F486245

General Info

Members Datasets Scaffolds Average Seq Length
938 461 928 84

Family's Representative Sequence

Representative Sequence 3300006038|Ga0075365_10000123|Ga0075365_1000012321
Length 93
Sequence MSKGQLQDPFLNALRKDKVPVSIYLVNGIKLQGLVESFDQFVVLLKNSVSQMVYKHAISTVVPAKNVKLASIDESNDLQSCNATDEELEITNA

Samples

Sample ID Description Type Environment
1 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
2 2734482258 Glomeribacter sp. phylotype 3 Isolate Unclassified
3 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
4 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
5 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
6 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
7 2928163908 Burkholderia sp. 567 Isolate Unclassified
8 2952252522 Salinicola sp. DM10 Isolate Unclassified
9 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
10 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
11 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
12 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
13 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
14 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
15 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
16 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
17 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
42 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
43 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
46 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
53 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
54 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
60 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
61 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
62 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
76 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
80 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
81 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
82 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
83 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
84 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
85 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
86 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
87 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
88 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
89 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
90 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
91 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
93 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
94 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
95 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
96 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
97 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
98 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
99 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
100 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
101 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
103 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
104 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
105 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
106 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
107 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
109 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
110 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
112 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
113 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
114 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
115 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
116 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
117 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
118 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
119 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
120 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
121 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
122 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
123 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
124 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
125 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
126 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
127 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
128 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
129 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
130 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
131 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
132 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
133 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
134 3300019166 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 3300019176 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
136 3300019177 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
137 3300019181 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
138 3300019183 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
139 3300019188 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
140 3300019190 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
141 3300019192 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
142 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
143 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
144 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
145 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
146 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
147 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
148 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
149 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
150 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
152 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
153 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
154 3300023552 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
155 3300023672 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
156 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
157 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
158 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
219 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
222 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
224 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
225 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
226 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
227 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
228 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
232 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
233 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
234 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
235 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
236 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
237 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
238 3300030762 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
239 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300030836 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 3300030877 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
243 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
244 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300030880 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
246 3300030882 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
247 3300030886 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
248 3300030888 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
249 3300030889 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300030963 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
251 3300031010 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
252 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
253 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
254 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
255 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
256 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
257 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
258 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
259 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
260 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
261 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
262 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
263 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
264 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
265 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
266 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
267 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
268 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
269 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
270 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
271 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
272 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
273 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
274 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
275 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
276 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
277 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
278 3300031814 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
279 3300031816 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Unclassified
280 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
281 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
282 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
283 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
284 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
285 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
286 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
287 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
288 3300032120 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
289 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
290 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
291 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
292 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
293 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
294 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
295 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
296 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
297 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
298 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
299 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
300 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
301 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
302 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
303 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
304 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
305 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
306 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
307 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
308 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
309 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
310 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
311 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
312 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
313 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
314 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
315 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
316 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
317 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
318 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
319 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
320 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
321 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
322 3300041916 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run Metatranscriptome Unclassified
323 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
324 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
325 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
326 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
327 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
328 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
329 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
330 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
331 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
332 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
333 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
334 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
335 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
336 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
337 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
338 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
339 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
340 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
341 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
342 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
343 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
344 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
345 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
346 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
347 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
348 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
349 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
350 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
351 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
352 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
353 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
354 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
355 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
356 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
357 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
358 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
359 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
360 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
361 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
362 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
363 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
364 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
365 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
366 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
367 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
368 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
369 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
370 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
371 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
372 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
373 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
374 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
375 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
376 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
377 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
378 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
379 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
380 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
381 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
382 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
383 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
384 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
385 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
386 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
387 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
388 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
389 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
390 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
391 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
392 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
393 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
394 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
395 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
396 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
397 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
398 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
399 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
400 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
401 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
402 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
403 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
404 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
405 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
406 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
407 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
408 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
409 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
410 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
411 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
412 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
413 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
414 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
415 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
416 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
417 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
418 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
419 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
420 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
421 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
422 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
423 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
424 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
425 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
426 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
427 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
428 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
429 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
430 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
431 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
432 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
433 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
434 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
435 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
436 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
437 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
438 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
439 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
440 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
441 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
442 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
443 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
444 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
445 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
446 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
447 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
448 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
449 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
450 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
451 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
452 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
453 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
454 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
455 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
456 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
457 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
458 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
459 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
460 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
461 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.95
Metatranscriptomes 10.98
Isolates 1.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.24
Nodule 0.11
Rhizoplane 1.81
Rhizosphere 91.68
Stem 0
Stem Tuber 0
Unclassified 4.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1012025 3300000546 Bacteria 921
2 JGI25150J39212_1003589 3300002774 Bacteria 3614
3 JGI25151J46595_10043569 3300003187 Bacteria 1604
4 Ga0058863_11949113 3300004799 Bacteria 882
5 Ga0058861_12065226 3300004800 Bacteria 757
6 Ga0065704_10010159 3300005289 Bacteria 1837
7 Ga0065712_10326864 3300005290 Bacteria 820
8 Ga0065707_10728472 3300005295 Bacteria 627
9 Ga0070658_10405905 3300005327 Bacteria 1171
10 Ga0070676_10628618 3300005328 Bacteria 777
11 Ga0070676_10692443 3300005328 Bacteria 743
12 Ga0070676_11373448 3300005328 Bacteria 541
13 Ga0070683_101041747 3300005329 Bacteria 786
14 Ga0070683_101809044 3300005329 Bacteria 587
15 Ga0070683_101836071 3300005329 Bacteria 582
16 Ga0070670_100007886 3300005331 Bacteria 9056
17 Ga0070670_101575436 3300005331 Bacteria 604
18 Ga0068869_100104307 3300005334 Bacteria 2149
19 Ga0068869_101434245 3300005334 Bacteria 612
20 Ga0068869_101477263 3300005334 Bacteria 603
21 Ga0070666_10013838 3300005335 Bacteria 5127
22 Ga0070666_10268853 3300005335 Bacteria 1210
23 Ga0070666_11239743 3300005335 Bacteria 556
24 Ga0070680_100049273 3300005336 Bacteria 3433
25 Ga0070680_100068715 3300005336 Bacteria 2908
26 Ga0070680_100069721 3300005336 Bacteria 2887
27 Ga0070682_100134969 3300005337 Bacteria 1675
28 Ga0068868_100018297 3300005338 Bacteria 5235
29 Ga0068868_100032185 3300005338 Bacteria 4033
30 Ga0070689_100820682 3300005340 Bacteria 819
31 Ga0070689_102237712 3300005340 Bacteria 501
32 Ga0070687_101274618 3300005343 Bacteria 545
33 Ga0070692_11349642 3300005345 Bacteria 513
34 Ga0070669_100160143 3300005353 Bacteria 1748
35 Ga0070669_100566157 3300005353 Bacteria 949
36 Ga0070669_100844812 3300005353 Bacteria 780
37 Ga0070669_100919071 3300005353 Bacteria 748
38 Ga0070675_100074763 3300005354 Bacteria 2815
39 Ga0070675_100819619 3300005354 Bacteria 851
40 Ga0070675_101794310 3300005354 Bacteria 566
41 Ga0070671_100015878 3300005355 Bacteria 6082
42 Ga0070671_100018983 3300005355 Bacteria 5591
43 Ga0070674_100283647 3300005356 Bacteria 1314
44 Ga0070674_100896987 3300005356 Bacteria 772
45 Ga0070673_100121783 3300005364 Bacteria 2177
46 Ga0070673_101096215 3300005364 Bacteria 744
47 Ga0070673_101449785 3300005364 Bacteria 647
48 Ga0070688_100857655 3300005365 Bacteria 714
49 Ga0070659_100436156 3300005366 Bacteria 1109
50 Ga0070659_101398060 3300005366 Bacteria 622
51 Ga0070667_100000046 3300005367 Bacteria 162942
52 Ga0070667_100004160 3300005367 Bacteria 12231
53 Ga0070667_100038957 3300005367 Bacteria 3985
54 Ga0070709_10053834 3300005434 Bacteria 2535
55 Ga0070709_10264091 3300005434 Bacteria 1245
56 Ga0070714_100008875 3300005435 Bacteria 7864
57 Ga0070714_100103127 3300005435 Bacteria 2516
58 Ga0070714_100160828 3300005435 Bacteria 2032
59 Ga0070713_100002296 3300005436 Bacteria 12440
60 Ga0070713_100022771 3300005436 Bacteria 4847
61 Ga0070713_100263809 3300005436 Bacteria 1575
62 Ga0070713_101066172 3300005436 Bacteria 780
63 Ga0070710_10010095 3300005437 Bacteria 4633
64 Ga0070710_10354064 3300005437 Bacteria 972
65 Ga0070710_10598765 3300005437 Bacteria 767
66 Ga0070710_11115080 3300005437 Bacteria 580
67 Ga0070711_100001034 3300005439 Bacteria 14805
68 Ga0070711_100008013 3300005439 Bacteria 6448
69 Ga0070705_100182697 3300005440 Bacteria 1422
70 Ga0070705_100316720 3300005440 Bacteria 1124
71 Ga0070700_100023816 3300005441 Bacteria 3586
72 Ga0070700_101026947 3300005441 Bacteria 679
73 Ga0070694_100325892 3300005444 Bacteria 1183
74 Ga0070694_100467465 3300005444 Bacteria 999
75 Ga0070708_100108966 3300005445 Bacteria 2544
76 Ga0070663_100426932 3300005455 Bacteria 1088
77 Ga0070663_101054531 3300005455 Bacteria 709
78 Ga0070678_100175756 3300005456 Bacteria 1748
79 Ga0070678_100991635 3300005456 Bacteria 772
80 Ga0070678_101671105 3300005456 Bacteria 599
81 Ga0070662_100876270 3300005457 Bacteria 765
82 Ga0070681_10012472 3300005458 Bacteria 8432
83 Ga0070681_10013550 3300005458 Bacteria 8109
84 Ga0070681_10063063 3300005458 Bacteria 3679
85 Ga0070681_10694133 3300005458 Bacteria 933
86 Ga0070681_11055348 3300005458 Bacteria 733
87 Ga0070681_12019274 3300005458 Bacteria 505
88 Ga0068867_100002191 3300005459 Bacteria 13716
89 Ga0068867_100091261 3300005459 Bacteria 2312
90 Ga0068867_100356763 3300005459 Bacteria 1222
91 Ga0070706_100020554 3300005467 Bacteria 6084
92 Ga0070706_101358474 3300005467 Bacteria 651
93 Ga0070707_100014717 3300005468 Bacteria 7333
94 Ga0070699_100410948 3300005518 Bacteria 1224
95 Ga0070679_100001170 3300005530 Bacteria 22959
96 Ga0070679_100038227 3300005530 Bacteria 4771
97 Ga0070679_100512099 3300005530 Bacteria 1144
98 Ga0070679_102069949 3300005530 Bacteria 518
99 Ga0070679_102132180 3300005530 Bacteria 510
100 Ga0070697_101101118 3300005536 Bacteria 707
101 Ga0068853_100019298 3300005539 Bacteria 5652
102 Ga0068853_100062295 3300005539 Bacteria 3227
103 Ga0068853_101516803 3300005539 Bacteria 649
104 Ga0070672_101287315 3300005543 Bacteria 652
105 Ga0070686_101709399 3300005544 Bacteria 534
106 Ga0070695_100023651 3300005545 Bacteria 3780
107 Ga0070695_100126445 3300005545 Bacteria 1756
108 Ga0070696_100344676 3300005546 Bacteria 1152
109 Ga0070693_100192663 3300005547 Bacteria 1319
110 Ga0070693_100494731 3300005547 Bacteria 866
111 Ga0070665_100000420 3300005548 Bacteria 62000
112 Ga0070665_100022414 3300005548 Bacteria 6355
113 Ga0070665_100239429 3300005548 Bacteria 1815
114 Ga0070665_100342301 3300005548 Bacteria 1500
115 Ga0070665_100713597 3300005548 Bacteria 1016
116 Ga0070704_100473864 3300005549 Bacteria 1082
117 Ga0070704_100511689 3300005549 Bacteria 1043
118 Ga0070704_100867542 3300005549 Bacteria 810
119 Ga0068855_100005297 3300005563 Bacteria 15751
120 Ga0068855_100006825 3300005563 Bacteria 13851
121 Ga0068855_100032463 3300005563 Bacteria 6234
122 Ga0068855_100258645 3300005563 Bacteria 1940
123 Ga0068855_101211058 3300005563 Bacteria 785
124 Ga0070664_101807266 3300005564 Bacteria 580
125 Ga0068857_100125984 3300005577 Bacteria 2308
126 Ga0068854_100048603 3300005578 Bacteria 3027
127 Ga0068854_100904691 3300005578 Bacteria 776
128 Ga0068854_101103810 3300005578 Bacteria 707
129 Ga0068854_101242774 3300005578 Bacteria 669
130 Ga0068856_100005786 3300005614 Bacteria 12183
131 Ga0068856_100217082 3300005614 Bacteria 1928
132 Ga0068856_100274337 3300005614 Bacteria 1702
133 Ga0068856_101672083 3300005614 Bacteria 649
134 Ga0068852_100573487 3300005616 Bacteria 1131
135 Ga0068852_101178901 3300005616 Bacteria 787
136 Ga0068859_100040454 3300005617 Bacteria 4679
137 Ga0068859_100041725 3300005617 Bacteria 4609
138 Ga0068859_100249892 3300005617 Bacteria 1864
139 Ga0068859_100851133 3300005617 Bacteria 998
140 Ga0068859_101250012 3300005617 Bacteria 818
141 Ga0068859_101470346 3300005617 Bacteria 752
142 Ga0068864_100374585 3300005618 Bacteria 1348
143 Ga0068864_100462411 3300005618 Bacteria 1215
144 Ga0068864_100613100 3300005618 Bacteria 1057
145 Ga0068866_10002926 3300005718 Bacteria 7042
146 Ga0068866_10102612 3300005718 Bacteria 1581
147 Ga0068866_10408965 3300005718 Bacteria 877
148 Ga0068861_100512000 3300005719 Bacteria 1087
149 Ga0068851_10294574 3300005834 Bacteria 931
150 Ga0068870_10211360 3300005840 Bacteria 1182
151 Ga0068863_100115613 3300005841 Bacteria 2556
152 Ga0068863_100150149 3300005841 Bacteria 2229
153 Ga0068863_100391573 3300005841 Bacteria 1358
154 Ga0068863_100818969 3300005841 Bacteria 929
155 Ga0068863_101724470 3300005841 Bacteria 636
156 Ga0068858_100019950 3300005842 Bacteria 6267
157 Ga0068858_101262095 3300005842 Bacteria 727
158 Ga0068860_100009171 3300005843 Bacteria 9835
159 Ga0068860_100036507 3300005843 Bacteria 4708
160 Ga0068860_100746585 3300005843 Bacteria 990
161 Ga0068860_102653695 3300005843 Bacteria 520
162 Ga0068862_100656714 3300005844 Bacteria 1012
163 Ga0068862_100764424 3300005844 Bacteria 941
164 Ga0070717_10009383 3300006028 Bacteria 7349
165 Ga0070717_10410798 3300006028 Bacteria 1217
166 Ga0075365_10000123 3300006038 Bacteria 23459
167 Ga0075368_10058206 3300006042 Bacteria 1544
168 Ga0075364_10000745 3300006051 Bacteria 17081
169 Ga0075364_10070422 3300006051 Bacteria 2302
170 Ga0070715_10000114 3300006163 Bacteria 19381
171 Ga0070715_10187865 3300006163 Bacteria 1041
172 Ga0070715_10282225 3300006163 Bacteria 881
173 Ga0070716_100015835 3300006173 Bacteria 3884
174 Ga0070716_100018080 3300006173 Bacteria 3667
175 Ga0070716_100090958 3300006173 Bacteria 1847
176 Ga0070716_100097671 3300006173 Bacteria 1793
177 Ga0070712_100001088 3300006175 Bacteria 16369
178 Ga0070712_100032180 3300006175 Bacteria 3539
179 Ga0070712_100162831 3300006175 Bacteria 1724
180 Ga0070712_100407717 3300006175 Bacteria 1124
181 Ga0075362_10619577 3300006177 Unclassified 560
182 Ga0075367_10000270 3300006178 Bacteria 17924
183 Ga0075369_10000133 3300006186 Bacteria 20639
184 Ga0097621_100045269 3300006237 Bacteria 3553
185 Ga0097621_100050132 3300006237 Bacteria 3394
186 Ga0097621_100380210 3300006237 Bacteria 1261
187 Ga0097621_100534101 3300006237 Bacteria 1066
188 Ga0097621_100821922 3300006237 Bacteria 862
189 Ga0068871_100019101 3300006358 Bacteria 5227
190 Ga0068871_100099687 3300006358 Bacteria 2432
191 Ga0075428_100006700 3300006844 Bacteria 12814
192 Ga0075430_100107480 3300006846 Bacteria 2327
193 Ga0075431_100126085 3300006847 Bacteria 2641
194 Ga0075431_100919261 3300006847 Bacteria 844
195 Ga0075433_10000312 3300006852 Bacteria 29496
196 Ga0075434_100000027 3300006871 Bacteria 66092
197 Ga0075434_100033428 3300006871 Bacteria 5076
198 Ga0075434_101218375 3300006871 Bacteria 764
199 Ga0075429_100004834 3300006880 Bacteria 11608
200 Ga0068865_100003798 3300006881 Bacteria 9068
201 Ga0068865_100051478 3300006881 Bacteria 2851
202 Ga0068865_100205301 3300006881 Bacteria 1532
203 Ga0068865_100321700 3300006881 Bacteria 1244
204 Ga0075436_100509366 3300006914 Bacteria 881
205 Ga0075436_100512741 3300006914 Bacteria 878
206 Ga0075436_100708208 3300006914 Bacteria 746
207 Ga0097620_100040454 3300006931 Bacteria 4679
208 Ga0097620_100041725 3300006931 Bacteria 4609
209 Ga0097620_100249886 3300006931 Bacteria 1864
210 Ga0097620_100851044 3300006931 Bacteria 998
211 Ga0097620_101250205 3300006931 Bacteria 818
212 Ga0097620_101470263 3300006931 Bacteria 752
213 Ga0075435_100089709 3300007076 Bacteria 2535
214 Ga0075435_100102338 3300007076 Bacteria 2374
215 Ga0075435_100435432 3300007076 Bacteria 1130
216 Ga0099794_10077367 3300007265 Bacteria 1637
217 Ga0099794_10145581 3300007265 Bacteria 1201
218 Ga0099795_10000007 3300007788 Bacteria 103906
219 Ga0099795_10020640 3300007788 Bacteria 2149
220 Ga0105250_10030267 3300009092 Bacteria 2177
221 Ga0105240_10009095 3300009093 Bacteria 14103
222 Ga0105240_10010581 3300009093 Bacteria 12960
223 Ga0105240_10023126 3300009093 Bacteria 8229
224 Ga0105240_10064123 3300009093 Bacteria 4566
225 Ga0105240_10077531 3300009093 Bacteria 4094
226 Ga0105240_10985979 3300009093 Bacteria 902
227 Ga0111539_10006985 3300009094 Bacteria 14481
228 Ga0111539_10193409 3300009094 Bacteria 2373
229 Ga0105245_10077868 3300009098 Bacteria 3024
230 Ga0105247_10100837 3300009101 Bacteria 1845
231 Ga0105247_10118162 3300009101 Bacteria 1715
232 Ga0105247_10202276 3300009101 Bacteria 1335
233 Ga0114129_10240458 3300009147 Bacteria 2434
234 Ga0105241_10330138 3300009174 Bacteria 1318
235 Ga0105241_11940537 3300009174 Bacteria 578
236 Ga0105242_10012052 3300009176 Bacteria 6654
237 Ga0105242_10079411 3300009176 Bacteria 2740
238 Ga0105242_10250626 3300009176 Bacteria 1595
239 Ga0105248_10149045 3300009177 Bacteria 2640
240 Ga0105248_10152340 3300009177 Bacteria 2609
241 Ga0105248_11508008 3300009177 Bacteria 761
242 Ga0105237_10114154 3300009545 Bacteria 2694
243 Ga0105237_10147148 3300009545 Bacteria 2351
244 Ga0105237_10473642 3300009545 Bacteria 1258
245 Ga0105237_10744897 3300009545 Bacteria 986
246 Ga0105237_11942984 3300009545 Bacteria 597
247 Ga0105237_11981725 3300009545 Bacteria 591
248 Ga0105238_10003358 3300009551 Bacteria 15967
249 Ga0105238_10190175 3300009551 Bacteria 2029
250 Ga0105238_10343773 3300009551 Bacteria 1480
251 Ga0105238_10897787 3300009551 Bacteria 904
252 Ga0105238_10981007 3300009551 Bacteria 865
253 Ga0105249_10216856 3300009553 Bacteria 1881
254 Ga0105249_10432225 3300009553 Bacteria 1352
255 Ga0105249_11301663 3300009553 Bacteria 798
256 Ga0105249_13428472 3300009553 Bacteria 510
257 Ga0105030_100115 3300009987 Bacteria 6208
258 Ga0099796_10000033 3300010159 Bacteria 31267
259 Ga0099796_10001828 3300010159 Bacteria 4473
260 Ga0099796_10010448 3300010159 Bacteria 2553
261 Ga0105239_10654436 3300010375 Bacteria 1200
262 Ga0105239_12095766 3300010375 Bacteria 657
263 Ga0157373_10578476 3300013100 Bacteria 816
264 Ga0157373_10722918 3300013100 Bacteria 731
265 Ga0157371_10157817 3300013102 Bacteria 1620
266 Ga0157370_10011541 3300013104 Bacteria 9225
267 Ga0157370_10096369 3300013104 Bacteria 2776
268 Ga0157370_10484692 3300013104 Bacteria 1136
269 Ga0157369_10039660 3300013105 Bacteria 5146
270 Ga0157369_10097953 3300013105 Bacteria 3128
271 Ga0157369_11374442 3300013105 Bacteria 719
272 Ga0157374_10011021 3300013296 Bacteria 7806
273 Ga0157378_10021389 3300013297 Bacteria 5688
274 Ga0157378_12707541 3300013297 Bacteria 548
275 Ga0163162_10037655 3300013306 Bacteria 4828
276 Ga0157372_10162230 3300013307 Bacteria 2584
277 Ga0157372_11015739 3300013307 Bacteria 960
278 Ga0157372_11511617 3300013307 Bacteria 773
279 Ga0157372_12316301 3300013307 Bacteria 617
280 Ga0157375_10014209 3300013308 Bacteria 7097
281 Ga0163163_10006099 3300014325 Bacteria 10496
282 Ga0163163_10122312 3300014325 Bacteria 2637
283 Ga0163163_10176521 3300014325 Bacteria 2183
284 Ga0163163_10422158 3300014325 Bacteria 1392
285 Ga0157380_10007838 3300014326 Bacteria 7602
286 Ga0157380_10102109 3300014326 Bacteria 2391
287 Ga0157380_11718502 3300014326 Bacteria 685
288 Ga0157377_10196529 3300014745 Bacteria 1278
289 Ga0157377_10349101 3300014745 Bacteria 992
290 Ga0157379_10010154 3300014968 Bacteria 8206
291 Ga0157379_10048326 3300014968 Bacteria 3797
292 Ga0157376_10050407 3300014969 Bacteria 3454
293 Ga0184595_111233 3300019166 Bacteria 822
294 Ga0184595_115396 3300019166 Bacteria 839
295 Ga0184596_108580 3300019176 Bacteria 733
296 Ga0184592_112061 3300019177 Bacteria 756
297 Ga0184594_102903 3300019181 Bacteria 537
298 Ga0184594_106280 3300019181 Bacteria 536
299 Ga0184601_141254 3300019183 Bacteria 662
300 Ga0184599_104977 3300019188 Bacteria 603
301 Ga0184600_102423 3300019190 Bacteria 611
302 Ga0184603_130163 3300019192 Bacteria 515
303 Ga0197907_10405711 3300020069 Bacteria 937
304 Ga0197907_10442029 3300020069 Bacteria 552
305 Ga0206349_1423094 3300020075 Bacteria 685
306 Ga0206355_1527855 3300020076 Bacteria 742
307 Ga0206351_10505028 3300020077 Bacteria 582
308 Ga0206351_10986797 3300020077 Bacteria 710
309 Ga0206352_10417728 3300020078 Bacteria 505
310 Ga0206352_10989618 3300020078 Bacteria 528
311 Ga0206350_10072159 3300020080 Bacteria 669
312 Ga0206350_11527223 3300020080 Bacteria 616
313 Ga0206354_10471473 3300020081 Bacteria 910
314 Ga0206354_11309011 3300020081 Bacteria 692
315 Ga0206353_10649310 3300020082 Bacteria 1111
316 Ga0206353_10906586 3300020082 Bacteria 613
317 Ga0154015_1114833 3300020610 Bacteria 505
318 Ga0154015_1228595 3300020610 Bacteria 517
319 Ga0154015_1535633 3300020610 Bacteria 599
320 Ga0213874_10010595 3300021377 Bacteria 2311
321 Ga0213871_10003766 3300021441 Bacteria 2965
322 Ga0224712_10295700 3300022467 Bacteria 756
323 Ga0224712_10317742 3300022467 Bacteria 731
324 Ga0224712_10351264 3300022467 Bacteria 697
325 Ga0247551_102277 3300023552 Bacteria 695
326 Ga0247553_112138 3300023672 Bacteria 507
327 Ga0224572_1020614 3300024225 Bacteria 1266
328 Ga0209025_1000003 3300025294 Bacteria 1366495
329 Ga0207656_10196151 3300025321 Bacteria 974
330 Ga0207696_1054385 3300025711 Bacteria 1138
331 Ga0207653_10072720 3300025885 Bacteria 1178
332 Ga0207692_10006619 3300025898 Bacteria 4708
333 Ga0207692_10904545 3300025898 Bacteria 581
334 Ga0207642_10009077 3300025899 Bacteria 3443
335 Ga0207642_10637313 3300025899 Bacteria 667
336 Ga0207710_10003821 3300025900 Bacteria 6652
337 Ga0207710_10068075 3300025900 Bacteria 1627
338 Ga0207680_10022402 3300025903 Bacteria 3435
339 Ga0207680_10051955 3300025903 Bacteria 2453
340 Ga0207680_10208797 3300025903 Bacteria 1334
341 Ga0207685_10044484 3300025905 Bacteria 1679
342 Ga0207685_10202116 3300025905 Bacteria 934
343 Ga0207699_10008031 3300025906 Bacteria 5185
344 Ga0207699_10099195 3300025906 Bacteria 1844
345 Ga0207645_10000348 3300025907 Bacteria 38649
346 Ga0207645_10522636 3300025907 Bacteria 804
347 Ga0207643_10246781 3300025908 Bacteria 1099
348 Ga0207705_10597061 3300025909 Bacteria 858
349 Ga0207684_10322850 3300025910 Bacteria 1330
350 Ga0207684_11179288 3300025910 Bacteria 635
351 Ga0207654_10484983 3300025911 Bacteria 871
352 Ga0207654_10874813 3300025911 Bacteria 651
353 Ga0207707_10000202 3300025912 Bacteria 63576
354 Ga0207707_10014584 3300025912 Bacteria 6846
355 Ga0207707_10024220 3300025912 Bacteria 5311
356 Ga0207707_10049339 3300025912 Bacteria 3667
357 Ga0207707_10998299 3300025912 Bacteria 687
358 Ga0207695_10010951 3300025913 Bacteria 11029
359 Ga0207695_10079448 3300025913 Bacteria 3325
360 Ga0207695_10148579 3300025913 Bacteria 2284
361 Ga0207695_10186441 3300025913 Bacteria 1993
362 Ga0207695_10300720 3300025913 Bacteria 1496
363 Ga0207695_11092592 3300025913 Bacteria 677
364 Ga0207671_10059420 3300025914 Bacteria 2835
365 Ga0207671_10131595 3300025914 Bacteria 1920
366 Ga0207671_10405741 3300025914 Bacteria 1084
367 Ga0207671_10722301 3300025914 Bacteria 792
368 Ga0207671_11460347 3300025914 Bacteria 529
369 Ga0207693_10000216 3300025915 Bacteria 53067
370 Ga0207693_10149640 3300025915 Bacteria 1836
371 Ga0207693_10354350 3300025915 Bacteria 1148
372 Ga0207663_10001899 3300025916 Bacteria 9881
373 Ga0207663_10020373 3300025916 Bacteria 3754
374 Ga0207663_11158201 3300025916 Bacteria 622
375 Ga0207660_10001921 3300025917 Bacteria 13857
376 Ga0207660_10245840 3300025917 Bacteria 1411
377 Ga0207657_10077276 3300025919 Bacteria 2806
378 Ga0207657_10318477 3300025919 Bacteria 1230
379 Ga0207652_10002554 3300025921 Bacteria 15274
380 Ga0207652_10031203 3300025921 Bacteria 4473
381 Ga0207652_11849962 3300025921 Bacteria 509
382 Ga0207646_10087813 3300025922 Bacteria 2782
383 Ga0207681_10388533 3300025923 Bacteria 1125
384 Ga0207681_10665723 3300025923 Bacteria 864
385 Ga0207681_10820437 3300025923 Bacteria 777
386 Ga0207681_10895643 3300025923 Bacteria 743
387 Ga0207694_10001276 3300025924 Bacteria 21700
388 Ga0207694_10184119 3300025924 Bacteria 1695
389 Ga0207694_10960856 3300025924 Bacteria 723
390 Ga0207694_11153545 3300025924 Bacteria 656
391 Ga0207650_10860774 3300025925 Bacteria 769
392 Ga0207659_10717300 3300025926 Bacteria 857
393 Ga0207659_10735132 3300025926 Bacteria 846
394 Ga0207659_10910438 3300025926 Bacteria 756
395 Ga0207687_10007462 3300025927 Bacteria 7199
396 Ga0207687_10008944 3300025927 Bacteria 6547
397 Ga0207700_10062255 3300025928 Bacteria 2833
398 Ga0207700_10288652 3300025928 Bacteria 1413
399 Ga0207700_11554874 3300025928 Bacteria 586
400 Ga0207664_10046950 3300025929 Bacteria 3391
401 Ga0207664_10383889 3300025929 Bacteria 1247
402 Ga0207644_10045386 3300025931 Bacteria 3126
403 Ga0207644_10838239 3300025931 Bacteria 770
404 Ga0207644_11409299 3300025931 Bacteria 585
405 Ga0207690_10977755 3300025932 Bacteria 704
406 Ga0207706_10193601 3300025933 Bacteria 1784
407 Ga0207706_10757415 3300025933 Bacteria 827
408 Ga0207686_10015664 3300025934 Bacteria 4243
409 Ga0207686_10428730 3300025934 Bacteria 1013
410 Ga0207686_11060713 3300025934 Bacteria 659
411 Ga0207686_11818198 3300025934 Bacteria 504
412 Ga0207669_10008128 3300025937 Bacteria 4908
413 Ga0207669_10698626 3300025937 Bacteria 833
414 Ga0207704_10025385 3300025938 Bacteria 3232
415 Ga0207704_10164081 3300025938 Bacteria 1584
416 Ga0207704_10174804 3300025938 Bacteria 1545
417 Ga0207665_10025478 3300025939 Bacteria 3903
418 Ga0207665_10032084 3300025939 Bacteria 3477
419 Ga0207665_10125025 3300025939 Bacteria 1820
420 Ga0207665_10313879 3300025939 Bacteria 1175
421 Ga0207691_10404384 3300025940 Bacteria 1164
422 Ga0207711_10024852 3300025941 Bacteria 5026
423 Ga0207711_10044292 3300025941 Bacteria 3798
424 Ga0207711_10486760 3300025941 Bacteria 1149
425 Ga0207689_10291810 3300025942 Bacteria 1351
426 Ga0207689_11571841 3300025942 Bacteria 548
427 Ga0207667_10005725 3300025949 Bacteria 15157
428 Ga0207667_10016648 3300025949 Bacteria 8299
429 Ga0207667_10108588 3300025949 Bacteria 2862
430 Ga0207667_10203259 3300025949 Bacteria 2032
431 Ga0207667_10222004 3300025949 Bacteria 1936
432 Ga0207667_11222646 3300025949 Bacteria 730
433 Ga0207651_10097285 3300025960 Bacteria 2173
434 Ga0207651_10620583 3300025960 Bacteria 947
435 Ga0207651_11341447 3300025960 Bacteria 643
436 Ga0207712_10039914 3300025961 Bacteria 3218
437 Ga0207712_10121945 3300025961 Bacteria 1973
438 Ga0207712_10177423 3300025961 Bacteria 1670
439 Ga0207712_11935549 3300025961 Bacteria 528
440 Ga0207640_11164260 3300025981 Bacteria 684
441 Ga0207658_10001515 3300025986 Bacteria 18034
442 Ga0207658_10008826 3300025986 Bacteria 6841
443 Ga0207658_10049346 3300025986 Bacteria 3092
444 Ga0207658_10082320 3300025986 Bacteria 2471
445 Ga0207658_12061416 3300025986 Bacteria 519
446 Ga0207677_10015325 3300026023 Bacteria 4504
447 Ga0207677_10029488 3300026023 Bacteria 3487
448 Ga0207703_10030489 3300026035 Bacteria 4263
449 Ga0207703_10279009 3300026035 Bacteria 1517
450 Ga0207703_10902227 3300026035 Bacteria 846
451 Ga0207703_11427913 3300026035 Bacteria 666
452 Ga0207703_12147007 3300026035 Bacteria 535
453 Ga0207639_10051978 3300026041 Bacteria 3119
454 Ga0207639_10240488 3300026041 Bacteria 1573
455 Ga0207678_10559948 3300026067 Bacteria 1000
456 Ga0207708_10964897 3300026075 Bacteria 740
457 Ga0207702_10029702 3300026078 Bacteria 4550
458 Ga0207702_10059820 3300026078 Bacteria 3246
459 Ga0207702_10374624 3300026078 Bacteria 1368
460 Ga0207641_10044038 3300026088 Bacteria 3751
461 Ga0207641_10069596 3300026088 Bacteria 3022
462 Ga0207641_11170754 3300026088 Bacteria 768
463 Ga0207648_10004874 3300026089 Bacteria 13685
464 Ga0207648_10128023 3300026089 Bacteria 2234
465 Ga0207648_10527718 3300026089 Bacteria 1082
466 Ga0207676_10008857 3300026095 Bacteria 7161
467 Ga0207676_10324632 3300026095 Bacteria 1414
468 Ga0207676_10535210 3300026095 Bacteria 1117
469 Ga0207674_10152939 3300026116 Bacteria 2264
470 Ga0207674_10293165 3300026116 Bacteria 1575
471 Ga0207674_10930031 3300026116 Bacteria 838
472 Ga0207675_100140996 3300026118 Bacteria 2290
473 Ga0207675_100820984 3300026118 Bacteria 944
474 Ga0207675_100931080 3300026118 Bacteria 886
475 Ga0207675_101598953 3300026118 Bacteria 672
476 Ga0207683_10004156 3300026121 Bacteria 12534
477 Ga0207683_10512380 3300026121 Bacteria 1108
478 Ga0207683_10538789 3300026121 Bacteria 1079
479 Ga0207698_11139805 3300026142 Bacteria 793
480 Ga0209179_1000074 3300027512 Bacteria 16239
481 Ga0209179_1001253 3300027512 Bacteria 3039
482 Ga0209968_1036269 3300027526 Bacteria 834
483 Ga0209999_1049771 3300027543 Bacteria 791
484 Ga0210002_1009907 3300027617 Bacteria 1457
485 Ga0209971_1020840 3300027682 Bacteria 1559
486 Ga0209813_10051262 3300027866 Bacteria 1290
487 Ga0209974_10224265 3300027876 Bacteria 701
488 Ga0207428_10002854 3300027907 Bacteria 17138
489 Ga0207428_10027919 3300027907 Bacteria 4694
490 Ga0207428_10103630 3300027907 Bacteria 2196
491 Ga0265354_1001940 3300028016 Bacteria 2742
492 Ga0265356_1042562 3300028017 Bacteria 501
493 Ga0265357_1005632 3300028023 Bacteria 1163
494 Ga0265355_1000217 3300028036 Bacteria 2610
495 Ga0268266_10000115 3300028379 Bacteria 164223
496 Ga0268266_10001499 3300028379 Bacteria 27597
497 Ga0268266_10098841 3300028379 Bacteria 2568
498 Ga0268266_10151887 3300028379 Bacteria 2088
499 Ga0268265_10660502 3300028380 Bacteria 1006
500 Ga0268264_10024968 3300028381 Bacteria 4884
501 Ga0268264_10678760 3300028381 Bacteria 1022
502 Ga0265326_10018777 3300028558 Bacteria 1988
503 Ga0265319_1021224 3300028563 Bacteria 2389
504 Ga0265334_10002111 3300028573 Bacteria 9393
505 Ga0265318_10004693 3300028577 Bacteria 6557
506 Ga0307515_10012124 3300028794 Bacteria 16257
507 Ga0307515_10186257 3300028794 Bacteria 2004
508 Ga0307515_10425173 3300028794 Bacteria 948
509 Ga0265338_10011547 3300028800 Bacteria 10185
510 Ga0265338_10072991 3300028800 Bacteria 2927
511 Ga0265338_10981117 3300028800 Bacteria 572
512 Ga0265762_1015920 3300030760 Bacteria 1362
513 Ga0265762_1028726 3300030760 Bacteria 1048
514 Ga0265762_1041940 3300030760 Bacteria 898
515 Ga0265775_106920 3300030762 Bacteria 673
516 Ga0265775_108790 3300030762 Bacteria 618
517 Ga0265763_1001528 3300030763 Bacteria 1665
518 Ga0265763_1009000 3300030763 Bacteria 901
519 Ga0265763_1054121 3300030763 Bacteria 511
520 Ga0265767_102081 3300030836 Bacteria 1043
521 Ga0265766_1003039 3300030863 Bacteria 960
522 Ga0265766_1015288 3300030863 Bacteria 591
523 Ga0265766_1025514 3300030863 Bacteria 507
524 Ga0265777_109944 3300030877 Bacteria 692
525 Ga0265777_121609 3300030877 Bacteria 535
526 Ga0265777_123747 3300030877 Unclassified 518
527 Ga0265770_1020946 3300030878 Bacteria 1036
528 Ga0265770_1131537 3300030878 Bacteria 535
529 Ga0265770_1157943 3300030878 Bacteria 502
530 Ga0265765_1007126 3300030879 Bacteria 1200
531 Ga0265765_1051988 3300030879 Bacteria 564
532 Ga0265776_103094 3300030880 Bacteria 796
533 Ga0265764_101304 3300030882 Bacteria 1092
534 Ga0265772_101130 3300030886 Bacteria 923
535 Ga0265772_107555 3300030886 Bacteria 512
536 Ga0265769_110822 3300030888 Bacteria 628
537 Ga0265761_112875 3300030889 Bacteria 502
538 Ga0265768_103830 3300030963 Bacteria 824
539 Ga0265771_1015496 3300031010 Bacteria 612
540 Ga0265773_1010359 3300031018 Bacteria 785
541 Ga0265760_10057296 3300031090 Bacteria 1180
542 Ga0265760_10120466 3300031090 Bacteria 842
543 Ga0265330_10029285 3300031235 Bacteria 2477
544 Ga0265332_10016032 3300031238 Bacteria 3306
545 Ga0265328_10013268 3300031239 Bacteria 3266
546 Ga0265328_10336108 3300031239 Bacteria 587
547 Ga0265320_10004829 3300031240 Bacteria 8759
548 Ga0265325_10010022 3300031241 Bacteria 5506
549 Ga0265325_10522956 3300031241 Bacteria 514
550 Ga0265325_10527284 3300031241 Bacteria 511
551 Ga0265329_10007475 3300031242 Bacteria 4218
552 Ga0265329_10048463 3300031242 Bacteria 1355
553 Ga0265340_10015618 3300031247 Bacteria 3943
554 Ga0265340_10123453 3300031247 Bacteria 1190
555 Ga0265340_10240202 3300031247 Bacteria 808
556 Ga0265340_10248262 3300031247 Bacteria 793
557 Ga0265340_10336449 3300031247 Bacteria 667
558 Ga0265339_10025490 3300031249 Bacteria 3393
559 Ga0265339_10127256 3300031249 Bacteria 1305
560 Ga0265331_10003518 3300031250 Bacteria 10080
561 Ga0265327_10001579 3300031251 Bacteria 27819
562 Ga0265316_10014952 3300031344 Bacteria 6806
563 Ga0265316_10350619 3300031344 Bacteria 1069
564 Ga0307509_10000099 3300031507 Bacteria 121307
565 Ga0307509_10209473 3300031507 Bacteria 1776
566 Ga0307408_100106988 3300031548 Bacteria 2141
567 Ga0307408_100846601 3300031548 Bacteria 833
568 Ga0265313_10005693 3300031595 Bacteria 9089
569 Ga0307508_10422939 3300031616 Bacteria 924
570 Ga0307508_10635106 3300031616 Bacteria 672
571 Ga0316575_10010287 3300031665 Bacteria 3433
572 Ga0316575_10057693 3300031665 Bacteria 1548
573 Ga0316575_10084712 3300031665 Bacteria 1280
574 Ga0316575_10156426 3300031665 Bacteria 942
575 Ga0316579_10576348 3300031691 Bacteria 545
576 Ga0265314_10005013 3300031711 Bacteria 12066
577 Ga0265314_10639754 3300031711 Bacteria 544
578 Ga0265342_10046558 3300031712 Bacteria 2606
579 Ga0316576_10002081 3300031727 Bacteria 11247
580 Ga0316576_10014055 3300031727 Bacteria 5338
581 Ga0316576_10027818 3300031727 Bacteria 3977
582 Ga0316576_10183421 3300031727 Bacteria 1578
583 Ga0316576_10193452 3300031727 Bacteria 1533
584 Ga0316576_10791416 3300031727 Bacteria 683
585 Ga0316576_10825715 3300031727 Bacteria 666
586 Ga0316578_10067900 3300031728 Bacteria 2108
587 Ga0316578_10185041 3300031728 Bacteria 1255
588 Ga0316578_10411326 3300031728 Bacteria 801
589 Ga0316578_10578966 3300031728 Bacteria 658
590 Ga0316578_10737196 3300031728 Bacteria 573
591 Ga0307516_10000794 3300031730 Bacteria 43134
592 Ga0307405_10273768 3300031731 Bacteria 1267
593 Ga0307405_10834885 3300031731 Bacteria 774
594 Ga0316577_10188022 3300031733 Bacteria 1167
595 Ga0316577_10692902 3300031733 Bacteria 579
596 Ga0247548_109242 3300031814 Bacteria 505
597 Ga0316042_123163 3300031816 Bacteria 634
598 Ga0307410_10317148 3300031852 Bacteria 1235
599 Ga0307406_10946672 3300031901 Bacteria 736
600 Ga0307406_10979171 3300031901 Bacteria 724
601 Ga0307407_10832953 3300031903 Bacteria 704
602 Ga0307407_11567500 3300031903 Bacteria 522
603 Ga0307412_12041327 3300031911 Bacteria 531
604 Ga0307412_12155639 3300031911 Bacteria 518
605 Ga0307409_101375571 3300031995 Bacteria 732
606 Ga0307409_101475498 3300031995 Bacteria 707
607 Ga0307416_100061146 3300032002 Bacteria 3072
608 Ga0307416_100360376 3300032002 Bacteria 1476
609 Ga0307414_11521203 3300032004 Bacteria 623
610 Ga0307414_11565707 3300032004 Bacteria 614
611 Ga0307411_10117261 3300032005 Bacteria 1918
612 Ga0307411_10349344 3300032005 Bacteria 1205
613 Ga0307411_11327483 3300032005 Bacteria 656
614 Ga0316053_103317 3300032120 Bacteria 951
615 Ga0316053_104287 3300032120 Bacteria 875
616 Ga0316053_104697 3300032120 Bacteria 849
617 Ga0307415_100814957 3300032126 Bacteria 853
618 Ga0316593_10001722 3300032168 Bacteria 4950
619 Ga0316593_10128541 3300032168 Bacteria 913
620 Ga0316593_10197532 3300032168 Bacteria 743
621 Ga0316593_10280182 3300032168 Bacteria 628
622 Ga0307510_10270889 3300033180 Bacteria 1174
623 Ga0316592_1160632 3300033524 Bacteria 532
624 Ga0316588_1197444 3300033528 Bacteria 525
625 Ga0316587_1029325 3300033529 Bacteria 967
626 Ga0316587_1045737 3300033529 Bacteria 796
627 Ga0316587_1085458 3300033529 Bacteria 599
628 Ga0316587_1109367 3300033529 Bacteria 536
629 Ga0316596_1125910 3300033541 Bacteria 698
630 Ga0316212_1058301 3300033547 Bacteria 555
631 Ga0373959_0084114 3300034820 Bacteria 737
632 Ga0373939_0347443 3300035114 Bacteria 603
633 Ga0316574_0000008 3300035398 Bacteria 48126
634 Ga0316574_0035259 3300035398 Bacteria 3056
635 Ga0316574_0036237 3300035398 Bacteria 3019
636 Ga0316574_0047826 3300035398 Bacteria 2656
637 Ga0316574_0133252 3300035398 Bacteria 1599
638 Ga0316574_0227365 3300035398 Bacteria 1194
639 Ga0316574_0293725 3300035398 Bacteria 1034
640 Ga0316574_0537941 3300035398 Bacteria 726
641 Ga0316574_0998585 3300035398 Bacteria 504
642 Ga0373935_0963129 3300035692 Bacteria 633
643 Ga0373933_0390731 3300035724 Bacteria 907
644 Ga0265778_055594 3300036457 Bacteria 548
645 Ga0265778_060894 3300036457 Bacteria 528
646 Ga0265778_062811 3300036457 Bacteria 521
647 Ga0316582_0117086 3300036647 Bacteria 1780
648 Ga0316582_0909758 3300036647 Unclassified 602
649 Ga0316584_0006318 3300036712 Bacteria 8025
650 Ga0316584_0112662 3300036712 Bacteria 2035
651 Ga0316584_0235760 3300036712 Bacteria 1340
652 Ga0316584_0320079 3300036712 Bacteria 1119
653 Ga0316584_0400486 3300036712 Bacteria 978
654 Ga0395899_0621662 3300037312 Bacteria 686
655 Ga0395900_0063904 3300037418 Bacteria 3783
656 Ga0395900_0125647 3300037418 Bacteria 2631
657 Ga0395900_0462554 3300037418 Bacteria 1223
658 Ga0395898_0002854 3300037466 Bacteria 19754
659 Ga0395898_0010069 3300037466 Bacteria 9895
660 Ga0395898_0188826 3300037466 Bacteria 1969
661 Ga0395898_0375533 3300037466 Bacteria 1356
662 Ga0436364_0164812 3300037853 Bacteria 1297
663 Ga0436364_1222050 3300037853 Bacteria 564
664 Ga0395901_0174298 3300038443 Bacteria 2256
665 Ga0400490_28919 3300038726 Bacteria 7529
666 Ga0400490_53651 3300038726 Bacteria 3454
667 Ga0400488_36511 3300038741 Bacteria 2289
668 Ga0400488_56057 3300038741 Bacteria 4432
669 Ga0400483_273147 3300039062 Bacteria 1100
670 Ga0400487_04101 3300039110 Bacteria 13055
671 Ga0400487_31583 3300039110 Bacteria 11327
672 Ga0436365_1797910 3300039437 Bacteria 783
673 Ga0436365_1901520 3300039437 Bacteria 878
674 Ga0436361_0193979 3300039447 Bacteria 589
675 Ga0436362_0935429 3300039453 Bacteria 527
676 Ga0436362_1215006 3300039453 Bacteria 706
677 Ga0439436_0126878 3300041404 Bacteria 715
678 Ga0439439_0050483 3300041406 Bacteria 1090
679 Ga0439461_0218811 3300041410 Bacteria 518
680 Ga0451798_0012111 3300041458 Bacteria 562
681 Ga0451807_0002537 3300041486 Bacteria 882
682 Ga0452271_28477 3300041916 Bacteria 608
683 Ga0439431_0120431 3300041997 Bacteria 732
684 Ga0439431_0193156 3300041997 Bacteria 591
685 Ga0439433_0079396 3300041999 Bacteria 797
686 Ga0439442_041737 3300042002 Bacteria 964
687 Ga0439443_097767 3300042003 Bacteria 560
688 Ga0439445_0076482 3300042004 Bacteria 932
689 Ga0439452_000426 3300042010 Bacteria 24406
690 Ga0439456_154930 3300042013 Bacteria 535
691 Ga0450920_002893 3300042122 Bacteria 2954
692 Ga0450923_000690 3300042125 Bacteria 3961
693 Ga0450895_029275 3300042132 Bacteria 533
694 Ga0450896_000264 3300042133 Bacteria 4827
695 Ga0450898_074331 3300042134 Bacteria 685
696 Ga0450907_005068 3300042146 Bacteria 2235
697 Ga0450910_013101 3300042147 Bacteria 1204
698 Ga0439446_0010932 3300042156 Bacteria 2454
699 Ga0439446_0385838 3300042156 Bacteria 504
700 Ga0450908_010340 3300042184 Bacteria 1722
701 Ga0439434_0024041 3300042435 Bacteria 1837
702 Ga0439434_0083345 3300042435 Bacteria 1016
703 Ga0439434_0117598 3300042435 Bacteria 865
704 Ga0439435_0029012 3300042436 Bacteria 1491
705 Ga0439464_0004826 3300042439 Bacteria 3456
706 Ga0450918_003499 3300042531 Bacteria 2915
707 Ga0450918_016616 3300042531 Bacteria 1279
708 Ga0450893_0115065 3300042532 Bacteria 558
709 Ga0451577_0007767 3300042876 Bacteria 10512
710 Ga0451577_0121837 3300042876 Bacteria 2336
711 Ga0451577_0141164 3300042876 Bacteria 2165
712 Ga0451577_0235064 3300042876 Bacteria 1657
713 Ga0451577_0440250 3300042876 Bacteria 1183
714 Ga0451577_0649751 3300042876 Bacteria 956
715 Ga0451577_1189484 3300042876 Bacteria 680
716 Ga0466969_0005066 3300044656 Bacteria 7008
717 Ga0466969_0040693 3300044656 Bacteria 2328
718 Ga0466969_0318689 3300044656 Bacteria 704
719 Ga0453683_0010066 3300044673 Bacteria 6286
720 Ga0453683_0082624 3300044673 Bacteria 2013
721 Ga0466966_0000786 3300044684 Bacteria 20203
722 Ga0466966_0291869 3300044684 Bacteria 980
723 Ga0466961_0010757 3300044693 Bacteria 5845
724 Ga0466961_0160163 3300044693 Bacteria 1403
725 Ga0466961_0347682 3300044693 Bacteria 903
726 Ga0466963_0088166 3300044694 Bacteria 2111
727 Ga0466964_0003849 3300044706 Bacteria 5508
728 Ga0453684_0032098 3300044712 Bacteria 7358
729 Ga0453684_0042866 3300044712 Bacteria 6091
730 Ga0453684_0267228 3300044712 Bacteria 1956
731 Ga0453684_0444488 3300044712 Bacteria 1444
732 Ga0453684_0445858 3300044712 Bacteria 1442
733 Ga0453684_1473551 3300044712 Bacteria 703
734 Ga0466971_0000163 3300044719 Bacteria 24784
735 Ga0466970_0012565 3300044765 Bacteria 4332
736 Ga0466970_0210690 3300044765 Bacteria 1083
737 Ga0466970_0876217 3300044765 Bacteria 527
738 Ga0466957_0030205 3300044842 Bacteria 3235
739 Ga0466957_0177687 3300044842 Bacteria 1389
740 Ga0466959_0003333 3300045049 Bacteria 10492
741 Ga0466959_0008064 3300045049 Bacteria 7424
742 Ga0466959_0483189 3300045049 Bacteria 838
743 Ga0451576_0004342 3300045051 Bacteria 18509
744 Ga0451576_0032859 3300045051 Bacteria 5517
745 Ga0451576_0203336 3300045051 Bacteria 2068
746 Ga0451576_0299623 3300045051 Bacteria 1681
747 Ga0451576_0409214 3300045051 Bacteria 1423
748 Ga0451576_1080226 3300045051 Bacteria 840
749 Ga0495617_258465 3300046452 Bacteria 536
750 Ga0495650_0000028 3300046471 Bacteria 473012
751 Ga0495580_0006674 3300046472 Bacteria 9368
752 Ga0495594_0531328 3300046499 Bacteria 668
753 Ga0495645_0790949 3300046543 Bacteria 570
754 Ga0495633_0338660 3300046558 Bacteria 682
755 Ga0495668_0811442 3300046616 Bacteria 518
756 Ga0495613_0368154 3300046689 Bacteria 984
757 Ga0495649_0348945 3300046694 Bacteria 748
758 Ga0495660_0294296 3300046810 Bacteria 738
759 Ga0495593_0142352 3300047673 Bacteria 1215
760 Ga0496102_0080906 3300048905 Bacteria 2994
761 Ga0496104_0048171 3300048907 Bacteria 4018
762 Ga0496105_0098503 3300048908 Bacteria 2414
763 Ga0496106_0175338 3300048909 Bacteria 1701
764 Ga0496106_0255709 3300048909 Bacteria 1401
765 Ga0496108_0373735 3300048911 Bacteria 1244
766 Ga0496108_1211794 3300048911 Bacteria 638
767 Ga0496109_0021996 3300048912 Bacteria 5645
768 Ga0496109_1343239 3300048912 Bacteria 651
769 Ga0496110_0514972 3300048913 Bacteria 1088
770 Ga0496111_0063990 3300048914 Bacteria 2668
771 Ga0496112_0999450 3300048915 Bacteria 756
772 Ga0496113_0306644 3300048916 Bacteria 1272
773 Ga0496114_0890133 3300048917 Bacteria 771
774 Ga0496115_0339614 3300048918 Bacteria 1226
775 Ga0496116_0040569 3300048919 Bacteria 3204
776 Ga0496117_0049034 3300048920 Bacteria 3008
777 Ga0496119_0056891 3300048922 Bacteria 2366
778 Ga0496120_0250355 3300048923 Bacteria 832
779 Ga0496121_0112251 3300048924 Bacteria 2076
780 Ga0496124_0097785 3300048927 Bacteria 2383
781 Ga0496125_0703258 3300048928 Bacteria 536
782 Ga0496126_0006195 3300048929 Bacteria 13385
783 Ga0496126_0858887 3300048929 Bacteria 691
784 Ga0501031_0115012 3300049568 Bacteria 1757
785 Ga0501032_0009894 3300049569 Bacteria 6891
786 Ga0501032_0066756 3300049569 Bacteria 2404
787 Ga0501032_0301958 3300049569 Bacteria 1035
788 Ga0501032_0689572 3300049569 Bacteria 648
789 Ga0501033_0001168 3300049570 Bacteria 23698
790 Ga0501033_0163918 3300049570 Bacteria 1599
791 Ga0501033_0449901 3300049570 Bacteria 895
792 Ga0501034_0002051 3300049571 Bacteria 25291
793 Ga0501034_0218058 3300049571 Bacteria 1861
794 Ga0501034_0290360 3300049571 Bacteria 1573
795 Ga0501036_0000113 3300049572 Bacteria 50142
796 Ga0501036_0573282 3300049572 Bacteria 937
797 Ga0501037_0018417 3300049573 Bacteria 5147
798 Ga0501037_0069861 3300049573 Bacteria 2556
799 Ga0501037_0153237 3300049573 Bacteria 1646
800 Ga0501037_1067014 3300049573 Bacteria 524
801 Ga0501038_0001322 3300049574 Bacteria 22542
802 Ga0501038_0149920 3300049574 Bacteria 1902
803 Ga0501038_0554907 3300049574 Bacteria 873
804 Ga0501038_0952707 3300049574 Bacteria 632
805 Ga0501039_0080377 3300049575 Bacteria 2537
806 Ga0501039_0296177 3300049575 Bacteria 1272
807 Ga0501039_0677630 3300049575 Bacteria 807
808 Ga0501039_0912959 3300049575 Bacteria 683
809 Ga0501040_0150960 3300049576 Bacteria 1639
810 Ga0501040_0177791 3300049576 Bacteria 1508
811 Ga0501041_0132475 3300049577 Bacteria 1553
812 Ga0501041_0206402 3300049577 Bacteria 1232
813 Ga0501041_0238682 3300049577 Bacteria 1142
814 Ga0501041_0715798 3300049577 Bacteria 641
815 Ga0501041_0854342 3300049577 Bacteria 584
816 Ga0501042_0373765 3300049578 Bacteria 1032
817 Ga0501042_1036441 3300049578 Bacteria 598
818 Ga0501042_1065945 3300049578 Bacteria 589
819 Ga0501043_0001910 3300049579 Bacteria 17856
820 Ga0501043_0578335 3300049579 Bacteria 832
821 Ga0501046_1231592 3300049580 Bacteria 513
822 Ga0501047_0004828 3300049581 Bacteria 12669
823 Ga0501048_1366183 3300049582 Bacteria 509
824 Ga0501067_0040984 3300049583 Bacteria 2571
825 Ga0501067_0137701 3300049583 Bacteria 1359
826 Ga0501068_0076151 3300049584 Bacteria 2053
827 Ga0501068_0203673 3300049584 Bacteria 1255
828 Ga0501069_0004062 3300049585 Bacteria 7556
829 Ga0501069_0264716 3300049585 Bacteria 1004
830 Ga0501069_0298343 3300049585 Bacteria 945
831 Ga0501070_0001800 3300049586 Bacteria 18908
832 Ga0501070_0008139 3300049586 Bacteria 8869
833 Ga0501070_0403826 3300049586 Bacteria 1105
834 Ga0501071_0173047 3300049587 Bacteria 1617
835 Ga0501071_0460106 3300049587 Bacteria 974
836 Ga0501072_0053074 3300049588 Bacteria 3192
837 Ga0501073_0005924 3300049589 Bacteria 9122
838 Ga0501073_0179996 3300049589 Bacteria 1463
839 Ga0501073_0484346 3300049589 Bacteria 855
840 Ga0501074_0001684 3300049590 Bacteria 15052
841 Ga0501074_0206914 3300049590 Bacteria 1398
842 Ga0501075_0045553 3300049591 Bacteria 3292
843 Ga0501075_0353365 3300049591 Bacteria 1120
844 Ga0501075_0444276 3300049591 Bacteria 989
845 Ga0501076_0118732 3300049592 Bacteria 2141
846 Ga0501076_0226463 3300049592 Bacteria 1528
847 Ga0501076_0439570 3300049592 Bacteria 1074
848 Ga0501076_0526696 3300049592 Bacteria 974
849 Ga0501076_0892340 3300049592 Bacteria 733
850 Ga0501076_1467435 3300049592 Bacteria 560
851 Ga0501077_0051134 3300049593 Bacteria 2626
852 Ga0501077_0231758 3300049593 Bacteria 1174
853 Ga0501235_107102 3300049669 Bacteria 688
854 Ga0501079_0189001 3300049741 Bacteria 1607
855 Ga0501079_0227407 3300049741 Bacteria 1457
856 Ga0501079_0948068 3300049741 Bacteria 678
857 Ga0501079_0982524 3300049741 Bacteria 665
858 Ga0501079_1372274 3300049741 Bacteria 556
859 Ga0501080_0010309 3300049742 Bacteria 8545
860 Ga0501080_0220020 3300049742 Bacteria 1738
861 Ga0501080_0969982 3300049742 Bacteria 738
862 Ga0501081_0018675 3300049743 Bacteria 4608
863 Ga0501081_0175591 3300049743 Bacteria 1548
864 Ga0501081_0288189 3300049743 Bacteria 1203
865 Ga0501081_0446034 3300049743 Bacteria 961
866 Ga0501081_0797532 3300049743 Bacteria 711
867 Ga0501083_0206592 3300049744 Bacteria 1281
868 Ga0501035_0004700 3300049822 Bacteria 12966
869 Ga0501035_0029347 3300049822 Bacteria 5015
870 Ga0501035_0080209 3300049822 Bacteria 2882
871 Ga0501035_1182974 3300049822 Bacteria 594
872 Ga0501044_0000213 3300049823 Bacteria 73593
873 Ga0501044_0005117 3300049823 Bacteria 14627
874 Ga0501044_0152988 3300049823 Bacteria 2288
875 Ga0501044_0849224 3300049823 Bacteria 790
876 Ga0501045_0093118 3300049824 Bacteria 2229
877 Ga0501045_0278582 3300049824 Bacteria 1245
878 Ga0501045_0833633 3300049824 Bacteria 678
879 Ga0501045_1158417 3300049824 Bacteria 565
880 nmdc:mga03683_557527_c1 3300050489 Unclassified 558
881 nmdc:mga00v17_108_c1 3300050491 Bacteria 49222
882 nmdc:mga00v17_32982_c1 3300050491 Bacteria 3065
883 nmdc:mga05p37_65384_c1 3300050507 Bacteria 4474
884 nmdc:mga09592_798815_c1 3300050508 Bacteria 798
885 nmdc:mga0qj67_17472_c1 3300050509 Bacteria 5454
886 nmdc:mga06r32_119848_c1 3300050510 Bacteria 2595
887 nmdc:mga08y16_139811_c1 3300050511 Bacteria 2517
888 nmdc:mga08y16_8740_c1 3300050511 Bacteria 10624
889 nmdc:mga0n895_1333096_c1 3300050512 Bacteria 688
890 nmdc:mga0n895_143_c1 3300050512 Bacteria 43481
891 nmdc:mga0rr50_113092_c1 3300050513 Bacteria 2151
892 nmdc:mga0rr50_1692828_c1 3300050513 Bacteria 533
893 nmdc:mga08x19_1020095_c1 3300050514 Bacteria 588
894 nmdc:mga0a205_87_c1 3300050515 Bacteria 51120
895 Ga0495601_0207595 3300053077 Bacteria 1280
896 Ga0495619_0402886 3300053085 Bacteria 945
897 Ga0500556_0000737 3300053104 Bacteria 19686
898 Ga0500562_108873 3300053108 Bacteria 755
899 Ga0500595_017641 3300053119 Bacteria 2630
900 Ga0500568_0215661 3300053139 Bacteria 702
901 Ga0500622_0000001 3300053156 Bacteria 657715
902 Ga0500622_0008492 3300053156 Bacteria 5740
903 Ga0500637_0111178 3300053178 Bacteria 1589
904 Ga0501084_0015172 3300054114 Bacteria 6387
905 Ga0501084_0548143 3300054114 Bacteria 977
906 Ga0587073_0083192 3300059492 Bacteria 799
907 Ga0587073_0121639 3300059492 Bacteria 705
908 Ga0587077_262131 3300059493 Bacteria 504
909 Ga0587080_050382 3300059503 Bacteria 785
910 Ga0587082_101970 3300059504 Bacteria 626
911 Ga0587086_079837 3300059507 Bacteria 575
912 Ga0587089_063698 3300059509 Bacteria 614
913 Ga0587090_095523 3300059510 Bacteria 615
914 Ga0587091_212207 3300059511 Bacteria 525
915 Ga0587094_110831 3300059513 Bacteria 540
916 Ga0587101_031787 3300059623 Bacteria 827
917 Ga0587130_045208 3300059631 Bacteria 541
918 Ga0587062_108958 3300059639 Bacteria 548
919 Ga0587067_120104 3300059640 Bacteria 630
920 Ga0587100_035105 3300059648 Bacteria 546
921 Ga0587124_031020 3300059660 Bacteria 591
922 Ga0587071_116898 3300060344 Bacteria 633
923 Ga0587071_157477 3300060344 Bacteria 569
924 Ga0501082_0290748 3300060353 Bacteria 1423
925 Ga0501082_0474553 3300060353 Bacteria 1093
926 Ga0501082_0783371 3300060353 Bacteria 834
927 Ga0466962_0005596 3300061719 Bacteria 6033
928 Ga0530510_0847068 3300061734 Bacteria 698

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2842391507 2842392710 66
2 iso_pu_bacteria 2919134579 2919136261 66
3 3300049576 Ga0501040_0177791 Ga0501040_0177791_541_771 74
4 3300049577 Ga0501041_0206402 Ga0501041_0206402_954_1184 74
5 3300049822 Ga0501035_1182974 Ga0501035_1182974_145_375 74
6 3300046558 Ga0495633_0338660 Ga0495633_0338660_290_523 75
7 iso_pu_bacteria 2928157003 2928160255 75
8 iso_pu_bacteria 2928163908 2928168747 75
9 iso_pu_bacteria 2981990288 2981994594 75
10 iso_pu_bacteria 641736154 642419664 75
11 3300005289 Ga0065704_10010159 Ga0065704_100101591 76
12 3300005548 Ga0070665_100000420 Ga0070665_10000042025 76
13 3300006051 Ga0075364_10070422 Ga0075364_100704222 76
14 3300006177 Ga0075362_10619577 Ga0075362_106195772 76
15 3300013100 Ga0157373_10722918 Ga0157373_107229182 76
16 3300013102 Ga0157371_10157817 Ga0157371_101578172 76
17 3300013104 Ga0157370_10096369 Ga0157370_100963692 76
18 3300013307 Ga0157372_10162230 Ga0157372_101622302 76
19 3300028379 Ga0268266_10000115 Ga0268266_1000011541 76
20 3300041486 Ga0451807_0002537 Ga0451807_0002537_448_681 76
21 3300041916 Ga0452271_28477 Ga0452271_28477_34_345 76
22 3300042010 Ga0439452_000426 Ga0439452_000426_23597_23908 76
23 3300042439 Ga0439464_0004826 Ga0439464_0004826_1739_2050 76
24 3300046471 Ga0495650_0000028 Ga0495650_0000028_435049_435360 76
25 3300046694 Ga0495649_0348945 Ga0495649_0348945_10_249 76
26 3300048919 Ga0496116_0040569 Ga0496116_0040569_17_328 76
27 3300048920 Ga0496117_0049034 Ga0496117_0049034_1471_1782 76
28 3300048922 Ga0496119_0056891 Ga0496119_0056891_528_839 76
29 3300048924 Ga0496121_0112251 Ga0496121_0112251_528_839 76
30 3300050489 nmdc:mga03683_557527_c1 nmdc:mga03683_557527_c1_235_546 76
31 3300050491 nmdc:mga00v17_32982_c1 nmdc:mga00v17_32982_c1_1679_1990 76
32 3300005365 Ga0070688_100857655 Ga0070688_1008576552 77
33 3300005366 Ga0070659_100436156 Ga0070659_1004361562 77
34 3300005455 Ga0070663_100426932 Ga0070663_1004269322 77
35 3300005539 Ga0068853_100019298 Ga0068853_1000192983 77
36 3300005563 Ga0068855_100258645 Ga0068855_1002586452 77
37 3300005577 Ga0068857_100125984 Ga0068857_1001259842 77
38 3300013297 Ga0157378_12707541 Ga0157378_127075411 77
39 3300020080 Ga0206350_10072159 Ga0206350_100721591 77
40 3300025294 Ga0209025_1000003 Ga0209025_1000003616 77
41 3300025919 Ga0207657_10077276 Ga0207657_100772762 77
42 3300025924 Ga0207694_10184119 Ga0207694_101841192 77
43 3300025949 Ga0207667_10203259 Ga0207667_102032592 77
44 3300026041 Ga0207639_10240488 Ga0207639_102404882 77
45 3300026067 Ga0207678_10559948 Ga0207678_105599482 77
46 3300026116 Ga0207674_10293165 Ga0207674_102931652 77
47 3300031665 Ga0316575_10010287 Ga0316575_100102872 77
48 3300031727 Ga0316576_10791416 Ga0316576_107914162 77
49 3300035398 Ga0316574_0227365 Ga0316574_0227365_648_884 77
50 3300037312 Ga0395899_0621662 Ga0395899_0621662_315_551 77
51 3300037418 Ga0395900_0063904 Ga0395900_0063904_676_912 77
52 3300037466 Ga0395898_0375533 Ga0395898_0375533_741_977 77
53 3300038443 Ga0395901_0174298 Ga0395901_0174298_655_891 77
54 3300044673 Ga0453683_0082624 Ga0453683_0082624_202_441 77
55 3300044765 Ga0466970_0210690 Ga0466970_0210690_172_408 77
56 3300049568 Ga0501031_0115012 Ga0501031_0115012_339_575 77
57 3300049569 Ga0501032_0009894 Ga0501032_0009894_1110_1346 77
58 3300049569 Ga0501032_0066756 Ga0501032_0066756_2065_2301 77
59 3300049569 Ga0501032_0689572 Ga0501032_0689572_95_331 77
60 3300049570 Ga0501033_0001168 Ga0501033_0001168_16772_17008 77
61 3300049570 Ga0501033_0163918 Ga0501033_0163918_271_507 77
62 3300049570 Ga0501033_0449901 Ga0501033_0449901_15_251 77
63 3300049571 Ga0501034_0002051 Ga0501034_0002051_13776_14012 77
64 3300049571 Ga0501034_0218058 Ga0501034_0218058_53_289 77
65 3300049571 Ga0501034_0290360 Ga0501034_0290360_874_1110 77
66 3300049572 Ga0501036_0000113 Ga0501036_0000113_16591_16827 77
67 3300049573 Ga0501037_0018417 Ga0501037_0018417_2995_3231 77
68 3300049573 Ga0501037_0069861 Ga0501037_0069861_2080_2316 77
69 3300049573 Ga0501037_0153237 Ga0501037_0153237_1013_1249 77
70 3300049573 Ga0501037_1067014 Ga0501037_1067014_16_252 77
71 3300049574 Ga0501038_0001322 Ga0501038_0001322_11143_11379 77
72 3300049574 Ga0501038_0149920 Ga0501038_0149920_871_1107 77
73 3300049574 Ga0501038_0952707 Ga0501038_0952707_279_515 77
74 3300049575 Ga0501039_0080377 Ga0501039_0080377_1507_1743 77
75 3300049578 Ga0501042_1065945 Ga0501042_1065945_295_537 77
76 3300049579 Ga0501043_0001910 Ga0501043_0001910_11322_11558 77
77 3300049579 Ga0501043_0578335 Ga0501043_0578335_449_685 77
78 3300049581 Ga0501047_0004828 Ga0501047_0004828_7297_7533 77
79 3300049591 Ga0501075_0444276 Ga0501075_0444276_16_258 77
80 3300049822 Ga0501035_0004700 Ga0501035_0004700_5265_5501 77
81 3300049822 Ga0501035_0029347 Ga0501035_0029347_2179_2415 77
82 3300049823 Ga0501044_0005117 Ga0501044_0005117_8595_8831 77
83 3300049823 Ga0501044_0152988 Ga0501044_0152988_83_319 77
84 iso_pu_bacteria 2687453129 2687578283 77
85 iso_pu_bacteria 2734482258 2735816853 77
86 iso_pu_bacteria 2919704043 2919704853 77
87 iso_pu_bacteria 2952252522 2952253479 77
88 3300005334 Ga0068869_101477263 Ga0068869_1014772632 78
89 3300005343 Ga0070687_101274618 Ga0070687_1012746181 78
90 3300005440 Ga0070705_100316720 Ga0070705_1003167201 78
91 3300005444 Ga0070694_100325892 Ga0070694_1003258921 78
92 3300005445 Ga0070708_100108966 Ga0070708_1001089663 78
93 3300005458 Ga0070681_10013550 Ga0070681_100135507 78
94 3300005467 Ga0070706_100020554 Ga0070706_1000205542 78
95 3300005468 Ga0070707_100014717 Ga0070707_1000147177 78
96 3300005530 Ga0070679_102132180 Ga0070679_1021321801 78
97 3300005545 Ga0070695_100023651 Ga0070695_1000236512 78
98 3300005547 Ga0070693_100494731 Ga0070693_1004947312 78
99 3300006871 Ga0075434_101218375 Ga0075434_1012183752 78
100 3300006914 Ga0075436_100708208 Ga0075436_1007082082 78
101 3300009551 Ga0105238_10981007 Ga0105238_109810072 78
102 3300025910 Ga0207684_10322850 Ga0207684_103228502 78
103 3300025912 Ga0207707_10024220 Ga0207707_100242203 78
104 3300025921 Ga0207652_11849962 Ga0207652_118499621 78
105 3300025922 Ga0207646_10087813 Ga0207646_100878132 78
106 3300025942 Ga0207689_11571841 Ga0207689_115718412 78
107 3300031239 Ga0265328_10336108 Ga0265328_103361081 78
108 3300031251 Ga0265327_10001579 Ga0265327_100015796 78
109 3300031911 Ga0307412_12155639 Ga0307412_121556392 78
110 3300038726 Ga0400490_28919 Ga0400490_28919_7248_7499 78
111 3300038726 Ga0400490_53651 Ga0400490_53651_1903_2142 78
112 3300038741 Ga0400488_36511 Ga0400488_36511_1840_2091 78
113 3300039110 Ga0400487_31583 Ga0400487_31583_7945_8196 78
114 3300042156 Ga0439446_0385838 Ga0439446_0385838_117_356 78
115 3300044712 Ga0453684_0042866 Ga0453684_0042866_4045_4287 78
116 3300045051 Ga0451576_0004342 Ga0451576_0004342_15344_15592 78
117 3300049585 Ga0501069_0004062 Ga0501069_0004062_3795_4034 78
118 3300049586 Ga0501070_0001800 Ga0501070_0001800_14737_14976 78
119 3300049586 Ga0501070_0008139 Ga0501070_0008139_3589_3828 78
120 3300049590 Ga0501074_0001684 Ga0501074_0001684_13586_13825 78
121 3300049741 Ga0501079_0948068 Ga0501079_0948068_86_325 78
122 3300049742 Ga0501080_0969982 Ga0501080_0969982_148_387 78
123 3300050512 nmdc:mga0n895_1333096_c1 nmdc:mga0n895_1333096_c1_67_306 78
124 3300050514 nmdc:mga08x19_1020095_c1 nmdc:mga08x19_1020095_c1_87_326 78
125 3300053156 Ga0500622_0000001 Ga0500622_0000001_189634_189873 78
126 3300060344 Ga0587071_157477 Ga0587071_157477_172_465 78
127 3300002774 JGI25150J39212_1003589 JGI25150J39212_10035893 79
128 3300003187 JGI25151J46595_10043569 JGI25151J46595_100435691 79
129 3300005331 Ga0070670_100007886 Ga0070670_1000078867 79
130 3300005335 Ga0070666_11239743 Ga0070666_112397432 79
131 3300005353 Ga0070669_100919071 Ga0070669_1009190711 79
132 3300005367 Ga0070667_100038957 Ga0070667_1000389573 79
133 3300005539 Ga0068853_100062295 Ga0068853_1000622953 79
134 3300005617 Ga0068859_101250012 Ga0068859_1012500121 79
135 3300005719 Ga0068861_100512000 Ga0068861_1005120002 79
136 3300005841 Ga0068863_101724470 Ga0068863_1017244702 79
137 3300005843 Ga0068860_102653695 Ga0068860_1026536951 79
138 3300006931 Ga0097620_101250205 Ga0097620_1012502051 79
139 3300009093 Ga0105240_10064123 Ga0105240_100641235 79
140 3300009545 Ga0105237_10744897 Ga0105237_107448972 79
141 3300013307 Ga0157372_12316301 Ga0157372_123163011 79
142 3300025913 Ga0207695_10300720 Ga0207695_103007202 79
143 3300025923 Ga0207681_10820437 Ga0207681_108204371 79
144 3300025986 Ga0207658_10082320 Ga0207658_100823203 79
145 3300026041 Ga0207639_10051978 Ga0207639_100519783 79
146 3300026118 Ga0207675_100931080 Ga0207675_1009310801 79
147 3300031247 Ga0265340_10336449 Ga0265340_103364492 79
148 3300031344 Ga0265316_10350619 Ga0265316_103506192 79
149 3300031711 Ga0265314_10639754 Ga0265314_106397541 79
150 3300031727 Ga0316576_10183421 Ga0316576_101834212 79
151 3300031727 Ga0316576_10825715 Ga0316576_108257152 79
152 3300031728 Ga0316578_10185041 Ga0316578_101850412 79
153 3300031733 Ga0316577_10188022 Ga0316577_101880221 79
154 3300032004 Ga0307414_11521203 Ga0307414_115212031 79
155 3300032005 Ga0307411_11327483 Ga0307411_113274831 79
156 3300032168 Ga0316593_10001722 Ga0316593_100017226 79
157 3300032168 Ga0316593_10197532 Ga0316593_101975321 79
158 3300033524 Ga0316592_1160632 Ga0316592_11606321 79
159 3300033528 Ga0316588_1197444 Ga0316588_11974442 79
160 3300033529 Ga0316587_1045737 Ga0316587_10457371 79
161 3300033529 Ga0316587_1085458 Ga0316587_10854581 79
162 3300035114 Ga0373939_0347443 Ga0373939_0347443_345_587 79
163 3300035398 Ga0316574_0293725 Ga0316574_0293725_491_736 79
164 3300035398 Ga0316574_0998585 Ga0316574_0998585_225_470 79
165 3300036712 Ga0316584_0112662 Ga0316584_0112662_1121_1366 79
166 3300039062 Ga0400483_273147 Ga0400483_273147_19_264 79
167 3300046616 Ga0495668_0811442 Ga0495668_0811442_69_341 79
168 3300049741 Ga0501079_1372274 Ga0501079_1372274_214_474 79
169 3300049743 Ga0501081_0797532 Ga0501081_0797532_186_431 79
170 3300050513 nmdc:mga0rr50_1692828_c1 nmdc:mga0rr50_1692828_c1_54_296 79
171 3300005335 Ga0070666_10268853 Ga0070666_102688532 80
172 3300005338 Ga0068868_100018297 Ga0068868_1000182973 80
173 3300005340 Ga0070689_102237712 Ga0070689_1022377122 80
174 3300005355 Ga0070671_100018983 Ga0070671_1000189832 80
175 3300005539 Ga0068853_101516803 Ga0068853_1015168031 80
176 3300005548 Ga0070665_100239429 Ga0070665_1002394292 80
177 3300005617 Ga0068859_100040454 Ga0068859_1000404543 80
178 3300005618 Ga0068864_100462411 Ga0068864_1004624112 80
179 3300005718 Ga0068866_10408965 Ga0068866_104089652 80
180 3300005841 Ga0068863_100150149 Ga0068863_1001501493 80
181 3300005843 Ga0068860_100009171 Ga0068860_1000091716 80
182 3300006237 Ga0097621_100050132 Ga0097621_1000501322 80
183 3300006358 Ga0068871_100099687 Ga0068871_1000996873 80
184 3300006881 Ga0068865_100205301 Ga0068865_1002053012 80
185 3300006931 Ga0097620_100040454 Ga0097620_1000404543 80
186 3300007788 Ga0099795_10000007 Ga0099795_1000000779 80
187 3300009098 Ga0105245_10077868 Ga0105245_100778683 80
188 3300009101 Ga0105247_10202276 Ga0105247_102022762 80
189 3300009176 Ga0105242_10012052 Ga0105242_100120526 80
190 3300009177 Ga0105248_10149045 Ga0105248_101490452 80
191 3300009545 Ga0105237_11981725 Ga0105237_119817251 80
192 3300009551 Ga0105238_10897787 Ga0105238_108977872 80
193 3300009553 Ga0105249_13428472 Ga0105249_134284722 80
194 3300010159 Ga0099796_10000033 Ga0099796_1000003315 80
195 3300013296 Ga0157374_10011021 Ga0157374_100110213 80
196 3300013297 Ga0157378_10021389 Ga0157378_100213893 80
197 3300013306 Ga0163162_10037655 Ga0163162_100376552 80
198 3300013308 Ga0157375_10014209 Ga0157375_100142096 80
199 3300014325 Ga0163163_10006099 Ga0163163_100060998 80
200 3300014968 Ga0157379_10010154 Ga0157379_100101548 80
201 3300014969 Ga0157376_10050407 Ga0157376_100504072 80
202 3300025899 Ga0207642_10637313 Ga0207642_106373132 80
203 3300025903 Ga0207680_10208797 Ga0207680_102087972 80
204 3300025927 Ga0207687_10007462 Ga0207687_100074623 80
205 3300025931 Ga0207644_11409299 Ga0207644_114092992 80
206 3300025934 Ga0207686_11060713 Ga0207686_110607132 80
207 3300025938 Ga0207704_10174804 Ga0207704_101748042 80
208 3300025941 Ga0207711_10024852 Ga0207711_100248524 80
209 3300025960 Ga0207651_10620583 Ga0207651_106205832 80
210 3300025986 Ga0207658_10008826 Ga0207658_100088264 80
211 3300026023 Ga0207677_10015325 Ga0207677_100153252 80
212 3300026035 Ga0207703_10030489 Ga0207703_100304892 80
213 3300026088 Ga0207641_10044038 Ga0207641_100440383 80
214 3300026095 Ga0207676_10008857 Ga0207676_100088577 80
215 3300027512 Ga0209179_1000074 Ga0209179_10000744 80
216 3300028379 Ga0268266_10151887 Ga0268266_101518873 80
217 3300028381 Ga0268264_10024968 Ga0268264_100249685 80
218 3300031727 Ga0316576_10027818 Ga0316576_100278183 80
219 3300031727 Ga0316576_10193452 Ga0316576_101934522 80
220 3300031728 Ga0316578_10411326 Ga0316578_104113261 80
221 3300031728 Ga0316578_10737196 Ga0316578_107371961 80
222 3300033529 Ga0316587_1109367 Ga0316587_11093671 80
223 3300035398 Ga0316574_0035259 Ga0316574_0035259_687_935 80
224 3300035398 Ga0316574_0133252 Ga0316574_0133252_1265_1513 80
225 3300036647 Ga0316582_0909758 Ga0316582_0909758_298_546 80
226 3300036712 Ga0316584_0320079 Ga0316584_0320079_342_590 80
227 3300036712 Ga0316584_0400486 Ga0316584_0400486_447_701 80
228 3300048907 Ga0496104_0048171 Ga0496104_0048171_2644_2889 80
229 3300048908 Ga0496105_0098503 Ga0496105_0098503_1003_1248 80
230 3300048909 Ga0496106_0175338 Ga0496106_0175338_463_708 80
231 3300048911 Ga0496108_0373735 Ga0496108_0373735_709_954 80
232 3300048912 Ga0496109_0021996 Ga0496109_0021996_1499_1744 80
233 3300048913 Ga0496110_0514972 Ga0496110_0514972_414_659 80
234 3300048914 Ga0496111_0063990 Ga0496111_0063990_676_921 80
235 3300048917 Ga0496114_0890133 Ga0496114_0890133_22_267 80
236 3300049587 Ga0501071_0173047 Ga0501071_0173047_154_402 80
237 3300005334 Ga0068869_101434245 Ga0068869_1014342451 81
238 3300005455 Ga0070663_101054531 Ga0070663_1010545312 81
239 3300005544 Ga0070686_101709399 Ga0070686_1017093992 81
240 3300005614 Ga0068856_101672083 Ga0068856_1016720832 81
241 3300005617 Ga0068859_100851133 Ga0068859_1008511332 81
242 3300006931 Ga0097620_100851044 Ga0097620_1008510441 81
243 3300009177 Ga0105248_11508008 Ga0105248_115080082 81
244 3300009553 Ga0105249_10432225 Ga0105249_104322252 81
245 3300013307 Ga0157372_11511617 Ga0157372_115116172 81
246 3300025961 Ga0207712_10039914 Ga0207712_100399142 81
247 3300026035 Ga0207703_12147007 Ga0207703_121470071 81
248 3300028558 Ga0265326_10018777 Ga0265326_100187772 81
249 3300028563 Ga0265319_1021224 Ga0265319_10212243 81
250 3300028573 Ga0265334_10002111 Ga0265334_100021113 81
251 3300028577 Ga0265318_10004693 Ga0265318_100046933 81
252 3300028794 Ga0307515_10186257 Ga0307515_101862572 81
253 3300028800 Ga0265338_10011547 Ga0265338_100115473 81
254 3300028800 Ga0265338_10072991 Ga0265338_100729913 81
255 3300031235 Ga0265330_10029285 Ga0265330_100292853 81
256 3300031238 Ga0265332_10016032 Ga0265332_100160323 81
257 3300031239 Ga0265328_10013268 Ga0265328_100132682 81
258 3300031240 Ga0265320_10004829 Ga0265320_100048294 81
259 3300031241 Ga0265325_10010022 Ga0265325_100100224 81
260 3300031242 Ga0265329_10007475 Ga0265329_100074753 81
261 3300031247 Ga0265340_10123453 Ga0265340_101234532 81
262 3300031247 Ga0265340_10240202 Ga0265340_102402021 81
263 3300031247 Ga0265340_10248262 Ga0265340_102482622 81
264 3300031249 Ga0265339_10025490 Ga0265339_100254902 81
265 3300031250 Ga0265331_10003518 Ga0265331_100035185 81
266 3300031344 Ga0265316_10014952 Ga0265316_100149527 81
267 3300031507 Ga0307509_10209473 Ga0307509_102094732 81
268 3300031595 Ga0265313_10005693 Ga0265313_100056933 81
269 3300031691 Ga0316579_10576348 Ga0316579_105763481 81
270 3300031711 Ga0265314_10005013 Ga0265314_100050138 81
271 3300031712 Ga0265342_10046558 Ga0265342_100465583 81
272 3300031728 Ga0316578_10578966 Ga0316578_105789661 81
273 3300032168 Ga0316593_10128541 Ga0316593_101285412 81
274 3300032168 Ga0316593_10280182 Ga0316593_102801821 81
275 3300033529 Ga0316587_1029325 Ga0316587_10293251 81
276 3300033541 Ga0316596_1125910 Ga0316596_11259101 81
277 3300035398 Ga0316574_0047826 Ga0316574_0047826_1839_2090 81
278 3300046452 Ga0495617_258465 Ga0495617_258465_114_371 81
279 3300049582 Ga0501048_1366183 Ga0501048_1366183_200_451 81
280 3300049586 Ga0501070_0403826 Ga0501070_0403826_215_472 81
281 3300049589 Ga0501073_0179996 Ga0501073_0179996_868_1125 81
282 3300049744 Ga0501083_0206592 Ga0501083_0206592_580_837 81
283 3300049823 Ga0501044_0849224 Ga0501044_0849224_22_273 81
284 3300053108 Ga0500562_108873 Ga0500562_108873_223_480 81
285 3300059492 Ga0587073_0083192 Ga0587073_0083192_245_502 81
286 3300059631 Ga0587130_045208 Ga0587130_045208_247_504 81
287 3300059639 Ga0587062_108958 Ga0587062_108958_171_428 81
288 3300005436 Ga0070713_101066172 Ga0070713_1010661722 82
289 3300005437 Ga0070710_10354064 Ga0070710_103540641 82
290 3300005548 Ga0070665_100342301 Ga0070665_1003423012 82
291 3300005578 Ga0068854_101242774 Ga0068854_1012427742 82
292 3300005842 Ga0068858_101262095 Ga0068858_1012620952 82
293 3300009093 Ga0105240_10023126 Ga0105240_100231266 82
294 3300009093 Ga0105240_10077531 Ga0105240_100775311 82
295 3300009101 Ga0105247_10100837 Ga0105247_101008372 82
296 3300009545 Ga0105237_10147148 Ga0105237_101471483 82
297 3300009551 Ga0105238_10190175 Ga0105238_101901752 82
298 3300010375 Ga0105239_12095766 Ga0105239_120957662 82
299 3300014325 Ga0163163_10176521 Ga0163163_101765212 82
300 3300014325 Ga0163163_10422158 Ga0163163_104221582 82
301 3300014968 Ga0157379_10048326 Ga0157379_100483262 82
302 3300020069 Ga0197907_10442029 Ga0197907_104420292 82
303 3300025981 Ga0207640_11164260 Ga0207640_111642602 82
304 3300025986 Ga0207658_12061416 Ga0207658_120614161 82
305 3300026035 Ga0207703_10279009 Ga0207703_102790092 82
306 3300028379 Ga0268266_10001499 Ga0268266_100014999 82
307 3300031665 Ga0316575_10084712 Ga0316575_100847122 82
308 3300031665 Ga0316575_10156426 Ga0316575_101564262 82
309 3300031727 Ga0316576_10014055 Ga0316576_100140556 82
310 3300031814 Ga0247548_109242 Ga0247548_1092421 82
311 3300031816 Ga0316042_123163 Ga0316042_1231632 82
312 3300031995 Ga0307409_101375571 Ga0307409_1013755712 82
313 3300032120 Ga0316053_103317 Ga0316053_1033172 82
314 3300035398 Ga0316574_0036237 Ga0316574_0036237_1314_1568 82
315 3300035398 Ga0316574_0537941 Ga0316574_0537941_395_649 82
316 3300036457 Ga0265778_062811 Ga0265778_062811_45_299 82
317 3300036712 Ga0316584_0235760 Ga0316584_0235760_628_882 82
318 3300037853 Ga0436364_1222050 Ga0436364_1222050_25_279 82
319 3300039437 Ga0436365_1797910 Ga0436365_1797910_52_306 82
320 3300044656 Ga0466969_0040693 Ga0466969_0040693_550_804 82
321 3300044693 Ga0466961_0160163 Ga0466961_0160163_540_794 82
322 3300044765 Ga0466970_0876217 Ga0466970_0876217_41_295 82
323 3300045049 Ga0466959_0008064 Ga0466959_0008064_309_563 82
324 3300045051 Ga0451576_1080226 Ga0451576_1080226_381_641 82
325 3300048912 Ga0496109_1343239 Ga0496109_1343239_202_456 82
326 3300048923 Ga0496120_0250355 Ga0496120_0250355_379_633 82
327 3300048927 Ga0496124_0097785 Ga0496124_0097785_120_374 82
328 3300048928 Ga0496125_0703258 Ga0496125_0703258_25_279 82
329 3300048929 Ga0496126_0006195 Ga0496126_0006195_6396_6650 82
330 3300048929 Ga0496126_0858887 Ga0496126_0858887_246_500 82
331 3300053119 Ga0500595_017641 Ga0500595_017641_1342_1596 82
332 3300059503 Ga0587080_050382 Ga0587080_050382_271_525 82
333 3300059504 Ga0587082_101970 Ga0587082_101970_110_364 82
334 3300059509 Ga0587089_063698 Ga0587089_063698_169_423 82
335 3300059510 Ga0587090_095523 Ga0587090_095523_106_360 82
336 3300059511 Ga0587091_212207 Ga0587091_212207_184_438 82
337 3300059513 Ga0587094_110831 Ga0587094_110831_98_352 82
338 3300059623 Ga0587101_031787 Ga0587101_031787_315_569 82
339 3300059640 Ga0587067_120104 Ga0587067_120104_284_538 82
340 3300059648 Ga0587100_035105 Ga0587100_035105_193_447 82
341 3300059660 Ga0587124_031020 Ga0587124_031020_189_443 82
342 3300005290 Ga0065712_10326864 Ga0065712_103268642 83
343 3300005295 Ga0065707_10728472 Ga0065707_107284722 83
344 3300005327 Ga0070658_10405905 Ga0070658_104059051 83
345 3300005328 Ga0070676_10628618 Ga0070676_106286182 83
346 3300005328 Ga0070676_10692443 Ga0070676_106924431 83
347 3300005328 Ga0070676_11373448 Ga0070676_113734481 83
348 3300005331 Ga0070670_101575436 Ga0070670_1015754362 83
349 3300005334 Ga0068869_100104307 Ga0068869_1001043072 83
350 3300005335 Ga0070666_10013838 Ga0070666_100138383 83
351 3300005336 Ga0070680_100068715 Ga0070680_1000687152 83
352 3300005336 Ga0070680_100069721 Ga0070680_1000697213 83
353 3300005337 Ga0070682_100134969 Ga0070682_1001349692 83
354 3300005338 Ga0068868_100032185 Ga0068868_1000321853 83
355 3300005340 Ga0070689_100820682 Ga0070689_1008206822 83
356 3300005345 Ga0070692_11349642 Ga0070692_113496421 83
357 3300005353 Ga0070669_100160143 Ga0070669_1001601432 83
358 3300005353 Ga0070669_100566157 Ga0070669_1005661572 83
359 3300005353 Ga0070669_100844812 Ga0070669_1008448122 83
360 3300005354 Ga0070675_100074763 Ga0070675_1000747632 83
361 3300005354 Ga0070675_101794310 Ga0070675_1017943101 83
362 3300005355 Ga0070671_100015878 Ga0070671_1000158783 83
363 3300005356 Ga0070674_100283647 Ga0070674_1002836472 83
364 3300005356 Ga0070674_100896987 Ga0070674_1008969872 83
365 3300005364 Ga0070673_100121783 Ga0070673_1001217831 83
366 3300005364 Ga0070673_101096215 Ga0070673_1010962151 83
367 3300005367 Ga0070667_100004160 Ga0070667_1000041609 83
368 3300005434 Ga0070709_10053834 Ga0070709_100538342 83
369 3300005434 Ga0070709_10264091 Ga0070709_102640912 83
370 3300005435 Ga0070714_100008875 Ga0070714_1000088752 83
371 3300005435 Ga0070714_100103127 Ga0070714_1001031272 83
372 3300005435 Ga0070714_100160828 Ga0070714_1001608282 83
373 3300005436 Ga0070713_100002296 Ga0070713_1000022964 83
374 3300005436 Ga0070713_100022771 Ga0070713_1000227712 83
375 3300005436 Ga0070713_100263809 Ga0070713_1002638092 83
376 3300005437 Ga0070710_10010095 Ga0070710_100100954 83
377 3300005437 Ga0070710_10598765 Ga0070710_105987651 83
378 3300005437 Ga0070710_11115080 Ga0070710_111150801 83
379 3300005439 Ga0070711_100001034 Ga0070711_1000010348 83
380 3300005440 Ga0070705_100182697 Ga0070705_1001826972 83
381 3300005441 Ga0070700_100023816 Ga0070700_1000238162 83
382 3300005441 Ga0070700_101026947 Ga0070700_1010269472 83
383 3300005444 Ga0070694_100467465 Ga0070694_1004674651 83
384 3300005456 Ga0070678_100175756 Ga0070678_1001757562 83
385 3300005456 Ga0070678_101671105 Ga0070678_1016711052 83
386 3300005457 Ga0070662_100876270 Ga0070662_1008762701 83
387 3300005458 Ga0070681_10012472 Ga0070681_100124724 83
388 3300005458 Ga0070681_10063063 Ga0070681_100630633 83
389 3300005458 Ga0070681_11055348 Ga0070681_110553482 83
390 3300005458 Ga0070681_12019274 Ga0070681_120192741 83
391 3300005459 Ga0068867_100002191 Ga0068867_1000021913 83
392 3300005459 Ga0068867_100091261 Ga0068867_1000912613 83
393 3300005459 Ga0068867_100356763 Ga0068867_1003567632 83
394 3300005467 Ga0070706_101358474 Ga0070706_1013584741 83
395 3300005530 Ga0070679_100001170 Ga0070679_1000011703 83
396 3300005530 Ga0070679_100038227 Ga0070679_1000382275 83
397 3300005536 Ga0070697_101101118 Ga0070697_1011011181 83
398 3300005543 Ga0070672_101287315 Ga0070672_1012873151 83
399 3300005545 Ga0070695_100126445 Ga0070695_1001264452 83
400 3300005547 Ga0070693_100192663 Ga0070693_1001926632 83
401 3300005548 Ga0070665_100022414 Ga0070665_1000224143 83
402 3300005549 Ga0070704_100473864 Ga0070704_1004738641 83
403 3300005549 Ga0070704_100511689 Ga0070704_1005116892 83
404 3300005549 Ga0070704_100867542 Ga0070704_1008675422 83
405 3300005563 Ga0068855_100005297 Ga0068855_10000529713 83
406 3300005563 Ga0068855_100006825 Ga0068855_1000068258 83
407 3300005563 Ga0068855_101211058 Ga0068855_1012110582 83
408 3300005578 Ga0068854_100048603 Ga0068854_1000486032 83
409 3300005578 Ga0068854_100904691 Ga0068854_1009046912 83
410 3300005578 Ga0068854_101103810 Ga0068854_1011038101 83
411 3300005614 Ga0068856_100005786 Ga0068856_1000057868 83
412 3300005614 Ga0068856_100217082 Ga0068856_1002170821 83
413 3300005614 Ga0068856_100274337 Ga0068856_1002743372 83
414 3300005616 Ga0068852_100573487 Ga0068852_1005734872 83
415 3300005617 Ga0068859_100249892 Ga0068859_1002498922 83
416 3300005617 Ga0068859_101470346 Ga0068859_1014703462 83
417 3300005618 Ga0068864_100374585 Ga0068864_1003745852 83
418 3300005718 Ga0068866_10002926 Ga0068866_100029266 83
419 3300005718 Ga0068866_10102612 Ga0068866_101026122 83
420 3300005840 Ga0068870_10211360 Ga0068870_102113602 83
421 3300005841 Ga0068863_100115613 Ga0068863_1001156133 83
422 3300005842 Ga0068858_100019950 Ga0068858_1000199503 83
423 3300005843 Ga0068860_100036507 Ga0068860_1000365072 83
424 3300005843 Ga0068860_100746585 Ga0068860_1007465852 83
425 3300005844 Ga0068862_100656714 Ga0068862_1006567142 83
426 3300005844 Ga0068862_100764424 Ga0068862_1007644242 83
427 3300006028 Ga0070717_10009383 Ga0070717_100093833 83
428 3300006028 Ga0070717_10410798 Ga0070717_104107982 83
429 3300006163 Ga0070715_10000114 Ga0070715_1000011415 83
430 3300006163 Ga0070715_10282225 Ga0070715_102822252 83
431 3300006173 Ga0070716_100015835 Ga0070716_1000158354 83
432 3300006173 Ga0070716_100018080 Ga0070716_1000180803 83
433 3300006173 Ga0070716_100090958 Ga0070716_1000909582 83
434 3300006175 Ga0070712_100001088 Ga0070712_1000010888 83
435 3300006175 Ga0070712_100032180 Ga0070712_1000321802 83
436 3300006175 Ga0070712_100162831 Ga0070712_1001628311 83
437 3300006237 Ga0097621_100045269 Ga0097621_1000452692 83
438 3300006237 Ga0097621_100534101 Ga0097621_1005341012 83
439 3300006358 Ga0068871_100019101 Ga0068871_1000191014 83
440 3300006844 Ga0075428_100006700 Ga0075428_10000670012 83
441 3300006846 Ga0075430_100107480 Ga0075430_1001074803 83
442 3300006847 Ga0075431_100126085 Ga0075431_1001260852 83
443 3300006847 Ga0075431_100919261 Ga0075431_1009192612 83
444 3300006852 Ga0075433_10000312 Ga0075433_1000031230 83
445 3300006871 Ga0075434_100000027 Ga0075434_10000002735 83
446 3300006871 Ga0075434_100033428 Ga0075434_1000334284 83
447 3300006881 Ga0068865_100003798 Ga0068865_1000037981 83
448 3300006881 Ga0068865_100051478 Ga0068865_1000514782 83
449 3300006881 Ga0068865_100321700 Ga0068865_1003217001 83
450 3300006914 Ga0075436_100509366 Ga0075436_1005093661 83
451 3300006914 Ga0075436_100512741 Ga0075436_1005127412 83
452 3300006931 Ga0097620_100249886 Ga0097620_1002498862 83
453 3300006931 Ga0097620_101470263 Ga0097620_1014702632 83
454 3300007076 Ga0075435_100089709 Ga0075435_1000897092 83
455 3300007076 Ga0075435_100102338 Ga0075435_1001023382 83
456 3300007076 Ga0075435_100435432 Ga0075435_1004354322 83
457 3300007265 Ga0099794_10145581 Ga0099794_101455812 83
458 3300009093 Ga0105240_10009095 Ga0105240_100090952 83
459 3300009093 Ga0105240_10985979 Ga0105240_109859792 83
460 3300009094 Ga0111539_10006985 Ga0111539_100069853 83
461 3300009094 Ga0111539_10193409 Ga0111539_101934092 83
462 3300009147 Ga0114129_10240458 Ga0114129_102404582 83
463 3300009174 Ga0105241_10330138 Ga0105241_103301383 83
464 3300009176 Ga0105242_10079411 Ga0105242_100794114 83
465 3300009176 Ga0105242_10250626 Ga0105242_102506263 83
466 3300009545 Ga0105237_10114154 Ga0105237_101141543 83
467 3300009551 Ga0105238_10003358 Ga0105238_1000335811 83
468 3300009553 Ga0105249_11301663 Ga0105249_113016632 83
469 3300010159 Ga0099796_10010448 Ga0099796_100104482 83
470 3300010375 Ga0105239_10654436 Ga0105239_106544362 83
471 3300013100 Ga0157373_10578476 Ga0157373_105784762 83
472 3300013104 Ga0157370_10011541 Ga0157370_100115419 83
473 3300013104 Ga0157370_10484692 Ga0157370_104846922 83
474 3300013105 Ga0157369_10039660 Ga0157369_100396603 83
475 3300013105 Ga0157369_10097953 Ga0157369_100979532 83
476 3300013105 Ga0157369_11374442 Ga0157369_113744422 83
477 3300013307 Ga0157372_11015739 Ga0157372_110157392 83
478 3300014326 Ga0157380_10007838 Ga0157380_100078386 83
479 3300014745 Ga0157377_10196529 Ga0157377_101965292 83
480 3300014745 Ga0157377_10349101 Ga0157377_103491012 83
481 3300020069 Ga0197907_10405711 Ga0197907_104057112 83
482 3300020075 Ga0206349_1423094 Ga0206349_14230941 83
483 3300020076 Ga0206355_1527855 Ga0206355_15278551 83
484 3300020077 Ga0206351_10505028 Ga0206351_105050282 83
485 3300020078 Ga0206352_10989618 Ga0206352_109896182 83
486 3300020081 Ga0206354_10471473 Ga0206354_104714732 83
487 3300020081 Ga0206354_11309011 Ga0206354_113090111 83
488 3300020082 Ga0206353_10649310 Ga0206353_106493102 83
489 3300020082 Ga0206353_10906586 Ga0206353_109065861 83
490 3300020610 Ga0154015_1228595 Ga0154015_12285952 83
491 3300020610 Ga0154015_1535633 Ga0154015_15356332 83
492 3300021377 Ga0213874_10010595 Ga0213874_100105952 83
493 3300021441 Ga0213871_10003766 Ga0213871_100037663 83
494 3300022467 Ga0224712_10295700 Ga0224712_102957002 83
495 3300022467 Ga0224712_10317742 Ga0224712_103177422 83
496 3300022467 Ga0224712_10351264 Ga0224712_103512642 83
497 3300025885 Ga0207653_10072720 Ga0207653_100727202 83
498 3300025898 Ga0207692_10006619 Ga0207692_100066194 83
499 3300025898 Ga0207692_10904545 Ga0207692_109045451 83
500 3300025899 Ga0207642_10009077 Ga0207642_100090773 83
501 3300025900 Ga0207710_10003821 Ga0207710_100038216 83
502 3300025903 Ga0207680_10051955 Ga0207680_100519552 83
503 3300025905 Ga0207685_10044484 Ga0207685_100444842 83
504 3300025906 Ga0207699_10008031 Ga0207699_100080312 83
505 3300025906 Ga0207699_10099195 Ga0207699_100991952 83
506 3300025907 Ga0207645_10000348 Ga0207645_1000034830 83
507 3300025907 Ga0207645_10522636 Ga0207645_105226362 83
508 3300025908 Ga0207643_10246781 Ga0207643_102467812 83
509 3300025909 Ga0207705_10597061 Ga0207705_105970612 83
510 3300025910 Ga0207684_11179288 Ga0207684_111792882 83
511 3300025911 Ga0207654_10874813 Ga0207654_108748132 83
512 3300025912 Ga0207707_10000202 Ga0207707_1000020249 83
513 3300025912 Ga0207707_10049339 Ga0207707_100493393 83
514 3300025912 Ga0207707_10998299 Ga0207707_109982991 83
515 3300025913 Ga0207695_10079448 Ga0207695_100794483 83
516 3300025913 Ga0207695_10148579 Ga0207695_101485792 83
517 3300025913 Ga0207695_10186441 Ga0207695_101864413 83
518 3300025914 Ga0207671_10059420 Ga0207671_100594203 83
519 3300025914 Ga0207671_10131595 Ga0207671_101315953 83
520 3300025915 Ga0207693_10000216 Ga0207693_1000021613 83
521 3300025915 Ga0207693_10149640 Ga0207693_101496402 83
522 3300025916 Ga0207663_10001899 Ga0207663_100018993 83
523 3300025916 Ga0207663_11158201 Ga0207663_111582012 83
524 3300025917 Ga0207660_10001921 Ga0207660_100019213 83
525 3300025917 Ga0207660_10245840 Ga0207660_102458402 83
526 3300025921 Ga0207652_10002554 Ga0207652_100025544 83
527 3300025921 Ga0207652_10031203 Ga0207652_100312033 83
528 3300025923 Ga0207681_10388533 Ga0207681_103885332 83
529 3300025923 Ga0207681_10665723 Ga0207681_106657232 83
530 3300025924 Ga0207694_10001276 Ga0207694_100012766 83
531 3300025925 Ga0207650_10860774 Ga0207650_108607742 83
532 3300025926 Ga0207659_10735132 Ga0207659_107351321 83
533 3300025926 Ga0207659_10910438 Ga0207659_109104382 83
534 3300025927 Ga0207687_10008944 Ga0207687_100089444 83
535 3300025928 Ga0207700_10062255 Ga0207700_100622552 83
536 3300025928 Ga0207700_10288652 Ga0207700_102886522 83
537 3300025928 Ga0207700_11554874 Ga0207700_115548741 83
538 3300025929 Ga0207664_10046950 Ga0207664_100469504 83
539 3300025929 Ga0207664_10383889 Ga0207664_103838892 83
540 3300025931 Ga0207644_10045386 Ga0207644_100453863 83
541 3300025931 Ga0207644_10838239 Ga0207644_108382391 83
542 3300025933 Ga0207706_10193601 Ga0207706_101936012 83
543 3300025933 Ga0207706_10757415 Ga0207706_107574152 83
544 3300025934 Ga0207686_10015664 Ga0207686_100156643 83
545 3300025934 Ga0207686_10428730 Ga0207686_104287302 83
546 3300025934 Ga0207686_11818198 Ga0207686_118181981 83
547 3300025937 Ga0207669_10008128 Ga0207669_100081286 83
548 3300025937 Ga0207669_10698626 Ga0207669_106986262 83
549 3300025938 Ga0207704_10025385 Ga0207704_100253854 83
550 3300025938 Ga0207704_10164081 Ga0207704_101640811 83
551 3300025939 Ga0207665_10025478 Ga0207665_100254782 83
552 3300025939 Ga0207665_10032084 Ga0207665_100320842 83
553 3300025939 Ga0207665_10313879 Ga0207665_103138791 83
554 3300025940 Ga0207691_10404384 Ga0207691_104043842 83
555 3300025941 Ga0207711_10044292 Ga0207711_100442923 83
556 3300025942 Ga0207689_10291810 Ga0207689_102918102 83
557 3300025949 Ga0207667_10005725 Ga0207667_1000572510 83
558 3300025949 Ga0207667_10016648 Ga0207667_100166483 83
559 3300025949 Ga0207667_10222004 Ga0207667_102220042 83
560 3300025960 Ga0207651_10097285 Ga0207651_100972852 83
561 3300025961 Ga0207712_10177423 Ga0207712_101774232 83
562 3300025961 Ga0207712_11935549 Ga0207712_119355492 83
563 3300025986 Ga0207658_10049346 Ga0207658_100493462 83
564 3300026023 Ga0207677_10029488 Ga0207677_100294883 83
565 3300026035 Ga0207703_10902227 Ga0207703_109022272 83
566 3300026035 Ga0207703_11427913 Ga0207703_114279131 83
567 3300026075 Ga0207708_10964897 Ga0207708_109648972 83
568 3300026078 Ga0207702_10029702 Ga0207702_100297026 83
569 3300026078 Ga0207702_10059820 Ga0207702_100598202 83
570 3300026078 Ga0207702_10374624 Ga0207702_103746242 83
571 3300026088 Ga0207641_10069596 Ga0207641_100695963 83
572 3300026089 Ga0207648_10004874 Ga0207648_100048749 83
573 3300026089 Ga0207648_10128023 Ga0207648_101280233 83
574 3300026089 Ga0207648_10527718 Ga0207648_105277182 83
575 3300026095 Ga0207676_10324632 Ga0207676_103246322 83
576 3300026116 Ga0207674_10152939 Ga0207674_101529393 83
577 3300026116 Ga0207674_10930031 Ga0207674_109300312 83
578 3300026118 Ga0207675_100140996 Ga0207675_1001409962 83
579 3300026118 Ga0207675_100820984 Ga0207675_1008209842 83
580 3300026118 Ga0207675_101598953 Ga0207675_1015989532 83
581 3300026121 Ga0207683_10004156 Ga0207683_100041566 83
582 3300026121 Ga0207683_10538789 Ga0207683_105387892 83
583 3300027907 Ga0207428_10002854 Ga0207428_1000285412 83
584 3300027907 Ga0207428_10027919 Ga0207428_100279192 83
585 3300027907 Ga0207428_10103630 Ga0207428_101036303 83
586 3300028379 Ga0268266_10098841 Ga0268266_100988412 83
587 3300028380 Ga0268265_10660502 Ga0268265_106605022 83
588 3300028381 Ga0268264_10678760 Ga0268264_106787601 83
589 3300028794 Ga0307515_10012124 Ga0307515_100121247 83
590 3300028794 Ga0307515_10425173 Ga0307515_104251732 83
591 3300031507 Ga0307509_10000099 Ga0307509_1000009919 83
592 3300031616 Ga0307508_10422939 Ga0307508_104229392 83
593 3300032004 Ga0307414_11565707 Ga0307414_115657071 83
594 3300035692 Ga0373935_0963129 Ga0373935_0963129_347_601 83
595 3300037418 Ga0395900_0125647 Ga0395900_0125647_446_700 83
596 3300037418 Ga0395900_0462554 Ga0395900_0462554_55_309 83
597 3300037466 Ga0395898_0002854 Ga0395898_0002854_7441_7695 83
598 3300037466 Ga0395898_0010069 Ga0395898_0010069_7434_7688 83
599 3300037466 Ga0395898_0188826 Ga0395898_0188826_1253_1507 83
600 3300038741 Ga0400488_56057 Ga0400488_56057_1521_1781 83
601 3300039110 Ga0400487_04101 Ga0400487_04101_11007_11267 83
602 3300039437 Ga0436365_1901520 Ga0436365_1901520_18_269 83
603 3300039447 Ga0436361_0193979 Ga0436361_0193979_101_358 83
604 3300042532 Ga0450893_0115065 Ga0450893_0115065_151_405 83
605 3300042876 Ga0451577_0007767 Ga0451577_0007767_3707_3964 83
606 3300042876 Ga0451577_0121837 Ga0451577_0121837_885_1142 83
607 3300044656 Ga0466969_0005066 Ga0466969_0005066_6563_6817 83
608 3300044656 Ga0466969_0318689 Ga0466969_0318689_196_450 83
609 3300044673 Ga0453683_0010066 Ga0453683_0010066_1385_1642 83
610 3300044684 Ga0466966_0000786 Ga0466966_0000786_1201_1455 83
611 3300044684 Ga0466966_0291869 Ga0466966_0291869_579_833 83
612 3300044693 Ga0466961_0010757 Ga0466961_0010757_483_737 83
613 3300044693 Ga0466961_0347682 Ga0466961_0347682_222_476 83
614 3300044694 Ga0466963_0088166 Ga0466963_0088166_1595_1849 83
615 3300044706 Ga0466964_0003849 Ga0466964_0003849_1204_1458 83
616 3300044712 Ga0453684_0032098 Ga0453684_0032098_346_603 83
617 3300044719 Ga0466971_0000163 Ga0466971_0000163_8248_8502 83
618 3300044765 Ga0466970_0012565 Ga0466970_0012565_192_446 83
619 3300044842 Ga0466957_0030205 Ga0466957_0030205_362_616 83
620 3300044842 Ga0466957_0177687 Ga0466957_0177687_92_346 83
621 3300045049 Ga0466959_0003333 Ga0466959_0003333_290_544 83
622 3300045049 Ga0466959_0483189 Ga0466959_0483189_286_540 83
623 3300045051 Ga0451576_0299623 Ga0451576_0299623_541_798 83
624 3300046472 Ga0495580_0006674 Ga0495580_0006674_17_274 83
625 3300046499 Ga0495594_0531328 Ga0495594_0531328_380_634 83
626 3300046689 Ga0495613_0368154 Ga0495613_0368154_705_959 83
627 3300046810 Ga0495660_0294296 Ga0495660_0294296_211_471 83
628 3300047673 Ga0495593_0142352 Ga0495593_0142352_864_1118 83
629 3300048905 Ga0496102_0080906 Ga0496102_0080906_510_761 83
630 3300048909 Ga0496106_0255709 Ga0496106_0255709_60_311 83
631 3300048911 Ga0496108_1211794 Ga0496108_1211794_225_476 83
632 3300048915 Ga0496112_0999450 Ga0496112_0999450_197_448 83
633 3300048916 Ga0496113_0306644 Ga0496113_0306644_1001_1255 83
634 3300049574 Ga0501038_0554907 Ga0501038_0554907_58_366 83
635 3300049575 Ga0501039_0912959 Ga0501039_0912959_369_629 83
636 3300049577 Ga0501041_0132475 Ga0501041_0132475_239_499 83
637 3300049580 Ga0501046_1231592 Ga0501046_1231592_84_344 83
638 3300049583 Ga0501067_0137701 Ga0501067_0137701_168_428 83
639 3300049584 Ga0501068_0076151 Ga0501068_0076151_1592_1852 83
640 3300049585 Ga0501069_0298343 Ga0501069_0298343_658_918 83
641 3300049588 Ga0501072_0053074 Ga0501072_0053074_1280_1540 83
642 3300049591 Ga0501075_0045553 Ga0501075_0045553_492_752 83
643 3300049592 Ga0501076_0118732 Ga0501076_0118732_191_451 83
644 3300049741 Ga0501079_0227407 Ga0501079_0227407_631_891 83
645 3300049743 Ga0501081_0175591 Ga0501081_0175591_792_1052 83
646 3300049822 Ga0501035_0080209 Ga0501035_0080209_1254_1562 83
647 3300049823 Ga0501044_0000213 Ga0501044_0000213_14803_15111 83
648 3300049824 Ga0501045_0833633 Ga0501045_0833633_102_362 83
649 3300050507 nmdc:mga05p37_65384_c1 nmdc:mga05p37_65384_c1_1084_1344 83
650 3300050508 nmdc:mga09592_798815_c1 nmdc:mga09592_798815_c1_224_484 83
651 3300050509 nmdc:mga0qj67_17472_c1 nmdc:mga0qj67_17472_c1_3995_4249 83
652 3300050510 nmdc:mga06r32_119848_c1 nmdc:mga06r32_119848_c1_2040_2294 83
653 3300050511 nmdc:mga08y16_139811_c1 nmdc:mga08y16_139811_c1_1108_1368 83
654 3300050511 nmdc:mga08y16_8740_c1 nmdc:mga08y16_8740_c1_8936_9196 83
655 3300050512 nmdc:mga0n895_143_c1 nmdc:mga0n895_143_c1_21104_21364 83
656 3300050513 nmdc:mga0rr50_113092_c1 nmdc:mga0rr50_113092_c1_713_973 83
657 3300050515 nmdc:mga0a205_87_c1 nmdc:mga0a205_87_c1_26463_26723 83
658 3300053139 Ga0500568_0215661 Ga0500568_0215661_197_460 83
659 3300053156 Ga0500622_0008492 Ga0500622_0008492_4817_5080 83
660 3300053178 Ga0500637_0111178 Ga0500637_0111178_372_653 83
661 3300059493 Ga0587077_262131 Ga0587077_262131_32_283 83
662 3300059507 Ga0587086_079837 Ga0587086_079837_161_412 83
663 3300060344 Ga0587071_116898 Ga0587071_116898_100_354 83
664 3300060353 Ga0501082_0474553 Ga0501082_0474553_484_744 83
665 3300061719 Ga0466962_0005596 Ga0466962_0005596_1324_1578 83
666 3300004799 Ga0058863_11949113 Ga0058863_119491132 84
667 3300004800 Ga0058861_12065226 Ga0058861_120652261 84
668 3300005329 Ga0070683_101041747 Ga0070683_1010417471 84
669 3300005329 Ga0070683_101809044 Ga0070683_1018090442 84
670 3300005329 Ga0070683_101836071 Ga0070683_1018360712 84
671 3300005336 Ga0070680_100049273 Ga0070680_1000492733 84
672 3300005366 Ga0070659_101398060 Ga0070659_1013980602 84
673 3300005367 Ga0070667_100000046 Ga0070667_10000004655 84
674 3300005458 Ga0070681_10694133 Ga0070681_106941332 84
675 3300005518 Ga0070699_100410948 Ga0070699_1004109481 84
676 3300005530 Ga0070679_100512099 Ga0070679_1005120992 84
677 3300005530 Ga0070679_102069949 Ga0070679_1020699492 84
678 3300005546 Ga0070696_100344676 Ga0070696_1003446762 84
679 3300005563 Ga0068855_100032463 Ga0068855_1000324632 84
680 3300005564 Ga0070664_101807266 Ga0070664_1018072662 84
681 3300005616 Ga0068852_101178901 Ga0068852_1011789012 84
682 3300005617 Ga0068859_100041725 Ga0068859_1000417254 84
683 3300005834 Ga0068851_10294574 Ga0068851_102945742 84
684 3300005841 Ga0068863_100391573 Ga0068863_1003915732 84
685 3300005841 Ga0068863_100818969 Ga0068863_1008189692 84
686 3300006038 Ga0075365_10000123 Ga0075365_1000012321 84
687 3300006042 Ga0075368_10058206 Ga0075368_100582061 84
688 3300006051 Ga0075364_10000745 Ga0075364_100007452 84
689 3300006178 Ga0075367_10000270 Ga0075367_100002706 84
690 3300006186 Ga0075369_10000133 Ga0075369_100001339 84
691 3300006237 Ga0097621_100821922 Ga0097621_1008219222 84
692 3300006880 Ga0075429_100004834 Ga0075429_1000048342 84
693 3300006931 Ga0097620_100041725 Ga0097620_1000417254 84
694 3300009092 Ga0105250_10030267 Ga0105250_100302673 84
695 3300009093 Ga0105240_10010581 Ga0105240_100105813 84
696 3300009101 Ga0105247_10118162 Ga0105247_101181622 84
697 3300009174 Ga0105241_11940537 Ga0105241_119405372 84
698 3300009177 Ga0105248_10152340 Ga0105248_101523402 84
699 3300009545 Ga0105237_10473642 Ga0105237_104736421 84
700 3300009545 Ga0105237_11942984 Ga0105237_119429841 84
701 3300009551 Ga0105238_10343773 Ga0105238_103437732 84
702 3300009553 Ga0105249_10216856 Ga0105249_102168563 84
703 3300009987 Ga0105030_100115 Ga0105030_1001155 84
704 3300014325 Ga0163163_10122312 Ga0163163_101223123 84
705 3300014326 Ga0157380_10102109 Ga0157380_101021092 84
706 3300014326 Ga0157380_11718502 Ga0157380_117185021 84
707 3300020077 Ga0206351_10986797 Ga0206351_109867972 84
708 3300020078 Ga0206352_10417728 Ga0206352_104177281 84
709 3300020080 Ga0206350_11527223 Ga0206350_115272232 84
710 3300020610 Ga0154015_1114833 Ga0154015_11148331 84
711 3300025321 Ga0207656_10196151 Ga0207656_101961512 84
712 3300025711 Ga0207696_1054385 Ga0207696_10543852 84
713 3300025900 Ga0207710_10068075 Ga0207710_100680752 84
714 3300025903 Ga0207680_10022402 Ga0207680_100224023 84
715 3300025911 Ga0207654_10484983 Ga0207654_104849832 84
716 3300025912 Ga0207707_10014584 Ga0207707_100145845 84
717 3300025913 Ga0207695_10010951 Ga0207695_100109514 84
718 3300025913 Ga0207695_11092592 Ga0207695_110925922 84
719 3300025914 Ga0207671_10405741 Ga0207671_104057411 84
720 3300025914 Ga0207671_10722301 Ga0207671_107223012 84
721 3300025914 Ga0207671_11460347 Ga0207671_114603471 84
722 3300025919 Ga0207657_10318477 Ga0207657_103184772 84
723 3300025924 Ga0207694_10960856 Ga0207694_109608562 84
724 3300025924 Ga0207694_11153545 Ga0207694_111535452 84
725 3300025932 Ga0207690_10977755 Ga0207690_109777552 84
726 3300025941 Ga0207711_10486760 Ga0207711_104867602 84
727 3300025949 Ga0207667_10108588 Ga0207667_101085882 84
728 3300025961 Ga0207712_10121945 Ga0207712_101219453 84
729 3300025986 Ga0207658_10001515 Ga0207658_1000151522 84
730 3300026088 Ga0207641_11170754 Ga0207641_111707542 84
731 3300026142 Ga0207698_11139805 Ga0207698_111398052 84
732 3300027526 Ga0209968_1036269 Ga0209968_10362691 84
733 3300027543 Ga0209999_1049771 Ga0209999_10497712 84
734 3300027617 Ga0210002_1009907 Ga0210002_10099072 84
735 3300027682 Ga0209971_1020840 Ga0209971_10208401 84
736 3300027866 Ga0209813_10051262 Ga0209813_100512621 84
737 3300027876 Ga0209974_10224265 Ga0209974_102242652 84
738 3300030863 Ga0265766_1025514 Ga0265766_10255142 84
739 3300031242 Ga0265329_10048463 Ga0265329_100484632 84
740 3300031247 Ga0265340_10015618 Ga0265340_100156183 84
741 3300031548 Ga0307408_100106988 Ga0307408_1001069883 84
742 3300031548 Ga0307408_100846601 Ga0307408_1008466011 84
743 3300031665 Ga0316575_10057693 Ga0316575_100576932 84
744 3300031727 Ga0316576_10002081 Ga0316576_100020813 84
745 3300031728 Ga0316578_10067900 Ga0316578_100679002 84
746 3300031731 Ga0307405_10273768 Ga0307405_102737682 84
747 3300031731 Ga0307405_10834885 Ga0307405_108348852 84
748 3300031733 Ga0316577_10692902 Ga0316577_106929021 84
749 3300031852 Ga0307410_10317148 Ga0307410_103171482 84
750 3300031901 Ga0307406_10946672 Ga0307406_109466722 84
751 3300031901 Ga0307406_10979171 Ga0307406_109791712 84
752 3300031903 Ga0307407_10832953 Ga0307407_108329532 84
753 3300031903 Ga0307407_11567500 Ga0307407_115675002 84
754 3300031911 Ga0307412_12041327 Ga0307412_120413272 84
755 3300031995 Ga0307409_101475498 Ga0307409_1014754982 84
756 3300032002 Ga0307416_100061146 Ga0307416_1000611463 84
757 3300032002 Ga0307416_100360376 Ga0307416_1003603762 84
758 3300032005 Ga0307411_10117261 Ga0307411_101172612 84
759 3300032005 Ga0307411_10349344 Ga0307411_103493442 84
760 3300032126 Ga0307415_100814957 Ga0307415_1008149572 84
761 3300034820 Ga0373959_0084114 Ga0373959_0084114_124_384 84
762 3300035398 Ga0316574_0000008 Ga0316574_0000008_44407_44667 84
763 3300036647 Ga0316582_0117086 Ga0316582_0117086_791_1051 84
764 3300036712 Ga0316584_0006318 Ga0316584_0006318_5568_5828 84
765 3300039453 Ga0436362_0935429 Ga0436362_0935429_182_460 84
766 3300039453 Ga0436362_1215006 Ga0436362_1215006_340_597 84
767 3300041404 Ga0439436_0126878 Ga0439436_0126878_409_672 84
768 3300041406 Ga0439439_0050483 Ga0439439_0050483_592_855 84
769 3300041410 Ga0439461_0218811 Ga0439461_0218811_226_489 84
770 3300041458 Ga0451798_0012111 Ga0451798_0012111_220_477 84
771 3300041997 Ga0439431_0120431 Ga0439431_0120431_209_472 84
772 3300041997 Ga0439431_0193156 Ga0439431_0193156_313_576 84
773 3300041999 Ga0439433_0079396 Ga0439433_0079396_473_736 84
774 3300042002 Ga0439442_041737 Ga0439442_041737_565_828 84
775 3300042003 Ga0439443_097767 Ga0439443_097767_76_342 84
776 3300042004 Ga0439445_0076482 Ga0439445_0076482_342_605 84
777 3300042013 Ga0439456_154930 Ga0439456_154930_53_319 84
778 3300042122 Ga0450920_002893 Ga0450920_002893_917_1180 84
779 3300042125 Ga0450923_000690 Ga0450923_000690_2888_3151 84
780 3300042132 Ga0450895_029275 Ga0450895_029275_148_411 84
781 3300042133 Ga0450896_000264 Ga0450896_000264_159_422 84
782 3300042134 Ga0450898_074331 Ga0450898_074331_363_626 84
783 3300042146 Ga0450907_005068 Ga0450907_005068_912_1175 84
784 3300042147 Ga0450910_013101 Ga0450910_013101_521_784 84
785 3300042156 Ga0439446_0010932 Ga0439446_0010932_1348_1611 84
786 3300042184 Ga0450908_010340 Ga0450908_010340_185_448 84
787 3300042435 Ga0439434_0024041 Ga0439434_0024041_607_870 84
788 3300042435 Ga0439434_0083345 Ga0439434_0083345_379_642 84
789 3300042435 Ga0439434_0117598 Ga0439434_0117598_325_588 84
790 3300042436 Ga0439435_0029012 Ga0439435_0029012_47_313 84
791 3300042531 Ga0450918_003499 Ga0450918_003499_1161_1424 84
792 3300042531 Ga0450918_016616 Ga0450918_016616_815_1078 84
793 3300042876 Ga0451577_0141164 Ga0451577_0141164_588_845 84
794 3300042876 Ga0451577_0235064 Ga0451577_0235064_1058_1318 84
795 3300042876 Ga0451577_0440250 Ga0451577_0440250_199_459 84
796 3300042876 Ga0451577_0649751 Ga0451577_0649751_94_354 84
797 3300042876 Ga0451577_1189484 Ga0451577_1189484_349_609 84
798 3300044712 Ga0453684_0267228 Ga0453684_0267228_1186_1446 84
799 3300044712 Ga0453684_0444488 Ga0453684_0444488_887_1147 84
800 3300044712 Ga0453684_0445858 Ga0453684_0445858_1140_1400 84
801 3300044712 Ga0453684_1473551 Ga0453684_1473551_376_633 84
802 3300045051 Ga0451576_0032859 Ga0451576_0032859_748_1008 84
803 3300045051 Ga0451576_0203336 Ga0451576_0203336_1470_1727 84
804 3300045051 Ga0451576_0409214 Ga0451576_0409214_749_1009 84
805 3300049569 Ga0501032_0301958 Ga0501032_0301958_219_482 84
806 3300049572 Ga0501036_0573282 Ga0501036_0573282_429_692 84
807 3300049575 Ga0501039_0296177 Ga0501039_0296177_373_636 84
808 3300049575 Ga0501039_0677630 Ga0501039_0677630_178_441 84
809 3300049576 Ga0501040_0150960 Ga0501040_0150960_1033_1296 84
810 3300049577 Ga0501041_0238682 Ga0501041_0238682_91_354 84
811 3300049577 Ga0501041_0715798 Ga0501041_0715798_45_308 84
812 3300049577 Ga0501041_0854342 Ga0501041_0854342_171_434 84
813 3300049578 Ga0501042_0373765 Ga0501042_0373765_101_364 84
814 3300049578 Ga0501042_1036441 Ga0501042_1036441_311_574 84
815 3300049583 Ga0501067_0040984 Ga0501067_0040984_1941_2204 84
816 3300049584 Ga0501068_0203673 Ga0501068_0203673_152_415 84
817 3300049585 Ga0501069_0264716 Ga0501069_0264716_232_495 84
818 3300049587 Ga0501071_0460106 Ga0501071_0460106_637_900 84
819 3300049589 Ga0501073_0005924 Ga0501073_0005924_6613_6876 84
820 3300049589 Ga0501073_0484346 Ga0501073_0484346_165_428 84
821 3300049590 Ga0501074_0206914 Ga0501074_0206914_511_774 84
822 3300049591 Ga0501075_0353365 Ga0501075_0353365_526_789 84
823 3300049592 Ga0501076_0226463 Ga0501076_0226463_28_291 84
824 3300049592 Ga0501076_0439570 Ga0501076_0439570_475_738 84
825 3300049592 Ga0501076_0526696 Ga0501076_0526696_94_357 84
826 3300049592 Ga0501076_0892340 Ga0501076_0892340_277_540 84
827 3300049592 Ga0501076_1467435 Ga0501076_1467435_68_331 84
828 3300049593 Ga0501077_0051134 Ga0501077_0051134_1828_2091 84
829 3300049593 Ga0501077_0231758 Ga0501077_0231758_466_729 84
830 3300049669 Ga0501235_107102 Ga0501235_107102_244_504 84
831 3300049741 Ga0501079_0189001 Ga0501079_0189001_608_871 84
832 3300049741 Ga0501079_0982524 Ga0501079_0982524_32_295 84
833 3300049742 Ga0501080_0010309 Ga0501080_0010309_6767_7030 84
834 3300049742 Ga0501080_0220020 Ga0501080_0220020_1064_1327 84
835 3300049743 Ga0501081_0018675 Ga0501081_0018675_4191_4454 84
836 3300049743 Ga0501081_0288189 Ga0501081_0288189_888_1151 84
837 3300049743 Ga0501081_0446034 Ga0501081_0446034_196_459 84
838 3300049824 Ga0501045_0093118 Ga0501045_0093118_1907_2170 84
839 3300049824 Ga0501045_0278582 Ga0501045_0278582_65_328 84
840 3300049824 Ga0501045_1158417 Ga0501045_1158417_266_529 84
841 3300050491 nmdc:mga00v17_108_c1 nmdc:mga00v17_108_c1_31763_32059 84
842 3300053104 Ga0500556_0000737 Ga0500556_0000737_12943_13209 84
843 3300054114 Ga0501084_0015172 Ga0501084_0015172_2428_2691 84
844 3300054114 Ga0501084_0548143 Ga0501084_0548143_282_545 84
845 3300059492 Ga0587073_0121639 Ga0587073_0121639_131_388 84
846 3300060353 Ga0501082_0290748 Ga0501082_0290748_696_959 84
847 3300060353 Ga0501082_0783371 Ga0501082_0783371_386_649 84
848 3300061734 Ga0530510_0847068 Ga0530510_0847068_49_312 84
849 3300000546 LJNas_1012025 LJNas_10120252 85
850 3300005354 Ga0070675_100819619 Ga0070675_1008196191 85
851 3300005364 Ga0070673_101449785 Ga0070673_1014497851 85
852 3300005439 Ga0070711_100008013 Ga0070711_1000080132 85
853 3300005456 Ga0070678_100991635 Ga0070678_1009916351 85
854 3300005548 Ga0070665_100713597 Ga0070665_1007135971 85
855 3300005618 Ga0068864_100613100 Ga0068864_1006131002 85
856 3300006163 Ga0070715_10187865 Ga0070715_101878651 85
857 3300006173 Ga0070716_100097671 Ga0070716_1000976712 85
858 3300006175 Ga0070712_100407717 Ga0070712_1004077172 85
859 3300006237 Ga0097621_100380210 Ga0097621_1003802102 85
860 3300007265 Ga0099794_10077367 Ga0099794_100773672 85
861 3300007788 Ga0099795_10020640 Ga0099795_100206402 85
862 3300010159 Ga0099796_10001828 Ga0099796_100018283 85
863 3300019166 Ga0184595_111233 Ga0184595_1112332 85
864 3300019166 Ga0184595_115396 Ga0184595_1153962 85
865 3300019176 Ga0184596_108580 Ga0184596_1085802 85
866 3300019177 Ga0184592_112061 Ga0184592_1120611 85
867 3300019181 Ga0184594_102903 Ga0184594_1029031 85
868 3300019181 Ga0184594_106280 Ga0184594_1062801 85
869 3300019183 Ga0184601_141254 Ga0184601_1412541 85
870 3300019188 Ga0184599_104977 Ga0184599_1049772 85
871 3300019190 Ga0184600_102423 Ga0184600_1024232 85
872 3300019192 Ga0184603_130163 Ga0184603_1301631 85
873 3300023552 Ga0247551_102277 Ga0247551_1022772 85
874 3300023672 Ga0247553_112138 Ga0247553_1121381 85
875 3300024225 Ga0224572_1020614 Ga0224572_10206142 85
876 3300025905 Ga0207685_10202116 Ga0207685_102021162 85
877 3300025915 Ga0207693_10354350 Ga0207693_103543502 85
878 3300025916 Ga0207663_10020373 Ga0207663_100203734 85
879 3300025923 Ga0207681_10895643 Ga0207681_108956431 85
880 3300025926 Ga0207659_10717300 Ga0207659_107173002 85
881 3300025939 Ga0207665_10125025 Ga0207665_101250252 85
882 3300025949 Ga0207667_11222646 Ga0207667_112226461 85
883 3300025960 Ga0207651_11341447 Ga0207651_113414471 85
884 3300026095 Ga0207676_10535210 Ga0207676_105352101 85
885 3300026121 Ga0207683_10512380 Ga0207683_105123802 85
886 3300027512 Ga0209179_1001253 Ga0209179_10012532 85
887 3300028016 Ga0265354_1001940 Ga0265354_10019403 85
888 3300028017 Ga0265356_1042562 Ga0265356_10425621 85
889 3300028023 Ga0265357_1005632 Ga0265357_10056322 85
890 3300028036 Ga0265355_1000217 Ga0265355_10002172 85
891 3300028800 Ga0265338_10981117 Ga0265338_109811171 85
892 3300030760 Ga0265762_1015920 Ga0265762_10159202 85
893 3300030760 Ga0265762_1028726 Ga0265762_10287262 85
894 3300030760 Ga0265762_1041940 Ga0265762_10419402 85
895 3300030762 Ga0265775_106920 Ga0265775_1069202 85
896 3300030762 Ga0265775_108790 Ga0265775_1087901 85
897 3300030763 Ga0265763_1001528 Ga0265763_10015282 85
898 3300030763 Ga0265763_1009000 Ga0265763_10090002 85
899 3300030763 Ga0265763_1054121 Ga0265763_10541211 85
900 3300030836 Ga0265767_102081 Ga0265767_1020812 85
901 3300030863 Ga0265766_1003039 Ga0265766_10030392 85
902 3300030863 Ga0265766_1015288 Ga0265766_10152881 85
903 3300030877 Ga0265777_109944 Ga0265777_1099442 85
904 3300030877 Ga0265777_121609 Ga0265777_1216091 85
905 3300030877 Ga0265777_123747 Ga0265777_1237472 85
906 3300030878 Ga0265770_1020946 Ga0265770_10209462 85
907 3300030878 Ga0265770_1131537 Ga0265770_11315372 85
908 3300030878 Ga0265770_1157943 Ga0265770_11579431 85
909 3300030879 Ga0265765_1007126 Ga0265765_10071262 85
910 3300030879 Ga0265765_1051988 Ga0265765_10519882 85
911 3300030880 Ga0265776_103094 Ga0265776_1030942 85
912 3300030882 Ga0265764_101304 Ga0265764_1013042 85
913 3300030886 Ga0265772_101130 Ga0265772_1011302 85
914 3300030886 Ga0265772_107555 Ga0265772_1075551 85
915 3300030888 Ga0265769_110822 Ga0265769_1108222 85
916 3300030889 Ga0265761_112875 Ga0265761_1128751 85
917 3300030963 Ga0265768_103830 Ga0265768_1038302 85
918 3300031010 Ga0265771_1015496 Ga0265771_10154961 85
919 3300031018 Ga0265773_1010359 Ga0265773_10103592 85
920 3300031090 Ga0265760_10057296 Ga0265760_100572962 85
921 3300031090 Ga0265760_10120466 Ga0265760_101204661 85
922 3300031241 Ga0265325_10522956 Ga0265325_105229561 85
923 3300031241 Ga0265325_10527284 Ga0265325_105272842 85
924 3300031249 Ga0265339_10127256 Ga0265339_101272562 85
925 3300031616 Ga0307508_10635106 Ga0307508_106351062 85
926 3300031730 Ga0307516_10000794 Ga0307516_1000079411 85
927 3300032120 Ga0316053_104287 Ga0316053_1042872 85
928 3300032120 Ga0316053_104697 Ga0316053_1046972 85
929 3300033180 Ga0307510_10270889 Ga0307510_102708892 85
930 3300033547 Ga0316212_1058301 Ga0316212_10583011 85
931 3300035724 Ga0373933_0390731 Ga0373933_0390731_26_283 85
932 3300036457 Ga0265778_055594 Ga0265778_055594_248_505 85
933 3300036457 Ga0265778_060894 Ga0265778_060894_211_468 85
934 3300037853 Ga0436364_0164812 Ga0436364_0164812_643_900 85
935 3300046543 Ga0495645_0790949 Ga0495645_0790949_291_548 85
936 3300048918 Ga0496115_0339614 Ga0496115_0339614_123_380 85
937 3300053077 Ga0495601_0207595 Ga0495601_0207595_48_305 85
938 3300053085 Ga0495619_0402886 Ga0495619_0402886_71_328 85

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17209

Hfq

Hfq protein

6

68

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
8bvj-assembly1.cif.gz_U hfq-crc-esta translation repression complex 0.9736 8 68
3hfn-assembly1.cif.gz_B crystal structure of an hfq protein from anabaena sp. 0.9683 11 64
3sb2-assembly1.cif.gz_C crystal structure of the rna chaperone hfq from herbaspirillum seropedicae smr1 0.9674 7 66
3hfo-assembly1.cif.gz_B crystal structure of an hfq protein from synechocystis sp. 0.9655 11 66
2yht-assembly1.cif.gz_A crystal structure of hfq riboregulator from e. coli (p1 space group) 0.9631 6 68
ID Description Score Start End Superfamily
3hfnB00 Mainly Beta;Roll;SH3 type barrels.; 0.9683 11 64 2.30.30.100
3hfoB00 Mainly Beta;Roll;SH3 type barrels.; 0.9654 11 66 2.30.30.100
3hsbD00 Mainly Beta;Roll;SH3 type barrels.; 0.9462 6 70 2.30.30.100
3qsuF00 Mainly Beta;Roll;SH3 type barrels.; 0.9444 6 63 2.30.30.100
af_A0A1D6E9S1_12_126_2.30.30.100 Mainly Beta;Roll;SH3 type barrels.; 0.9075 19 66 2.30.30.100
ID Description Score Start End GO Terms
AF-A0A383CSK0-F1-model_v4 Sm domain-containing protein 1.01 9 70 GO:0003723
GO:0005829
GO:0006355
GO:0043487
GO:0045974
AF-A0A1G3Y8L1-F1-model_v4 RNA chaperone Hfq 0.9891 9 72 GO:0003723
GO:0005829
GO:0006355
GO:0043487
GO:0045974
AF-A0A7D5GWE5-F1-model_v4 RNA-binding protein Hfq 0.9796 7 70 GO:0003723
GO:0005829
GO:0006355
GO:0043487
GO:0045974
AF-A0A5M8SLT8-F1-model_v4 Hfq-related domain-containing protein 0.9769 11 65
AF-A0A259EW12-F1-model_v4 RNA-binding protein Hfq 0.9765 8 72 GO:0003723
GO:0005829
GO:0006355
GO:0043487
GO:0045974

Feature Viewer

pLDDT pTM Quality
82.84 0.68 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map