F489069
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1051 | 524 | 2102 | 86 |
Family's Representative Sequence
| Representative Sequence | 3300005436|Ga0070713_101466632|Ga0070713_1014666322 |
| Length | 78 |
| Sequence | MAHKKGGGSSRNGRDSKAKRLGTKVYGGQVVTAGSIIVRQREGVGKGGDDTLFATRAGQVRFHESRGRTYAVVDLVSA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 2 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 3 | 3300002872 | Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_5 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 4 | 3300003161 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_8 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 5 | 3300003162 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 6 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 7 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 8 | 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 9 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 10 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 11 | 3300003559 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 12 | 3300003568 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 13 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 14 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 15 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 16 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 17 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 18 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 19 | 3300003735 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 20 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 21 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 22 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 23 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 24 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 25 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 30 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 54 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 65 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 66 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 67 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 68 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 69 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 70 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 71 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 72 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 74 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 75 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 76 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 80 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 81 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 82 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 83 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 84 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 85 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 86 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 87 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 88 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 89 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 90 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 91 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 92 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 94 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 95 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 96 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300012490 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 | Metagenome | Rhizosphere |
| 111 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 112 | 3300013043 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 113 | 3300013044 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 114 | 3300013045 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 115 | 3300013062 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 116 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 124 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 126 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300019183 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA1 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 128 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 130 | 3300020071 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 131 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 132 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 133 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 134 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 135 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 136 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 137 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 138 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 139 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 140 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 141 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 142 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 143 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 144 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 188 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 189 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 193 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 194 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 195 | 3300029285 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 | Metatranscriptome | Rhizosphere |
| 196 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 197 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 198 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 199 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 200 | 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 201 | 3300030886 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 202 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 203 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 204 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 205 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 206 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 207 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 208 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 209 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 210 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 211 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 212 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 213 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 214 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 215 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 216 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 217 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 218 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 219 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 220 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 221 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 222 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 223 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 224 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 225 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 226 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 227 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 228 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 229 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 230 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 231 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 232 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 233 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 234 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 235 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 236 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 237 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 238 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 239 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 240 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 241 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 242 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 243 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 244 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 245 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 246 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 247 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 248 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 249 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 250 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 251 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 252 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 253 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 254 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 255 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 256 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 257 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 258 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 259 | 3300041457 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaT | Metatranscriptome | Rhizoplane |
| 260 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 261 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 262 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 263 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 264 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 265 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 266 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 267 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 268 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 269 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 270 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 271 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 272 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 273 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 274 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 275 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 276 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 277 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 278 | 3300042117 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 | Metagenome | Rhizosphere |
| 279 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 280 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 281 | 3300042123 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 | Metagenome | Rhizosphere |
| 282 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 283 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 284 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 285 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 286 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 287 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 288 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 289 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 290 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 291 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 292 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 293 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 294 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 295 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 296 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 297 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 298 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 299 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 300 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 301 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 302 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 303 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 304 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 305 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 306 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 307 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 308 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 309 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 310 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 311 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 312 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 313 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 366 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 367 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 368 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 369 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 370 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 371 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 372 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 373 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 374 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 375 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 376 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 377 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 378 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 379 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 380 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 381 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 382 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 383 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 384 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 385 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 386 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 387 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 388 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 389 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 390 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 391 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 392 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 393 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 394 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 395 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 396 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 397 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 398 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 399 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 400 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 401 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 402 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 403 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 404 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 405 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 406 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 407 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 408 | 3300049556 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 409 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 410 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 411 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 412 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 413 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 414 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 415 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 416 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 417 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 418 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 419 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 420 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 421 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 422 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 423 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 424 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 425 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 426 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 427 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 428 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 429 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 430 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 431 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 432 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 433 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 434 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 435 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 436 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 437 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 438 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 439 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 440 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 441 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 442 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 443 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 444 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 445 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 446 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 447 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 448 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 449 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 450 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 451 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 452 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 453 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 454 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 455 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 458 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 459 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 460 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 461 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 462 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 463 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 464 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 465 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 466 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 467 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 468 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 469 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 470 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 471 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 472 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 473 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 474 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 475 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 476 | 3300059514 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 477 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 478 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 479 | 3300059607 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 480 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 481 | 3300059625 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 482 | 3300059628 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 483 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 484 | 3300059631 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 485 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 486 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 487 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 488 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 489 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 490 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 491 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 492 | 3300059654 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 493 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 494 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 495 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 496 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 497 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 498 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 499 | 2558860112 | Pseudonocardia acaciae DSM 45401 | Isolate | Unclassified |
| 500 | 2565956761 | Rhodococcus qingshengii BKS 20-40 | Isolate | Rhizosphere |
| 501 | 2585427649 | Amycolatopsis japonica MG417-CF17, DSM 44213 | Isolate | Unclassified |
| 502 | 2643221567 | Phycicoccus sp. Root563 | Isolate | Unclassified |
| 503 | 2643221624 | Phycicoccus sp. Root101 | Isolate | Unclassified |
| 504 | 2643221711 | Terrabacter sp. Root85 | Isolate | Unclassified |
| 505 | 2738541308 | Rhodococcus sp. OK551 | Isolate | Unclassified |
| 506 | 2744054611 | Aldersonia kunmingensis DSM 45001 | Isolate | Rhizosphere |
| 507 | 2795385470 | Labedaea rhizosphaerae DSM 45361 | Isolate | Rhizosphere |
| 508 | 2795385472 | Herbihabitans rhizosphaerae DSM 101727 | Isolate | Rhizosphere |
| 509 | 2808606365 | Phycicoccus sp. SLBN-51 | Isolate | Unclassified |
| 510 | 2808606522 | Amycolatopsis sp. BJA-103 | Isolate | Unclassified |
| 511 | 2811994882 | Terrabacter sp. SLBN-196 | Isolate | Unclassified |
| 512 | 2818991318 | Humibacillus xanthopallidus SLBN-155 | Isolate | Unclassified |
| 513 | 2818991458 | Terrabacter sp. 3211 | Isolate | Rhizosphere |
| 514 | 2818991462 | Terrabacter sp. 3264 | Isolate | Rhizosphere |
| 515 | 2818991469 | Terrabacter lapilli 3265 | Isolate | Rhizosphere |
| 516 | 2866612099 | Amycolatopsis suaedae 8-3EHSu | Isolate | Unclassified |
| 517 | 2870782633 | Pseudonocardia eucalypti DSM 45351 | Isolate | Unclassified |
| 518 | 2899359706 | Amycolatopsis anabasis EGI 650086 | Isolate | Unclassified |
| 519 | 2904535858 | Rhodococcus erythropolis 2017 | Isolate | Unclassified |
| 520 | 2915358134 | Pseudonocardia pini CAP47R | Isolate | Unclassified |
| 521 | 2915768154 | Amycolatopsis pittospori PIP199 | Isolate | Unclassified |
| 522 | 2922554459 | Rhodococcus sp. 66b | Isolate | Unclassified |
| 523 | 2974315732 | Rhodococcus sp. SORGH_AS 301 | Isolate | Unclassified |
| 524 | 2984523437 | Rhodococcus sp. SORGH_AS303 | Isolate | Aerial Root |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 76.31 |
| Metatranscriptomes | 21.22 |
| Isolates | 2.47 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.1 |
| Bulb | 0 |
| Endosphere | 1.71 |
| Nodule | 0.19 |
| Rhizoplane | 5.61 |
| Rhizosphere | 85.73 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.19 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070713_101466632 | 3300005436 | Bacteria | 662 |
| 2 | JGI24735J21928_10210953 | 3300002067 | Bacteria | 564 |
| 3 | Ga0006762J43184_106040 | 3300002872 | Bacteria | 747 |
| 4 | Ga0006765J45826_110262 | 3300003161 | Bacteria | 733 |
| 5 | Ga0006778J45830_1005056 | 3300003162 | Bacteria | 813 |
| 6 | Ga0006778J45830_1038144 | 3300003162 | Bacteria | 771 |
| 7 | Ga0006759J45824_1034474 | 3300003163 | Bacteria | 688 |
| 8 | JGI25406J46586_10013924 | 3300003203 | Bacteria | 3434 |
| 9 | Ga0006777J48905_1006137 | 3300003308 | Bacteria | 846 |
| 10 | Ga0006777J48905_1026371 | 3300003308 | Bacteria | 723 |
| 11 | JGI25407J50210_10103766 | 3300003373 | Bacteria | 702 |
| 12 | Ga0007417J51691_1036609 | 3300003544 | Bacteria | 732 |
| 13 | Ga0007427J51700_104963 | 3300003559 | Bacteria | 756 |
| 14 | Ga0006781J51513_1004313 | 3300003568 | Bacteria | 784 |
| 15 | Ga0007410J51695_1031624 | 3300003574 | Bacteria | 741 |
| 16 | Ga0007410J51695_1032791 | 3300003574 | Bacteria | 743 |
| 17 | Ga0007409J51694_1033305 | 3300003575 | Bacteria | 730 |
| 18 | Ga0007416J51690_1008291 | 3300003577 | Bacteria | 804 |
| 19 | Ga0006562J51391_1009846 | 3300003578 | Bacteria | 709 |
| 20 | Ga0007429J51699_1004583 | 3300003579 | Bacteria | 1072 |
| 21 | Ga0007429J51699_1023912 | 3300003579 | Bacteria | 588 |
| 22 | Ga0007429J51699_1041285 | 3300003579 | Bacteria | 602 |
| 23 | Ga0032354_1033399 | 3300003693 | Bacteria | 622 |
| 24 | Ga0032354_1034419 | 3300003693 | Bacteria | 727 |
| 25 | Ga0032354_1059326 | 3300003693 | Bacteria | 703 |
| 26 | Ga0032354_1073262 | 3300003693 | Bacteria | 661 |
| 27 | Ga0006780_1001866 | 3300003735 | Bacteria | 743 |
| 28 | Ga0058859_10089023 | 3300004798 | Bacteria | 680 |
| 29 | Ga0058863_10008355 | 3300004799 | Bacteria | 648 |
| 30 | Ga0058863_10026305 | 3300004799 | Bacteria | 504 |
| 31 | Ga0058861_10026983 | 3300004800 | Bacteria | 831 |
| 32 | Ga0058861_10149181 | 3300004800 | Bacteria | 586 |
| 33 | Ga0058861_11719764 | 3300004800 | Bacteria | 682 |
| 34 | Ga0058860_10089247 | 3300004801 | Bacteria | 625 |
| 35 | Ga0058862_10217586 | 3300004803 | Bacteria | 508 |
| 36 | Ga0058862_12879838 | 3300004803 | Bacteria | 634 |
| 37 | Ga0070658_11134521 | 3300005327 | Bacteria | 680 |
| 38 | Ga0070658_11476507 | 3300005327 | Bacteria | 590 |
| 39 | Ga0070683_100477399 | 3300005329 | Bacteria | 1190 |
| 40 | Ga0070683_101127242 | 3300005329 | Bacteria | 754 |
| 41 | Ga0070683_102206042 | 3300005329 | Bacteria | 529 |
| 42 | Ga0070670_100311440 | 3300005331 | Bacteria | 1378 |
| 43 | Ga0070670_100879134 | 3300005331 | Bacteria | 812 |
| 44 | Ga0070670_102204608 | 3300005331 | Bacteria | 508 |
| 45 | Ga0070677_10060915 | 3300005333 | Bacteria | 1556 |
| 46 | Ga0070677_10296584 | 3300005333 | Bacteria | 820 |
| 47 | Ga0068869_100735424 | 3300005334 | Bacteria | 844 |
| 48 | Ga0070666_10016267 | 3300005335 | Bacteria | 4757 |
| 49 | Ga0070666_11064486 | 3300005335 | Bacteria | 601 |
| 50 | Ga0070666_11393473 | 3300005335 | Bacteria | 524 |
| 51 | Ga0070680_101466279 | 3300005336 | Bacteria | 591 |
| 52 | Ga0070660_100641963 | 3300005339 | Bacteria | 889 |
| 53 | Ga0070660_100740989 | 3300005339 | Bacteria | 825 |
| 54 | Ga0070660_101156321 | 3300005339 | Bacteria | 656 |
| 55 | Ga0070689_101043798 | 3300005340 | Bacteria | 729 |
| 56 | Ga0070687_100615357 | 3300005343 | Bacteria | 748 |
| 57 | Ga0070661_101457457 | 3300005344 | Bacteria | 577 |
| 58 | Ga0070692_11124989 | 3300005345 | Bacteria | 556 |
| 59 | Ga0070668_100626451 | 3300005347 | Bacteria | 943 |
| 60 | Ga0070668_101395525 | 3300005347 | Bacteria | 639 |
| 61 | Ga0070669_100663673 | 3300005353 | Bacteria | 878 |
| 62 | Ga0070675_100618916 | 3300005354 | Bacteria | 983 |
| 63 | Ga0070671_100875833 | 3300005355 | Bacteria | 784 |
| 64 | Ga0070674_100178234 | 3300005356 | Bacteria | 1626 |
| 65 | Ga0070674_100243236 | 3300005356 | Bacteria | 1410 |
| 66 | Ga0070674_100258691 | 3300005356 | Bacteria | 1370 |
| 67 | Ga0070674_100620453 | 3300005356 | Bacteria | 916 |
| 68 | Ga0070674_100632275 | 3300005356 | Bacteria | 908 |
| 69 | Ga0070667_100080335 | 3300005367 | Bacteria | 2789 |
| 70 | Ga0070709_10695403 | 3300005434 | Bacteria | 791 |
| 71 | Ga0070709_10942188 | 3300005434 | Bacteria | 684 |
| 72 | Ga0070709_11096603 | 3300005434 | Bacteria | 636 |
| 73 | Ga0070714_101590174 | 3300005435 | Bacteria | 638 |
| 74 | Ga0070713_101283156 | 3300005436 | Bacteria | 709 |
| 75 | Ga0070713_101612971 | 3300005436 | Bacteria | 630 |
| 76 | Ga0070710_10679718 | 3300005437 | Bacteria | 724 |
| 77 | Ga0070710_10679719 | 3300005437 | Bacteria | 724 |
| 78 | Ga0070710_11406024 | 3300005437 | Bacteria | 522 |
| 79 | Ga0070711_100003789 | 3300005439 | Bacteria | 8872 |
| 80 | Ga0070711_100219993 | 3300005439 | Bacteria | 1475 |
| 81 | Ga0070711_100611127 | 3300005439 | Bacteria | 910 |
| 82 | Ga0070711_101233417 | 3300005439 | Bacteria | 647 |
| 83 | Ga0070711_101986237 | 3300005439 | Bacteria | 511 |
| 84 | Ga0070663_101466910 | 3300005455 | Bacteria | 606 |
| 85 | Ga0070678_100076418 | 3300005456 | Bacteria | 2522 |
| 86 | Ga0070681_10406266 | 3300005458 | Bacteria | 1273 |
| 87 | Ga0070681_11150177 | 3300005458 | Bacteria | 697 |
| 88 | Ga0070685_10611086 | 3300005466 | Bacteria | 786 |
| 89 | Ga0070707_100871511 | 3300005468 | Bacteria | 865 |
| 90 | Ga0070684_100194508 | 3300005535 | Bacteria | 1846 |
| 91 | Ga0070684_100357105 | 3300005535 | Bacteria | 1345 |
| 92 | Ga0070684_100679954 | 3300005535 | Bacteria | 959 |
| 93 | Ga0068853_100819511 | 3300005539 | Bacteria | 892 |
| 94 | Ga0070672_100366745 | 3300005543 | Bacteria | 1230 |
| 95 | Ga0070686_101416219 | 3300005544 | Bacteria | 584 |
| 96 | Ga0070696_100328651 | 3300005546 | Bacteria | 1179 |
| 97 | Ga0070696_101588431 | 3300005546 | Bacteria | 562 |
| 98 | Ga0070665_100011443 | 3300005548 | Bacteria | 8971 |
| 99 | Ga0070665_100233199 | 3300005548 | Bacteria | 1841 |
| 100 | Ga0068855_100101198 | 3300005563 | Bacteria | 3317 |
| 101 | Ga0068855_100498795 | 3300005563 | Bacteria | 1323 |
| 102 | Ga0070702_100416124 | 3300005615 | Bacteria | 966 |
| 103 | Ga0068852_100581584 | 3300005616 | Bacteria | 1123 |
| 104 | Ga0068859_100009699 | 3300005617 | Bacteria | 9721 |
| 105 | Ga0068859_100408448 | 3300005617 | Bacteria | 1454 |
| 106 | Ga0068864_100723368 | 3300005618 | Bacteria | 974 |
| 107 | Ga0068864_101063745 | 3300005618 | Bacteria | 804 |
| 108 | Ga0068861_101654744 | 3300005719 | Bacteria | 632 |
| 109 | Ga0068863_100000271 | 3300005841 | Bacteria | 53894 |
| 110 | Ga0068863_100819549 | 3300005841 | Bacteria | 929 |
| 111 | Ga0068863_101012327 | 3300005841 | Bacteria | 834 |
| 112 | Ga0068858_100042746 | 3300005842 | Bacteria | 4202 |
| 113 | Ga0068858_100310988 | 3300005842 | Bacteria | 1505 |
| 114 | Ga0068858_101087157 | 3300005842 | Bacteria | 785 |
| 115 | Ga0068860_100000017 | 3300005843 | Bacteria | 307083 |
| 116 | Ga0068862_101751187 | 3300005844 | Bacteria | 630 |
| 117 | Ga0081455_10449726 | 3300005937 | Bacteria | 880 |
| 118 | Ga0081538_10003166 | 3300005981 | Bacteria | 15648 |
| 119 | Ga0081538_10046271 | 3300005981 | Bacteria | 2686 |
| 120 | Ga0081538_10103120 | 3300005981 | Bacteria | 1429 |
| 121 | Ga0081538_10123888 | 3300005981 | Bacteria | 1235 |
| 122 | Ga0081540_1205334 | 3300005983 | Bacteria | 713 |
| 123 | Ga0081539_10056259 | 3300005985 | Bacteria | 2184 |
| 124 | Ga0081539_10101202 | 3300005985 | Bacteria | 1469 |
| 125 | Ga0070717_10233235 | 3300006028 | Bacteria | 1621 |
| 126 | Ga0070717_10494657 | 3300006028 | Bacteria | 1105 |
| 127 | Ga0070717_11523731 | 3300006028 | Bacteria | 606 |
| 128 | Ga0070717_11916909 | 3300006028 | Bacteria | 535 |
| 129 | Ga0075365_10229574 | 3300006038 | Bacteria | 1303 |
| 130 | Ga0075364_10268624 | 3300006051 | Bacteria | 1160 |
| 131 | Ga0075364_10440156 | 3300006051 | Bacteria | 890 |
| 132 | Ga0075432_10007919 | 3300006058 | Bacteria | 3622 |
| 133 | Ga0070715_10014834 | 3300006163 | Bacteria | 2894 |
| 134 | Ga0070715_10077553 | 3300006163 | Bacteria | 1500 |
| 135 | Ga0070715_10208938 | 3300006163 | Bacteria | 996 |
| 136 | Ga0070716_100440099 | 3300006173 | Bacteria | 947 |
| 137 | Ga0070716_101291322 | 3300006173 | Bacteria | 590 |
| 138 | Ga0070712_100129277 | 3300006175 | Bacteria | 1912 |
| 139 | Ga0070712_100338724 | 3300006175 | Bacteria | 1227 |
| 140 | Ga0070712_101269107 | 3300006175 | Bacteria | 641 |
| 141 | Ga0075362_10119435 | 3300006177 | Bacteria | 1247 |
| 142 | Ga0075369_10340621 | 3300006186 | Bacteria | 703 |
| 143 | Ga0075427_10003509 | 3300006194 | Bacteria | 2168 |
| 144 | Ga0075370_10203384 | 3300006353 | Bacteria | 1168 |
| 145 | Ga0075370_10368609 | 3300006353 | Bacteria | 859 |
| 146 | Ga0068871_100161342 | 3300006358 | Bacteria | 1918 |
| 147 | Ga0075428_102323943 | 3300006844 | Bacteria | 551 |
| 148 | Ga0075430_100002298 | 3300006846 | Bacteria | 15851 |
| 149 | Ga0075431_100046360 | 3300006847 | Bacteria | 4482 |
| 150 | Ga0075433_10202134 | 3300006852 | Bacteria | 1766 |
| 151 | Ga0075434_100173292 | 3300006871 | Bacteria | 2177 |
| 152 | Ga0075434_100732809 | 3300006871 | Bacteria | 1006 |
| 153 | Ga0075429_100184448 | 3300006880 | Bacteria | 1828 |
| 154 | Ga0075429_100484559 | 3300006880 | Bacteria | 1084 |
| 155 | Ga0068865_100031002 | 3300006881 | Bacteria | 3561 |
| 156 | Ga0075436_100106475 | 3300006914 | Bacteria | 1956 |
| 157 | Ga0075436_100712459 | 3300006914 | Bacteria | 744 |
| 158 | Ga0097620_100009699 | 3300006931 | Bacteria | 9721 |
| 159 | Ga0097620_100408444 | 3300006931 | Bacteria | 1454 |
| 160 | Ga0099826_10503269 | 3300006948 | Bacteria | 566 |
| 161 | Ga0075435_100223661 | 3300007076 | Bacteria | 1598 |
| 162 | Ga0075435_100327153 | 3300007076 | Bacteria | 1312 |
| 163 | Ga0099794_10264980 | 3300007265 | Bacteria | 887 |
| 164 | Ga0105244_10155452 | 3300009036 | Bacteria | 1094 |
| 165 | Ga0105250_10365835 | 3300009092 | Bacteria | 634 |
| 166 | Ga0105240_10344993 | 3300009093 | Bacteria | 1691 |
| 167 | Ga0105240_10927804 | 3300009093 | Bacteria | 935 |
| 168 | Ga0111539_10008260 | 3300009094 | Bacteria | 13247 |
| 169 | Ga0111539_10637647 | 3300009094 | Bacteria | 1241 |
| 170 | Ga0111539_11215726 | 3300009094 | Bacteria | 875 |
| 171 | Ga0105245_11428557 | 3300009098 | Bacteria | 742 |
| 172 | Ga0105245_13052556 | 3300009098 | Bacteria | 519 |
| 173 | Ga0105245_13170242 | 3300009098 | Bacteria | 510 |
| 174 | Ga0105247_10003047 | 3300009101 | Bacteria | 11095 |
| 175 | Ga0105247_10097661 | 3300009101 | Bacteria | 1874 |
| 176 | Ga0105247_11322399 | 3300009101 | Bacteria | 580 |
| 177 | Ga0114129_10008595 | 3300009147 | Bacteria | 14561 |
| 178 | Ga0114129_10215833 | 3300009147 | Bacteria | 2591 |
| 179 | Ga0105241_10140534 | 3300009174 | Bacteria | 1965 |
| 180 | Ga0105241_10813919 | 3300009174 | Bacteria | 861 |
| 181 | Ga0105242_10960326 | 3300009176 | Bacteria | 859 |
| 182 | Ga0105248_10577601 | 3300009177 | Bacteria | 1268 |
| 183 | Ga0105248_10839045 | 3300009177 | Bacteria | 1037 |
| 184 | Ga0105238_10316290 | 3300009551 | Bacteria | 1547 |
| 185 | Ga0105249_12164515 | 3300009553 | Bacteria | 629 |
| 186 | Ga0105239_10888391 | 3300010375 | Bacteria | 1023 |
| 187 | Ga0105246_10694791 | 3300011119 | Bacteria | 891 |
| 188 | Ga0157322_1013097 | 3300012490 | Bacteria | 708 |
| 189 | Ga0157315_1041091 | 3300012508 | Bacteria | 586 |
| 190 | Ga0154018_106035 | 3300013043 | Bacteria | 615 |
| 191 | Ga0154019_111685 | 3300013044 | Bacteria | 762 |
| 192 | Ga0154019_130654 | 3300013044 | Bacteria | 714 |
| 193 | Ga0154019_132188 | 3300013044 | Bacteria | 679 |
| 194 | Ga0154016_140112 | 3300013045 | Bacteria | 600 |
| 195 | Ga0154010_134604 | 3300013062 | Bacteria | 815 |
| 196 | Ga0157369_10335593 | 3300013105 | Bacteria | 1570 |
| 197 | Ga0157369_10863208 | 3300013105 | Bacteria | 929 |
| 198 | Ga0157369_10893070 | 3300013105 | Bacteria | 911 |
| 199 | Ga0157369_11025526 | 3300013105 | Bacteria | 844 |
| 200 | Ga0157369_11174195 | 3300013105 | Bacteria | 784 |
| 201 | Ga0157369_12352435 | 3300013105 | Bacteria | 540 |
| 202 | Ga0157374_10624912 | 3300013296 | Bacteria | 1088 |
| 203 | Ga0163162_10726698 | 3300013306 | Bacteria | 1113 |
| 204 | Ga0163162_11786131 | 3300013306 | Bacteria | 703 |
| 205 | Ga0163162_12451292 | 3300013306 | Bacteria | 600 |
| 206 | Ga0157372_12169798 | 3300013307 | Bacteria | 638 |
| 207 | Ga0157372_13083542 | 3300013307 | Bacteria | 532 |
| 208 | Ga0157375_10202275 | 3300013308 | Bacteria | 2142 |
| 209 | Ga0157375_11213137 | 3300013308 | Bacteria | 885 |
| 210 | Ga0157375_12652050 | 3300013308 | Bacteria | 599 |
| 211 | Ga0163163_11121161 | 3300014325 | Bacteria | 850 |
| 212 | Ga0163163_11253974 | 3300014325 | Bacteria | 804 |
| 213 | Ga0163163_11908895 | 3300014325 | Bacteria | 654 |
| 214 | Ga0163163_12375095 | 3300014325 | Bacteria | 589 |
| 215 | Ga0157380_10062761 | 3300014326 | Bacteria | 2977 |
| 216 | Ga0157380_10170339 | 3300014326 | Bacteria | 1902 |
| 217 | Ga0182008_10150045 | 3300014497 | Bacteria | 1169 |
| 218 | Ga0182008_10611691 | 3300014497 | Bacteria | 613 |
| 219 | Ga0157379_10433023 | 3300014968 | Bacteria | 1212 |
| 220 | Ga0182007_10205048 | 3300015262 | Bacteria | 691 |
| 221 | Ga0163161_10273822 | 3300017792 | Bacteria | 1322 |
| 222 | Ga0163161_11194458 | 3300017792 | Bacteria | 657 |
| 223 | Ga0184601_106667 | 3300019183 | Bacteria | 758 |
| 224 | Ga0197907_10510385 | 3300020069 | Bacteria | 649 |
| 225 | Ga0197907_10609010 | 3300020069 | Bacteria | 889 |
| 226 | Ga0197907_10673134 | 3300020069 | Bacteria | 816 |
| 227 | Ga0197907_10774481 | 3300020069 | Bacteria | 699 |
| 228 | Ga0197907_11011516 | 3300020069 | Bacteria | 682 |
| 229 | Ga0197907_11074173 | 3300020069 | Bacteria | 711 |
| 230 | Ga0197907_11203548 | 3300020069 | Bacteria | 610 |
| 231 | Ga0206356_10063509 | 3300020070 | Bacteria | 645 |
| 232 | Ga0206356_10066933 | 3300020070 | Bacteria | 715 |
| 233 | Ga0206356_10411237 | 3300020070 | Bacteria | 767 |
| 234 | Ga0206356_10508149 | 3300020070 | Bacteria | 835 |
| 235 | Ga0206356_10536307 | 3300020070 | Bacteria | 731 |
| 236 | Ga0206356_10991299 | 3300020070 | Bacteria | 602 |
| 237 | Ga0206348_118668 | 3300020071 | Bacteria | 677 |
| 238 | Ga0206349_1011561 | 3300020075 | Bacteria | 964 |
| 239 | Ga0206349_1032467 | 3300020075 | Bacteria | 537 |
| 240 | Ga0206349_1074758 | 3300020075 | Bacteria | 1049 |
| 241 | Ga0206349_1229691 | 3300020075 | Bacteria | 718 |
| 242 | Ga0206349_1334875 | 3300020075 | Bacteria | 739 |
| 243 | Ga0206349_1348834 | 3300020075 | Bacteria | 1062 |
| 244 | Ga0206349_1350967 | 3300020075 | Bacteria | 931 |
| 245 | Ga0206349_1426679 | 3300020075 | Bacteria | 599 |
| 246 | Ga0206349_1431629 | 3300020075 | Bacteria | 704 |
| 247 | Ga0206349_1862309 | 3300020075 | Bacteria | 934 |
| 248 | Ga0206349_1888998 | 3300020075 | Bacteria | 509 |
| 249 | Ga0206355_1100617 | 3300020076 | Bacteria | 610 |
| 250 | Ga0206355_1285473 | 3300020076 | Bacteria | 705 |
| 251 | Ga0206355_1468932 | 3300020076 | Bacteria | 697 |
| 252 | Ga0206355_1470546 | 3300020076 | Bacteria | 774 |
| 253 | Ga0206355_1470679 | 3300020076 | Bacteria | 1051 |
| 254 | Ga0206351_10083497 | 3300020077 | Bacteria | 655 |
| 255 | Ga0206351_10138064 | 3300020077 | Bacteria | 710 |
| 256 | Ga0206351_10141963 | 3300020077 | Bacteria | 854 |
| 257 | Ga0206351_10809814 | 3300020077 | Bacteria | 1027 |
| 258 | Ga0206351_10827074 | 3300020077 | Bacteria | 717 |
| 259 | Ga0206352_10380058 | 3300020078 | Bacteria | 522 |
| 260 | Ga0206352_10497015 | 3300020078 | Bacteria | 928 |
| 261 | Ga0206352_10742338 | 3300020078 | Bacteria | 743 |
| 262 | Ga0206352_10991705 | 3300020078 | Bacteria | 528 |
| 263 | Ga0206352_11121572 | 3300020078 | Bacteria | 531 |
| 264 | Ga0206352_11330184 | 3300020078 | Bacteria | 709 |
| 265 | Ga0206350_10039080 | 3300020080 | Bacteria | 1017 |
| 266 | Ga0206350_10042893 | 3300020080 | Bacteria | 584 |
| 267 | Ga0206350_10267178 | 3300020080 | Bacteria | 1181 |
| 268 | Ga0206350_10582716 | 3300020080 | Bacteria | 972 |
| 269 | Ga0206350_11015395 | 3300020080 | Bacteria | 509 |
| 270 | Ga0206350_11037954 | 3300020080 | Bacteria | 738 |
| 271 | Ga0206350_11501976 | 3300020080 | Bacteria | 652 |
| 272 | Ga0206354_10204393 | 3300020081 | Bacteria | 879 |
| 273 | Ga0206354_10390798 | 3300020081 | Bacteria | 1158 |
| 274 | Ga0206354_10558174 | 3300020081 | Bacteria | 864 |
| 275 | Ga0206354_10569637 | 3300020081 | Bacteria | 678 |
| 276 | Ga0206354_10818766 | 3300020081 | Bacteria | 858 |
| 277 | Ga0206354_10823933 | 3300020081 | Bacteria | 1041 |
| 278 | Ga0206354_11025846 | 3300020081 | Bacteria | 989 |
| 279 | Ga0206354_11057629 | 3300020081 | Bacteria | 647 |
| 280 | Ga0206354_11180658 | 3300020081 | Bacteria | 1312 |
| 281 | Ga0206354_11366478 | 3300020081 | Bacteria | 842 |
| 282 | Ga0206354_11441011 | 3300020081 | Bacteria | 1554 |
| 283 | Ga0206354_11566837 | 3300020081 | Bacteria | 546 |
| 284 | Ga0206354_11583124 | 3300020081 | Bacteria | 587 |
| 285 | Ga0206353_10186978 | 3300020082 | Bacteria | 4091 |
| 286 | Ga0206353_10987516 | 3300020082 | Bacteria | 556 |
| 287 | Ga0206353_11114468 | 3300020082 | Bacteria | 635 |
| 288 | Ga0206353_11197291 | 3300020082 | Bacteria | 1116 |
| 289 | Ga0206353_11396596 | 3300020082 | Bacteria | 680 |
| 290 | Ga0206353_11416059 | 3300020082 | Bacteria | 772 |
| 291 | Ga0206353_11453009 | 3300020082 | Bacteria | 590 |
| 292 | Ga0206353_11543644 | 3300020082 | Bacteria | 1104 |
| 293 | Ga0206353_11692651 | 3300020082 | Bacteria | 924 |
| 294 | Ga0206353_11741539 | 3300020082 | Bacteria | 1507 |
| 295 | Ga0206353_11858452 | 3300020082 | Bacteria | 828 |
| 296 | Ga0206353_12003308 | 3300020082 | Bacteria | 704 |
| 297 | Ga0154015_1149892 | 3300020610 | Bacteria | 675 |
| 298 | Ga0154015_1195599 | 3300020610 | Bacteria | 931 |
| 299 | Ga0154015_1323326 | 3300020610 | Bacteria | 975 |
| 300 | Ga0154015_1438066 | 3300020610 | Bacteria | 767 |
| 301 | Ga0154015_1446764 | 3300020610 | Bacteria | 910 |
| 302 | Ga0213873_10000044 | 3300021358 | Bacteria | 29410 |
| 303 | Ga0213873_10035419 | 3300021358 | Bacteria | 1263 |
| 304 | Ga0213874_10402982 | 3300021377 | Bacteria | 533 |
| 305 | Ga0213876_10022891 | 3300021384 | Bacteria | 3301 |
| 306 | Ga0213876_10443400 | 3300021384 | Bacteria | 691 |
| 307 | Ga0213876_10552332 | 3300021384 | Bacteria | 613 |
| 308 | Ga0213875_10000692 | 3300021388 | Bacteria | 26091 |
| 309 | Ga0213875_10008193 | 3300021388 | Bacteria | 5364 |
| 310 | Ga0213875_10103896 | 3300021388 | Bacteria | 1326 |
| 311 | Ga0213875_10130659 | 3300021388 | Bacteria | 1174 |
| 312 | Ga0224712_10076988 | 3300022467 | Bacteria | 1368 |
| 313 | Ga0224712_10165193 | 3300022467 | Bacteria | 990 |
| 314 | Ga0224712_10222608 | 3300022467 | Bacteria | 864 |
| 315 | Ga0224712_10260005 | 3300022467 | Bacteria | 804 |
| 316 | Ga0224712_10284759 | 3300022467 | Bacteria | 770 |
| 317 | Ga0224712_10305510 | 3300022467 | Bacteria | 745 |
| 318 | Ga0224712_10306688 | 3300022467 | Bacteria | 743 |
| 319 | Ga0224712_10333902 | 3300022467 | Bacteria | 714 |
| 320 | Ga0224712_10572981 | 3300022467 | Bacteria | 550 |
| 321 | Ga0224712_10658638 | 3300022467 | Bacteria | 513 |
| 322 | Ga0207682_10337243 | 3300025893 | Bacteria | 709 |
| 323 | Ga0207692_10012975 | 3300025898 | Bacteria | 3599 |
| 324 | Ga0207692_10685428 | 3300025898 | Bacteria | 664 |
| 325 | Ga0207642_10281604 | 3300025899 | Bacteria | 956 |
| 326 | Ga0207710_10005532 | 3300025900 | Bacteria | 5436 |
| 327 | Ga0207688_10289700 | 3300025901 | Bacteria | 999 |
| 328 | Ga0207688_10631186 | 3300025901 | Bacteria | 676 |
| 329 | Ga0207688_10844494 | 3300025901 | Bacteria | 580 |
| 330 | Ga0207680_10009754 | 3300025903 | Bacteria | 4777 |
| 331 | Ga0207647_10172767 | 3300025904 | Bacteria | 1258 |
| 332 | Ga0207647_10321023 | 3300025904 | Bacteria | 879 |
| 333 | Ga0207647_10321788 | 3300025904 | Bacteria | 878 |
| 334 | Ga0207685_10004610 | 3300025905 | Bacteria | 3532 |
| 335 | Ga0207685_10120774 | 3300025905 | Bacteria | 1150 |
| 336 | Ga0207699_10026990 | 3300025906 | Bacteria | 3173 |
| 337 | Ga0207699_10145227 | 3300025906 | Bacteria | 1563 |
| 338 | Ga0207699_10693393 | 3300025906 | Bacteria | 745 |
| 339 | Ga0207699_11179383 | 3300025906 | Bacteria | 567 |
| 340 | Ga0207705_11238583 | 3300025909 | Bacteria | 571 |
| 341 | Ga0207684_10361066 | 3300025910 | Bacteria | 1250 |
| 342 | Ga0207654_10230206 | 3300025911 | Bacteria | 1234 |
| 343 | Ga0207707_10669748 | 3300025912 | Bacteria | 873 |
| 344 | Ga0207707_11488311 | 3300025912 | Bacteria | 537 |
| 345 | Ga0207695_10425580 | 3300025913 | Bacteria | 1212 |
| 346 | Ga0207671_10151997 | 3300025914 | Bacteria | 1789 |
| 347 | Ga0207693_10002030 | 3300025915 | Bacteria | 17760 |
| 348 | Ga0207693_10460482 | 3300025915 | Bacteria | 993 |
| 349 | Ga0207663_10034355 | 3300025916 | Bacteria | 3031 |
| 350 | Ga0207663_11688963 | 3300025916 | Bacteria | 509 |
| 351 | Ga0207657_10654639 | 3300025919 | Bacteria | 818 |
| 352 | Ga0207657_11298084 | 3300025919 | Bacteria | 550 |
| 353 | Ga0207649_10870608 | 3300025920 | Bacteria | 705 |
| 354 | Ga0207650_10626451 | 3300025925 | Bacteria | 906 |
| 355 | Ga0207650_11810563 | 3300025925 | Bacteria | 516 |
| 356 | Ga0207700_10839451 | 3300025928 | Bacteria | 822 |
| 357 | Ga0207700_10897371 | 3300025928 | Bacteria | 793 |
| 358 | Ga0207700_11281227 | 3300025928 | Bacteria | 653 |
| 359 | Ga0207664_10003926 | 3300025929 | Bacteria | 9997 |
| 360 | Ga0207664_10139021 | 3300025929 | Bacteria | 2052 |
| 361 | Ga0207664_10333834 | 3300025929 | Bacteria | 1339 |
| 362 | Ga0207709_10130456 | 3300025935 | Bacteria | 1712 |
| 363 | Ga0207670_10231427 | 3300025936 | Bacteria | 1419 |
| 364 | Ga0207669_10158283 | 3300025937 | Bacteria | 1596 |
| 365 | Ga0207669_10357911 | 3300025937 | Bacteria | 1130 |
| 366 | Ga0207669_10714325 | 3300025937 | Bacteria | 825 |
| 367 | Ga0207665_10006636 | 3300025939 | Bacteria | 7679 |
| 368 | Ga0207665_10104462 | 3300025939 | Bacteria | 1983 |
| 369 | Ga0207665_10737354 | 3300025939 | Bacteria | 776 |
| 370 | Ga0207665_11255901 | 3300025939 | Bacteria | 591 |
| 371 | Ga0207661_10208623 | 3300025944 | Bacteria | 1721 |
| 372 | Ga0207661_10416296 | 3300025944 | Bacteria | 1220 |
| 373 | Ga0207661_10685865 | 3300025944 | Bacteria | 942 |
| 374 | Ga0207679_10240780 | 3300025945 | Bacteria | 1533 |
| 375 | Ga0207679_10686304 | 3300025945 | Bacteria | 928 |
| 376 | Ga0207667_10118066 | 3300025949 | Bacteria | 2734 |
| 377 | Ga0207667_11245621 | 3300025949 | Bacteria | 722 |
| 378 | Ga0207712_10297421 | 3300025961 | Bacteria | 1323 |
| 379 | Ga0207668_10243478 | 3300025972 | Bacteria | 1456 |
| 380 | Ga0207658_10065373 | 3300025986 | Bacteria | 2731 |
| 381 | Ga0207658_11623533 | 3300025986 | Bacteria | 591 |
| 382 | Ga0207703_10012820 | 3300026035 | Bacteria | 6536 |
| 383 | Ga0207703_11628415 | 3300026035 | Bacteria | 621 |
| 384 | Ga0207678_10417466 | 3300026067 | Bacteria | 1163 |
| 385 | Ga0207678_11104284 | 3300026067 | Bacteria | 702 |
| 386 | Ga0207708_10834243 | 3300026075 | Bacteria | 795 |
| 387 | Ga0207702_11678910 | 3300026078 | Bacteria | 628 |
| 388 | Ga0207641_10000547 | 3300026088 | Bacteria | 42161 |
| 389 | Ga0207641_10450900 | 3300026088 | Bacteria | 1243 |
| 390 | Ga0207641_11267211 | 3300026088 | Bacteria | 737 |
| 391 | Ga0207648_10615728 | 3300026089 | Bacteria | 1002 |
| 392 | Ga0207676_10551403 | 3300026095 | Bacteria | 1101 |
| 393 | Ga0207676_11703172 | 3300026095 | Bacteria | 629 |
| 394 | Ga0207676_12304721 | 3300026095 | Bacteria | 536 |
| 395 | Ga0207674_10811365 | 3300026116 | Bacteria | 903 |
| 396 | Ga0207674_11120589 | 3300026116 | Bacteria | 756 |
| 397 | Ga0207674_11517762 | 3300026116 | Bacteria | 639 |
| 398 | Ga0207675_100857418 | 3300026118 | Bacteria | 923 |
| 399 | Ga0207683_10305752 | 3300026121 | Bacteria | 1455 |
| 400 | Ga0207683_10437002 | 3300026121 | Bacteria | 1206 |
| 401 | Ga0207683_10916546 | 3300026121 | Bacteria | 814 |
| 402 | Ga0207698_10710431 | 3300026142 | Bacteria | 1001 |
| 403 | Ga0207698_11685620 | 3300026142 | Bacteria | 649 |
| 404 | Ga0209282_1392684 | 3300027666 | Bacteria | 548 |
| 405 | Ga0207428_10001612 | 3300027907 | Bacteria | 23416 |
| 406 | Ga0207428_10830686 | 3300027907 | Bacteria | 655 |
| 407 | Ga0268266_10002626 | 3300028379 | Bacteria | 18973 |
| 408 | Ga0268265_11724309 | 3300028380 | Bacteria | 632 |
| 409 | Ga0268264_10000033 | 3300028381 | Bacteria | 404123 |
| 410 | Ga0265319_1025680 | 3300028563 | Bacteria | 2106 |
| 411 | Ga0265318_10071667 | 3300028577 | Bacteria | 1284 |
| 412 | Ga0265338_10350464 | 3300028800 | Bacteria | 1062 |
| 413 | Ga0310981_1035484 | 3300029285 | Bacteria | 672 |
| 414 | Ga0307512_10032840 | 3300030522 | Bacteria | 4474 |
| 415 | Ga0316177_1197151 | 3300030731 | Bacteria | 1272 |
| 416 | Ga0316176_1100909 | 3300030732 | Bacteria | 602 |
| 417 | Ga0316181_1261438 | 3300030744 | Bacteria | 1590 |
| 418 | Ga0265766_1009194 | 3300030863 | Bacteria | 689 |
| 419 | Ga0265772_104269 | 3300030886 | Bacteria | 611 |
| 420 | Ga0265320_10012962 | 3300031240 | Bacteria | 4817 |
| 421 | Ga0307513_10067761 | 3300031456 | Bacteria | 3742 |
| 422 | Ga0307513_10419183 | 3300031456 | Bacteria | 1069 |
| 423 | Ga0307408_100012883 | 3300031548 | Bacteria | 5543 |
| 424 | Ga0307408_100790413 | 3300031548 | Bacteria | 860 |
| 425 | Ga0307408_100806837 | 3300031548 | Bacteria | 852 |
| 426 | Ga0265314_10015293 | 3300031711 | Bacteria | 6095 |
| 427 | Ga0265342_10340872 | 3300031712 | Bacteria | 782 |
| 428 | Ga0307405_10014617 | 3300031731 | Bacteria | 4227 |
| 429 | Ga0307405_10023921 | 3300031731 | Bacteria | 3481 |
| 430 | Ga0307405_10105489 | 3300031731 | Bacteria | 1898 |
| 431 | Ga0307405_10147418 | 3300031731 | Bacteria | 1650 |
| 432 | Ga0307405_10649696 | 3300031731 | Bacteria | 867 |
| 433 | Ga0307405_12113430 | 3300031731 | Bacteria | 505 |
| 434 | Ga0307413_10010302 | 3300031824 | Bacteria | 4525 |
| 435 | Ga0307413_10381670 | 3300031824 | Bacteria | 1098 |
| 436 | Ga0307413_10457533 | 3300031824 | Bacteria | 1014 |
| 437 | Ga0307518_10000212 | 3300031838 | Bacteria | 44023 |
| 438 | Ga0307410_10019522 | 3300031852 | Bacteria | 4126 |
| 439 | Ga0307410_10097923 | 3300031852 | Bacteria | 2096 |
| 440 | Ga0307410_10252592 | 3300031852 | Bacteria | 1371 |
| 441 | Ga0307410_11123488 | 3300031852 | Bacteria | 682 |
| 442 | Ga0326468_10023711 | 3300031889 | Bacteria | 757 |
| 443 | Ga0307406_10076888 | 3300031901 | Bacteria | 2206 |
| 444 | Ga0307407_10065605 | 3300031903 | Bacteria | 2138 |
| 445 | Ga0307407_10069693 | 3300031903 | Bacteria | 2088 |
| 446 | Ga0307412_10053504 | 3300031911 | Bacteria | 2676 |
| 447 | Ga0307412_10207191 | 3300031911 | Bacteria | 1493 |
| 448 | Ga0307412_10224781 | 3300031911 | Bacteria | 1441 |
| 449 | Ga0307409_100004219 | 3300031995 | Bacteria | 8017 |
| 450 | Ga0307409_100013993 | 3300031995 | Bacteria | 5194 |
| 451 | Ga0307409_100281437 | 3300031995 | Bacteria | 1537 |
| 452 | Ga0307409_100463678 | 3300031995 | Bacteria | 1225 |
| 453 | Ga0307409_100611218 | 3300031995 | Bacteria | 1078 |
| 454 | Ga0307409_101037823 | 3300031995 | Bacteria | 839 |
| 455 | Ga0307416_100001334 | 3300032002 | Bacteria | 13291 |
| 456 | Ga0307416_100013202 | 3300032002 | Bacteria | 5605 |
| 457 | Ga0307416_100056503 | 3300032002 | Bacteria | 3168 |
| 458 | Ga0307416_100057421 | 3300032002 | Bacteria | 3148 |
| 459 | Ga0307416_100134315 | 3300032002 | Bacteria | 2235 |
| 460 | Ga0307416_100294159 | 3300032002 | Bacteria | 1609 |
| 461 | Ga0307416_100420408 | 3300032002 | Bacteria | 1381 |
| 462 | Ga0307416_100578772 | 3300032002 | Bacteria | 1200 |
| 463 | Ga0307416_102316452 | 3300032002 | Bacteria | 637 |
| 464 | Ga0307414_10092801 | 3300032004 | Bacteria | 2249 |
| 465 | Ga0307414_10954257 | 3300032004 | Bacteria | 788 |
| 466 | Ga0307414_11048532 | 3300032004 | Bacteria | 752 |
| 467 | Ga0307414_11147959 | 3300032004 | Bacteria | 718 |
| 468 | Ga0307411_10133450 | 3300032005 | Bacteria | 1818 |
| 469 | Ga0307411_10504499 | 3300032005 | Bacteria | 1023 |
| 470 | Ga0307411_10576971 | 3300032005 | Bacteria | 963 |
| 471 | Ga0307415_100007344 | 3300032126 | Bacteria | 6022 |
| 472 | Ga0307415_100011202 | 3300032126 | Bacteria | 5119 |
| 473 | Ga0307415_100128419 | 3300032126 | Bacteria | 1914 |
| 474 | Ga0307415_100333275 | 3300032126 | Bacteria | 1270 |
| 475 | Ga0307415_100434353 | 3300032126 | Bacteria | 1130 |
| 476 | Ga0307415_100905104 | 3300032126 | Bacteria | 813 |
| 477 | Ga0307415_101782385 | 3300032126 | Bacteria | 595 |
| 478 | Ga0307507_10013762 | 3300033179 | Bacteria | 9762 |
| 479 | Ga0307510_10117798 | 3300033180 | Bacteria | 2372 |
| 480 | Ga0307510_10194125 | 3300033180 | Bacteria | 1574 |
| 481 | Ga0373938_0062689 | 3300034957 | Bacteria | 873 |
| 482 | Ga0373926_0001445 | 3300035083 | Bacteria | 7237 |
| 483 | Ga0373926_0132475 | 3300035083 | Bacteria | 944 |
| 484 | Ga0373944_0009366 | 3300035089 | Bacteria | 2653 |
| 485 | Ga0373952_0240423 | 3300035092 | Bacteria | 545 |
| 486 | Ga0373923_0005888 | 3300035111 | Bacteria | 4190 |
| 487 | Ga0373936_0015957 | 3300035113 | Bacteria | 2882 |
| 488 | Ga0373939_0495468 | 3300035114 | Bacteria | 521 |
| 489 | Ga0373945_0000630 | 3300035116 | Bacteria | 10134 |
| 490 | Ga0373954_0280650 | 3300035118 | Bacteria | 821 |
| 491 | Ga0373943_0006324 | 3300035170 | Bacteria | 5316 |
| 492 | Ga0373946_0000565 | 3300035171 | Bacteria | 12211 |
| 493 | Ga0373955_0229348 | 3300035172 | Bacteria | 1110 |
| 494 | Ga0373924_0029336 | 3300035410 | Bacteria | 2198 |
| 495 | Ga0373931_0575423 | 3300035691 | Bacteria | 734 |
| 496 | Ga0373935_0011880 | 3300035692 | Bacteria | 5231 |
| 497 | Ga0373935_0082681 | 3300035692 | Bacteria | 2089 |
| 498 | Ga0373927_0001626 | 3300035695 | Bacteria | 16844 |
| 499 | Ga0373927_0872566 | 3300035695 | Bacteria | 594 |
| 500 | Ga0373947_0000144 | 3300035725 | Bacteria | 36821 |
| 501 | Ga0373947_0021705 | 3300035725 | Bacteria | 3718 |
| 502 | Ga0373937_0213389 | 3300036401 | Bacteria | 1816 |
| 503 | Ga0372808_019497 | 3300036459 | Bacteria | 975 |
| 504 | Ga0373925_0004024 | 3300037068 | Bacteria | 11178 |
| 505 | Ga0373925_0182845 | 3300037068 | Bacteria | 1660 |
| 506 | Ga0373925_0355301 | 3300037068 | Bacteria | 1190 |
| 507 | Ga0395899_0164282 | 3300037312 | Bacteria | 1567 |
| 508 | Ga0395899_0166121 | 3300037312 | Bacteria | 1557 |
| 509 | Ga0395899_0212385 | 3300037312 | Bacteria | 1344 |
| 510 | Ga0395899_0337248 | 3300037312 | Bacteria | 1012 |
| 511 | Ga0395899_0413641 | 3300037312 | Bacteria | 890 |
| 512 | Ga0395900_0039968 | 3300037418 | Bacteria | 4834 |
| 513 | Ga0395900_0178726 | 3300037418 | Bacteria | 2158 |
| 514 | Ga0395900_0236345 | 3300037418 | Bacteria | 1835 |
| 515 | Ga0395900_0431612 | 3300037418 | Bacteria | 1277 |
| 516 | Ga0395900_0613612 | 3300037418 | Bacteria | 1027 |
| 517 | Ga0395900_0677683 | 3300037418 | Bacteria | 966 |
| 518 | Ga0395900_0689884 | 3300037418 | Bacteria | 955 |
| 519 | Ga0395900_0907525 | 3300037418 | Bacteria | 804 |
| 520 | Ga0395900_1411230 | 3300037418 | Bacteria | 609 |
| 521 | Ga0395898_0039954 | 3300037466 | Bacteria | 4642 |
| 522 | Ga0395898_0143940 | 3300037466 | Bacteria | 2282 |
| 523 | Ga0395898_0175455 | 3300037466 | Bacteria | 2048 |
| 524 | Ga0395898_0421323 | 3300037466 | Bacteria | 1272 |
| 525 | Ga0395898_0794493 | 3300037466 | Bacteria | 887 |
| 526 | Ga0395905_0049807 | 3300037471 | Bacteria | 3926 |
| 527 | Ga0395905_1216659 | 3300037471 | Bacteria | 657 |
| 528 | Ga0436364_0002502 | 3300037853 | Bacteria | 1183 |
| 529 | Ga0436364_0080744 | 3300037853 | Bacteria | 1920 |
| 530 | Ga0436364_0131116 | 3300037853 | Bacteria | 702 |
| 531 | Ga0436364_0796409 | 3300037853 | Bacteria | 952 |
| 532 | Ga0436364_0802122 | 3300037853 | Bacteria | 22234 |
| 533 | Ga0436364_0926314 | 3300037853 | Bacteria | 5211 |
| 534 | Ga0436364_1000549 | 3300037853 | Bacteria | 5568 |
| 535 | Ga0436364_1088153 | 3300037853 | Bacteria | 2196 |
| 536 | Ga0436364_1330872 | 3300037853 | Bacteria | 914 |
| 537 | Ga0395901_0029983 | 3300038443 | Bacteria | 5604 |
| 538 | Ga0395901_0120400 | 3300038443 | Bacteria | 2758 |
| 539 | Ga0395901_0436282 | 3300038443 | Bacteria | 1341 |
| 540 | Ga0395901_0480347 | 3300038443 | Bacteria | 1267 |
| 541 | Ga0395901_0487477 | 3300038443 | Bacteria | 1256 |
| 542 | Ga0395901_0683870 | 3300038443 | Bacteria | 1025 |
| 543 | Ga0395901_1529035 | 3300038443 | Bacteria | 623 |
| 544 | Ga0436365_0031240 | 3300039437 | Bacteria | 581 |
| 545 | Ga0436365_0428182 | 3300039437 | Bacteria | 1999 |
| 546 | Ga0436365_0451748 | 3300039437 | Bacteria | 651 |
| 547 | Ga0436365_1157386 | 3300039437 | Bacteria | 1173 |
| 548 | Ga0436365_1294233 | 3300039437 | Bacteria | 504 |
| 549 | Ga0436365_1635144 | 3300039437 | Bacteria | 5330 |
| 550 | Ga0436360_0662365 | 3300039438 | Bacteria | 501 |
| 551 | Ga0436361_0391834 | 3300039447 | Bacteria | 796 |
| 552 | Ga0436361_1157191 | 3300039447 | Bacteria | 624 |
| 553 | Ga0436363_0177779 | 3300039450 | Bacteria | 740 |
| 554 | Ga0436363_0367727 | 3300039450 | Bacteria | 1356 |
| 555 | Ga0436363_0912415 | 3300039450 | Bacteria | 746 |
| 556 | Ga0436363_1670490 | 3300039450 | Bacteria | 549 |
| 557 | Ga0436362_0750637 | 3300039453 | Bacteria | 691 |
| 558 | Ga0436362_1082250 | 3300039453 | Bacteria | 24191 |
| 559 | Ga0436362_1138202 | 3300039453 | Bacteria | 1286 |
| 560 | Ga0439461_0147026 | 3300041410 | Bacteria | 606 |
| 561 | Ga0439466_0229576 | 3300041411 | Bacteria | 563 |
| 562 | Ga0439465_0094258 | 3300041413 | Bacteria | 1028 |
| 563 | Ga0451789_0256892 | 3300041443 | Bacteria | 515 |
| 564 | Ga0451791_1171476 | 3300041451 | Bacteria | 996 |
| 565 | Ga0451793_1392987 | 3300041452 | Bacteria | 787 |
| 566 | Ga0451803_10011 | 3300041457 | Bacteria | 699 |
| 567 | Ga0451800_1378464 | 3300041459 | Bacteria | 801 |
| 568 | Ga0451833_0082567 | 3300041491 | Bacteria | 1250 |
| 569 | Ga0451835_0298329 | 3300041492 | Bacteria | 1132 |
| 570 | Ga0451849_0912681 | 3300041505 | Bacteria | 706 |
| 571 | Ga0451851_0172594 | 3300041507 | Bacteria | 1180 |
| 572 | Ga0451843_1198960 | 3300041509 | Bacteria | 1307 |
| 573 | Ga0451855_0835965 | 3300041511 | Bacteria | 607 |
| 574 | Ga0451853_1103692 | 3300041512 | Bacteria | 813 |
| 575 | Ga0451853_2624957 | 3300041512 | Bacteria | 673 |
| 576 | Ga0439431_0017985 | 3300041997 | Bacteria | 1668 |
| 577 | Ga0439433_0030726 | 3300041999 | Bacteria | 1228 |
| 578 | Ga0439443_002696 | 3300042003 | Bacteria | 2152 |
| 579 | Ga0439448_0000530 | 3300042005 | Bacteria | 8886 |
| 580 | Ga0439448_0041815 | 3300042005 | Bacteria | 1484 |
| 581 | Ga0439449_0200624 | 3300042007 | Bacteria | 747 |
| 582 | Ga0439450_000277 | 3300042008 | Bacteria | 6274 |
| 583 | Ga0439455_0151312 | 3300042012 | Bacteria | 660 |
| 584 | Ga0439462_0161565 | 3300042015 | Bacteria | 632 |
| 585 | Ga0439463_001090 | 3300042016 | Bacteria | 7327 |
| 586 | Ga0450912_017599 | 3300042116 | Bacteria | 670 |
| 587 | Ga0450913_000860 | 3300042117 | Bacteria | 1481 |
| 588 | Ga0450914_012561 | 3300042118 | Bacteria | 850 |
| 589 | Ga0450917_001102 | 3300042120 | Bacteria | 1985 |
| 590 | Ga0450921_022548 | 3300042123 | Bacteria | 607 |
| 591 | Ga0450922_011727 | 3300042124 | Bacteria | 846 |
| 592 | Ga0450923_001738 | 3300042125 | Bacteria | 2971 |
| 593 | Ga0450890_035424 | 3300042127 | Bacteria | 724 |
| 594 | Ga0450900_014351 | 3300042136 | Bacteria | 1056 |
| 595 | Ga0450905_034623 | 3300042142 | Bacteria | 788 |
| 596 | Ga0450905_044728 | 3300042142 | Bacteria | 710 |
| 597 | Ga0450910_006225 | 3300042147 | Bacteria | 1642 |
| 598 | Ga0450910_088069 | 3300042147 | Bacteria | 548 |
| 599 | Ga0439444_0007391 | 3300042437 | Bacteria | 1685 |
| 600 | Ga0439459_0136786 | 3300042438 | Bacteria | 630 |
| 601 | Ga0439464_0020230 | 3300042439 | Bacteria | 1821 |
| 602 | Ga0439460_0025353 | 3300042461 | Bacteria | 1650 |
| 603 | Ga0450916_000072 | 3300042530 | Bacteria | 6092 |
| 604 | Ga0450918_058782 | 3300042531 | Bacteria | 708 |
| 605 | Ga0450901_031185 | 3300042533 | Bacteria | 589 |
| 606 | Ga0439440_0000363 | 3300042993 | Bacteria | 7513 |
| 607 | Ga0466969_0017358 | 3300044656 | Bacteria | 3758 |
| 608 | Ga0466969_0046923 | 3300044656 | Bacteria | 2140 |
| 609 | Ga0466969_0080478 | 3300044656 | Bacteria | 1556 |
| 610 | Ga0466969_0216817 | 3300044656 | Bacteria | 871 |
| 611 | Ga0466972_0063377 | 3300044658 | Bacteria | 1770 |
| 612 | Ga0453683_0000549 | 3300044673 | Bacteria | 41753 |
| 613 | Ga0453683_0256899 | 3300044673 | Bacteria | 1114 |
| 614 | Ga0466965_0006927 | 3300044683 | Bacteria | 5186 |
| 615 | Ga0466965_0155522 | 3300044683 | Bacteria | 1197 |
| 616 | Ga0466965_0609030 | 3300044683 | Bacteria | 621 |
| 617 | Ga0466966_0005077 | 3300044684 | Bacteria | 8647 |
| 618 | Ga0466966_0025264 | 3300044684 | Bacteria | 3881 |
| 619 | Ga0466966_0116248 | 3300044684 | Bacteria | 1646 |
| 620 | Ga0466966_0665109 | 3300044684 | Bacteria | 627 |
| 621 | Ga0466966_0920601 | 3300044684 | Bacteria | 527 |
| 622 | Ga0466961_0000785 | 3300044693 | Bacteria | 19929 |
| 623 | Ga0466961_0024534 | 3300044693 | Bacteria | 3879 |
| 624 | Ga0466961_0034731 | 3300044693 | Bacteria | 3237 |
| 625 | Ga0466961_0113908 | 3300044693 | Bacteria | 1700 |
| 626 | Ga0466963_0002014 | 3300044694 | Bacteria | 11169 |
| 627 | Ga0466963_0020515 | 3300044694 | Bacteria | 4156 |
| 628 | Ga0466963_0092292 | 3300044694 | Bacteria | 2063 |
| 629 | Ga0466963_0098223 | 3300044694 | Bacteria | 2001 |
| 630 | Ga0466963_0160449 | 3300044694 | Bacteria | 1565 |
| 631 | Ga0466963_0164646 | 3300044694 | Bacteria | 1544 |
| 632 | Ga0466963_0186045 | 3300044694 | Bacteria | 1451 |
| 633 | Ga0466964_0027416 | 3300044706 | Bacteria | 2237 |
| 634 | Ga0466964_0039221 | 3300044706 | Bacteria | 1907 |
| 635 | Ga0466964_0272256 | 3300044706 | Bacteria | 843 |
| 636 | Ga0453684_0006025 | 3300044712 | Bacteria | 23467 |
| 637 | Ga0466971_0004313 | 3300044719 | Bacteria | 6129 |
| 638 | Ga0466971_0010927 | 3300044719 | Bacteria | 3971 |
| 639 | Ga0466971_0063593 | 3300044719 | Bacteria | 1670 |
| 640 | Ga0466971_0172604 | 3300044719 | Bacteria | 1015 |
| 641 | Ga0466971_0256180 | 3300044719 | Bacteria | 834 |
| 642 | Ga0466970_0020020 | 3300044765 | Bacteria | 3472 |
| 643 | Ga0466970_0223848 | 3300044765 | Bacteria | 1050 |
| 644 | Ga0466970_0370464 | 3300044765 | Bacteria | 814 |
| 645 | Ga0466970_0529456 | 3300044765 | Bacteria | 680 |
| 646 | Ga0466957_0004795 | 3300044842 | Bacteria | 7571 |
| 647 | Ga0466957_0013692 | 3300044842 | Bacteria | 4709 |
| 648 | Ga0466957_0475320 | 3300044842 | Bacteria | 864 |
| 649 | Ga0466957_1298547 | 3300044842 | Bacteria | 528 |
| 650 | Ga0466960_0042178 | 3300044901 | Bacteria | 2165 |
| 651 | Ga0466960_0091289 | 3300044901 | Bacteria | 1553 |
| 652 | Ga0466960_0287653 | 3300044901 | Bacteria | 923 |
| 653 | Ga0466960_1032812 | 3300044901 | Bacteria | 506 |
| 654 | Ga0466959_0000705 | 3300045049 | Bacteria | 19526 |
| 655 | Ga0466959_0160639 | 3300045049 | Bacteria | 1580 |
| 656 | Ga0466959_0162327 | 3300045049 | Bacteria | 1570 |
| 657 | Ga0466959_0233960 | 3300045049 | Bacteria | 1271 |
| 658 | Ga0466959_0293888 | 3300045049 | Bacteria | 1113 |
| 659 | Ga0466959_0303830 | 3300045049 | Bacteria | 1092 |
| 660 | Ga0466959_0579273 | 3300045049 | Bacteria | 756 |
| 661 | Ga0466959_0767681 | 3300045049 | Bacteria | 645 |
| 662 | Ga0466959_1151284 | 3300045049 | Bacteria | 516 |
| 663 | Ga0451576_0022491 | 3300045051 | Bacteria | 6836 |
| 664 | Ga0466958_0000094 | 3300045836 | Bacteria | 27609 |
| 665 | Ga0466958_0017906 | 3300045836 | Bacteria | 4104 |
| 666 | Ga0466958_0075922 | 3300045836 | Bacteria | 2062 |
| 667 | Ga0466958_0078887 | 3300045836 | Bacteria | 2024 |
| 668 | Ga0466958_0097392 | 3300045836 | Bacteria | 1825 |
| 669 | Ga0466958_0412095 | 3300045836 | Bacteria | 873 |
| 670 | Ga0466958_0417187 | 3300045836 | Bacteria | 867 |
| 671 | Ga0466967_0003455 | 3300045976 | Bacteria | 10312 |
| 672 | Ga0466967_0064160 | 3300045976 | Bacteria | 3266 |
| 673 | Ga0466967_0064939 | 3300045976 | Bacteria | 3247 |
| 674 | Ga0466967_0099960 | 3300045976 | Bacteria | 2650 |
| 675 | Ga0466967_0121206 | 3300045976 | Bacteria | 2416 |
| 676 | Ga0466967_0760305 | 3300045976 | Bacteria | 961 |
| 677 | Ga0466967_2355652 | 3300045976 | Bacteria | 528 |
| 678 | Ga0495627_201784 | 3300046453 | Unclassified | 548 |
| 679 | Ga0495603_0156959 | 3300046455 | Bacteria | 1320 |
| 680 | Ga0495603_0302245 | 3300046455 | Bacteria | 919 |
| 681 | Ga0495603_0840395 | 3300046455 | Bacteria | 523 |
| 682 | Ga0495629_1021528 | 3300046459 | Bacteria | 537 |
| 683 | Ga0495641_0031062 | 3300046461 | Bacteria | 2555 |
| 684 | Ga0495641_0605818 | 3300046461 | Bacteria | 501 |
| 685 | Ga0495651_0061769 | 3300046462 | Bacteria | 2867 |
| 686 | Ga0495653_0082304 | 3300046463 | Bacteria | 2376 |
| 687 | Ga0495582_0066529 | 3300046473 | Bacteria | 1991 |
| 688 | Ga0495605_0309601 | 3300046474 | Bacteria | 667 |
| 689 | Ga0495639_0440061 | 3300046475 | Bacteria | 661 |
| 690 | Ga0495662_0021138 | 3300046476 | Bacteria | 3147 |
| 691 | Ga0495664_0000083 | 3300046477 | Bacteria | 46009 |
| 692 | Ga0495584_0192153 | 3300046491 | Bacteria | 1038 |
| 693 | Ga0495584_0215023 | 3300046491 | Bacteria | 977 |
| 694 | Ga0495608_0046927 | 3300046511 | Bacteria | 2873 |
| 695 | Ga0495618_0024377 | 3300046514 | Bacteria | 3747 |
| 696 | Ga0495628_0072657 | 3300046516 | Bacteria | 2680 |
| 697 | Ga0495630_0042051 | 3300046517 | Bacteria | 3413 |
| 698 | Ga0495644_0013701 | 3300046523 | Bacteria | 3109 |
| 699 | Ga0495644_0447360 | 3300046523 | Unclassified | 514 |
| 700 | Ga0495663_0212074 | 3300046525 | Bacteria | 679 |
| 701 | Ga0495642_0301831 | 3300046528 | Bacteria | 702 |
| 702 | Ga0495642_0311272 | 3300046528 | Bacteria | 690 |
| 703 | Ga0495652_0023799 | 3300046529 | Bacteria | 5427 |
| 704 | Ga0495654_0236122 | 3300046530 | Bacteria | 767 |
| 705 | Ga0495665_0030444 | 3300046531 | Bacteria | 2888 |
| 706 | Ga0495665_0067643 | 3300046531 | Bacteria | 1884 |
| 707 | Ga0495665_0090863 | 3300046531 | Bacteria | 1604 |
| 708 | Ga0495640_0025751 | 3300046533 | Bacteria | 4261 |
| 709 | Ga0495586_0289460 | 3300046535 | Bacteria | 938 |
| 710 | Ga0495586_0356106 | 3300046535 | Bacteria | 841 |
| 711 | Ga0495586_0360570 | 3300046535 | Bacteria | 835 |
| 712 | Ga0495587_0090150 | 3300046536 | Bacteria | 1771 |
| 713 | Ga0495598_0303495 | 3300046537 | Bacteria | 604 |
| 714 | Ga0495609_0011484 | 3300046538 | Bacteria | 4217 |
| 715 | Ga0495621_0089038 | 3300046539 | Bacteria | 1161 |
| 716 | Ga0495622_0166088 | 3300046557 | Bacteria | 994 |
| 717 | Ga0495667_0023226 | 3300046559 | Bacteria | 4178 |
| 718 | Ga0495656_0006124 | 3300046615 | Bacteria | 4200 |
| 719 | Ga0495656_0099553 | 3300046615 | Bacteria | 1342 |
| 720 | Ga0495668_0000043 | 3300046616 | Bacteria | 227636 |
| 721 | Ga0495668_0621931 | 3300046616 | Bacteria | 597 |
| 722 | Ga0495634_0046162 | 3300046642 | Bacteria | 2941 |
| 723 | Ga0495634_0134461 | 3300046642 | Bacteria | 1574 |
| 724 | Ga0495635_0004414 | 3300046663 | Bacteria | 9742 |
| 725 | Ga0495659_0118883 | 3300046664 | Bacteria | 1039 |
| 726 | Ga0495588_0128586 | 3300046674 | Bacteria | 1336 |
| 727 | Ga0495588_0238864 | 3300046674 | Bacteria | 958 |
| 728 | Ga0495588_0292726 | 3300046674 | Bacteria | 858 |
| 729 | Ga0495657_0062491 | 3300046675 | Bacteria | 2460 |
| 730 | Ga0495657_0067118 | 3300046675 | Bacteria | 2355 |
| 731 | Ga0495599_0049567 | 3300046678 | Bacteria | 2632 |
| 732 | Ga0495646_0074394 | 3300046680 | Bacteria | 1994 |
| 733 | Ga0495646_0569296 | 3300046680 | Bacteria | 577 |
| 734 | Ga0495647_0257917 | 3300046681 | Bacteria | 777 |
| 735 | Ga0495669_0036649 | 3300046684 | Bacteria | 2169 |
| 736 | Ga0495624_0002178 | 3300046690 | Bacteria | 14958 |
| 737 | Ga0495600_0113876 | 3300046809 | Bacteria | 1761 |
| 738 | Ga0495600_0214736 | 3300046809 | Bacteria | 1232 |
| 739 | Ga0495581_0033096 | 3300047315 | Bacteria | 2993 |
| 740 | Ga0495581_0039003 | 3300047315 | Bacteria | 2750 |
| 741 | Ga0495636_0120711 | 3300047318 | Bacteria | 1159 |
| 742 | Ga0495674_0001086 | 3300047319 | Bacteria | 26157 |
| 743 | Ga0495674_1033376 | 3300047319 | Bacteria | 628 |
| 744 | Ga0495676_0022375 | 3300047321 | Bacteria | 5499 |
| 745 | Ga0495680_0004440 | 3300047322 | Bacteria | 13403 |
| 746 | Ga0495680_0993588 | 3300047322 | Bacteria | 536 |
| 747 | Ga0495680_1020277 | 3300047322 | Bacteria | 527 |
| 748 | Ga0495677_0138383 | 3300047445 | Bacteria | 934 |
| 749 | Ga0495684_0001387 | 3300047471 | Bacteria | 19454 |
| 750 | Ga0495614_0188099 | 3300048089 | Bacteria | 931 |
| 751 | Ga0495614_0366714 | 3300048089 | Bacteria | 673 |
| 752 | Ga0495626_0381879 | 3300048091 | Bacteria | 547 |
| 753 | Ga0496100_0035341 | 3300048903 | Bacteria | 3142 |
| 754 | Ga0496100_0038819 | 3300048903 | Bacteria | 3020 |
| 755 | Ga0496100_0109922 | 3300048903 | Bacteria | 1913 |
| 756 | Ga0496100_0176737 | 3300048903 | Bacteria | 1542 |
| 757 | Ga0496100_0246996 | 3300048903 | Bacteria | 1319 |
| 758 | Ga0496100_0378536 | 3300048903 | Bacteria | 1075 |
| 759 | Ga0496101_0262185 | 3300048904 | Bacteria | 1348 |
| 760 | Ga0496102_0000142 | 3300048905 | Bacteria | 97037 |
| 761 | Ga0496102_0000569 | 3300048905 | Bacteria | 39306 |
| 762 | Ga0496102_0002441 | 3300048905 | Bacteria | 15850 |
| 763 | Ga0496102_0701165 | 3300048905 | Bacteria | 935 |
| 764 | Ga0496102_0816532 | 3300048905 | Bacteria | 855 |
| 765 | Ga0496102_1119064 | 3300048905 | Bacteria | 707 |
| 766 | Ga0496102_1292409 | 3300048905 | Bacteria | 649 |
| 767 | Ga0496103_0000085 | 3300048906 | Bacteria | 105412 |
| 768 | Ga0496103_0097690 | 3300048906 | Bacteria | 1856 |
| 769 | Ga0496103_0453464 | 3300048906 | Bacteria | 822 |
| 770 | Ga0496103_0510279 | 3300048906 | Bacteria | 769 |
| 771 | Ga0496103_0855690 | 3300048906 | Bacteria | 572 |
| 772 | Ga0496104_0150654 | 3300048907 | Bacteria | 2233 |
| 773 | Ga0496104_0742640 | 3300048907 | Bacteria | 888 |
| 774 | Ga0496104_0785709 | 3300048907 | Bacteria | 858 |
| 775 | Ga0496104_0947397 | 3300048907 | Bacteria | 765 |
| 776 | Ga0496104_1491275 | 3300048907 | Bacteria | 579 |
| 777 | Ga0496105_0429126 | 3300048908 | Bacteria | 1046 |
| 778 | Ga0496105_1089398 | 3300048908 | Bacteria | 593 |
| 779 | Ga0496106_0112887 | 3300048909 | Bacteria | 2118 |
| 780 | Ga0496106_0559802 | 3300048909 | Bacteria | 917 |
| 781 | Ga0496106_0734697 | 3300048909 | Bacteria | 785 |
| 782 | Ga0496107_0223042 | 3300048910 | Bacteria | 1402 |
| 783 | Ga0496107_0260004 | 3300048910 | Bacteria | 1292 |
| 784 | Ga0496108_0204798 | 3300048911 | Bacteria | 1712 |
| 785 | Ga0496108_0214497 | 3300048911 | Bacteria | 1671 |
| 786 | Ga0496109_0532299 | 3300048912 | Bacteria | 1109 |
| 787 | Ga0496109_1144258 | 3300048912 | Bacteria | 715 |
| 788 | Ga0496109_1901040 | 3300048912 | Bacteria | 528 |
| 789 | Ga0496110_0428085 | 3300048913 | Bacteria | 1206 |
| 790 | Ga0496110_0738601 | 3300048913 | Bacteria | 887 |
| 791 | Ga0496110_1367957 | 3300048913 | Bacteria | 617 |
| 792 | Ga0496111_0245421 | 3300048914 | Bacteria | 1329 |
| 793 | Ga0496111_0457303 | 3300048914 | Bacteria | 942 |
| 794 | Ga0496112_0249946 | 3300048915 | Bacteria | 1725 |
| 795 | Ga0496112_0419900 | 3300048915 | Bacteria | 1276 |
| 796 | Ga0496113_0094465 | 3300048916 | Bacteria | 2310 |
| 797 | Ga0496113_0167659 | 3300048916 | Bacteria | 1738 |
| 798 | Ga0496113_0547508 | 3300048916 | Bacteria | 928 |
| 799 | Ga0496113_0731573 | 3300048916 | Bacteria | 788 |
| 800 | Ga0496113_1591235 | 3300048916 | Bacteria | 503 |
| 801 | Ga0496114_0284421 | 3300048917 | Bacteria | 1458 |
| 802 | Ga0496114_0454189 | 3300048917 | Bacteria | 1134 |
| 803 | Ga0496114_0971896 | 3300048917 | Bacteria | 732 |
| 804 | Ga0496114_1313340 | 3300048917 | Bacteria | 610 |
| 805 | Ga0496115_0555294 | 3300048918 | Bacteria | 917 |
| 806 | Ga0496115_0930574 | 3300048918 | Bacteria | 668 |
| 807 | Ga0496119_0000153 | 3300048922 | Bacteria | 95945 |
| 808 | Ga0496119_0138796 | 3300048922 | Bacteria | 1315 |
| 809 | Ga0496120_0022025 | 3300048923 | Bacteria | 4013 |
| 810 | Ga0496124_0912935 | 3300048927 | Bacteria | 532 |
| 811 | Ga0496125_0039413 | 3300048928 | Bacteria | 4068 |
| 812 | Ga0496126_0531998 | 3300048929 | Bacteria | 935 |
| 813 | Ga0501306_010963 | 3300049127 | Bacteria | 1149 |
| 814 | Ga0501306_028346 | 3300049127 | Bacteria | 820 |
| 815 | Ga0501306_036026 | 3300049127 | Bacteria | 753 |
| 816 | Ga0501306_071800 | 3300049127 | Bacteria | 585 |
| 817 | Ga0501308_028187 | 3300049128 | Bacteria | 741 |
| 818 | Ga0501308_030187 | 3300049128 | Bacteria | 724 |
| 819 | Ga0501309_022434 | 3300049129 | Bacteria | 893 |
| 820 | Ga0501310_009659 | 3300049130 | Bacteria | 1067 |
| 821 | Ga0501310_024994 | 3300049130 | Bacteria | 767 |
| 822 | Ga0501310_045818 | 3300049130 | Bacteria | 621 |
| 823 | Ga0501304_008465 | 3300049160 | Bacteria | 867 |
| 824 | Ga0501304_013152 | 3300049160 | Bacteria | 754 |
| 825 | Ga0501307_022876 | 3300049162 | Bacteria | 824 |
| 826 | Ga0501307_030750 | 3300049162 | Bacteria | 743 |
| 827 | Ga0501307_064045 | 3300049162 | Bacteria | 575 |
| 828 | Ga0501292_131513 | 3300049515 | Bacteria | 518 |
| 829 | Ga0501311_017476 | 3300049527 | Bacteria | 944 |
| 830 | Ga0501311_033087 | 3300049527 | Bacteria | 756 |
| 831 | Ga0501312_042652 | 3300049528 | Bacteria | 745 |
| 832 | Ga0501312_059050 | 3300049528 | Bacteria | 661 |
| 833 | Ga0501312_094358 | 3300049528 | Bacteria | 555 |
| 834 | Ga0501313_035339 | 3300049529 | Bacteria | 659 |
| 835 | Ga0501314_007912 | 3300049530 | Bacteria | 951 |
| 836 | Ga0501315_023939 | 3300049531 | Bacteria | 842 |
| 837 | Ga0501316_010482 | 3300049532 | Bacteria | 1056 |
| 838 | Ga0501316_015341 | 3300049532 | Bacteria | 922 |
| 839 | Ga0501316_027685 | 3300049532 | Bacteria | 746 |
| 840 | Ga0501317_003671 | 3300049533 | Bacteria | 1548 |
| 841 | Ga0501317_107874 | 3300049533 | Bacteria | 509 |
| 842 | Ga0501318_012782 | 3300049534 | Bacteria | 967 |
| 843 | Ga0501318_024930 | 3300049534 | Bacteria | 781 |
| 844 | Ga0501319_018821 | 3300049535 | Bacteria | 607 |
| 845 | Ga0501320_006131 | 3300049536 | Bacteria | 1117 |
| 846 | Ga0501320_025116 | 3300049536 | Bacteria | 713 |
| 847 | Ga0501321_010647 | 3300049537 | Bacteria | 1013 |
| 848 | Ga0501321_031990 | 3300049537 | Bacteria | 707 |
| 849 | Ga0501321_035595 | 3300049537 | Bacteria | 683 |
| 850 | Ga0501322_009380 | 3300049538 | Bacteria | 740 |
| 851 | Ga0501322_025499 | 3300049538 | Bacteria | 538 |
| 852 | Ga0501323_004515 | 3300049539 | Bacteria | 1478 |
| 853 | Ga0501323_042372 | 3300049539 | Bacteria | 671 |
| 854 | Ga0501324_004693 | 3300049540 | Bacteria | 1097 |
| 855 | Ga0501324_012897 | 3300049540 | Bacteria | 787 |
| 856 | Ga0501324_017532 | 3300049540 | Bacteria | 710 |
| 857 | Ga0501325_014995 | 3300049541 | Bacteria | 760 |
| 858 | Ga0501340_015962 | 3300049556 | Bacteria | 597 |
| 859 | Ga0501031_0003631 | 3300049568 | Bacteria | 9929 |
| 860 | Ga0501031_0012405 | 3300049568 | Bacteria | 5557 |
| 861 | Ga0501032_0143956 | 3300049569 | Bacteria | 1569 |
| 862 | Ga0501032_0584939 | 3300049569 | Bacteria | 711 |
| 863 | Ga0501033_0162221 | 3300049570 | Bacteria | 1609 |
| 864 | Ga0501033_0760304 | 3300049570 | Bacteria | 657 |
| 865 | Ga0501033_1021562 | 3300049570 | Bacteria | 552 |
| 866 | Ga0501036_0033144 | 3300049572 | Bacteria | 4368 |
| 867 | Ga0501036_0101976 | 3300049572 | Bacteria | 2427 |
| 868 | Ga0501036_0534648 | 3300049572 | Bacteria | 974 |
| 869 | Ga0501036_0708914 | 3300049572 | Bacteria | 831 |
| 870 | Ga0501037_0121775 | 3300049573 | Bacteria | 1875 |
| 871 | Ga0501037_0177488 | 3300049573 | Bacteria | 1512 |
| 872 | Ga0501037_0801736 | 3300049573 | Bacteria | 622 |
| 873 | Ga0501038_0003697 | 3300049574 | Bacteria | 14253 |
| 874 | Ga0501038_0361619 | 3300049574 | Bacteria | 1128 |
| 875 | Ga0501039_0002883 | 3300049575 | Bacteria | 12868 |
| 876 | Ga0501039_0633842 | 3300049575 | Bacteria | 837 |
| 877 | Ga0501040_0004229 | 3300049576 | Bacteria | 9345 |
| 878 | Ga0501040_0551163 | 3300049576 | Bacteria | 832 |
| 879 | Ga0501041_0003187 | 3300049577 | Bacteria | 9435 |
| 880 | Ga0501041_0847651 | 3300049577 | Bacteria | 587 |
| 881 | Ga0501042_0002172 | 3300049578 | Bacteria | 11946 |
| 882 | Ga0501042_1059932 | 3300049578 | Bacteria | 591 |
| 883 | Ga0501043_0055149 | 3300049579 | Bacteria | 3122 |
| 884 | Ga0501043_0076995 | 3300049579 | Bacteria | 2620 |
| 885 | Ga0501043_0164881 | 3300049579 | Bacteria | 1730 |
| 886 | Ga0501046_0027051 | 3300049580 | Bacteria | 4682 |
| 887 | Ga0501046_0048811 | 3300049580 | Bacteria | 3351 |
| 888 | Ga0501047_0003454 | 3300049581 | Bacteria | 14936 |
| 889 | Ga0501047_0099241 | 3300049581 | Bacteria | 2791 |
| 890 | Ga0501048_0000303 | 3300049582 | Bacteria | 33444 |
| 891 | Ga0501048_0003130 | 3300049582 | Bacteria | 12636 |
| 892 | Ga0501067_0165646 | 3300049583 | Bacteria | 1231 |
| 893 | Ga0501067_0274861 | 3300049583 | Bacteria | 938 |
| 894 | Ga0501067_0565474 | 3300049583 | Bacteria | 637 |
| 895 | Ga0501068_0007451 | 3300049584 | Bacteria | 6062 |
| 896 | Ga0501068_0470881 | 3300049584 | Bacteria | 814 |
| 897 | Ga0501069_0021537 | 3300049585 | Bacteria | 3500 |
| 898 | Ga0501069_0950017 | 3300049585 | Bacteria | 524 |
| 899 | Ga0501070_0047259 | 3300049586 | Bacteria | 3578 |
| 900 | Ga0501070_0968434 | 3300049586 | Bacteria | 661 |
| 901 | Ga0501071_0001632 | 3300049587 | Bacteria | 13173 |
| 902 | Ga0501071_0499957 | 3300049587 | Bacteria | 933 |
| 903 | Ga0501072_0004544 | 3300049588 | Bacteria | 10549 |
| 904 | Ga0501072_0601477 | 3300049588 | Bacteria | 867 |
| 905 | Ga0501073_0223964 | 3300049589 | Bacteria | 1299 |
| 906 | Ga0501074_0003709 | 3300049590 | Bacteria | 10831 |
| 907 | Ga0501074_0012634 | 3300049590 | Bacteria | 6141 |
| 908 | Ga0501075_0008057 | 3300049591 | Bacteria | 7325 |
| 909 | Ga0501075_0363018 | 3300049591 | Bacteria | 1104 |
| 910 | Ga0501075_0472181 | 3300049591 | Bacteria | 957 |
| 911 | Ga0501075_0634732 | 3300049591 | Bacteria | 814 |
| 912 | Ga0501075_0828518 | 3300049591 | Bacteria | 704 |
| 913 | Ga0501076_0005239 | 3300049592 | Bacteria | 9296 |
| 914 | Ga0501077_0000779 | 3300049593 | Bacteria | 19273 |
| 915 | Ga0501079_0004077 | 3300049741 | Bacteria | 10822 |
| 916 | Ga0501080_0372271 | 3300049742 | Bacteria | 1288 |
| 917 | Ga0501080_0389163 | 3300049742 | Bacteria | 1255 |
| 918 | Ga0501080_1837981 | 3300049742 | Bacteria | 508 |
| 919 | Ga0501081_0003874 | 3300049743 | Bacteria | 9588 |
| 920 | Ga0501083_0470467 | 3300049744 | Bacteria | 818 |
| 921 | Ga0501083_1153992 | 3300049744 | Bacteria | 504 |
| 922 | Ga0501035_0023918 | 3300049822 | Bacteria | 5606 |
| 923 | Ga0501035_0111426 | 3300049822 | Bacteria | 2398 |
| 924 | Ga0501035_0688819 | 3300049822 | Bacteria | 825 |
| 925 | Ga0501035_1287958 | 3300049822 | Bacteria | 564 |
| 926 | Ga0501044_0070422 | 3300049823 | Bacteria | 3557 |
| 927 | Ga0501044_0206728 | 3300049823 | Bacteria | 1919 |
| 928 | Ga0501045_0000531 | 3300049824 | Bacteria | 23816 |
| 929 | Ga0501045_0697538 | 3300049824 | Bacteria | 749 |
| 930 | Ga0501045_1161239 | 3300049824 | Bacteria | 564 |
| 931 | Ga0501045_1175764 | 3300049824 | Bacteria | 560 |
| 932 | nmdc:mga03683_37209_c1 | 3300050489 | Bacteria | 1982 |
| 933 | nmdc:mga03n38_51079_c1 | 3300050490 | Bacteria | 1845 |
| 934 | nmdc:mga00v17_102257_c1 | 3300050491 | Bacteria | 1810 |
| 935 | nmdc:mga00v17_207838_c1 | 3300050491 | Bacteria | 1266 |
| 936 | nmdc:mga07m45_25616_c1 | 3300050496 | Bacteria | 3236 |
| 937 | nmdc:mga07m45_75049_c1 | 3300050496 | Bacteria | 1926 |
| 938 | nmdc:mga05p37_49276_c1 | 3300050507 | Bacteria | 5181 |
| 939 | nmdc:mga05p37_5454_c1 | 3300050507 | Bacteria | 14933 |
| 940 | nmdc:mga09592_33094_c1 | 3300050508 | Bacteria | 4313 |
| 941 | nmdc:mga09592_633840_c1 | 3300050508 | Bacteria | 914 |
| 942 | nmdc:mga0qj67_24560_c1 | 3300050509 | Bacteria | 4648 |
| 943 | nmdc:mga06r32_29000_c1 | 3300050510 | Bacteria | 5183 |
| 944 | nmdc:mga08y16_1526332_c1 | 3300050511 | Bacteria | 628 |
| 945 | nmdc:mga08y16_16077_c1 | 3300050511 | Bacteria | 7870 |
| 946 | nmdc:mga0n895_1032966_c1 | 3300050512 | Bacteria | 802 |
| 947 | nmdc:mga0n895_123154_c1 | 3300050512 | Bacteria | 2615 |
| 948 | nmdc:mga0n895_2073032_c1 | 3300050512 | Bacteria | 526 |
| 949 | nmdc:mga0rr50_144385_c1 | 3300050513 | Bacteria | 1917 |
| 950 | nmdc:mga0rr50_1469394_c1 | 3300050513 | Bacteria | 576 |
| 951 | nmdc:mga0rr50_466705_c1 | 3300050513 | Bacteria | 1071 |
| 952 | nmdc:mga0rr50_673993_c1 | 3300050513 | Bacteria | 882 |
| 953 | nmdc:mga08x19_821943_c1 | 3300050514 | Bacteria | 660 |
| 954 | nmdc:mga0a205_66497_c1 | 3300050515 | Bacteria | 3483 |
| 955 | nmdc:mga0a205_8127_c1 | 3300050515 | Bacteria | 9535 |
| 956 | nmdc:mga0sz30_407783_c1 | 3300050516 | Bacteria | 609 |
| 957 | Ga0495601_0091737 | 3300053077 | Bacteria | 1956 |
| 958 | Ga0495619_0332498 | 3300053085 | Bacteria | 1052 |
| 959 | Ga0495619_0433250 | 3300053085 | Bacteria | 907 |
| 960 | Ga0495619_0522822 | 3300053085 | Bacteria | 815 |
| 961 | Ga0495619_0936651 | 3300053085 | Bacteria | 581 |
| 962 | Ga0500644_0320349 | 3300053088 | Bacteria | 666 |
| 963 | Ga0500583_0040555 | 3300053092 | Bacteria | 2110 |
| 964 | Ga0500577_0133410 | 3300053142 | Bacteria | 1042 |
| 965 | Ga0500622_0253793 | 3300053156 | Bacteria | 771 |
| 966 | Ga0501084_0007319 | 3300054114 | Bacteria | 9091 |
| 967 | Ga0501084_0223559 | 3300054114 | Bacteria | 1589 |
| 968 | Ga0590071_007853 | 3300059421 | Bacteria | 2521 |
| 969 | Ga0590071_025696 | 3300059421 | Bacteria | 1396 |
| 970 | Ga0590074_003728 | 3300059423 | Bacteria | 2522 |
| 971 | Ga0590075_001621 | 3300059424 | Bacteria | 5557 |
| 972 | Ga0590077_013179 | 3300059426 | Bacteria | 1718 |
| 973 | Ga0587070_079942 | 3300059491 | Bacteria | 715 |
| 974 | Ga0587073_0131260 | 3300059492 | Bacteria | 688 |
| 975 | Ga0587082_052942 | 3300059504 | Bacteria | 780 |
| 976 | Ga0587083_0017352 | 3300059505 | Bacteria | 1286 |
| 977 | Ga0587083_0072330 | 3300059505 | Bacteria | 803 |
| 978 | Ga0587085_055821 | 3300059506 | Bacteria | 733 |
| 979 | Ga0587085_069772 | 3300059506 | Bacteria | 684 |
| 980 | Ga0587086_041092 | 3300059507 | Bacteria | 716 |
| 981 | Ga0587088_045917 | 3300059508 | Bacteria | 839 |
| 982 | Ga0587090_068054 | 3300059510 | Bacteria | 690 |
| 983 | Ga0587091_070340 | 3300059511 | Bacteria | 764 |
| 984 | Ga0587092_052260 | 3300059512 | Bacteria | 743 |
| 985 | Ga0587095_026416 | 3300059514 | Bacteria | 583 |
| 986 | Ga0587098_028821 | 3300059604 | Bacteria | 752 |
| 987 | Ga0587098_034655 | 3300059604 | Bacteria | 710 |
| 988 | Ga0587098_035375 | 3300059604 | Bacteria | 705 |
| 989 | Ga0587106_060370 | 3300059605 | Bacteria | 695 |
| 990 | Ga0587125_020354 | 3300059607 | Bacteria | 779 |
| 991 | Ga0587101_051608 | 3300059623 | Bacteria | 710 |
| 992 | Ga0587101_072846 | 3300059623 | Bacteria | 636 |
| 993 | Ga0587113_018654 | 3300059625 | Bacteria | 713 |
| 994 | Ga0587122_017965 | 3300059628 | Bacteria | 745 |
| 995 | Ga0587122_021501 | 3300059628 | Bacteria | 705 |
| 996 | Ga0587128_155290 | 3300059630 | Bacteria | 524 |
| 997 | Ga0587130_018631 | 3300059631 | Bacteria | 737 |
| 998 | Ga0587062_042885 | 3300059639 | Bacteria | 740 |
| 999 | Ga0587062_047886 | 3300059639 | Bacteria | 715 |
| 1000 | Ga0587062_052052 | 3300059639 | Bacteria | 696 |
| 1001 | Ga0587067_037069 | 3300059640 | Bacteria | 930 |
| 1002 | Ga0587067_057243 | 3300059640 | Bacteria | 807 |
| 1003 | Ga0587067_083279 | 3300059640 | Bacteria | 712 |
| 1004 | Ga0587068_063078 | 3300059641 | Bacteria | 717 |
| 1005 | Ga0587069_044056 | 3300059642 | Bacteria | 772 |
| 1006 | Ga0587069_048422 | 3300059642 | Bacteria | 749 |
| 1007 | Ga0587072_095346 | 3300059643 | Bacteria | 661 |
| 1008 | Ga0587076_054659 | 3300059645 | Bacteria | 788 |
| 1009 | Ga0587076_076692 | 3300059645 | Bacteria | 705 |
| 1010 | Ga0587079_076015 | 3300059647 | Bacteria | 759 |
| 1011 | Ga0587110_031279 | 3300059654 | Bacteria | 650 |
| 1012 | Ga0587114_097086 | 3300059655 | Bacteria | 570 |
| 1013 | Ga0587114_144356 | 3300059655 | Bacteria | 500 |
| 1014 | Ga0587071_061297 | 3300060344 | Bacteria | 800 |
| 1015 | Ga0587071_061707 | 3300060344 | Bacteria | 798 |
| 1016 | Ga0587071_083475 | 3300060344 | Bacteria | 715 |
| 1017 | Ga0587111_0105467 | 3300060346 | Bacteria | 708 |
| 1018 | Ga0587111_0116904 | 3300060346 | Bacteria | 682 |
| 1019 | Ga0501082_0006128 | 3300060353 | Bacteria | 10438 |
| 1020 | Ga0501082_0916558 | 3300060353 | Bacteria | 766 |
| 1021 | Ga0466962_0000866 | 3300061719 | Bacteria | 13714 |
| 1022 | Ga0466962_0037329 | 3300061719 | Bacteria | 2326 |
| 1023 | Ga0466962_0055080 | 3300061719 | Bacteria | 1900 |
| 1024 | Ga0466962_0722167 | 3300061719 | Bacteria | 512 |
| 1025 | Ga0530510_0000751 | 3300061734 | Bacteria | 21029 |
| 1026 | 2558912950 | 2558860112 | Bacteria | 9931328 |
| 1027 | 2566994032 | 2565956761 | Bacteria | 6601618 |
| 1028 | 2586063202 | 2585427649 | Bacteria | 9053857 |
| 1029 | 2643850676 | 2643221567 | Bacteria | 4163945 |
| 1030 | 2644134430 | 2643221624 | Bacteria | 4384879 |
| 1031 | 2644611469 | 2643221711 | Bacteria | 4865335 |
| 1032 | 2738889592 | 2738541308 | Bacteria | 7020677 |
| 1033 | 2744955776 | 2744054611 | Bacteria | 5611514 |
| 1034 | 2795784616 | 2795385470 | Bacteria | 8317180 |
| 1035 | 2795797296 | 2795385472 | Bacteria | 6627535 |
| 1036 | 2808873541 | 2808606365 | Bacteria | 4301966 |
| 1037 | 2809587649 | 2808606522 | Bacteria | 9488490 |
| 1038 | 2812375405 | 2811994882 | Bacteria | 4688362 |
| 1039 | 2819428135 | 2818991318 | Bacteria | 5266538 |
| 1040 | 2819668312 | 2818991458 | Bacteria | 4794049 |
| 1041 | 2819692161 | 2818991462 | Bacteria | 4320267 |
| 1042 | 2819729902 | 2818991469 | Bacteria | 4644110 |
| 1043 | 2866614028 | 2866612099 | Bacteria | 7543886 |
| 1044 | 2870790936 | 2870782633 | Bacteria | 9624083 |
| 1045 | 2899362936 | 2899359706 | Bacteria | 10940472 |
| 1046 | 2904539800 | 2904535858 | Bacteria | 6308016 |
| 1047 | 2915364144 | 2915358134 | Bacteria | 6050864 |
| 1048 | 2915771213 | 2915768154 | Bacteria | 8424322 |
| 1049 | 2922560369 | 2922554459 | Bacteria | 6683962 |
| 1050 | 2974316861 | 2974315732 | Bacteria | 4602776 |
| 1051 | 2984525044 | 2984523437 | Bacteria | 4508481 |
| 1052 | Ga0070713_101466632 | |||
| 1053 | JGI24735J21928_10210953 | |||
| 1054 | Ga0006762J43184_106040 | |||
| 1055 | Ga0006765J45826_110262 | |||
| 1056 | Ga0006778J45830_1005056 | |||
| 1057 | Ga0006778J45830_1038144 | |||
| 1058 | Ga0006759J45824_1034474 | |||
| 1059 | JGI25406J46586_10013924 | |||
| 1060 | Ga0006777J48905_1006137 | |||
| 1061 | Ga0006777J48905_1026371 | |||
| 1062 | JGI25407J50210_10103766 | |||
| 1063 | Ga0007417J51691_1036609 | |||
| 1064 | Ga0007427J51700_104963 | |||
| 1065 | Ga0006781J51513_1004313 | |||
| 1066 | Ga0007410J51695_1031624 | |||
| 1067 | Ga0007410J51695_1032791 | |||
| 1068 | Ga0007409J51694_1033305 | |||
| 1069 | Ga0007416J51690_1008291 | |||
| 1070 | Ga0006562J51391_1009846 | |||
| 1071 | Ga0007429J51699_1004583 | |||
| 1072 | Ga0007429J51699_1023912 | |||
| 1073 | Ga0007429J51699_1041285 | |||
| 1074 | Ga0032354_1033399 | |||
| 1075 | Ga0032354_1034419 | |||
| 1076 | Ga0032354_1059326 | |||
| 1077 | Ga0032354_1073262 | |||
| 1078 | Ga0006780_1001866 | |||
| 1079 | Ga0058859_10089023 | |||
| 1080 | Ga0058863_10008355 | |||
| 1081 | Ga0058863_10026305 | |||
| 1082 | Ga0058861_10026983 | |||
| 1083 | Ga0058861_10149181 | |||
| 1084 | Ga0058861_11719764 | |||
| 1085 | Ga0058860_10089247 | |||
| 1086 | Ga0058862_10217586 | |||
| 1087 | Ga0058862_12879838 | |||
| 1088 | Ga0070658_11134521 | |||
| 1089 | Ga0070658_11476507 | |||
| 1090 | Ga0070683_100477399 | |||
| 1091 | Ga0070683_101127242 | |||
| 1092 | Ga0070683_102206042 | |||
| 1093 | Ga0070670_100311440 | |||
| 1094 | Ga0070670_100879134 | |||
| 1095 | Ga0070670_102204608 | |||
| 1096 | Ga0070677_10060915 | |||
| 1097 | Ga0070677_10296584 | |||
| 1098 | Ga0068869_100735424 | |||
| 1099 | Ga0070666_10016267 | |||
| 1100 | Ga0070666_11064486 | |||
| 1101 | Ga0070666_11393473 | |||
| 1102 | Ga0070680_101466279 | |||
| 1103 | Ga0070660_100641963 | |||
| 1104 | Ga0070660_100740989 | |||
| 1105 | Ga0070660_101156321 | |||
| 1106 | Ga0070689_101043798 | |||
| 1107 | Ga0070687_100615357 | |||
| 1108 | Ga0070661_101457457 | |||
| 1109 | Ga0070692_11124989 | |||
| 1110 | Ga0070668_100626451 | |||
| 1111 | Ga0070668_101395525 | |||
| 1112 | Ga0070669_100663673 | |||
| 1113 | Ga0070675_100618916 | |||
| 1114 | Ga0070671_100875833 | |||
| 1115 | Ga0070674_100178234 | |||
| 1116 | Ga0070674_100243236 | |||
| 1117 | Ga0070674_100258691 | |||
| 1118 | Ga0070674_100620453 | |||
| 1119 | Ga0070674_100632275 | |||
| 1120 | Ga0070667_100080335 | |||
| 1121 | Ga0070709_10695403 | |||
| 1122 | Ga0070709_10942188 | |||
| 1123 | Ga0070709_11096603 | |||
| 1124 | Ga0070714_101590174 | |||
| 1125 | Ga0070713_101283156 | |||
| 1126 | Ga0070713_101612971 | |||
| 1127 | Ga0070710_10679718 | |||
| 1128 | Ga0070710_10679719 | |||
| 1129 | Ga0070710_11406024 | |||
| 1130 | Ga0070711_100003789 | |||
| 1131 | Ga0070711_100219993 | |||
| 1132 | Ga0070711_100611127 | |||
| 1133 | Ga0070711_101233417 | |||
| 1134 | Ga0070711_101986237 | |||
| 1135 | Ga0070663_101466910 | |||
| 1136 | Ga0070678_100076418 | |||
| 1137 | Ga0070681_10406266 | |||
| 1138 | Ga0070681_11150177 | |||
| 1139 | Ga0070685_10611086 | |||
| 1140 | Ga0070707_100871511 | |||
| 1141 | Ga0070684_100194508 | |||
| 1142 | Ga0070684_100357105 | |||
| 1143 | Ga0070684_100679954 | |||
| 1144 | Ga0068853_100819511 | |||
| 1145 | Ga0070672_100366745 | |||
| 1146 | Ga0070686_101416219 | |||
| 1147 | Ga0070696_100328651 | |||
| 1148 | Ga0070696_101588431 | |||
| 1149 | Ga0070665_100011443 | |||
| 1150 | Ga0070665_100233199 | |||
| 1151 | Ga0068855_100101198 | |||
| 1152 | Ga0068855_100498795 | |||
| 1153 | Ga0070702_100416124 | |||
| 1154 | Ga0068852_100581584 | |||
| 1155 | Ga0068859_100009699 | |||
| 1156 | Ga0068859_100408448 | |||
| 1157 | Ga0068864_100723368 | |||
| 1158 | Ga0068864_101063745 | |||
| 1159 | Ga0068861_101654744 | |||
| 1160 | Ga0068863_100000271 | |||
| 1161 | Ga0068863_100819549 | |||
| 1162 | Ga0068863_101012327 | |||
| 1163 | Ga0068858_100042746 | |||
| 1164 | Ga0068858_100310988 | |||
| 1165 | Ga0068858_101087157 | |||
| 1166 | Ga0068860_100000017 | |||
| 1167 | Ga0068862_101751187 | |||
| 1168 | Ga0081455_10449726 | |||
| 1169 | Ga0081538_10003166 | |||
| 1170 | Ga0081538_10046271 | |||
| 1171 | Ga0081538_10103120 | |||
| 1172 | Ga0081538_10123888 | |||
| 1173 | Ga0081540_1205334 | |||
| 1174 | Ga0081539_10056259 | |||
| 1175 | Ga0081539_10101202 | |||
| 1176 | Ga0070717_10233235 | |||
| 1177 | Ga0070717_10494657 | |||
| 1178 | Ga0070717_11523731 | |||
| 1179 | Ga0070717_11916909 | |||
| 1180 | Ga0075365_10229574 | |||
| 1181 | Ga0075364_10268624 | |||
| 1182 | Ga0075364_10440156 | |||
| 1183 | Ga0075432_10007919 | |||
| 1184 | Ga0070715_10014834 | |||
| 1185 | Ga0070715_10077553 | |||
| 1186 | Ga0070715_10208938 | |||
| 1187 | Ga0070716_100440099 | |||
| 1188 | Ga0070716_101291322 | |||
| 1189 | Ga0070712_100129277 | |||
| 1190 | Ga0070712_100338724 | |||
| 1191 | Ga0070712_101269107 | |||
| 1192 | Ga0075362_10119435 | |||
| 1193 | Ga0075369_10340621 | |||
| 1194 | Ga0075427_10003509 | |||
| 1195 | Ga0075370_10203384 | |||
| 1196 | Ga0075370_10368609 | |||
| 1197 | Ga0068871_100161342 | |||
| 1198 | Ga0075428_102323943 | |||
| 1199 | Ga0075430_100002298 | |||
| 1200 | Ga0075431_100046360 | |||
| 1201 | Ga0075433_10202134 | |||
| 1202 | Ga0075434_100173292 | |||
| 1203 | Ga0075434_100732809 | |||
| 1204 | Ga0075429_100184448 | |||
| 1205 | Ga0075429_100484559 | |||
| 1206 | Ga0068865_100031002 | |||
| 1207 | Ga0075436_100106475 | |||
| 1208 | Ga0075436_100712459 | |||
| 1209 | Ga0097620_100009699 | |||
| 1210 | Ga0097620_100408444 | |||
| 1211 | Ga0099826_10503269 | |||
| 1212 | Ga0075435_100223661 | |||
| 1213 | Ga0075435_100327153 | |||
| 1214 | Ga0099794_10264980 | |||
| 1215 | Ga0105244_10155452 | |||
| 1216 | Ga0105250_10365835 | |||
| 1217 | Ga0105240_10344993 | |||
| 1218 | Ga0105240_10927804 | |||
| 1219 | Ga0111539_10008260 | |||
| 1220 | Ga0111539_10637647 | |||
| 1221 | Ga0111539_11215726 | |||
| 1222 | Ga0105245_11428557 | |||
| 1223 | Ga0105245_13052556 | |||
| 1224 | Ga0105245_13170242 | |||
| 1225 | Ga0105247_10003047 | |||
| 1226 | Ga0105247_10097661 | |||
| 1227 | Ga0105247_11322399 | |||
| 1228 | Ga0114129_10008595 | |||
| 1229 | Ga0114129_10215833 | |||
| 1230 | Ga0105241_10140534 | |||
| 1231 | Ga0105241_10813919 | |||
| 1232 | Ga0105242_10960326 | |||
| 1233 | Ga0105248_10577601 | |||
| 1234 | Ga0105248_10839045 | |||
| 1235 | Ga0105238_10316290 | |||
| 1236 | Ga0105249_12164515 | |||
| 1237 | Ga0105239_10888391 | |||
| 1238 | Ga0105246_10694791 | |||
| 1239 | Ga0157322_1013097 | |||
| 1240 | Ga0157315_1041091 | |||
| 1241 | Ga0154018_106035 | |||
| 1242 | Ga0154019_111685 | |||
| 1243 | Ga0154019_130654 | |||
| 1244 | Ga0154019_132188 | |||
| 1245 | Ga0154016_140112 | |||
| 1246 | Ga0154010_134604 | |||
| 1247 | Ga0157369_10335593 | |||
| 1248 | Ga0157369_10863208 | |||
| 1249 | Ga0157369_10893070 | |||
| 1250 | Ga0157369_11025526 | |||
| 1251 | Ga0157369_11174195 | |||
| 1252 | Ga0157369_12352435 | |||
| 1253 | Ga0157374_10624912 | |||
| 1254 | Ga0163162_10726698 | |||
| 1255 | Ga0163162_11786131 | |||
| 1256 | Ga0163162_12451292 | |||
| 1257 | Ga0157372_12169798 | |||
| 1258 | Ga0157372_13083542 | |||
| 1259 | Ga0157375_10202275 | |||
| 1260 | Ga0157375_11213137 | |||
| 1261 | Ga0157375_12652050 | |||
| 1262 | Ga0163163_11121161 | |||
| 1263 | Ga0163163_11253974 | |||
| 1264 | Ga0163163_11908895 | |||
| 1265 | Ga0163163_12375095 | |||
| 1266 | Ga0157380_10062761 | |||
| 1267 | Ga0157380_10170339 | |||
| 1268 | Ga0182008_10150045 | |||
| 1269 | Ga0182008_10611691 | |||
| 1270 | Ga0157379_10433023 | |||
| 1271 | Ga0182007_10205048 | |||
| 1272 | Ga0163161_10273822 | |||
| 1273 | Ga0163161_11194458 | |||
| 1274 | Ga0184601_106667 | |||
| 1275 | Ga0197907_10510385 | |||
| 1276 | Ga0197907_10609010 | |||
| 1277 | Ga0197907_10673134 | |||
| 1278 | Ga0197907_10774481 | |||
| 1279 | Ga0197907_11011516 | |||
| 1280 | Ga0197907_11074173 | |||
| 1281 | Ga0197907_11203548 | |||
| 1282 | Ga0206356_10063509 | |||
| 1283 | Ga0206356_10066933 | |||
| 1284 | Ga0206356_10411237 | |||
| 1285 | Ga0206356_10508149 | |||
| 1286 | Ga0206356_10536307 | |||
| 1287 | Ga0206356_10991299 | |||
| 1288 | Ga0206348_118668 | |||
| 1289 | Ga0206349_1011561 | |||
| 1290 | Ga0206349_1032467 | |||
| 1291 | Ga0206349_1074758 | |||
| 1292 | Ga0206349_1229691 | |||
| 1293 | Ga0206349_1334875 | |||
| 1294 | Ga0206349_1348834 | |||
| 1295 | Ga0206349_1350967 | |||
| 1296 | Ga0206349_1426679 | |||
| 1297 | Ga0206349_1431629 | |||
| 1298 | Ga0206349_1862309 | |||
| 1299 | Ga0206349_1888998 | |||
| 1300 | Ga0206355_1100617 | |||
| 1301 | Ga0206355_1285473 | |||
| 1302 | Ga0206355_1468932 | |||
| 1303 | Ga0206355_1470546 | |||
| 1304 | Ga0206355_1470679 | |||
| 1305 | Ga0206351_10083497 | |||
| 1306 | Ga0206351_10138064 | |||
| 1307 | Ga0206351_10141963 | |||
| 1308 | Ga0206351_10809814 | |||
| 1309 | Ga0206351_10827074 | |||
| 1310 | Ga0206352_10380058 | |||
| 1311 | Ga0206352_10497015 | |||
| 1312 | Ga0206352_10742338 | |||
| 1313 | Ga0206352_10991705 | |||
| 1314 | Ga0206352_11121572 | |||
| 1315 | Ga0206352_11330184 | |||
| 1316 | Ga0206350_10039080 | |||
| 1317 | Ga0206350_10042893 | |||
| 1318 | Ga0206350_10267178 | |||
| 1319 | Ga0206350_10582716 | |||
| 1320 | Ga0206350_11015395 | |||
| 1321 | Ga0206350_11037954 | |||
| 1322 | Ga0206350_11501976 | |||
| 1323 | Ga0206354_10204393 | |||
| 1324 | Ga0206354_10390798 | |||
| 1325 | Ga0206354_10558174 | |||
| 1326 | Ga0206354_10569637 | |||
| 1327 | Ga0206354_10818766 | |||
| 1328 | Ga0206354_10823933 | |||
| 1329 | Ga0206354_11025846 | |||
| 1330 | Ga0206354_11057629 | |||
| 1331 | Ga0206354_11180658 | |||
| 1332 | Ga0206354_11366478 | |||
| 1333 | Ga0206354_11441011 | |||
| 1334 | Ga0206354_11566837 | |||
| 1335 | Ga0206354_11583124 | |||
| 1336 | Ga0206353_10186978 | |||
| 1337 | Ga0206353_10987516 | |||
| 1338 | Ga0206353_11114468 | |||
| 1339 | Ga0206353_11197291 | |||
| 1340 | Ga0206353_11396596 | |||
| 1341 | Ga0206353_11416059 | |||
| 1342 | Ga0206353_11453009 | |||
| 1343 | Ga0206353_11543644 | |||
| 1344 | Ga0206353_11692651 | |||
| 1345 | Ga0206353_11741539 | |||
| 1346 | Ga0206353_11858452 | |||
| 1347 | Ga0206353_12003308 | |||
| 1348 | Ga0154015_1149892 | |||
| 1349 | Ga0154015_1195599 | |||
| 1350 | Ga0154015_1323326 | |||
| 1351 | Ga0154015_1438066 | |||
| 1352 | Ga0154015_1446764 | |||
| 1353 | Ga0213873_10000044 | |||
| 1354 | Ga0213873_10035419 | |||
| 1355 | Ga0213874_10402982 | |||
| 1356 | Ga0213876_10022891 | |||
| 1357 | Ga0213876_10443400 | |||
| 1358 | Ga0213876_10552332 | |||
| 1359 | Ga0213875_10000692 | |||
| 1360 | Ga0213875_10008193 | |||
| 1361 | Ga0213875_10103896 | |||
| 1362 | Ga0213875_10130659 | |||
| 1363 | Ga0224712_10076988 | |||
| 1364 | Ga0224712_10165193 | |||
| 1365 | Ga0224712_10222608 | |||
| 1366 | Ga0224712_10260005 | |||
| 1367 | Ga0224712_10284759 | |||
| 1368 | Ga0224712_10305510 | |||
| 1369 | Ga0224712_10306688 | |||
| 1370 | Ga0224712_10333902 | |||
| 1371 | Ga0224712_10572981 | |||
| 1372 | Ga0224712_10658638 | |||
| 1373 | Ga0207682_10337243 | |||
| 1374 | Ga0207692_10012975 | |||
| 1375 | Ga0207692_10685428 | |||
| 1376 | Ga0207642_10281604 | |||
| 1377 | Ga0207710_10005532 | |||
| 1378 | Ga0207688_10289700 | |||
| 1379 | Ga0207688_10631186 | |||
| 1380 | Ga0207688_10844494 | |||
| 1381 | Ga0207680_10009754 | |||
| 1382 | Ga0207647_10172767 | |||
| 1383 | Ga0207647_10321023 | |||
| 1384 | Ga0207647_10321788 | |||
| 1385 | Ga0207685_10004610 | |||
| 1386 | Ga0207685_10120774 | |||
| 1387 | Ga0207699_10026990 | |||
| 1388 | Ga0207699_10145227 | |||
| 1389 | Ga0207699_10693393 | |||
| 1390 | Ga0207699_11179383 | |||
| 1391 | Ga0207705_11238583 | |||
| 1392 | Ga0207684_10361066 | |||
| 1393 | Ga0207654_10230206 | |||
| 1394 | Ga0207707_10669748 | |||
| 1395 | Ga0207707_11488311 | |||
| 1396 | Ga0207695_10425580 | |||
| 1397 | Ga0207671_10151997 | |||
| 1398 | Ga0207693_10002030 | |||
| 1399 | Ga0207693_10460482 | |||
| 1400 | Ga0207663_10034355 | |||
| 1401 | Ga0207663_11688963 | |||
| 1402 | Ga0207657_10654639 | |||
| 1403 | Ga0207657_11298084 | |||
| 1404 | Ga0207649_10870608 | |||
| 1405 | Ga0207650_10626451 | |||
| 1406 | Ga0207650_11810563 | |||
| 1407 | Ga0207700_10839451 | |||
| 1408 | Ga0207700_10897371 | |||
| 1409 | Ga0207700_11281227 | |||
| 1410 | Ga0207664_10003926 | |||
| 1411 | Ga0207664_10139021 | |||
| 1412 | Ga0207664_10333834 | |||
| 1413 | Ga0207709_10130456 | |||
| 1414 | Ga0207670_10231427 | |||
| 1415 | Ga0207669_10158283 | |||
| 1416 | Ga0207669_10357911 | |||
| 1417 | Ga0207669_10714325 | |||
| 1418 | Ga0207665_10006636 | |||
| 1419 | Ga0207665_10104462 | |||
| 1420 | Ga0207665_10737354 | |||
| 1421 | Ga0207665_11255901 | |||
| 1422 | Ga0207661_10208623 | |||
| 1423 | Ga0207661_10416296 | |||
| 1424 | Ga0207661_10685865 | |||
| 1425 | Ga0207679_10240780 | |||
| 1426 | Ga0207679_10686304 | |||
| 1427 | Ga0207667_10118066 | |||
| 1428 | Ga0207667_11245621 | |||
| 1429 | Ga0207712_10297421 | |||
| 1430 | Ga0207668_10243478 | |||
| 1431 | Ga0207658_10065373 | |||
| 1432 | Ga0207658_11623533 | |||
| 1433 | Ga0207703_10012820 | |||
| 1434 | Ga0207703_11628415 | |||
| 1435 | Ga0207678_10417466 | |||
| 1436 | Ga0207678_11104284 | |||
| 1437 | Ga0207708_10834243 | |||
| 1438 | Ga0207702_11678910 | |||
| 1439 | Ga0207641_10000547 | |||
| 1440 | Ga0207641_10450900 | |||
| 1441 | Ga0207641_11267211 | |||
| 1442 | Ga0207648_10615728 | |||
| 1443 | Ga0207676_10551403 | |||
| 1444 | Ga0207676_11703172 | |||
| 1445 | Ga0207676_12304721 | |||
| 1446 | Ga0207674_10811365 | |||
| 1447 | Ga0207674_11120589 | |||
| 1448 | Ga0207674_11517762 | |||
| 1449 | Ga0207675_100857418 | |||
| 1450 | Ga0207683_10305752 | |||
| 1451 | Ga0207683_10437002 | |||
| 1452 | Ga0207683_10916546 | |||
| 1453 | Ga0207698_10710431 | |||
| 1454 | Ga0207698_11685620 | |||
| 1455 | Ga0209282_1392684 | |||
| 1456 | Ga0207428_10001612 | |||
| 1457 | Ga0207428_10830686 | |||
| 1458 | Ga0268266_10002626 | |||
| 1459 | Ga0268265_11724309 | |||
| 1460 | Ga0268264_10000033 | |||
| 1461 | Ga0265319_1025680 | |||
| 1462 | Ga0265318_10071667 | |||
| 1463 | Ga0265338_10350464 | |||
| 1464 | Ga0310981_1035484 | |||
| 1465 | Ga0307512_10032840 | |||
| 1466 | Ga0316177_1197151 | |||
| 1467 | Ga0316176_1100909 | |||
| 1468 | Ga0316181_1261438 | |||
| 1469 | Ga0265766_1009194 | |||
| 1470 | Ga0265772_104269 | |||
| 1471 | Ga0265320_10012962 | |||
| 1472 | Ga0307513_10067761 | |||
| 1473 | Ga0307513_10419183 | |||
| 1474 | Ga0307408_100012883 | |||
| 1475 | Ga0307408_100790413 | |||
| 1476 | Ga0307408_100806837 | |||
| 1477 | Ga0265314_10015293 | |||
| 1478 | Ga0265342_10340872 | |||
| 1479 | Ga0307405_10014617 | |||
| 1480 | Ga0307405_10023921 | |||
| 1481 | Ga0307405_10105489 | |||
| 1482 | Ga0307405_10147418 | |||
| 1483 | Ga0307405_10649696 | |||
| 1484 | Ga0307405_12113430 | |||
| 1485 | Ga0307413_10010302 | |||
| 1486 | Ga0307413_10381670 | |||
| 1487 | Ga0307413_10457533 | |||
| 1488 | Ga0307518_10000212 | |||
| 1489 | Ga0307410_10019522 | |||
| 1490 | Ga0307410_10097923 | |||
| 1491 | Ga0307410_10252592 | |||
| 1492 | Ga0307410_11123488 | |||
| 1493 | Ga0326468_10023711 | |||
| 1494 | Ga0307406_10076888 | |||
| 1495 | Ga0307407_10065605 | |||
| 1496 | Ga0307407_10069693 | |||
| 1497 | Ga0307412_10053504 | |||
| 1498 | Ga0307412_10207191 | |||
| 1499 | Ga0307412_10224781 | |||
| 1500 | Ga0307409_100004219 | |||
| 1501 | Ga0307409_100013993 | |||
| 1502 | Ga0307409_100281437 | |||
| 1503 | Ga0307409_100463678 | |||
| 1504 | Ga0307409_100611218 | |||
| 1505 | Ga0307409_101037823 | |||
| 1506 | Ga0307416_100001334 | |||
| 1507 | Ga0307416_100013202 | |||
| 1508 | Ga0307416_100056503 | |||
| 1509 | Ga0307416_100057421 | |||
| 1510 | Ga0307416_100134315 | |||
| 1511 | Ga0307416_100294159 | |||
| 1512 | Ga0307416_100420408 | |||
| 1513 | Ga0307416_100578772 | |||
| 1514 | Ga0307416_102316452 | |||
| 1515 | Ga0307414_10092801 | |||
| 1516 | Ga0307414_10954257 | |||
| 1517 | Ga0307414_11048532 | |||
| 1518 | Ga0307414_11147959 | |||
| 1519 | Ga0307411_10133450 | |||
| 1520 | Ga0307411_10504499 | |||
| 1521 | Ga0307411_10576971 | |||
| 1522 | Ga0307415_100007344 | |||
| 1523 | Ga0307415_100011202 | |||
| 1524 | Ga0307415_100128419 | |||
| 1525 | Ga0307415_100333275 | |||
| 1526 | Ga0307415_100434353 | |||
| 1527 | Ga0307415_100905104 | |||
| 1528 | Ga0307415_101782385 | |||
| 1529 | Ga0307507_10013762 | |||
| 1530 | Ga0307510_10117798 | |||
| 1531 | Ga0307510_10194125 | |||
| 1532 | Ga0373938_0062689 | |||
| 1533 | Ga0373926_0001445 | |||
| 1534 | Ga0373926_0132475 | |||
| 1535 | Ga0373944_0009366 | |||
| 1536 | Ga0373952_0240423 | |||
| 1537 | Ga0373923_0005888 | |||
| 1538 | Ga0373936_0015957 | |||
| 1539 | Ga0373939_0495468 | |||
| 1540 | Ga0373945_0000630 | |||
| 1541 | Ga0373954_0280650 | |||
| 1542 | Ga0373943_0006324 | |||
| 1543 | Ga0373946_0000565 | |||
| 1544 | Ga0373955_0229348 | |||
| 1545 | Ga0373924_0029336 | |||
| 1546 | Ga0373931_0575423 | |||
| 1547 | Ga0373935_0011880 | |||
| 1548 | Ga0373935_0082681 | |||
| 1549 | Ga0373927_0001626 | |||
| 1550 | Ga0373927_0872566 | |||
| 1551 | Ga0373947_0000144 | |||
| 1552 | Ga0373947_0021705 | |||
| 1553 | Ga0373937_0213389 | |||
| 1554 | Ga0372808_019497 | |||
| 1555 | Ga0373925_0004024 | |||
| 1556 | Ga0373925_0182845 | |||
| 1557 | Ga0373925_0355301 | |||
| 1558 | Ga0395899_0164282 | |||
| 1559 | Ga0395899_0166121 | |||
| 1560 | Ga0395899_0212385 | |||
| 1561 | Ga0395899_0337248 | |||
| 1562 | Ga0395899_0413641 | |||
| 1563 | Ga0395900_0039968 | |||
| 1564 | Ga0395900_0178726 | |||
| 1565 | Ga0395900_0236345 | |||
| 1566 | Ga0395900_0431612 | |||
| 1567 | Ga0395900_0613612 | |||
| 1568 | Ga0395900_0677683 | |||
| 1569 | Ga0395900_0689884 | |||
| 1570 | Ga0395900_0907525 | |||
| 1571 | Ga0395900_1411230 | |||
| 1572 | Ga0395898_0039954 | |||
| 1573 | Ga0395898_0143940 | |||
| 1574 | Ga0395898_0175455 | |||
| 1575 | Ga0395898_0421323 | |||
| 1576 | Ga0395898_0794493 | |||
| 1577 | Ga0395905_0049807 | |||
| 1578 | Ga0395905_1216659 | |||
| 1579 | Ga0436364_0002502 | |||
| 1580 | Ga0436364_0080744 | |||
| 1581 | Ga0436364_0131116 | |||
| 1582 | Ga0436364_0796409 | |||
| 1583 | Ga0436364_0802122 | |||
| 1584 | Ga0436364_0926314 | |||
| 1585 | Ga0436364_1000549 | |||
| 1586 | Ga0436364_1088153 | |||
| 1587 | Ga0436364_1330872 | |||
| 1588 | Ga0395901_0029983 | |||
| 1589 | Ga0395901_0120400 | |||
| 1590 | Ga0395901_0436282 | |||
| 1591 | Ga0395901_0480347 | |||
| 1592 | Ga0395901_0487477 | |||
| 1593 | Ga0395901_0683870 | |||
| 1594 | Ga0395901_1529035 | |||
| 1595 | Ga0436365_0031240 | |||
| 1596 | Ga0436365_0428182 | |||
| 1597 | Ga0436365_0451748 | |||
| 1598 | Ga0436365_1157386 | |||
| 1599 | Ga0436365_1294233 | |||
| 1600 | Ga0436365_1635144 | |||
| 1601 | Ga0436360_0662365 | |||
| 1602 | Ga0436361_0391834 | |||
| 1603 | Ga0436361_1157191 | |||
| 1604 | Ga0436363_0177779 | |||
| 1605 | Ga0436363_0367727 | |||
| 1606 | Ga0436363_0912415 | |||
| 1607 | Ga0436363_1670490 | |||
| 1608 | Ga0436362_0750637 | |||
| 1609 | Ga0436362_1082250 | |||
| 1610 | Ga0436362_1138202 | |||
| 1611 | Ga0439461_0147026 | |||
| 1612 | Ga0439466_0229576 | |||
| 1613 | Ga0439465_0094258 | |||
| 1614 | Ga0451789_0256892 | |||
| 1615 | Ga0451791_1171476 | |||
| 1616 | Ga0451793_1392987 | |||
| 1617 | Ga0451803_10011 | |||
| 1618 | Ga0451800_1378464 | |||
| 1619 | Ga0451833_0082567 | |||
| 1620 | Ga0451835_0298329 | |||
| 1621 | Ga0451849_0912681 | |||
| 1622 | Ga0451851_0172594 | |||
| 1623 | Ga0451843_1198960 | |||
| 1624 | Ga0451855_0835965 | |||
| 1625 | Ga0451853_1103692 | |||
| 1626 | Ga0451853_2624957 | |||
| 1627 | Ga0439431_0017985 | |||
| 1628 | Ga0439433_0030726 | |||
| 1629 | Ga0439443_002696 | |||
| 1630 | Ga0439448_0000530 | |||
| 1631 | Ga0439448_0041815 | |||
| 1632 | Ga0439449_0200624 | |||
| 1633 | Ga0439450_000277 | |||
| 1634 | Ga0439455_0151312 | |||
| 1635 | Ga0439462_0161565 | |||
| 1636 | Ga0439463_001090 | |||
| 1637 | Ga0450912_017599 | |||
| 1638 | Ga0450913_000860 | |||
| 1639 | Ga0450914_012561 | |||
| 1640 | Ga0450917_001102 | |||
| 1641 | Ga0450921_022548 | |||
| 1642 | Ga0450922_011727 | |||
| 1643 | Ga0450923_001738 | |||
| 1644 | Ga0450890_035424 | |||
| 1645 | Ga0450900_014351 | |||
| 1646 | Ga0450905_034623 | |||
| 1647 | Ga0450905_044728 | |||
| 1648 | Ga0450910_006225 | |||
| 1649 | Ga0450910_088069 | |||
| 1650 | Ga0439444_0007391 | |||
| 1651 | Ga0439459_0136786 | |||
| 1652 | Ga0439464_0020230 | |||
| 1653 | Ga0439460_0025353 | |||
| 1654 | Ga0450916_000072 | |||
| 1655 | Ga0450918_058782 | |||
| 1656 | Ga0450901_031185 | |||
| 1657 | Ga0439440_0000363 | |||
| 1658 | Ga0466969_0017358 | |||
| 1659 | Ga0466969_0046923 | |||
| 1660 | Ga0466969_0080478 | |||
| 1661 | Ga0466969_0216817 | |||
| 1662 | Ga0466972_0063377 | |||
| 1663 | Ga0453683_0000549 | |||
| 1664 | Ga0453683_0256899 | |||
| 1665 | Ga0466965_0006927 | |||
| 1666 | Ga0466965_0155522 | |||
| 1667 | Ga0466965_0609030 | |||
| 1668 | Ga0466966_0005077 | |||
| 1669 | Ga0466966_0025264 | |||
| 1670 | Ga0466966_0116248 | |||
| 1671 | Ga0466966_0665109 | |||
| 1672 | Ga0466966_0920601 | |||
| 1673 | Ga0466961_0000785 | |||
| 1674 | Ga0466961_0024534 | |||
| 1675 | Ga0466961_0034731 | |||
| 1676 | Ga0466961_0113908 | |||
| 1677 | Ga0466963_0002014 | |||
| 1678 | Ga0466963_0020515 | |||
| 1679 | Ga0466963_0092292 | |||
| 1680 | Ga0466963_0098223 | |||
| 1681 | Ga0466963_0160449 | |||
| 1682 | Ga0466963_0164646 | |||
| 1683 | Ga0466963_0186045 | |||
| 1684 | Ga0466964_0027416 | |||
| 1685 | Ga0466964_0039221 | |||
| 1686 | Ga0466964_0272256 | |||
| 1687 | Ga0453684_0006025 | |||
| 1688 | Ga0466971_0004313 | |||
| 1689 | Ga0466971_0010927 | |||
| 1690 | Ga0466971_0063593 | |||
| 1691 | Ga0466971_0172604 | |||
| 1692 | Ga0466971_0256180 | |||
| 1693 | Ga0466970_0020020 | |||
| 1694 | Ga0466970_0223848 | |||
| 1695 | Ga0466970_0370464 | |||
| 1696 | Ga0466970_0529456 | |||
| 1697 | Ga0466957_0004795 | |||
| 1698 | Ga0466957_0013692 | |||
| 1699 | Ga0466957_0475320 | |||
| 1700 | Ga0466957_1298547 | |||
| 1701 | Ga0466960_0042178 | |||
| 1702 | Ga0466960_0091289 | |||
| 1703 | Ga0466960_0287653 | |||
| 1704 | Ga0466960_1032812 | |||
| 1705 | Ga0466959_0000705 | |||
| 1706 | Ga0466959_0160639 | |||
| 1707 | Ga0466959_0162327 | |||
| 1708 | Ga0466959_0233960 | |||
| 1709 | Ga0466959_0293888 | |||
| 1710 | Ga0466959_0303830 | |||
| 1711 | Ga0466959_0579273 | |||
| 1712 | Ga0466959_0767681 | |||
| 1713 | Ga0466959_1151284 | |||
| 1714 | Ga0451576_0022491 | |||
| 1715 | Ga0466958_0000094 | |||
| 1716 | Ga0466958_0017906 | |||
| 1717 | Ga0466958_0075922 | |||
| 1718 | Ga0466958_0078887 | |||
| 1719 | Ga0466958_0097392 | |||
| 1720 | Ga0466958_0412095 | |||
| 1721 | Ga0466958_0417187 | |||
| 1722 | Ga0466967_0003455 | |||
| 1723 | Ga0466967_0064160 | |||
| 1724 | Ga0466967_0064939 | |||
| 1725 | Ga0466967_0099960 | |||
| 1726 | Ga0466967_0121206 | |||
| 1727 | Ga0466967_0760305 | |||
| 1728 | Ga0466967_2355652 | |||
| 1729 | Ga0495627_201784 | |||
| 1730 | Ga0495603_0156959 | |||
| 1731 | Ga0495603_0302245 | |||
| 1732 | Ga0495603_0840395 | |||
| 1733 | Ga0495629_1021528 | |||
| 1734 | Ga0495641_0031062 | |||
| 1735 | Ga0495641_0605818 | |||
| 1736 | Ga0495651_0061769 | |||
| 1737 | Ga0495653_0082304 | |||
| 1738 | Ga0495582_0066529 | |||
| 1739 | Ga0495605_0309601 | |||
| 1740 | Ga0495639_0440061 | |||
| 1741 | Ga0495662_0021138 | |||
| 1742 | Ga0495664_0000083 | |||
| 1743 | Ga0495584_0192153 | |||
| 1744 | Ga0495584_0215023 | |||
| 1745 | Ga0495608_0046927 | |||
| 1746 | Ga0495618_0024377 | |||
| 1747 | Ga0495628_0072657 | |||
| 1748 | Ga0495630_0042051 | |||
| 1749 | Ga0495644_0013701 | |||
| 1750 | Ga0495644_0447360 | |||
| 1751 | Ga0495663_0212074 | |||
| 1752 | Ga0495642_0301831 | |||
| 1753 | Ga0495642_0311272 | |||
| 1754 | Ga0495652_0023799 | |||
| 1755 | Ga0495654_0236122 | |||
| 1756 | Ga0495665_0030444 | |||
| 1757 | Ga0495665_0067643 | |||
| 1758 | Ga0495665_0090863 | |||
| 1759 | Ga0495640_0025751 | |||
| 1760 | Ga0495586_0289460 | |||
| 1761 | Ga0495586_0356106 | |||
| 1762 | Ga0495586_0360570 | |||
| 1763 | Ga0495587_0090150 | |||
| 1764 | Ga0495598_0303495 | |||
| 1765 | Ga0495609_0011484 | |||
| 1766 | Ga0495621_0089038 | |||
| 1767 | Ga0495622_0166088 | |||
| 1768 | Ga0495667_0023226 | |||
| 1769 | Ga0495656_0006124 | |||
| 1770 | Ga0495656_0099553 | |||
| 1771 | Ga0495668_0000043 | |||
| 1772 | Ga0495668_0621931 | |||
| 1773 | Ga0495634_0046162 | |||
| 1774 | Ga0495634_0134461 | |||
| 1775 | Ga0495635_0004414 | |||
| 1776 | Ga0495659_0118883 | |||
| 1777 | Ga0495588_0128586 | |||
| 1778 | Ga0495588_0238864 | |||
| 1779 | Ga0495588_0292726 | |||
| 1780 | Ga0495657_0062491 | |||
| 1781 | Ga0495657_0067118 | |||
| 1782 | Ga0495599_0049567 | |||
| 1783 | Ga0495646_0074394 | |||
| 1784 | Ga0495646_0569296 | |||
| 1785 | Ga0495647_0257917 | |||
| 1786 | Ga0495669_0036649 | |||
| 1787 | Ga0495624_0002178 | |||
| 1788 | Ga0495600_0113876 | |||
| 1789 | Ga0495600_0214736 | |||
| 1790 | Ga0495581_0033096 | |||
| 1791 | Ga0495581_0039003 | |||
| 1792 | Ga0495636_0120711 | |||
| 1793 | Ga0495674_0001086 | |||
| 1794 | Ga0495674_1033376 | |||
| 1795 | Ga0495676_0022375 | |||
| 1796 | Ga0495680_0004440 | |||
| 1797 | Ga0495680_0993588 | |||
| 1798 | Ga0495680_1020277 | |||
| 1799 | Ga0495677_0138383 | |||
| 1800 | Ga0495684_0001387 | |||
| 1801 | Ga0495614_0188099 | |||
| 1802 | Ga0495614_0366714 | |||
| 1803 | Ga0495626_0381879 | |||
| 1804 | Ga0496100_0035341 | |||
| 1805 | Ga0496100_0038819 | |||
| 1806 | Ga0496100_0109922 | |||
| 1807 | Ga0496100_0176737 | |||
| 1808 | Ga0496100_0246996 | |||
| 1809 | Ga0496100_0378536 | |||
| 1810 | Ga0496101_0262185 | |||
| 1811 | Ga0496102_0000142 | |||
| 1812 | Ga0496102_0000569 | |||
| 1813 | Ga0496102_0002441 | |||
| 1814 | Ga0496102_0701165 | |||
| 1815 | Ga0496102_0816532 | |||
| 1816 | Ga0496102_1119064 | |||
| 1817 | Ga0496102_1292409 | |||
| 1818 | Ga0496103_0000085 | |||
| 1819 | Ga0496103_0097690 | |||
| 1820 | Ga0496103_0453464 | |||
| 1821 | Ga0496103_0510279 | |||
| 1822 | Ga0496103_0855690 | |||
| 1823 | Ga0496104_0150654 | |||
| 1824 | Ga0496104_0742640 | |||
| 1825 | Ga0496104_0785709 | |||
| 1826 | Ga0496104_0947397 | |||
| 1827 | Ga0496104_1491275 | |||
| 1828 | Ga0496105_0429126 | |||
| 1829 | Ga0496105_1089398 | |||
| 1830 | Ga0496106_0112887 | |||
| 1831 | Ga0496106_0559802 | |||
| 1832 | Ga0496106_0734697 | |||
| 1833 | Ga0496107_0223042 | |||
| 1834 | Ga0496107_0260004 | |||
| 1835 | Ga0496108_0204798 | |||
| 1836 | Ga0496108_0214497 | |||
| 1837 | Ga0496109_0532299 | |||
| 1838 | Ga0496109_1144258 | |||
| 1839 | Ga0496109_1901040 | |||
| 1840 | Ga0496110_0428085 | |||
| 1841 | Ga0496110_0738601 | |||
| 1842 | Ga0496110_1367957 | |||
| 1843 | Ga0496111_0245421 | |||
| 1844 | Ga0496111_0457303 | |||
| 1845 | Ga0496112_0249946 | |||
| 1846 | Ga0496112_0419900 | |||
| 1847 | Ga0496113_0094465 | |||
| 1848 | Ga0496113_0167659 | |||
| 1849 | Ga0496113_0547508 | |||
| 1850 | Ga0496113_0731573 | |||
| 1851 | Ga0496113_1591235 | |||
| 1852 | Ga0496114_0284421 | |||
| 1853 | Ga0496114_0454189 | |||
| 1854 | Ga0496114_0971896 | |||
| 1855 | Ga0496114_1313340 | |||
| 1856 | Ga0496115_0555294 | |||
| 1857 | Ga0496115_0930574 | |||
| 1858 | Ga0496119_0000153 | |||
| 1859 | Ga0496119_0138796 | |||
| 1860 | Ga0496120_0022025 | |||
| 1861 | Ga0496124_0912935 | |||
| 1862 | Ga0496125_0039413 | |||
| 1863 | Ga0496126_0531998 | |||
| 1864 | Ga0501306_010963 | |||
| 1865 | Ga0501306_028346 | |||
| 1866 | Ga0501306_036026 | |||
| 1867 | Ga0501306_071800 | |||
| 1868 | Ga0501308_028187 | |||
| 1869 | Ga0501308_030187 | |||
| 1870 | Ga0501309_022434 | |||
| 1871 | Ga0501310_009659 | |||
| 1872 | Ga0501310_024994 | |||
| 1873 | Ga0501310_045818 | |||
| 1874 | Ga0501304_008465 | |||
| 1875 | Ga0501304_013152 | |||
| 1876 | Ga0501307_022876 | |||
| 1877 | Ga0501307_030750 | |||
| 1878 | Ga0501307_064045 | |||
| 1879 | Ga0501292_131513 | |||
| 1880 | Ga0501311_017476 | |||
| 1881 | Ga0501311_033087 | |||
| 1882 | Ga0501312_042652 | |||
| 1883 | Ga0501312_059050 | |||
| 1884 | Ga0501312_094358 | |||
| 1885 | Ga0501313_035339 | |||
| 1886 | Ga0501314_007912 | |||
| 1887 | Ga0501315_023939 | |||
| 1888 | Ga0501316_010482 | |||
| 1889 | Ga0501316_015341 | |||
| 1890 | Ga0501316_027685 | |||
| 1891 | Ga0501317_003671 | |||
| 1892 | Ga0501317_107874 | |||
| 1893 | Ga0501318_012782 | |||
| 1894 | Ga0501318_024930 | |||
| 1895 | Ga0501319_018821 | |||
| 1896 | Ga0501320_006131 | |||
| 1897 | Ga0501320_025116 | |||
| 1898 | Ga0501321_010647 | |||
| 1899 | Ga0501321_031990 | |||
| 1900 | Ga0501321_035595 | |||
| 1901 | Ga0501322_009380 | |||
| 1902 | Ga0501322_025499 | |||
| 1903 | Ga0501323_004515 | |||
| 1904 | Ga0501323_042372 | |||
| 1905 | Ga0501324_004693 | |||
| 1906 | Ga0501324_012897 | |||
| 1907 | Ga0501324_017532 | |||
| 1908 | Ga0501325_014995 | |||
| 1909 | Ga0501340_015962 | |||
| 1910 | Ga0501031_0003631 | |||
| 1911 | Ga0501031_0012405 | |||
| 1912 | Ga0501032_0143956 | |||
| 1913 | Ga0501032_0584939 | |||
| 1914 | Ga0501033_0162221 | |||
| 1915 | Ga0501033_0760304 | |||
| 1916 | Ga0501033_1021562 | |||
| 1917 | Ga0501036_0033144 | |||
| 1918 | Ga0501036_0101976 | |||
| 1919 | Ga0501036_0534648 | |||
| 1920 | Ga0501036_0708914 | |||
| 1921 | Ga0501037_0121775 | |||
| 1922 | Ga0501037_0177488 | |||
| 1923 | Ga0501037_0801736 | |||
| 1924 | Ga0501038_0003697 | |||
| 1925 | Ga0501038_0361619 | |||
| 1926 | Ga0501039_0002883 | |||
| 1927 | Ga0501039_0633842 | |||
| 1928 | Ga0501040_0004229 | |||
| 1929 | Ga0501040_0551163 | |||
| 1930 | Ga0501041_0003187 | |||
| 1931 | Ga0501041_0847651 | |||
| 1932 | Ga0501042_0002172 | |||
| 1933 | Ga0501042_1059932 | |||
| 1934 | Ga0501043_0055149 | |||
| 1935 | Ga0501043_0076995 | |||
| 1936 | Ga0501043_0164881 | |||
| 1937 | Ga0501046_0027051 | |||
| 1938 | Ga0501046_0048811 | |||
| 1939 | Ga0501047_0003454 | |||
| 1940 | Ga0501047_0099241 | |||
| 1941 | Ga0501048_0000303 | |||
| 1942 | Ga0501048_0003130 | |||
| 1943 | Ga0501067_0165646 | |||
| 1944 | Ga0501067_0274861 | |||
| 1945 | Ga0501067_0565474 | |||
| 1946 | Ga0501068_0007451 | |||
| 1947 | Ga0501068_0470881 | |||
| 1948 | Ga0501069_0021537 | |||
| 1949 | Ga0501069_0950017 | |||
| 1950 | Ga0501070_0047259 | |||
| 1951 | Ga0501070_0968434 | |||
| 1952 | Ga0501071_0001632 | |||
| 1953 | Ga0501071_0499957 | |||
| 1954 | Ga0501072_0004544 | |||
| 1955 | Ga0501072_0601477 | |||
| 1956 | Ga0501073_0223964 | |||
| 1957 | Ga0501074_0003709 | |||
| 1958 | Ga0501074_0012634 | |||
| 1959 | Ga0501075_0008057 | |||
| 1960 | Ga0501075_0363018 | |||
| 1961 | Ga0501075_0472181 | |||
| 1962 | Ga0501075_0634732 | |||
| 1963 | Ga0501075_0828518 | |||
| 1964 | Ga0501076_0005239 | |||
| 1965 | Ga0501077_0000779 | |||
| 1966 | Ga0501079_0004077 | |||
| 1967 | Ga0501080_0372271 | |||
| 1968 | Ga0501080_0389163 | |||
| 1969 | Ga0501080_1837981 | |||
| 1970 | Ga0501081_0003874 | |||
| 1971 | Ga0501083_0470467 | |||
| 1972 | Ga0501083_1153992 | |||
| 1973 | Ga0501035_0023918 | |||
| 1974 | Ga0501035_0111426 | |||
| 1975 | Ga0501035_0688819 | |||
| 1976 | Ga0501035_1287958 | |||
| 1977 | Ga0501044_0070422 | |||
| 1978 | Ga0501044_0206728 | |||
| 1979 | Ga0501045_0000531 | |||
| 1980 | Ga0501045_0697538 | |||
| 1981 | Ga0501045_1161239 | |||
| 1982 | Ga0501045_1175764 | |||
| 1983 | nmdc:mga03683_37209_c1 | |||
| 1984 | nmdc:mga03n38_51079_c1 | |||
| 1985 | nmdc:mga00v17_102257_c1 | |||
| 1986 | nmdc:mga00v17_207838_c1 | |||
| 1987 | nmdc:mga07m45_25616_c1 | |||
| 1988 | nmdc:mga07m45_75049_c1 | |||
| 1989 | nmdc:mga05p37_49276_c1 | |||
| 1990 | nmdc:mga05p37_5454_c1 | |||
| 1991 | nmdc:mga09592_33094_c1 | |||
| 1992 | nmdc:mga09592_633840_c1 | |||
| 1993 | nmdc:mga0qj67_24560_c1 | |||
| 1994 | nmdc:mga06r32_29000_c1 | |||
| 1995 | nmdc:mga08y16_1526332_c1 | |||
| 1996 | nmdc:mga08y16_16077_c1 | |||
| 1997 | nmdc:mga0n895_1032966_c1 | |||
| 1998 | nmdc:mga0n895_123154_c1 | |||
| 1999 | nmdc:mga0n895_2073032_c1 | |||
| 2000 | nmdc:mga0rr50_144385_c1 | |||
| 2001 | nmdc:mga0rr50_1469394_c1 | |||
| 2002 | nmdc:mga0rr50_466705_c1 | |||
| 2003 | nmdc:mga0rr50_673993_c1 | |||
| 2004 | nmdc:mga08x19_821943_c1 | |||
| 2005 | nmdc:mga0a205_66497_c1 | |||
| 2006 | nmdc:mga0a205_8127_c1 | |||
| 2007 | nmdc:mga0sz30_407783_c1 | |||
| 2008 | Ga0495601_0091737 | |||
| 2009 | Ga0495619_0332498 | |||
| 2010 | Ga0495619_0433250 | |||
| 2011 | Ga0495619_0522822 | |||
| 2012 | Ga0495619_0936651 | |||
| 2013 | Ga0500644_0320349 | |||
| 2014 | Ga0500583_0040555 | |||
| 2015 | Ga0500577_0133410 | |||
| 2016 | Ga0500622_0253793 | |||
| 2017 | Ga0501084_0007319 | |||
| 2018 | Ga0501084_0223559 | |||
| 2019 | Ga0590071_007853 | |||
| 2020 | Ga0590071_025696 | |||
| 2021 | Ga0590074_003728 | |||
| 2022 | Ga0590075_001621 | |||
| 2023 | Ga0590077_013179 | |||
| 2024 | Ga0587070_079942 | |||
| 2025 | Ga0587073_0131260 | |||
| 2026 | Ga0587082_052942 | |||
| 2027 | Ga0587083_0017352 | |||
| 2028 | Ga0587083_0072330 | |||
| 2029 | Ga0587085_055821 | |||
| 2030 | Ga0587085_069772 | |||
| 2031 | Ga0587086_041092 | |||
| 2032 | Ga0587088_045917 | |||
| 2033 | Ga0587090_068054 | |||
| 2034 | Ga0587091_070340 | |||
| 2035 | Ga0587092_052260 | |||
| 2036 | Ga0587095_026416 | |||
| 2037 | Ga0587098_028821 | |||
| 2038 | Ga0587098_034655 | |||
| 2039 | Ga0587098_035375 | |||
| 2040 | Ga0587106_060370 | |||
| 2041 | Ga0587125_020354 | |||
| 2042 | Ga0587101_051608 | |||
| 2043 | Ga0587101_072846 | |||
| 2044 | Ga0587113_018654 | |||
| 2045 | Ga0587122_017965 | |||
| 2046 | Ga0587122_021501 | |||
| 2047 | Ga0587128_155290 | |||
| 2048 | Ga0587130_018631 | |||
| 2049 | Ga0587062_042885 | |||
| 2050 | Ga0587062_047886 | |||
| 2051 | Ga0587062_052052 | |||
| 2052 | Ga0587067_037069 | |||
| 2053 | Ga0587067_057243 | |||
| 2054 | Ga0587067_083279 | |||
| 2055 | Ga0587068_063078 | |||
| 2056 | Ga0587069_044056 | |||
| 2057 | Ga0587069_048422 | |||
| 2058 | Ga0587072_095346 | |||
| 2059 | Ga0587076_054659 | |||
| 2060 | Ga0587076_076692 | |||
| 2061 | Ga0587079_076015 | |||
| 2062 | Ga0587110_031279 | |||
| 2063 | Ga0587114_097086 | |||
| 2064 | Ga0587114_144356 | |||
| 2065 | Ga0587071_061297 | |||
| 2066 | Ga0587071_061707 | |||
| 2067 | Ga0587071_083475 | |||
| 2068 | Ga0587111_0105467 | |||
| 2069 | Ga0587111_0116904 | |||
| 2070 | Ga0501082_0006128 | |||
| 2071 | Ga0501082_0916558 | |||
| 2072 | Ga0466962_0000866 | |||
| 2073 | Ga0466962_0037329 | |||
| 2074 | Ga0466962_0055080 | |||
| 2075 | Ga0466962_0722167 | |||
| 2076 | Ga0530510_0000751 | |||
| 2077 | 2558912950 | |||
| 2078 | 2566994032 | |||
| 2079 | 2586063202 | |||
| 2080 | 2643850676 | |||
| 2081 | 2644134430 | |||
| 2082 | 2644611469 | |||
| 2083 | 2738889592 | |||
| 2084 | 2744955776 | |||
| 2085 | 2795784616 | |||
| 2086 | 2795797296 | |||
| 2087 | 2808873541 | |||
| 2088 | 2809587649 | |||
| 2089 | 2812375405 | |||
| 2090 | 2819428135 | |||
| 2091 | 2819668312 | |||
| 2092 | 2819692161 | |||
| 2093 | 2819729902 | |||
| 2094 | 2866614028 | |||
| 2095 | 2870790936 | |||
| 2096 | 2899362936 | |||
| 2097 | 2904539800 | |||
| 2098 | 2915364144 | |||
| 2099 | 2915771213 | |||
| 2100 | 2922560369 | |||
| 2101 | 2974316861 | |||
| 2102 | 2984525044 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8c8z-assembly1.cif.gz_W | cryo-em captures early ribosome assembly in action | 0.9119 | 21 | 82 |
| 8c94-assembly1.cif.gz_W | cryo-em captures early ribosome assembly in action | 0.9099 | 21 | 82 |
| 6ywv-assembly1.cif.gz_R | the structure of the atp25 bound assembly intermediate of the mitoribosome from neurospora crassa | 0.9092 | 21 | 81 |
| 1v8q-assembly1.cif.gz_A | crystal structure of ribosomal protein l27 from thermus thermophilus hb8 | 0.9053 | 21 | 84 |
| 7o9k-assembly1.cif.gz_W | human mitochondrial ribosome large subunit assembly intermediate with mterf4-nsun4, mrm2, mtg1, the malsu module, gtpbp5 and mtef-tu | 0.8832 | 22 | 85 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1v8qA00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9053 | 21 | 84 | 2.40.50.100 |
| 1v8qA00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.8669 | 21 | 84 | 2.40.50.100 |
| af_O59821_2_44_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.8546 | 29 | 65 | 2.40.50.100 |
| af_Q8IBQ2_8_59_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.8261 | 29 | 81 | 2.40.50.100 |
| af_Q95XD0_22_81_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.8183 | 28 | 85 | 2.40.50.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-I0R0V1-F1-model_v4 | Large ribosomal subunit protein bL27 (50S ribosomal protein L27) | 0.9752 | 24 | 82 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-I4M014-F1-model_v4 | Large ribosomal subunit protein bL27 (50S ribosomal protein L27) | 0.9697 | 27 | 83 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A2D7PMC6-F1-model_v4 | Large ribosomal subunit protein bL27 (50S ribosomal protein L27) | 0.9587 | 24 | 84 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-W4UE80-F1-model_v4 | deleted | 0.9586 | 24 | 85 |
|
| AF-I4M014-F1-model_v4 | Large ribosomal subunit protein bL27 (50S ribosomal protein L27) | 0.9533 | 27 | 83 |
GO:0003735
GO:0006412 GO:0022625 |