356_11126089 | |||
| 1353 | Ga0206356_11592613 | |||
| 1354 | Ga0206356_11827344 | |||
| 1355 | Ga0206356_11912411 | |||
| 1356 | Ga0206349_1223975 | |||
| 1357 | Ga0206349_1304958 | |||
| 1358 | Ga0206349_1307432 | |||
| 1359 | Ga0206349_1795798 | |||
| 1360 | Ga0206349_1928615 | |||
| 1361 | Ga0206355_1240335 | |||
| 1362 | Ga0206355_1311754 | |||
| 1363 | Ga0206355_1550074 | |||
| 1364 | Ga0206355_1647933 | |||
| 1365 | Ga0206351_10069959 | |||
| 1366 | Ga0206351_10276363 | |||
| 1367 | Ga0206351_10716824 | |||
| 1368 | Ga0206351_10843227 | |||
| 1369 | Ga0206351_10855027 | |||
| 1370 | Ga0206351_10992582 | |||
| 1371 | Ga0206352_10212532 | |||
| 1372 | Ga0206352_10558699 | |||
| 1373 | Ga0206352_10575761 | |||
| 1374 | Ga0206352_11310539 | |||
| 1375 | Ga0206350_10147246 | |||
| 1376 | Ga0206350_10196722 | |||
| 1377 | Ga0206350_10402406 | |||
| 1378 | Ga0206350_10487997 | |||
| 1379 | Ga0206350_10697263 | |||
| 1380 | Ga0206354_10393317 | |||
| 1381 | Ga0206354_10395330 | |||
| 1382 | Ga0206354_10964643 | |||
| 1383 | Ga0206354_11184638 | |||
| 1384 | Ga0206354_11215295 | |||
| 1385 | Ga0206354_11595272 | |||
| 1386 | Ga0206353_10558440 | |||
| 1387 | Ga0206353_10848610 | |||
| 1388 | Ga0206353_11042105 | |||
| 1389 | Ga0206353_11068100 | |||
| 1390 | Ga0206353_11092044 | |||
| 1391 | Ga0206353_11438092 | |||
| 1392 | Ga0206353_11481534 | |||
| 1393 | Ga0206353_11956454 | |||
| 1394 | Ga0154015_1201380 | |||
| 1395 | Ga0154015_1262035 | |||
| 1396 | Ga0154015_1606074 | |||
| 1397 | Ga0154015_1629110 | |||
| 1398 | Ga0213874_10094303 | |||
| 1399 | Ga0213876_10037165 | |||
| 1400 | Ga0213876_10448867 | |||
| 1401 | Ga0213875_10000615 | |||
| 1402 | Ga0213875_10001186 | |||
| 1403 | Ga0213875_10266563 | |||
| 1404 | Ga0213875_10412719 | |||
| 1405 | Ga0224712_10110938 | |||
| 1406 | Ga0224712_10171710 | |||
| 1407 | Ga0224712_10207099 | |||
| 1408 | Ga0224712_10284314 | |||
| 1409 | Ga0224712_10291278 | |||
| 1410 | Ga0224712_10299038 | |||
| 1411 | Ga0224712_10316594 | |||
| 1412 | Ga0224712_10320558 | |||
| 1413 | Ga0224712_10427613 | |||
| 1414 | Ga0224712_10531577 | |||
| 1415 | Ga0256744_106735 | |||
| 1416 | Ga0207696_1084120 | |||
| 1417 | Ga0207655_1094961 | |||
| 1418 | Ga0207713_1001777 | |||
| 1419 | Ga0207682_10416738 | |||
| 1420 | Ga0207642_10807183 | |||
| 1421 | Ga0207710_10493867 | |||
| 1422 | Ga0207688_11011175 | |||
| 1423 | Ga0207699_10141173 | |||
| 1424 | Ga0207705_10316856 | |||
| 1425 | Ga0207705_10366980 | |||
| 1426 | Ga0207705_11023085 | |||
| 1427 | Ga0207684_11067781 | |||
| 1428 | Ga0207684_11495836 | |||
| 1429 | Ga0207707_10000584 | |||
| 1430 | Ga0207707_10046626 | |||
| 1431 | Ga0207707_10251711 | |||
| 1432 | Ga0207707_10311873 | |||
| 1433 | Ga0207707_10494254 | |||
| 1434 | Ga0207707_11153308 | |||
| 1435 | Ga0207707_11275011 | |||
| 1436 | Ga0207707_11381083 | |||
| 1437 | Ga0207707_11405460 | |||
| 1438 | Ga0207695_10213125 | |||
| 1439 | Ga0207695_10219474 | |||
| 1440 | Ga0207695_11080116 | |||
| 1441 | Ga0207671_10020279 | |||
| 1442 | Ga0207693_10080900 | |||
| 1443 | Ga0207693_11096898 | |||
| 1444 | Ga0207663_10611649 | |||
| 1445 | Ga0207660_10000533 | |||
| 1446 | Ga0207660_10094365 | |||
| 1447 | Ga0207660_10096255 | |||
| 1448 | Ga0207660_10291510 | |||
| 1449 | Ga0207660_11030742 | |||
| 1450 | Ga0207660_11290092 | |||
| 1451 | Ga0207660_11437351 | |||
| 1452 | Ga0207657_10306188 | |||
| 1453 | Ga0207649_10953642 | |||
| 1454 | Ga0207652_10000092 | |||
| 1455 | Ga0207652_10006782 | |||
| 1456 | Ga0207652_10176750 | |||
| 1457 | Ga0207652_10245676 | |||
| 1458 | Ga0207652_10309097 | |||
| 1459 | Ga0207652_10313792 | |||
| 1460 | Ga0207652_10583624 | |||
| 1461 | Ga0207652_11277598 | |||
| 1462 | Ga0207646_10142985 | |||
| 1463 | Ga0207646_10449608 | |||
| 1464 | Ga0207646_11107057 | |||
| 1465 | Ga0207681_10836055 | |||
| 1466 | Ga0207694_10300125 | |||
| 1467 | Ga0207694_10592168 | |||
| 1468 | Ga0207650_10934502 | |||
| 1469 | Ga0207650_11486474 | |||
| 1470 | Ga0207659_10456923 | |||
| 1471 | Ga0207659_10546160 | |||
| 1472 | Ga0207687_10778830 | |||
| 1473 | Ga0207687_11187786 | |||
| 1474 | Ga0207700_10043031 | |||
| 1475 | Ga0207700_10205227 | |||
| 1476 | Ga0207700_10850449 | |||
| 1477 | Ga0207700_11262225 | |||
| 1478 | Ga0207700_11522231 | |||
| 1479 | Ga0207664_10072702 | |||
| 1480 | Ga0207664_10097512 | |||
| 1481 | Ga0207664_10149767 | |||
| 1482 | Ga0207664_10190983 | |||
| 1483 | Ga0207664_10673415 | |||
| 1484 | Ga0207664_11287199 | |||
| 1485 | Ga0207664_11485652 | |||
| 1486 | Ga0207644_10107281 | |||
| 1487 | Ga0207690_10366883 | |||
| 1488 | Ga0207690_10419284 | |||
| 1489 | Ga0207706_10167834 | |||
| 1490 | Ga0207706_10372934 | |||
| 1491 | Ga0207706_10417972 | |||
| 1492 | Ga0207709_10165129 | |||
| 1493 | Ga0207670_10295409 | |||
| 1494 | Ga0207670_10599118 | |||
| 1495 | Ga0207670_11314085 | |||
| 1496 | Ga0207670_11580868 | |||
| 1497 | Ga0207669_11470512 | |||
| 1498 | Ga0207704_10705457 | |||
| 1499 | Ga0207665_10007124 | |||
| 1500 | Ga0207665_10185402 | |||
| 1501 | Ga0207711_10539672 | |||
| 1502 | Ga0207661_10236664 | |||
| 1503 | Ga0207661_10684280 | |||
| 1504 | Ga0207679_10239452 | |||
| 1505 | Ga0207679_11795864 | |||
| 1506 | Ga0207667_10613788 | |||
| 1507 | Ga0207667_11474231 | |||
| 1508 | Ga0207667_11569406 | |||
| 1509 | Ga0207712_11410193 | |||
| 1510 | Ga0207712_11556920 | |||
| 1511 | Ga0207640_10667515 | |||
| 1512 | Ga0207640_11081302 | |||
| 1513 | Ga0207677_10708569 | |||
| 1514 | Ga0207703_10814745 | |||
| 1515 | Ga0207703_11098649 | |||
| 1516 | Ga0207703_11860188 | |||
| 1517 | Ga0207639_11118327 | |||
| 1518 | Ga0207639_12083042 | |||
| 1519 | Ga0207678_10327848 | |||
| 1520 | Ga0207678_11175299 | |||
| 1521 | Ga0207678_11645101 | |||
| 1522 | Ga0207708_10350443 | |||
| 1523 | Ga0207708_10511955 | |||
| 1524 | Ga0207702_10230790 | |||
| 1525 | Ga0207702_10296670 | |||
| 1526 | Ga0207702_10587224 | |||
| 1527 | Ga0207641_10063495 | |||
| 1528 | Ga0207641_10584304 | |||
| 1529 | Ga0207676_10296215 | |||
| 1530 | Ga0207676_10798269 | |||
| 1531 | Ga0207676_11937149 | |||
| 1532 | Ga0207674_10250658 | |||
| 1533 | Ga0207674_10610647 | |||
| 1534 | Ga0207674_11023874 | |||
| 1535 | Ga0207683_10203579 | |||
| 1536 | Ga0207683_10319514 | |||
| 1537 | Ga0207683_11458947 | |||
| 1538 | Ga0209969_1026630 | |||
| 1539 | Ga0209981_1010438 | |||
| 1540 | Ga0209179_1027274 | |||
| 1541 | Ga0209968_1009840 | |||
| 1542 | Ga0209999_1005895 | |||
| 1543 | Ga0209982_1016465 | |||
| 1544 | Ga0210002_1032425 | |||
| 1545 | Ga0209966_1074084 | |||
| 1546 | Ga0209974_10014857 | |||
| 1547 | Ga0268266_10487636 | |||
| 1548 | Ga0268266_10845016 | |||
| 1549 | Ga0268265_11084284 | |||
| 1550 | Ga0265337_1019915 | |||
| 1551 | Ga0265337_1150680 | |||
| 1552 | Ga0265326_10156197 | |||
| 1553 | Ga0265336_10011537 | |||
| 1554 | Ga0265336_10213078 | |||
| 1555 | Ga0265338_10004574 | |||
| 1556 | Ga0265338_10168144 | |||
| 1557 | Ga0265338_10622045 | |||
| 1558 | Ga0265763_1055331 | |||
| 1559 | Ga0265330_10121909 | |||
| 1560 | Ga0265332_10409833 | |||
| 1561 | Ga0265320_10314666 | |||
| 1562 | Ga0265339_10538710 | |||
| 1563 | Ga0265327_10000067 | |||
| 1564 | Ga0265327_10004149 | |||
| 1565 | Ga0265327_10011608 | |||
| 1566 | Ga0265327_10141435 | |||
| 1567 | Ga0265316_10052910 | |||
| 1568 | Ga0265316_10450785 | |||
| 1569 | Ga0307513_10082362 | |||
| 1570 | Ga0307408_100826775 | |||
| 1571 | Ga0307408_101441333 | |||
| 1572 | Ga0307508_10027405 | |||
| 1573 | Ga0307508_10571319 | |||
| 1574 | Ga0316575_10004351 | |||
| 1575 | Ga0316575_10139113 | |||
| 1576 | Ga0316579_10261263 | |||
| 1577 | Ga0316579_10397479 | |||
| 1578 | Ga0316579_10409096 | |||
| 1579 | Ga0265314_10237624 | |||
| 1580 | Ga0265342_10040927 | |||
| 1581 | Ga0265342_10185085 | |||
| 1582 | Ga0265342_10274952 | |||
| 1583 | Ga0316576_10000084 | |||
| 1584 | Ga0316576_10008056 | |||
| 1585 | Ga0316576_10075389 | |||
| 1586 | Ga0316576_10472204 | |||
| 1587 | Ga0316576_10542960 | |||
| 1588 | Ga0316576_10612615 | |||
| 1589 | Ga0316576_10740691 | |||
| 1590 | Ga0316576_11169675 | |||
| 1591 | Ga0316578_10001418 | |||
| 1592 | Ga0316578_10041078 | |||
| 1593 | Ga0316578_10264588 | |||
| 1594 | Ga0316578_10340022 | |||
| 1595 | Ga0316578_10778068 | |||
| 1596 | Ga0316578_10797582 | |||
| 1597 | Ga0307405_10048648 | |||
| 1598 | Ga0316577_10000019 | |||
| 1599 | Ga0316577_10001425 | |||
| 1600 | Ga0316577_10024900 | |||
| 1601 | Ga0316577_10025071 | |||
| 1602 | Ga0316577_10050159 | |||
| 1603 | Ga0316577_10058738 | |||
| 1604 | Ga0316577_10072040 | |||
| 1605 | Ga0307413_10342383 | |||
| 1606 | Ga0307413_10674438 | |||
| 1607 | Ga0307410_10166113 | |||
| 1608 | Ga0307410_10345352 | |||
| 1609 | Ga0307410_10655088 | |||
| 1610 | Ga0307406_10032565 | |||
| 1611 | Ga0307406_10143535 | |||
| 1612 | Ga0307406_10177186 | |||
| 1613 | Ga0307406_10667629 | |||
| 1614 | Ga0307406_10858207 | |||
| 1615 | Ga0307407_10112997 | |||
| 1616 | Ga0307407_10145711 | |||
| 1617 | Ga0307407_10921455 | |||
| 1618 | Ga0307407_11064187 | |||
| 1619 | Ga0307412_10144736 | |||
| 1620 | Ga0307412_10194667 | |||
| 1621 | Ga0307412_10201899 | |||
| 1622 | Ga0307409_100126564 | |||
| 1623 | Ga0307409_100137310 | |||
| 1624 | Ga0307409_100196515 | |||
| 1625 | Ga0307409_100224818 | |||
| 1626 | Ga0307409_100602477 | |||
| 1627 | Ga0307409_101300755 | |||
| 1628 | Ga0307409_101817587 | |||
| 1629 | Ga0307409_101828938 | |||
| 1630 | Ga0307409_102187226 | |||
| 1631 | Ga0307409_102295428 | |||
| 1632 | Ga0307416_100709939 | |||
| 1633 | Ga0307416_101872005 | |||
| 1634 | Ga0307416_101972677 | |||
| 1635 | Ga0307416_102058835 | |||
| 1636 | Ga0307416_102088886 | |||
| 1637 | Ga0307414_10035189 | |||
| 1638 | Ga0307414_10038299 | |||
| 1639 | Ga0307414_10073222 | |||
| 1640 | Ga0307414_11132015 | |||
| 1641 | Ga0307414_11842676 | |||
| 1642 | Ga0307411_10121707 | |||
| 1643 | Ga0307411_10148068 | |||
| 1644 | Ga0307411_11964466 | |||
| 1645 | Ga0307415_100134788 | |||
| 1646 | Ga0307415_100191393 | |||
| 1647 | Ga0307415_101729521 | |||
| 1648 | Ga0307415_101748991 | |||
| 1649 | Ga0307415_101828668 | |||
| 1650 | Ga0307415_102176557 | |||
| 1651 | Ga0307415_102273842 | |||
| 1652 | Ga0316583_10005213 | |||
| 1653 | Ga0316583_10173345 | |||
| 1654 | Ga0316583_10202301 | |||
| 1655 | Ga0316585_10000385 | |||
| 1656 | Ga0316585_10002483 | |||
| 1657 | Ga0316585_10087353 | |||
| 1658 | Ga0316585_10193046 | |||
| 1659 | Ga0316580_10001806 | |||
| 1660 | Ga0316580_10002999 | |||
| 1661 | Ga0316580_10143768 | |||
| 1662 | Ga0316593_10033414 | |||
| 1663 | Ga0316593_10053490 | |||
| 1664 | Ga0316593_10063762 | |||
| 1665 | Ga0316593_10064615 | |||
| 1666 | Ga0316593_10124721 | |||
| 1667 | Ga0316593_10135634 | |||
| 1668 | Ga0316593_10162027 | |||
| 1669 | Ga0316593_10164674 | |||
| 1670 | Ga0316593_10181662 | |||
| 1671 | Ga0316593_10367128 | |||
| 1672 | Ga0316593_10376829 | |||
| 1673 | Ga0316592_1015961 | |||
| 1674 | Ga0316592_1018872 | |||
| 1675 | Ga0316592_1029346 | |||
| 1676 | Ga0316592_1045756 | |||
| 1677 | Ga0316592_1059328 | |||
| 1678 | Ga0316586_1011407 | |||
| 1679 | Ga0316586_1040230 | |||
| 1680 | Ga0316586_1070506 | |||
| 1681 | Ga0316588_1024559 | |||
| 1682 | Ga0316588_1050008 | |||
| 1683 | Ga0316588_1060981 | |||
| 1684 | Ga0316588_1081704 | |||
| 1685 | Ga0316587_1067308 | |||
| 1686 | Ga0316587_1068251 | |||
| 1687 | Ga0316596_1016638 | |||
| 1688 | Ga0316596_1021561 | |||
| 1689 | Ga0316596_1031158 | |||
| 1690 | Ga0316596_1032577 | |||
| 1691 | Ga0316596_1065344 | |||
| 1692 | Ga0316596_1066060 | |||
| 1693 | Ga0316596_1068235 | |||
| 1694 | Ga0316596_1071025 | |||
| 1695 | Ga0316596_1079361 | |||
| 1696 | Ga0316596_1081574 | |||
| 1697 | Ga0316596_1115326 | |||
| 1698 | Ga0316596_1126610 | |||
| 1699 | Ga0316596_1170719 | |||
| 1700 | Ga0373930_0049504 | |||
| 1701 | Ga0373959_0166904 | |||
| 1702 | Ga0373926_0015576 | |||
| 1703 | Ga0373926_0366649 | |||
| 1704 | Ga0373928_0086941 | |||
| 1705 | Ga0373928_0225712 | |||
| 1706 | Ga0373940_0119284 | |||
| 1707 | Ga0373932_0036064 | |||
| 1708 | Ga0373936_0509482 | |||
| 1709 | Ga0373939_0079682 | |||
| 1710 | Ga0373941_0038593 | |||
| 1711 | Ga0373941_0072986 | |||
| 1712 | Ga0373954_0343964 | |||
| 1713 | Ga0373956_0278485 | |||
| 1714 | Ga0373957_0388099 | |||
| 1715 | Ga0373960_0391170 | |||
| 1716 | Ga0373943_0281301 | |||
| 1717 | Ga0373943_0405107 | |||
| 1718 | Ga0373946_0644426 | |||
| 1719 | Ga0373955_0065584 | |||
| 1720 | Ga0316574_0030395 | |||
| 1721 | Ga0316574_0054640 | |||
| 1722 | Ga0316574_0064233 | |||
| 1723 | Ga0316574_0602011 | |||
| 1724 | Ga0316574_0631897 | |||
| 1725 | Ga0316574_0895400 | |||
| 1726 | Ga0316574_1000456 | |||
| 1727 | Ga0373931_0007124 | |||
| 1728 | Ga0373931_0025954 | |||
| 1729 | Ga0373931_0866174 | |||
| 1730 | Ga0373931_0868492 | |||
| 1731 | Ga0373935_0986997 | |||
| 1732 | Ga0373927_0216322 | |||
| 1733 | Ga0373927_0462047 | |||
| 1734 | Ga0373927_1183836 | |||
| 1735 | Ga0373933_0038013 | |||
| 1736 | Ga0373933_0606778 | |||
| 1737 | Ga0373947_0152637 | |||
| 1738 | Ga0373947_0248589 | |||
| 1739 | Ga0373937_0002155 | |||
| 1740 | Ga0373937_0008457 | |||
| 1741 | Ga0373937_1058555 | |||
| 1742 | Ga0373937_1178266 | |||
| 1743 | Ga0316582_0000072 | |||
| 1744 | Ga0316582_0000333 | |||
| 1745 | Ga0316582_0029641 | |||
| 1746 | Ga0316582_0051089 | |||
| 1747 | Ga0316582_0640447 | |||
| 1748 | Ga0316584_0004528 | |||
| 1749 | Ga0316584_0006234 | |||
| 1750 | Ga0316584_0010371 | |||
| 1751 | Ga0316584_0036121 | |||
| 1752 | Ga0316584_0081897 | |||
| 1753 | Ga0316584_0096540 | |||
| 1754 | Ga0316584_0225028 | |||
| 1755 | Ga0316584_0393626 | |||
| 1756 | Ga0316584_0555749 | |||
| 1757 | Ga0373925_0049724 | |||
| 1758 | Ga0395899_0005116 | |||
| 1759 | Ga0395899_0511266 | |||
| 1760 | Ga0395900_0070247 | |||
| 1761 | Ga0395900_0325826 | |||
| 1762 | Ga0395900_0740869 | |||
| 1763 | Ga0395900_0955678 | |||
| 1764 | Ga0395900_1216390 | |||
| 1765 | Ga0395898_0058321 | |||
| 1766 | Ga0395898_0113648 | |||
| 1767 | Ga0395898_0163979 | |||
| 1768 | Ga0395898_1374517 | |||
| 1769 | Ga0395905_0578158 | |||
| 1770 | Ga0316581_0018989 | |||
| 1771 | Ga0436364_0053954 | |||
| 1772 | Ga0436364_0088803 | |||
| 1773 | Ga0436364_0259249 | |||
| 1774 | Ga0436364_0287928 | |||
| 1775 | Ga0436364_0335253 | |||
| 1776 | Ga0436364_0646869 | |||
| 1777 | Ga0436364_1146099 | |||
| 1778 | Ga0395901_0156061 | |||
| 1779 | Ga0395901_0237868 | |||
| 1780 | Ga0395901_1114730 | |||
| 1781 | Ga0395901_1918841 | |||
| 1782 | Ga0395901_1992590 | |||
| 1783 | Ga0400488_47748 | |||
| 1784 | Ga0400488_50168 | |||
| 1785 | Ga0400489_13001 | |||
| 1786 | Ga0400487_25766 | |||
| 1787 | Ga0436365_0629779 | |||
| 1788 | Ga0436365_1092364 | |||
| 1789 | Ga0436365_1102338 | |||
| 1790 | Ga0436365_1102958 | |||
| 1791 | Ga0436365_1241481 | |||
| 1792 | Ga0436365_1339253 | |||
| 1793 | Ga0436365_1548100 | |||
| 1794 | Ga0436360_0203097 | |||
| 1795 | Ga0436360_0254951 | |||
| 1796 | Ga0436360_0349850 | |||
| 1797 | Ga0436360_0851683 | |||
| 1798 | Ga0436361_0816314 | |||
| 1799 | Ga0436363_0062905 | |||
| 1800 | Ga0436363_0690294 | |||
| 1801 | Ga0436363_1272931 | |||
| 1802 | Ga0436362_0302776 | |||
| 1803 | Ga0436362_0871893 | |||
| 1804 | Ga0439439_0143748 | |||
| 1805 | Ga0439453_0073309 | |||
| 1806 | Ga0439465_0322514 | |||
| 1807 | Ga0451789_0261361 | |||
| 1808 | Ga0439441_119733 | |||
| 1809 | Ga0439448_0030111 | |||
| 1810 | Ga0439448_0054596 | |||
| 1811 | Ga0439448_0142639 | |||
| 1812 | Ga0439432_037858 | |||
| 1813 | Ga0439450_022457 | |||
| 1814 | Ga0439450_191313 | |||
| 1815 | Ga0439455_0011759 | |||
| 1816 | Ga0439463_039473 | |||
| 1817 | Ga0450920_125303 | |||
| 1818 | Ga0450888_002305 | |||
| 1819 | Ga0450905_045808 | |||
| 1820 | Ga0439458_0002485 | |||
| 1821 | Ga0439464_0049463 | |||
| 1822 | Ga0439464_0097919 | |||
| 1823 | Ga0439460_0005254 | |||
| 1824 | Ga0439460_0374861 | |||
| 1825 | Ga0451577_0167217 | |||
| 1826 | Ga0451577_0431394 | |||
| 1827 | Ga0439440_0217672 | |||
| 1828 | Ga0466965_0086124 | |||
| 1829 | Ga0466965_0141894 | |||
| 1830 | Ga0466965_0304011 | |||
| 1831 | Ga0466965_0334020 | |||
| 1832 | Ga0466965_0372249 | |||
| 1833 | Ga0466965_0746480 | |||
| 1834 | Ga0466966_0068535 | |||
| 1835 | Ga0466966_0116988 | |||
| 1836 | Ga0466966_0158096 | |||
| 1837 | Ga0466966_0968263 | |||
| 1838 | Ga0466961_0034795 | |||
| 1839 | Ga0466961_0166202 | |||
| 1840 | Ga0466961_0202773 | |||
| 1841 | Ga0466961_0391104 | |||
| 1842 | Ga0466961_0814336 | |||
| 1843 | Ga0466963_0165271 | |||
| 1844 | Ga0466963_0226003 | |||
| 1845 | Ga0466963_0347578 | |||
| 1846 | Ga0466963_0611396 | |||
| 1847 | Ga0466963_0635468 | |||
| 1848 | Ga0466963_0882003 | |||
| 1849 | Ga0466963_1321179 | |||
| 1850 | Ga0466964_0309843 | |||
| 1851 | Ga0466964_0338655 | |||
| 1852 | Ga0466964_0393964 | |||
| 1853 | Ga0453684_0000172 | |||
| 1854 | Ga0453684_0043460 | |||
| 1855 | Ga0453684_0112383 | |||
| 1856 | Ga0453684_2429882 | |||
| 1857 | Ga0466971_0088779 | |||
| 1858 | Ga0466970_0045751 | |||
| 1859 | Ga0466970_0489459 | |||
| 1860 | Ga0466957_0058510 | |||
| 1861 | Ga0466957_0176337 | |||
| 1862 | Ga0466957_0410151 | |||
| 1863 | Ga0466957_0977178 | |||
| 1864 | Ga0466957_1145979 | |||
| 1865 | Ga0466960_0057849 | |||
| 1866 | Ga0466960_0350769 | |||
| 1867 | Ga0466959_0034988 | |||
| 1868 | Ga0466959_0318895 | |||
| 1869 | Ga0466959_0397209 | |||
| 1870 | Ga0466959_0518013 | |||
| 1871 | Ga0451576_0004532 | |||
| 1872 | Ga0451576_0004555 | |||
| 1873 | Ga0451576_0590940 | |||
| 1874 | Ga0451576_1499329 | |||
| 1875 | Ga0451576_1768609 | |||
| 1876 | Ga0466958_0179691 | |||
| 1877 | Ga0466958_0325340 | |||
| 1878 | Ga0466958_0454841 | |||
| 1879 | Ga0466958_0697268 | |||
| 1880 | Ga0466958_0700709 | |||
| 1881 | Ga0466958_1040961 | |||
| 1882 | Ga0466958_1101165 | |||
| 1883 | Ga0466967_0000625 | |||
| 1884 | Ga0466967_0181381 | |||
| 1885 | Ga0466967_0324423 | |||
| 1886 | Ga0466967_0431649 | |||
| 1887 | Ga0466967_0551541 | |||
| 1888 | Ga0466967_1095912 | |||
| 1889 | Ga0466967_1173575 | |||
| 1890 | Ga0466967_2046771 | |||
| 1891 | Ga0466967_2596926 | |||
| 1892 | Ga0495590_0240734 | |||
| 1893 | Ga0495653_0322127 | |||
| 1894 | Ga0495653_0707381 | |||
| 1895 | Ga0495580_0273777 | |||
| 1896 | Ga0495580_0377213 | |||
| 1897 | Ga0495580_0491899 | |||
| 1898 | Ga0495582_0844769 | |||
| 1899 | Ga0495639_0012646 | |||
| 1900 | Ga0495664_0563049 | |||
| 1901 | Ga0495584_0561171 | |||
| 1902 | Ga0495585_0289287 | |||
| 1903 | Ga0495607_0347968 | |||
| 1904 | Ga0495620_0231694 | |||
| 1905 | Ga0495630_0818673 | |||
| 1906 | Ga0495630_1423589 | |||
| 1907 | Ga0495631_0064850 | |||
| 1908 | Ga0495663_0026688 | |||
| 1909 | Ga0495666_0057518 | |||
| 1910 | Ga0495642_0491522 | |||
| 1911 | Ga0495665_0403825 | |||
| 1912 | Ga0495656_0080882 | |||
| 1913 | Ga0495656_0653356 | |||
| 1914 | Ga0495668_0228072 | |||
| 1915 | Ga0495635_0185844 | |||
| 1916 | Ga0495661_0543568 | |||
| 1917 | Ga0495669_0007054 | |||
| 1918 | Ga0495613_0387712 | |||
| 1919 | Ga0495613_0626467 | |||
| 1920 | Ga0495671_0344502 | |||
| 1921 | Ga0495636_0040093 | |||
| 1922 | Ga0495672_0006230 | |||
| 1923 | Ga0495676_0033948 | |||
| 1924 | Ga0495675_0416186 | |||
| 1925 | Ga0495677_0041532 | |||
| 1926 | Ga0495685_105432 | |||
| 1927 | Ga0495686_0001038 | |||
| 1928 | Ga0495593_0628130 | |||
| 1929 | Ga0495626_0369444 | |||
| 1930 | Ga0496100_0608501 | |||
| 1931 | Ga0496102_0488261 | |||
| 1932 | Ga0496102_1112826 | |||
| 1933 | Ga0496103_0301503 | |||
| 1934 | Ga0496104_0173411 | |||
| 1935 | Ga0496104_0323469 | |||
| 1936 | Ga0496105_0711633 | |||
| 1937 | Ga0496108_0848060 | |||
| 1938 | Ga0496108_1708803 | |||
| 1939 | Ga0496109_0492531 | |||
| 1940 | Ga0496109_1323301 | |||
| 1941 | Ga0496110_0737018 | |||
| 1942 | Ga0496110_1263773 | |||
| 1943 | Ga0496111_0783858 | |||
| 1944 | Ga0496111_0934907 | |||
| 1945 | Ga0496112_0102484 | |||
| 1946 | Ga0496112_0210902 | |||
| 1947 | Ga0496112_0582861 | |||
| 1948 | Ga0496113_0043903 | |||
| 1949 | Ga0496113_0768248 | |||
| 1950 | Ga0496113_1192964 | |||
| 1951 | Ga0496115_0781562 | |||
| 1952 | Ga0496117_0034577 | |||
| 1953 | Ga0496118_0007338 | |||
| 1954 | Ga0496120_0186452 | |||
| 1955 | Ga0496121_0702437 | |||
| 1956 | Ga0496122_0001160 | |||
| 1957 | Ga0496124_0009571 | |||
| 1958 | Ga0496125_0000094 | |||
| 1959 | Ga0501306_024116 | |||
| 1960 | Ga0501308_013227 | |||
| 1961 | Ga0501308_027979 | |||
| 1962 | Ga0501309_070204 | |||
| 1963 | Ga0501341_06994 | |||
| 1964 | Ga0501305_020255 | |||
| 1965 | Ga0501307_057619 | |||
| 1966 | Ga0501307_060301 | |||
| 1967 | Ga0501303_055156 | |||
| 1968 | Ga0501311_022396 | |||
| 1969 | Ga0501312_051571 | |||
| 1970 | Ga0501312_087513 | |||
| 1971 | Ga0501314_020764 | |||
| 1972 | Ga0501314_022026 | |||
| 1973 | Ga0501315_042473 | |||
| 1974 | Ga0501315_042590 | |||
| 1975 | Ga0501317_005251 | |||
| 1976 | Ga0501317_021604 | |||
| 1977 | Ga0501318_010062 | |||
| 1978 | Ga0501319_011382 | |||
| 1979 | Ga0501319_011919 | |||
| 1980 | Ga0501322_002304 | |||
| 1981 | Ga0501322_009573 | |||
| 1982 | Ga0501322_010107 | |||
| 1983 | Ga0501340_010992 | |||
| 1984 | Ga0501031_0554744 | |||
| 1985 | Ga0501031_0683632 | |||
| 1986 | Ga0501032_0269102 | |||
| 1987 | Ga0501032_0500961 | |||
| 1988 | Ga0501032_0532006 | |||
| 1989 | Ga0501033_0647293 | |||
| 1990 | Ga0501037_0068611 | |||
| 1991 | Ga0501038_1217369 | |||
| 1992 | Ga0501039_0100696 | |||
| 1993 | Ga0501040_0622419 | |||
| 1994 | Ga0501041_0002243 | |||
| 1995 | Ga0501042_0989942 | |||
| 1996 | Ga0501042_1057783 | |||
| 1997 | Ga0501042_1206685 | |||
| 1998 | Ga0501043_0361135 | |||
| 1999 | Ga0501043_0436213 | |||
| 2000 | Ga0501043_0802410 | |||
| 2001 | Ga0501047_0014394 | |||
| 2002 | Ga0501047_0184397 | |||
| 2003 | Ga0501047_0241900 | |||
| 2004 | Ga0501047_0351219 | |||
| 2005 | Ga0501047_1094350 | |||
| 2006 | Ga0501048_0063131 | |||
| 2007 | Ga0501068_0134020 | |||
| 2008 | Ga0501068_1011133 | |||
| 2009 | Ga0501069_0056554 | |||
| 2010 | Ga0501070_0001672 | |||
| 2011 | Ga0501070_0145986 | |||
| 2012 | Ga0501070_0454163 | |||
| 2013 | Ga0501071_0048281 | |||
| 2014 | Ga0501073_0005789 | |||
| 2015 | Ga0501073_0383035 | |||
| 2016 | Ga0501074_0008563 | |||
| 2017 | Ga0501074_0258440 | |||
| 2018 | Ga0501075_0030005 | |||
| 2019 | Ga0501076_0018225 | |||
| 2020 | Ga0501077_0011967 | |||
| 2021 | Ga0501077_0335059 | |||
| 2022 | Ga0501206_113205 | |||
| 2023 | Ga0501243_001637 | |||
| 2024 | Ga0501079_0003679 | |||
| 2025 | Ga0501079_0019517 | |||
| 2026 | Ga0501080_0015230 | |||
| 2027 | Ga0501080_0115403 | |||
| 2028 | Ga0501081_0033925 | |||
| 2029 | Ga0501081_1025940 | |||
| 2030 | Ga0501081_1146826 | |||
| 2031 | Ga0501083_0265301 | |||
| 2032 | Ga0501241_123517 | |||
| 2033 | Ga0501271_022312 | |||
| 2034 | Ga0501282_006822 | |||
| 2035 | Ga0501035_1406765 | |||
| 2036 | Ga0501035_1449728 | |||
| 2037 | Ga0501044_0168333 | |||
| 2038 | Ga0501044_0278248 | |||
| 2039 | Ga0501044_0856927 | |||
| 2040 | Ga0501044_1259121 | |||
| 2041 | Ga0501212_122359 | |||
| 2042 | nmdc:mga00v17_134291_c1 | |||
| 2043 | nmdc:mga0yw44_256029_c1 | |||
| 2044 | nmdc:mga0yw44_915685_c1 | |||
| 2045 | nmdc:mga0k408_310713_c1 | |||
| 2046 | nmdc:mga07m45_32747_c1 | |||
| 2047 | nmdc:mga05p37_69462_c1 | |||
| 2048 | nmdc:mga09592_1184977_c1 | |||
| 2049 | nmdc:mga09592_307899_c1 | |||
| 2050 | nmdc:mga0qj67_1283558_c1 | |||
| 2051 | nmdc:mga06r32_1093626_c1 | |||
| 2052 | nmdc:mga06r32_38923_c1 | |||
| 2053 | nmdc:mga06r32_59733_c1 | |||
| 2054 | nmdc:mga0n895_1691524_c1 | |||
| 2055 | nmdc:mga0n895_744964_c1 | |||
| 2056 | nmdc:mga0n895_869913_c1 | |||
| 2057 | nmdc:mga0rr50_118698_c1 | |||
| 2058 | nmdc:mga08x19_135737_c1 | |||
| 2059 | nmdc:mga08x19_6846_c1 | |||
| 2060 | Ga0500562_059626 | |||
| 2061 | Ga0500616_0004725 | |||
| 2062 | Ga0500587_006564 | |||
| 2063 | Ga0501084_0033293 | |||
| 2064 | Ga0501084_0234423 | |||
| 2065 | Ga0587093_076037 | |||
| 2066 | Ga0587066_068844 | |||
| 2067 | Ga0587070_197286 | |||
| 2068 | Ga0587073_0110888 | |||
| 2069 | Ga0587088_039423 | |||
| 2070 | Ga0587091_131366 | |||
| 2071 | Ga0587106_067524 | |||
| 2072 | Ga0587062_079349 | |||
| 2073 | Ga0587075_011854 | |||
| 2074 | Ga0587076_091728 | |||
| 2075 | Ga0587078_032166 | |||
| 2076 | Ga0587114_051436 | |||
| 2077 | Ga0587111_0184431 | |||
| 2078 | Ga0466962_0040787 | |||
| 2079 | Ga0466962_0175028 | |||
| 2080 | Ga0466962_0425359 | |||
| 2081 | Ga0530510_1326480 | |||
| 2082 | 2511255820 | |||
| 2083 | 2511276351 | |||
| 2084 | 2511325713 | |||
| 2085 | 2511338294 | |||
| 2086 | 2511343081 | |||
| 2087 | 2511361163 | |||
| 2088 | 2621297571 | |||
| 2089 | 2738671082 | |||
| 2090 | 2738749476 | |||
| 2091 | 2738858516 | |||
| 2092 | 2774121751 | |||
| 2093 | 2784317832 | |||
| 2094 | 2808930805 | |||
| 2095 | 2808952927 | |||
| 2096 | 2808959252 | |||
| 2097 | 2817493300 | |||
| 2098 | 2837272115 | |||
| 2099 | 2860343823 | |||
| 2100 | 2919461806 | |||
| 2101 | 2931397493 | |||
| 2102 | 2945966219 | |||
| 2103 | 3007516630 | |||
| 2104 | 3007621459 | |||
| 2105 | 8002748011 | |||
| 2106 | 8056157137 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8c8z-assembly1.cif.gz_W | cryo-em captures early ribosome assembly in action | 0.977 | 17 | 85 |
| 8c94-assembly1.cif.gz_W | cryo-em captures early ribosome assembly in action | 0.9652 | 18 | 85 |
| 1v8q-assembly1.cif.gz_A | crystal structure of ribosomal protein l27 from thermus thermophilus hb8 | 0.9644 | 20 | 85 |
| 7pkt-assembly1.cif.gz_u | large subunit of the chlamydomonas reinhardtii mitoribosome | 0.9634 | 20 | 85 |
| 8c8z-assembly1.cif.gz_W | cryo-em captures early ribosome assembly in action | 0.9634 | 17 | 85 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1v8qA00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9644 | 20 | 85 | 2.40.50.100 |
| 1v8qA00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9361 | 20 | 85 | 2.40.50.100 |
| af_Q8IJ68_113_199_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9086 | 8 | 85 | 2.40.50.100 |
| af_P0A7L8_6_84_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9078 | 6 | 84 | 2.40.50.100 |
| af_Q9ZVX0_51_147_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.8989 | 7 | 84 | 2.40.50.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A455UVJ5-F1-model_v4 | deleted | 1.004 | 23 | 85 |
|
| AF-A0A0A8XHI5-F1-model_v4 | Large ribosomal subunit protein bL27 (50S ribosomal protein L27) | 1.002 | 20 | 85 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A378VWB8-F1-model_v4 | Large ribosomal subunit protein bL27 (50S ribosomal protein L27) | 1.002 | 22 | 84 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A2E9FJN9-F1-model_v4 | Large ribosomal subunit protein bL27 (50S ribosomal protein L27) | 0.9995 | 21 | 85 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A3B8REZ0-F1-model_v4 | Large ribosomal subunit protein bL27 (50S ribosomal protein L27) | 0.9948 | 15 | 85 |
GO:0003735
GO:0006412 GO:0022625 |