F486245
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 938 | 461 | 928 | 84 |
Family's Representative Sequence
| Representative Sequence | 3300006038|Ga0075365_10000123|Ga0075365_1000012321 |
| Length | 93 |
| Sequence | MSKGQLQDPFLNALRKDKVPVSIYLVNGIKLQGLVESFDQFVVLLKNSVSQMVYKHAISTVVPAKNVKLASIDESNDLQSCNATDEELEITNA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2687453129 | Halotalea alkalilenta IHB B 13600 | Isolate | Unclassified |
| 2 | 2734482258 | Glomeribacter sp. phylotype 3 | Isolate | Unclassified |
| 3 | 2842391507 | Stenotrophomonas maltophilia SEMIA 4027 | Isolate | Nodule |
| 4 | 2919134579 | Stenotrophomonas geniculata 1733 | Isolate | Rhizosphere |
| 5 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 6 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 7 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 8 | 2952252522 | Salinicola sp. DM10 | Isolate | Unclassified |
| 9 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 10 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 11 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 12 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 13 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 14 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 15 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 17 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 23 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 27 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 52 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 58 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 66 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 68 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 69 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 70 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 71 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 72 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 73 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 74 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 75 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 76 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 77 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 78 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 79 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 80 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 81 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 83 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 84 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 85 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 87 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 89 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 90 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 91 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 93 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 94 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 95 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 96 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 97 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 98 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 99 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 100 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 101 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 103 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 104 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 105 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009987 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG | Metagenome | Rhizosphere |
| 118 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 119 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300019166 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 135 | 3300019176 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 136 | 3300019177 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI1 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 137 | 3300019181 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI3 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 138 | 3300019183 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA1 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 139 | 3300019188 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE2 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 140 | 3300019190 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE3 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 141 | 3300019192 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA3 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 142 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 143 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 144 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 145 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 146 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 147 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 148 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 149 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 150 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 151 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 152 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 153 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 154 | 3300023552 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 155 | 3300023672 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 156 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 157 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 222 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 224 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 225 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 226 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 227 | 3300028036 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 | Metagenome | Rhizosphere |
| 228 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 232 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 233 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 234 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 235 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 236 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 237 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 238 | 3300030762 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 239 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 240 | 3300030836 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 241 | 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 242 | 3300030877 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 243 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 244 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 245 | 3300030880 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 246 | 3300030882 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 247 | 3300030886 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 248 | 3300030888 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 249 | 3300030889 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 250 | 3300030963 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 251 | 3300031010 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 252 | 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 253 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 254 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 255 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 256 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 257 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 258 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 259 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 260 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 261 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 262 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 263 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 264 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 265 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 266 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 267 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 268 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 269 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 270 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 271 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 272 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 273 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 274 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 275 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 276 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 277 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 278 | 3300031814 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 279 | 3300031816 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Unclassified |
| 280 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 281 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 282 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 283 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 284 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 285 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 286 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 287 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 288 | 3300032120 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 289 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 290 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 291 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 292 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 293 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 294 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 295 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 296 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 297 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 298 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 299 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 300 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 301 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 302 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 303 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 304 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 305 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 306 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 307 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 308 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 309 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 310 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 311 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 312 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 313 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 314 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 315 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 316 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 317 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 318 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 319 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 320 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 321 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 322 | 3300041916 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run | Metatranscriptome | Unclassified |
| 323 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 324 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 325 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 326 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 327 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 328 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 329 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 330 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 331 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 332 | 3300042132 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 | Metagenome | Rhizosphere |
| 333 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 334 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 335 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 336 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 337 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 338 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 339 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 340 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 341 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 342 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 343 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 344 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 345 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 346 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 347 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 348 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 349 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 350 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 351 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 352 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 353 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 354 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 355 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 356 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 357 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 369 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 370 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 371 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 372 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 373 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 374 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 375 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 376 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 377 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 378 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 379 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 380 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 381 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 382 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 383 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 384 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 385 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 386 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 387 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 388 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 389 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 390 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 391 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 392 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 393 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 394 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 395 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 396 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 397 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 398 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 399 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 400 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 401 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 402 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 403 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 404 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 405 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 406 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 407 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 408 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 409 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 410 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 411 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 412 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 413 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 414 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 415 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 416 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 417 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 418 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 419 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 420 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 421 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 422 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 423 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 424 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 425 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 426 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 427 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 428 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 429 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 430 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 431 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 432 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 433 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 436 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 437 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 438 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 439 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 440 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 441 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 442 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 443 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 444 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 445 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 446 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 447 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 448 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 449 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 450 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 451 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 452 | 3300059631 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 453 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 454 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 455 | 3300059648 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 456 | 3300059660 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 457 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 458 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 459 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 460 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 461 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 87.95 |
| Metatranscriptomes | 10.98 |
| Isolates | 1.07 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.24 |
| Nodule | 0.11 |
| Rhizoplane | 1.81 |
| Rhizosphere | 91.68 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.16 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1012025 | 3300000546 | Bacteria | 921 |
| 2 | JGI25150J39212_1003589 | 3300002774 | Bacteria | 3614 |
| 3 | JGI25151J46595_10043569 | 3300003187 | Bacteria | 1604 |
| 4 | Ga0058863_11949113 | 3300004799 | Bacteria | 882 |
| 5 | Ga0058861_12065226 | 3300004800 | Bacteria | 757 |
| 6 | Ga0065704_10010159 | 3300005289 | Bacteria | 1837 |
| 7 | Ga0065712_10326864 | 3300005290 | Bacteria | 820 |
| 8 | Ga0065707_10728472 | 3300005295 | Bacteria | 627 |
| 9 | Ga0070658_10405905 | 3300005327 | Bacteria | 1171 |
| 10 | Ga0070676_10628618 | 3300005328 | Bacteria | 777 |
| 11 | Ga0070676_10692443 | 3300005328 | Bacteria | 743 |
| 12 | Ga0070676_11373448 | 3300005328 | Bacteria | 541 |
| 13 | Ga0070683_101041747 | 3300005329 | Bacteria | 786 |
| 14 | Ga0070683_101809044 | 3300005329 | Bacteria | 587 |
| 15 | Ga0070683_101836071 | 3300005329 | Bacteria | 582 |
| 16 | Ga0070670_100007886 | 3300005331 | Bacteria | 9056 |
| 17 | Ga0070670_101575436 | 3300005331 | Bacteria | 604 |
| 18 | Ga0068869_100104307 | 3300005334 | Bacteria | 2149 |
| 19 | Ga0068869_101434245 | 3300005334 | Bacteria | 612 |
| 20 | Ga0068869_101477263 | 3300005334 | Bacteria | 603 |
| 21 | Ga0070666_10013838 | 3300005335 | Bacteria | 5127 |
| 22 | Ga0070666_10268853 | 3300005335 | Bacteria | 1210 |
| 23 | Ga0070666_11239743 | 3300005335 | Bacteria | 556 |
| 24 | Ga0070680_100049273 | 3300005336 | Bacteria | 3433 |
| 25 | Ga0070680_100068715 | 3300005336 | Bacteria | 2908 |
| 26 | Ga0070680_100069721 | 3300005336 | Bacteria | 2887 |
| 27 | Ga0070682_100134969 | 3300005337 | Bacteria | 1675 |
| 28 | Ga0068868_100018297 | 3300005338 | Bacteria | 5235 |
| 29 | Ga0068868_100032185 | 3300005338 | Bacteria | 4033 |
| 30 | Ga0070689_100820682 | 3300005340 | Bacteria | 819 |
| 31 | Ga0070689_102237712 | 3300005340 | Bacteria | 501 |
| 32 | Ga0070687_101274618 | 3300005343 | Bacteria | 545 |
| 33 | Ga0070692_11349642 | 3300005345 | Bacteria | 513 |
| 34 | Ga0070669_100160143 | 3300005353 | Bacteria | 1748 |
| 35 | Ga0070669_100566157 | 3300005353 | Bacteria | 949 |
| 36 | Ga0070669_100844812 | 3300005353 | Bacteria | 780 |
| 37 | Ga0070669_100919071 | 3300005353 | Bacteria | 748 |
| 38 | Ga0070675_100074763 | 3300005354 | Bacteria | 2815 |
| 39 | Ga0070675_100819619 | 3300005354 | Bacteria | 851 |
| 40 | Ga0070675_101794310 | 3300005354 | Bacteria | 566 |
| 41 | Ga0070671_100015878 | 3300005355 | Bacteria | 6082 |
| 42 | Ga0070671_100018983 | 3300005355 | Bacteria | 5591 |
| 43 | Ga0070674_100283647 | 3300005356 | Bacteria | 1314 |
| 44 | Ga0070674_100896987 | 3300005356 | Bacteria | 772 |
| 45 | Ga0070673_100121783 | 3300005364 | Bacteria | 2177 |
| 46 | Ga0070673_101096215 | 3300005364 | Bacteria | 744 |
| 47 | Ga0070673_101449785 | 3300005364 | Bacteria | 647 |
| 48 | Ga0070688_100857655 | 3300005365 | Bacteria | 714 |
| 49 | Ga0070659_100436156 | 3300005366 | Bacteria | 1109 |
| 50 | Ga0070659_101398060 | 3300005366 | Bacteria | 622 |
| 51 | Ga0070667_100000046 | 3300005367 | Bacteria | 162942 |
| 52 | Ga0070667_100004160 | 3300005367 | Bacteria | 12231 |
| 53 | Ga0070667_100038957 | 3300005367 | Bacteria | 3985 |
| 54 | Ga0070709_10053834 | 3300005434 | Bacteria | 2535 |
| 55 | Ga0070709_10264091 | 3300005434 | Bacteria | 1245 |
| 56 | Ga0070714_100008875 | 3300005435 | Bacteria | 7864 |
| 57 | Ga0070714_100103127 | 3300005435 | Bacteria | 2516 |
| 58 | Ga0070714_100160828 | 3300005435 | Bacteria | 2032 |
| 59 | Ga0070713_100002296 | 3300005436 | Bacteria | 12440 |
| 60 | Ga0070713_100022771 | 3300005436 | Bacteria | 4847 |
| 61 | Ga0070713_100263809 | 3300005436 | Bacteria | 1575 |
| 62 | Ga0070713_101066172 | 3300005436 | Bacteria | 780 |
| 63 | Ga0070710_10010095 | 3300005437 | Bacteria | 4633 |
| 64 | Ga0070710_10354064 | 3300005437 | Bacteria | 972 |
| 65 | Ga0070710_10598765 | 3300005437 | Bacteria | 767 |
| 66 | Ga0070710_11115080 | 3300005437 | Bacteria | 580 |
| 67 | Ga0070711_100001034 | 3300005439 | Bacteria | 14805 |
| 68 | Ga0070711_100008013 | 3300005439 | Bacteria | 6448 |
| 69 | Ga0070705_100182697 | 3300005440 | Bacteria | 1422 |
| 70 | Ga0070705_100316720 | 3300005440 | Bacteria | 1124 |
| 71 | Ga0070700_100023816 | 3300005441 | Bacteria | 3586 |
| 72 | Ga0070700_101026947 | 3300005441 | Bacteria | 679 |
| 73 | Ga0070694_100325892 | 3300005444 | Bacteria | 1183 |
| 74 | Ga0070694_100467465 | 3300005444 | Bacteria | 999 |
| 75 | Ga0070708_100108966 | 3300005445 | Bacteria | 2544 |
| 76 | Ga0070663_100426932 | 3300005455 | Bacteria | 1088 |
| 77 | Ga0070663_101054531 | 3300005455 | Bacteria | 709 |
| 78 | Ga0070678_100175756 | 3300005456 | Bacteria | 1748 |
| 79 | Ga0070678_100991635 | 3300005456 | Bacteria | 772 |
| 80 | Ga0070678_101671105 | 3300005456 | Bacteria | 599 |
| 81 | Ga0070662_100876270 | 3300005457 | Bacteria | 765 |
| 82 | Ga0070681_10012472 | 3300005458 | Bacteria | 8432 |
| 83 | Ga0070681_10013550 | 3300005458 | Bacteria | 8109 |
| 84 | Ga0070681_10063063 | 3300005458 | Bacteria | 3679 |
| 85 | Ga0070681_10694133 | 3300005458 | Bacteria | 933 |
| 86 | Ga0070681_11055348 | 3300005458 | Bacteria | 733 |
| 87 | Ga0070681_12019274 | 3300005458 | Bacteria | 505 |
| 88 | Ga0068867_100002191 | 3300005459 | Bacteria | 13716 |
| 89 | Ga0068867_100091261 | 3300005459 | Bacteria | 2312 |
| 90 | Ga0068867_100356763 | 3300005459 | Bacteria | 1222 |
| 91 | Ga0070706_100020554 | 3300005467 | Bacteria | 6084 |
| 92 | Ga0070706_101358474 | 3300005467 | Bacteria | 651 |
| 93 | Ga0070707_100014717 | 3300005468 | Bacteria | 7333 |
| 94 | Ga0070699_100410948 | 3300005518 | Bacteria | 1224 |
| 95 | Ga0070679_100001170 | 3300005530 | Bacteria | 22959 |
| 96 | Ga0070679_100038227 | 3300005530 | Bacteria | 4771 |
| 97 | Ga0070679_100512099 | 3300005530 | Bacteria | 1144 |
| 98 | Ga0070679_102069949 | 3300005530 | Bacteria | 518 |
| 99 | Ga0070679_102132180 | 3300005530 | Bacteria | 510 |
| 100 | Ga0070697_101101118 | 3300005536 | Bacteria | 707 |
| 101 | Ga0068853_100019298 | 3300005539 | Bacteria | 5652 |
| 102 | Ga0068853_100062295 | 3300005539 | Bacteria | 3227 |
| 103 | Ga0068853_101516803 | 3300005539 | Bacteria | 649 |
| 104 | Ga0070672_101287315 | 3300005543 | Bacteria | 652 |
| 105 | Ga0070686_101709399 | 3300005544 | Bacteria | 534 |
| 106 | Ga0070695_100023651 | 3300005545 | Bacteria | 3780 |
| 107 | Ga0070695_100126445 | 3300005545 | Bacteria | 1756 |
| 108 | Ga0070696_100344676 | 3300005546 | Bacteria | 1152 |
| 109 | Ga0070693_100192663 | 3300005547 | Bacteria | 1319 |
| 110 | Ga0070693_100494731 | 3300005547 | Bacteria | 866 |
| 111 | Ga0070665_100000420 | 3300005548 | Bacteria | 62000 |
| 112 | Ga0070665_100022414 | 3300005548 | Bacteria | 6355 |
| 113 | Ga0070665_100239429 | 3300005548 | Bacteria | 1815 |
| 114 | Ga0070665_100342301 | 3300005548 | Bacteria | 1500 |
| 115 | Ga0070665_100713597 | 3300005548 | Bacteria | 1016 |
| 116 | Ga0070704_100473864 | 3300005549 | Bacteria | 1082 |
| 117 | Ga0070704_100511689 | 3300005549 | Bacteria | 1043 |
| 118 | Ga0070704_100867542 | 3300005549 | Bacteria | 810 |
| 119 | Ga0068855_100005297 | 3300005563 | Bacteria | 15751 |
| 120 | Ga0068855_100006825 | 3300005563 | Bacteria | 13851 |
| 121 | Ga0068855_100032463 | 3300005563 | Bacteria | 6234 |
| 122 | Ga0068855_100258645 | 3300005563 | Bacteria | 1940 |
| 123 | Ga0068855_101211058 | 3300005563 | Bacteria | 785 |
| 124 | Ga0070664_101807266 | 3300005564 | Bacteria | 580 |
| 125 | Ga0068857_100125984 | 3300005577 | Bacteria | 2308 |
| 126 | Ga0068854_100048603 | 3300005578 | Bacteria | 3027 |
| 127 | Ga0068854_100904691 | 3300005578 | Bacteria | 776 |
| 128 | Ga0068854_101103810 | 3300005578 | Bacteria | 707 |
| 129 | Ga0068854_101242774 | 3300005578 | Bacteria | 669 |
| 130 | Ga0068856_100005786 | 3300005614 | Bacteria | 12183 |
| 131 | Ga0068856_100217082 | 3300005614 | Bacteria | 1928 |
| 132 | Ga0068856_100274337 | 3300005614 | Bacteria | 1702 |
| 133 | Ga0068856_101672083 | 3300005614 | Bacteria | 649 |
| 134 | Ga0068852_100573487 | 3300005616 | Bacteria | 1131 |
| 135 | Ga0068852_101178901 | 3300005616 | Bacteria | 787 |
| 136 | Ga0068859_100040454 | 3300005617 | Bacteria | 4679 |
| 137 | Ga0068859_100041725 | 3300005617 | Bacteria | 4609 |
| 138 | Ga0068859_100249892 | 3300005617 | Bacteria | 1864 |
| 139 | Ga0068859_100851133 | 3300005617 | Bacteria | 998 |
| 140 | Ga0068859_101250012 | 3300005617 | Bacteria | 818 |
| 141 | Ga0068859_101470346 | 3300005617 | Bacteria | 752 |
| 142 | Ga0068864_100374585 | 3300005618 | Bacteria | 1348 |
| 143 | Ga0068864_100462411 | 3300005618 | Bacteria | 1215 |
| 144 | Ga0068864_100613100 | 3300005618 | Bacteria | 1057 |
| 145 | Ga0068866_10002926 | 3300005718 | Bacteria | 7042 |
| 146 | Ga0068866_10102612 | 3300005718 | Bacteria | 1581 |
| 147 | Ga0068866_10408965 | 3300005718 | Bacteria | 877 |
| 148 | Ga0068861_100512000 | 3300005719 | Bacteria | 1087 |
| 149 | Ga0068851_10294574 | 3300005834 | Bacteria | 931 |
| 150 | Ga0068870_10211360 | 3300005840 | Bacteria | 1182 |
| 151 | Ga0068863_100115613 | 3300005841 | Bacteria | 2556 |
| 152 | Ga0068863_100150149 | 3300005841 | Bacteria | 2229 |
| 153 | Ga0068863_100391573 | 3300005841 | Bacteria | 1358 |
| 154 | Ga0068863_100818969 | 3300005841 | Bacteria | 929 |
| 155 | Ga0068863_101724470 | 3300005841 | Bacteria | 636 |
| 156 | Ga0068858_100019950 | 3300005842 | Bacteria | 6267 |
| 157 | Ga0068858_101262095 | 3300005842 | Bacteria | 727 |
| 158 | Ga0068860_100009171 | 3300005843 | Bacteria | 9835 |
| 159 | Ga0068860_100036507 | 3300005843 | Bacteria | 4708 |
| 160 | Ga0068860_100746585 | 3300005843 | Bacteria | 990 |
| 161 | Ga0068860_102653695 | 3300005843 | Bacteria | 520 |
| 162 | Ga0068862_100656714 | 3300005844 | Bacteria | 1012 |
| 163 | Ga0068862_100764424 | 3300005844 | Bacteria | 941 |
| 164 | Ga0070717_10009383 | 3300006028 | Bacteria | 7349 |
| 165 | Ga0070717_10410798 | 3300006028 | Bacteria | 1217 |
| 166 | Ga0075365_10000123 | 3300006038 | Bacteria | 23459 |
| 167 | Ga0075368_10058206 | 3300006042 | Bacteria | 1544 |
| 168 | Ga0075364_10000745 | 3300006051 | Bacteria | 17081 |
| 169 | Ga0075364_10070422 | 3300006051 | Bacteria | 2302 |
| 170 | Ga0070715_10000114 | 3300006163 | Bacteria | 19381 |
| 171 | Ga0070715_10187865 | 3300006163 | Bacteria | 1041 |
| 172 | Ga0070715_10282225 | 3300006163 | Bacteria | 881 |
| 173 | Ga0070716_100015835 | 3300006173 | Bacteria | 3884 |
| 174 | Ga0070716_100018080 | 3300006173 | Bacteria | 3667 |
| 175 | Ga0070716_100090958 | 3300006173 | Bacteria | 1847 |
| 176 | Ga0070716_100097671 | 3300006173 | Bacteria | 1793 |
| 177 | Ga0070712_100001088 | 3300006175 | Bacteria | 16369 |
| 178 | Ga0070712_100032180 | 3300006175 | Bacteria | 3539 |
| 179 | Ga0070712_100162831 | 3300006175 | Bacteria | 1724 |
| 180 | Ga0070712_100407717 | 3300006175 | Bacteria | 1124 |
| 181 | Ga0075362_10619577 | 3300006177 | Unclassified | 560 |
| 182 | Ga0075367_10000270 | 3300006178 | Bacteria | 17924 |
| 183 | Ga0075369_10000133 | 3300006186 | Bacteria | 20639 |
| 184 | Ga0097621_100045269 | 3300006237 | Bacteria | 3553 |
| 185 | Ga0097621_100050132 | 3300006237 | Bacteria | 3394 |
| 186 | Ga0097621_100380210 | 3300006237 | Bacteria | 1261 |
| 187 | Ga0097621_100534101 | 3300006237 | Bacteria | 1066 |
| 188 | Ga0097621_100821922 | 3300006237 | Bacteria | 862 |
| 189 | Ga0068871_100019101 | 3300006358 | Bacteria | 5227 |
| 190 | Ga0068871_100099687 | 3300006358 | Bacteria | 2432 |
| 191 | Ga0075428_100006700 | 3300006844 | Bacteria | 12814 |
| 192 | Ga0075430_100107480 | 3300006846 | Bacteria | 2327 |
| 193 | Ga0075431_100126085 | 3300006847 | Bacteria | 2641 |
| 194 | Ga0075431_100919261 | 3300006847 | Bacteria | 844 |
| 195 | Ga0075433_10000312 | 3300006852 | Bacteria | 29496 |
| 196 | Ga0075434_100000027 | 3300006871 | Bacteria | 66092 |
| 197 | Ga0075434_100033428 | 3300006871 | Bacteria | 5076 |
| 198 | Ga0075434_101218375 | 3300006871 | Bacteria | 764 |
| 199 | Ga0075429_100004834 | 3300006880 | Bacteria | 11608 |
| 200 | Ga0068865_100003798 | 3300006881 | Bacteria | 9068 |
| 201 | Ga0068865_100051478 | 3300006881 | Bacteria | 2851 |
| 202 | Ga0068865_100205301 | 3300006881 | Bacteria | 1532 |
| 203 | Ga0068865_100321700 | 3300006881 | Bacteria | 1244 |
| 204 | Ga0075436_100509366 | 3300006914 | Bacteria | 881 |
| 205 | Ga0075436_100512741 | 3300006914 | Bacteria | 878 |
| 206 | Ga0075436_100708208 | 3300006914 | Bacteria | 746 |
| 207 | Ga0097620_100040454 | 3300006931 | Bacteria | 4679 |
| 208 | Ga0097620_100041725 | 3300006931 | Bacteria | 4609 |
| 209 | Ga0097620_100249886 | 3300006931 | Bacteria | 1864 |
| 210 | Ga0097620_100851044 | 3300006931 | Bacteria | 998 |
| 211 | Ga0097620_101250205 | 3300006931 | Bacteria | 818 |
| 212 | Ga0097620_101470263 | 3300006931 | Bacteria | 752 |
| 213 | Ga0075435_100089709 | 3300007076 | Bacteria | 2535 |
| 214 | Ga0075435_100102338 | 3300007076 | Bacteria | 2374 |
| 215 | Ga0075435_100435432 | 3300007076 | Bacteria | 1130 |
| 216 | Ga0099794_10077367 | 3300007265 | Bacteria | 1637 |
| 217 | Ga0099794_10145581 | 3300007265 | Bacteria | 1201 |
| 218 | Ga0099795_10000007 | 3300007788 | Bacteria | 103906 |
| 219 | Ga0099795_10020640 | 3300007788 | Bacteria | 2149 |
| 220 | Ga0105250_10030267 | 3300009092 | Bacteria | 2177 |
| 221 | Ga0105240_10009095 | 3300009093 | Bacteria | 14103 |
| 222 | Ga0105240_10010581 | 3300009093 | Bacteria | 12960 |
| 223 | Ga0105240_10023126 | 3300009093 | Bacteria | 8229 |
| 224 | Ga0105240_10064123 | 3300009093 | Bacteria | 4566 |
| 225 | Ga0105240_10077531 | 3300009093 | Bacteria | 4094 |
| 226 | Ga0105240_10985979 | 3300009093 | Bacteria | 902 |
| 227 | Ga0111539_10006985 | 3300009094 | Bacteria | 14481 |
| 228 | Ga0111539_10193409 | 3300009094 | Bacteria | 2373 |
| 229 | Ga0105245_10077868 | 3300009098 | Bacteria | 3024 |
| 230 | Ga0105247_10100837 | 3300009101 | Bacteria | 1845 |
| 231 | Ga0105247_10118162 | 3300009101 | Bacteria | 1715 |
| 232 | Ga0105247_10202276 | 3300009101 | Bacteria | 1335 |
| 233 | Ga0114129_10240458 | 3300009147 | Bacteria | 2434 |
| 234 | Ga0105241_10330138 | 3300009174 | Bacteria | 1318 |
| 235 | Ga0105241_11940537 | 3300009174 | Bacteria | 578 |
| 236 | Ga0105242_10012052 | 3300009176 | Bacteria | 6654 |
| 237 | Ga0105242_10079411 | 3300009176 | Bacteria | 2740 |
| 238 | Ga0105242_10250626 | 3300009176 | Bacteria | 1595 |
| 239 | Ga0105248_10149045 | 3300009177 | Bacteria | 2640 |
| 240 | Ga0105248_10152340 | 3300009177 | Bacteria | 2609 |
| 241 | Ga0105248_11508008 | 3300009177 | Bacteria | 761 |
| 242 | Ga0105237_10114154 | 3300009545 | Bacteria | 2694 |
| 243 | Ga0105237_10147148 | 3300009545 | Bacteria | 2351 |
| 244 | Ga0105237_10473642 | 3300009545 | Bacteria | 1258 |
| 245 | Ga0105237_10744897 | 3300009545 | Bacteria | 986 |
| 246 | Ga0105237_11942984 | 3300009545 | Bacteria | 597 |
| 247 | Ga0105237_11981725 | 3300009545 | Bacteria | 591 |
| 248 | Ga0105238_10003358 | 3300009551 | Bacteria | 15967 |
| 249 | Ga0105238_10190175 | 3300009551 | Bacteria | 2029 |
| 250 | Ga0105238_10343773 | 3300009551 | Bacteria | 1480 |
| 251 | Ga0105238_10897787 | 3300009551 | Bacteria | 904 |
| 252 | Ga0105238_10981007 | 3300009551 | Bacteria | 865 |
| 253 | Ga0105249_10216856 | 3300009553 | Bacteria | 1881 |
| 254 | Ga0105249_10432225 | 3300009553 | Bacteria | 1352 |
| 255 | Ga0105249_11301663 | 3300009553 | Bacteria | 798 |
| 256 | Ga0105249_13428472 | 3300009553 | Bacteria | 510 |
| 257 | Ga0105030_100115 | 3300009987 | Bacteria | 6208 |
| 258 | Ga0099796_10000033 | 3300010159 | Bacteria | 31267 |
| 259 | Ga0099796_10001828 | 3300010159 | Bacteria | 4473 |
| 260 | Ga0099796_10010448 | 3300010159 | Bacteria | 2553 |
| 261 | Ga0105239_10654436 | 3300010375 | Bacteria | 1200 |
| 262 | Ga0105239_12095766 | 3300010375 | Bacteria | 657 |
| 263 | Ga0157373_10578476 | 3300013100 | Bacteria | 816 |
| 264 | Ga0157373_10722918 | 3300013100 | Bacteria | 731 |
| 265 | Ga0157371_10157817 | 3300013102 | Bacteria | 1620 |
| 266 | Ga0157370_10011541 | 3300013104 | Bacteria | 9225 |
| 267 | Ga0157370_10096369 | 3300013104 | Bacteria | 2776 |
| 268 | Ga0157370_10484692 | 3300013104 | Bacteria | 1136 |
| 269 | Ga0157369_10039660 | 3300013105 | Bacteria | 5146 |
| 270 | Ga0157369_10097953 | 3300013105 | Bacteria | 3128 |
| 271 | Ga0157369_11374442 | 3300013105 | Bacteria | 719 |
| 272 | Ga0157374_10011021 | 3300013296 | Bacteria | 7806 |
| 273 | Ga0157378_10021389 | 3300013297 | Bacteria | 5688 |
| 274 | Ga0157378_12707541 | 3300013297 | Bacteria | 548 |
| 275 | Ga0163162_10037655 | 3300013306 | Bacteria | 4828 |
| 276 | Ga0157372_10162230 | 3300013307 | Bacteria | 2584 |
| 277 | Ga0157372_11015739 | 3300013307 | Bacteria | 960 |
| 278 | Ga0157372_11511617 | 3300013307 | Bacteria | 773 |
| 279 | Ga0157372_12316301 | 3300013307 | Bacteria | 617 |
| 280 | Ga0157375_10014209 | 3300013308 | Bacteria | 7097 |
| 281 | Ga0163163_10006099 | 3300014325 | Bacteria | 10496 |
| 282 | Ga0163163_10122312 | 3300014325 | Bacteria | 2637 |
| 283 | Ga0163163_10176521 | 3300014325 | Bacteria | 2183 |
| 284 | Ga0163163_10422158 | 3300014325 | Bacteria | 1392 |
| 285 | Ga0157380_10007838 | 3300014326 | Bacteria | 7602 |
| 286 | Ga0157380_10102109 | 3300014326 | Bacteria | 2391 |
| 287 | Ga0157380_11718502 | 3300014326 | Bacteria | 685 |
| 288 | Ga0157377_10196529 | 3300014745 | Bacteria | 1278 |
| 289 | Ga0157377_10349101 | 3300014745 | Bacteria | 992 |
| 290 | Ga0157379_10010154 | 3300014968 | Bacteria | 8206 |
| 291 | Ga0157379_10048326 | 3300014968 | Bacteria | 3797 |
| 292 | Ga0157376_10050407 | 3300014969 | Bacteria | 3454 |
| 293 | Ga0184595_111233 | 3300019166 | Bacteria | 822 |
| 294 | Ga0184595_115396 | 3300019166 | Bacteria | 839 |
| 295 | Ga0184596_108580 | 3300019176 | Bacteria | 733 |
| 296 | Ga0184592_112061 | 3300019177 | Bacteria | 756 |
| 297 | Ga0184594_102903 | 3300019181 | Bacteria | 537 |
| 298 | Ga0184594_106280 | 3300019181 | Bacteria | 536 |
| 299 | Ga0184601_141254 | 3300019183 | Bacteria | 662 |
| 300 | Ga0184599_104977 | 3300019188 | Bacteria | 603 |
| 301 | Ga0184600_102423 | 3300019190 | Bacteria | 611 |
| 302 | Ga0184603_130163 | 3300019192 | Bacteria | 515 |
| 303 | Ga0197907_10405711 | 3300020069 | Bacteria | 937 |
| 304 | Ga0197907_10442029 | 3300020069 | Bacteria | 552 |
| 305 | Ga0206349_1423094 | 3300020075 | Bacteria | 685 |
| 306 | Ga0206355_1527855 | 3300020076 | Bacteria | 742 |
| 307 | Ga0206351_10505028 | 3300020077 | Bacteria | 582 |
| 308 | Ga0206351_10986797 | 3300020077 | Bacteria | 710 |
| 309 | Ga0206352_10417728 | 3300020078 | Bacteria | 505 |
| 310 | Ga0206352_10989618 | 3300020078 | Bacteria | 528 |
| 311 | Ga0206350_10072159 | 3300020080 | Bacteria | 669 |
| 312 | Ga0206350_11527223 | 3300020080 | Bacteria | 616 |
| 313 | Ga0206354_10471473 | 3300020081 | Bacteria | 910 |
| 314 | Ga0206354_11309011 | 3300020081 | Bacteria | 692 |
| 315 | Ga0206353_10649310 | 3300020082 | Bacteria | 1111 |
| 316 | Ga0206353_10906586 | 3300020082 | Bacteria | 613 |
| 317 | Ga0154015_1114833 | 3300020610 | Bacteria | 505 |
| 318 | Ga0154015_1228595 | 3300020610 | Bacteria | 517 |
| 319 | Ga0154015_1535633 | 3300020610 | Bacteria | 599 |
| 320 | Ga0213874_10010595 | 3300021377 | Bacteria | 2311 |
| 321 | Ga0213871_10003766 | 3300021441 | Bacteria | 2965 |
| 322 | Ga0224712_10295700 | 3300022467 | Bacteria | 756 |
| 323 | Ga0224712_10317742 | 3300022467 | Bacteria | 731 |
| 324 | Ga0224712_10351264 | 3300022467 | Bacteria | 697 |
| 325 | Ga0247551_102277 | 3300023552 | Bacteria | 695 |
| 326 | Ga0247553_112138 | 3300023672 | Bacteria | 507 |
| 327 | Ga0224572_1020614 | 3300024225 | Bacteria | 1266 |
| 328 | Ga0209025_1000003 | 3300025294 | Bacteria | 1366495 |
| 329 | Ga0207656_10196151 | 3300025321 | Bacteria | 974 |
| 330 | Ga0207696_1054385 | 3300025711 | Bacteria | 1138 |
| 331 | Ga0207653_10072720 | 3300025885 | Bacteria | 1178 |
| 332 | Ga0207692_10006619 | 3300025898 | Bacteria | 4708 |
| 333 | Ga0207692_10904545 | 3300025898 | Bacteria | 581 |
| 334 | Ga0207642_10009077 | 3300025899 | Bacteria | 3443 |
| 335 | Ga0207642_10637313 | 3300025899 | Bacteria | 667 |
| 336 | Ga0207710_10003821 | 3300025900 | Bacteria | 6652 |
| 337 | Ga0207710_10068075 | 3300025900 | Bacteria | 1627 |
| 338 | Ga0207680_10022402 | 3300025903 | Bacteria | 3435 |
| 339 | Ga0207680_10051955 | 3300025903 | Bacteria | 2453 |
| 340 | Ga0207680_10208797 | 3300025903 | Bacteria | 1334 |
| 341 | Ga0207685_10044484 | 3300025905 | Bacteria | 1679 |
| 342 | Ga0207685_10202116 | 3300025905 | Bacteria | 934 |
| 343 | Ga0207699_10008031 | 3300025906 | Bacteria | 5185 |
| 344 | Ga0207699_10099195 | 3300025906 | Bacteria | 1844 |
| 345 | Ga0207645_10000348 | 3300025907 | Bacteria | 38649 |
| 346 | Ga0207645_10522636 | 3300025907 | Bacteria | 804 |
| 347 | Ga0207643_10246781 | 3300025908 | Bacteria | 1099 |
| 348 | Ga0207705_10597061 | 3300025909 | Bacteria | 858 |
| 349 | Ga0207684_10322850 | 3300025910 | Bacteria | 1330 |
| 350 | Ga0207684_11179288 | 3300025910 | Bacteria | 635 |
| 351 | Ga0207654_10484983 | 3300025911 | Bacteria | 871 |
| 352 | Ga0207654_10874813 | 3300025911 | Bacteria | 651 |
| 353 | Ga0207707_10000202 | 3300025912 | Bacteria | 63576 |
| 354 | Ga0207707_10014584 | 3300025912 | Bacteria | 6846 |
| 355 | Ga0207707_10024220 | 3300025912 | Bacteria | 5311 |
| 356 | Ga0207707_10049339 | 3300025912 | Bacteria | 3667 |
| 357 | Ga0207707_10998299 | 3300025912 | Bacteria | 687 |
| 358 | Ga0207695_10010951 | 3300025913 | Bacteria | 11029 |
| 359 | Ga0207695_10079448 | 3300025913 | Bacteria | 3325 |
| 360 | Ga0207695_10148579 | 3300025913 | Bacteria | 2284 |
| 361 | Ga0207695_10186441 | 3300025913 | Bacteria | 1993 |
| 362 | Ga0207695_10300720 | 3300025913 | Bacteria | 1496 |
| 363 | Ga0207695_11092592 | 3300025913 | Bacteria | 677 |
| 364 | Ga0207671_10059420 | 3300025914 | Bacteria | 2835 |
| 365 | Ga0207671_10131595 | 3300025914 | Bacteria | 1920 |
| 366 | Ga0207671_10405741 | 3300025914 | Bacteria | 1084 |
| 367 | Ga0207671_10722301 | 3300025914 | Bacteria | 792 |
| 368 | Ga0207671_11460347 | 3300025914 | Bacteria | 529 |
| 369 | Ga0207693_10000216 | 3300025915 | Bacteria | 53067 |
| 370 | Ga0207693_10149640 | 3300025915 | Bacteria | 1836 |
| 371 | Ga0207693_10354350 | 3300025915 | Bacteria | 1148 |
| 372 | Ga0207663_10001899 | 3300025916 | Bacteria | 9881 |
| 373 | Ga0207663_10020373 | 3300025916 | Bacteria | 3754 |
| 374 | Ga0207663_11158201 | 3300025916 | Bacteria | 622 |
| 375 | Ga0207660_10001921 | 3300025917 | Bacteria | 13857 |
| 376 | Ga0207660_10245840 | 3300025917 | Bacteria | 1411 |
| 377 | Ga0207657_10077276 | 3300025919 | Bacteria | 2806 |
| 378 | Ga0207657_10318477 | 3300025919 | Bacteria | 1230 |
| 379 | Ga0207652_10002554 | 3300025921 | Bacteria | 15274 |
| 380 | Ga0207652_10031203 | 3300025921 | Bacteria | 4473 |
| 381 | Ga0207652_11849962 | 3300025921 | Bacteria | 509 |
| 382 | Ga0207646_10087813 | 3300025922 | Bacteria | 2782 |
| 383 | Ga0207681_10388533 | 3300025923 | Bacteria | 1125 |
| 384 | Ga0207681_10665723 | 3300025923 | Bacteria | 864 |
| 385 | Ga0207681_10820437 | 3300025923 | Bacteria | 777 |
| 386 | Ga0207681_10895643 | 3300025923 | Bacteria | 743 |
| 387 | Ga0207694_10001276 | 3300025924 | Bacteria | 21700 |
| 388 | Ga0207694_10184119 | 3300025924 | Bacteria | 1695 |
| 389 | Ga0207694_10960856 | 3300025924 | Bacteria | 723 |
| 390 | Ga0207694_11153545 | 3300025924 | Bacteria | 656 |
| 391 | Ga0207650_10860774 | 3300025925 | Bacteria | 769 |
| 392 | Ga0207659_10717300 | 3300025926 | Bacteria | 857 |
| 393 | Ga0207659_10735132 | 3300025926 | Bacteria | 846 |
| 394 | Ga0207659_10910438 | 3300025926 | Bacteria | 756 |
| 395 | Ga0207687_10007462 | 3300025927 | Bacteria | 7199 |
| 396 | Ga0207687_10008944 | 3300025927 | Bacteria | 6547 |
| 397 | Ga0207700_10062255 | 3300025928 | Bacteria | 2833 |
| 398 | Ga0207700_10288652 | 3300025928 | Bacteria | 1413 |
| 399 | Ga0207700_11554874 | 3300025928 | Bacteria | 586 |
| 400 | Ga0207664_10046950 | 3300025929 | Bacteria | 3391 |
| 401 | Ga0207664_10383889 | 3300025929 | Bacteria | 1247 |
| 402 | Ga0207644_10045386 | 3300025931 | Bacteria | 3126 |
| 403 | Ga0207644_10838239 | 3300025931 | Bacteria | 770 |
| 404 | Ga0207644_11409299 | 3300025931 | Bacteria | 585 |
| 405 | Ga0207690_10977755 | 3300025932 | Bacteria | 704 |
| 406 | Ga0207706_10193601 | 3300025933 | Bacteria | 1784 |
| 407 | Ga0207706_10757415 | 3300025933 | Bacteria | 827 |
| 408 | Ga0207686_10015664 | 3300025934 | Bacteria | 4243 |
| 409 | Ga0207686_10428730 | 3300025934 | Bacteria | 1013 |
| 410 | Ga0207686_11060713 | 3300025934 | Bacteria | 659 |
| 411 | Ga0207686_11818198 | 3300025934 | Bacteria | 504 |
| 412 | Ga0207669_10008128 | 3300025937 | Bacteria | 4908 |
| 413 | Ga0207669_10698626 | 3300025937 | Bacteria | 833 |
| 414 | Ga0207704_10025385 | 3300025938 | Bacteria | 3232 |
| 415 | Ga0207704_10164081 | 3300025938 | Bacteria | 1584 |
| 416 | Ga0207704_10174804 | 3300025938 | Bacteria | 1545 |
| 417 | Ga0207665_10025478 | 3300025939 | Bacteria | 3903 |
| 418 | Ga0207665_10032084 | 3300025939 | Bacteria | 3477 |
| 419 | Ga0207665_10125025 | 3300025939 | Bacteria | 1820 |
| 420 | Ga0207665_10313879 | 3300025939 | Bacteria | 1175 |
| 421 | Ga0207691_10404384 | 3300025940 | Bacteria | 1164 |
| 422 | Ga0207711_10024852 | 3300025941 | Bacteria | 5026 |
| 423 | Ga0207711_10044292 | 3300025941 | Bacteria | 3798 |
| 424 | Ga0207711_10486760 | 3300025941 | Bacteria | 1149 |
| 425 | Ga0207689_10291810 | 3300025942 | Bacteria | 1351 |
| 426 | Ga0207689_11571841 | 3300025942 | Bacteria | 548 |
| 427 | Ga0207667_10005725 | 3300025949 | Bacteria | 15157 |
| 428 | Ga0207667_10016648 | 3300025949 | Bacteria | 8299 |
| 429 | Ga0207667_10108588 | 3300025949 | Bacteria | 2862 |
| 430 | Ga0207667_10203259 | 3300025949 | Bacteria | 2032 |
| 431 | Ga0207667_10222004 | 3300025949 | Bacteria | 1936 |
| 432 | Ga0207667_11222646 | 3300025949 | Bacteria | 730 |
| 433 | Ga0207651_10097285 | 3300025960 | Bacteria | 2173 |
| 434 | Ga0207651_10620583 | 3300025960 | Bacteria | 947 |
| 435 | Ga0207651_11341447 | 3300025960 | Bacteria | 643 |
| 436 | Ga0207712_10039914 | 3300025961 | Bacteria | 3218 |
| 437 | Ga0207712_10121945 | 3300025961 | Bacteria | 1973 |
| 438 | Ga0207712_10177423 | 3300025961 | Bacteria | 1670 |
| 439 | Ga0207712_11935549 | 3300025961 | Bacteria | 528 |
| 440 | Ga0207640_11164260 | 3300025981 | Bacteria | 684 |
| 441 | Ga0207658_10001515 | 3300025986 | Bacteria | 18034 |
| 442 | Ga0207658_10008826 | 3300025986 | Bacteria | 6841 |
| 443 | Ga0207658_10049346 | 3300025986 | Bacteria | 3092 |
| 444 | Ga0207658_10082320 | 3300025986 | Bacteria | 2471 |
| 445 | Ga0207658_12061416 | 3300025986 | Bacteria | 519 |
| 446 | Ga0207677_10015325 | 3300026023 | Bacteria | 4504 |
| 447 | Ga0207677_10029488 | 3300026023 | Bacteria | 3487 |
| 448 | Ga0207703_10030489 | 3300026035 | Bacteria | 4263 |
| 449 | Ga0207703_10279009 | 3300026035 | Bacteria | 1517 |
| 450 | Ga0207703_10902227 | 3300026035 | Bacteria | 846 |
| 451 | Ga0207703_11427913 | 3300026035 | Bacteria | 666 |
| 452 | Ga0207703_12147007 | 3300026035 | Bacteria | 535 |
| 453 | Ga0207639_10051978 | 3300026041 | Bacteria | 3119 |
| 454 | Ga0207639_10240488 | 3300026041 | Bacteria | 1573 |
| 455 | Ga0207678_10559948 | 3300026067 | Bacteria | 1000 |
| 456 | Ga0207708_10964897 | 3300026075 | Bacteria | 740 |
| 457 | Ga0207702_10029702 | 3300026078 | Bacteria | 4550 |
| 458 | Ga0207702_10059820 | 3300026078 | Bacteria | 3246 |
| 459 | Ga0207702_10374624 | 3300026078 | Bacteria | 1368 |
| 460 | Ga0207641_10044038 | 3300026088 | Bacteria | 3751 |
| 461 | Ga0207641_10069596 | 3300026088 | Bacteria | 3022 |
| 462 | Ga0207641_11170754 | 3300026088 | Bacteria | 768 |
| 463 | Ga0207648_10004874 | 3300026089 | Bacteria | 13685 |
| 464 | Ga0207648_10128023 | 3300026089 | Bacteria | 2234 |
| 465 | Ga0207648_10527718 | 3300026089 | Bacteria | 1082 |
| 466 | Ga0207676_10008857 | 3300026095 | Bacteria | 7161 |
| 467 | Ga0207676_10324632 | 3300026095 | Bacteria | 1414 |
| 468 | Ga0207676_10535210 | 3300026095 | Bacteria | 1117 |
| 469 | Ga0207674_10152939 | 3300026116 | Bacteria | 2264 |
| 470 | Ga0207674_10293165 | 3300026116 | Bacteria | 1575 |
| 471 | Ga0207674_10930031 | 3300026116 | Bacteria | 838 |
| 472 | Ga0207675_100140996 | 3300026118 | Bacteria | 2290 |
| 473 | Ga0207675_100820984 | 3300026118 | Bacteria | 944 |
| 474 | Ga0207675_100931080 | 3300026118 | Bacteria | 886 |
| 475 | Ga0207675_101598953 | 3300026118 | Bacteria | 672 |
| 476 | Ga0207683_10004156 | 3300026121 | Bacteria | 12534 |
| 477 | Ga0207683_10512380 | 3300026121 | Bacteria | 1108 |
| 478 | Ga0207683_10538789 | 3300026121 | Bacteria | 1079 |
| 479 | Ga0207698_11139805 | 3300026142 | Bacteria | 793 |
| 480 | Ga0209179_1000074 | 3300027512 | Bacteria | 16239 |
| 481 | Ga0209179_1001253 | 3300027512 | Bacteria | 3039 |
| 482 | Ga0209968_1036269 | 3300027526 | Bacteria | 834 |
| 483 | Ga0209999_1049771 | 3300027543 | Bacteria | 791 |
| 484 | Ga0210002_1009907 | 3300027617 | Bacteria | 1457 |
| 485 | Ga0209971_1020840 | 3300027682 | Bacteria | 1559 |
| 486 | Ga0209813_10051262 | 3300027866 | Bacteria | 1290 |
| 487 | Ga0209974_10224265 | 3300027876 | Bacteria | 701 |
| 488 | Ga0207428_10002854 | 3300027907 | Bacteria | 17138 |
| 489 | Ga0207428_10027919 | 3300027907 | Bacteria | 4694 |
| 490 | Ga0207428_10103630 | 3300027907 | Bacteria | 2196 |
| 491 | Ga0265354_1001940 | 3300028016 | Bacteria | 2742 |
| 492 | Ga0265356_1042562 | 3300028017 | Bacteria | 501 |
| 493 | Ga0265357_1005632 | 3300028023 | Bacteria | 1163 |
| 494 | Ga0265355_1000217 | 3300028036 | Bacteria | 2610 |
| 495 | Ga0268266_10000115 | 3300028379 | Bacteria | 164223 |
| 496 | Ga0268266_10001499 | 3300028379 | Bacteria | 27597 |
| 497 | Ga0268266_10098841 | 3300028379 | Bacteria | 2568 |
| 498 | Ga0268266_10151887 | 3300028379 | Bacteria | 2088 |
| 499 | Ga0268265_10660502 | 3300028380 | Bacteria | 1006 |
| 500 | Ga0268264_10024968 | 3300028381 | Bacteria | 4884 |
| 501 | Ga0268264_10678760 | 3300028381 | Bacteria | 1022 |
| 502 | Ga0265326_10018777 | 3300028558 | Bacteria | 1988 |
| 503 | Ga0265319_1021224 | 3300028563 | Bacteria | 2389 |
| 504 | Ga0265334_10002111 | 3300028573 | Bacteria | 9393 |
| 505 | Ga0265318_10004693 | 3300028577 | Bacteria | 6557 |
| 506 | Ga0307515_10012124 | 3300028794 | Bacteria | 16257 |
| 507 | Ga0307515_10186257 | 3300028794 | Bacteria | 2004 |
| 508 | Ga0307515_10425173 | 3300028794 | Bacteria | 948 |
| 509 | Ga0265338_10011547 | 3300028800 | Bacteria | 10185 |
| 510 | Ga0265338_10072991 | 3300028800 | Bacteria | 2927 |
| 511 | Ga0265338_10981117 | 3300028800 | Bacteria | 572 |
| 512 | Ga0265762_1015920 | 3300030760 | Bacteria | 1362 |
| 513 | Ga0265762_1028726 | 3300030760 | Bacteria | 1048 |
| 514 | Ga0265762_1041940 | 3300030760 | Bacteria | 898 |
| 515 | Ga0265775_106920 | 3300030762 | Bacteria | 673 |
| 516 | Ga0265775_108790 | 3300030762 | Bacteria | 618 |
| 517 | Ga0265763_1001528 | 3300030763 | Bacteria | 1665 |
| 518 | Ga0265763_1009000 | 3300030763 | Bacteria | 901 |
| 519 | Ga0265763_1054121 | 3300030763 | Bacteria | 511 |
| 520 | Ga0265767_102081 | 3300030836 | Bacteria | 1043 |
| 521 | Ga0265766_1003039 | 3300030863 | Bacteria | 960 |
| 522 | Ga0265766_1015288 | 3300030863 | Bacteria | 591 |
| 523 | Ga0265766_1025514 | 3300030863 | Bacteria | 507 |
| 524 | Ga0265777_109944 | 3300030877 | Bacteria | 692 |
| 525 | Ga0265777_121609 | 3300030877 | Bacteria | 535 |
| 526 | Ga0265777_123747 | 3300030877 | Unclassified | 518 |
| 527 | Ga0265770_1020946 | 3300030878 | Bacteria | 1036 |
| 528 | Ga0265770_1131537 | 3300030878 | Bacteria | 535 |
| 529 | Ga0265770_1157943 | 3300030878 | Bacteria | 502 |
| 530 | Ga0265765_1007126 | 3300030879 | Bacteria | 1200 |
| 531 | Ga0265765_1051988 | 3300030879 | Bacteria | 564 |
| 532 | Ga0265776_103094 | 3300030880 | Bacteria | 796 |
| 533 | Ga0265764_101304 | 3300030882 | Bacteria | 1092 |
| 534 | Ga0265772_101130 | 3300030886 | Bacteria | 923 |
| 535 | Ga0265772_107555 | 3300030886 | Bacteria | 512 |
| 536 | Ga0265769_110822 | 3300030888 | Bacteria | 628 |
| 537 | Ga0265761_112875 | 3300030889 | Bacteria | 502 |
| 538 | Ga0265768_103830 | 3300030963 | Bacteria | 824 |
| 539 | Ga0265771_1015496 | 3300031010 | Bacteria | 612 |
| 540 | Ga0265773_1010359 | 3300031018 | Bacteria | 785 |
| 541 | Ga0265760_10057296 | 3300031090 | Bacteria | 1180 |
| 542 | Ga0265760_10120466 | 3300031090 | Bacteria | 842 |
| 543 | Ga0265330_10029285 | 3300031235 | Bacteria | 2477 |
| 544 | Ga0265332_10016032 | 3300031238 | Bacteria | 3306 |
| 545 | Ga0265328_10013268 | 3300031239 | Bacteria | 3266 |
| 546 | Ga0265328_10336108 | 3300031239 | Bacteria | 587 |
| 547 | Ga0265320_10004829 | 3300031240 | Bacteria | 8759 |
| 548 | Ga0265325_10010022 | 3300031241 | Bacteria | 5506 |
| 549 | Ga0265325_10522956 | 3300031241 | Bacteria | 514 |
| 550 | Ga0265325_10527284 | 3300031241 | Bacteria | 511 |
| 551 | Ga0265329_10007475 | 3300031242 | Bacteria | 4218 |
| 552 | Ga0265329_10048463 | 3300031242 | Bacteria | 1355 |
| 553 | Ga0265340_10015618 | 3300031247 | Bacteria | 3943 |
| 554 | Ga0265340_10123453 | 3300031247 | Bacteria | 1190 |
| 555 | Ga0265340_10240202 | 3300031247 | Bacteria | 808 |
| 556 | Ga0265340_10248262 | 3300031247 | Bacteria | 793 |
| 557 | Ga0265340_10336449 | 3300031247 | Bacteria | 667 |
| 558 | Ga0265339_10025490 | 3300031249 | Bacteria | 3393 |
| 559 | Ga0265339_10127256 | 3300031249 | Bacteria | 1305 |
| 560 | Ga0265331_10003518 | 3300031250 | Bacteria | 10080 |
| 561 | Ga0265327_10001579 | 3300031251 | Bacteria | 27819 |
| 562 | Ga0265316_10014952 | 3300031344 | Bacteria | 6806 |
| 563 | Ga0265316_10350619 | 3300031344 | Bacteria | 1069 |
| 564 | Ga0307509_10000099 | 3300031507 | Bacteria | 121307 |
| 565 | Ga0307509_10209473 | 3300031507 | Bacteria | 1776 |
| 566 | Ga0307408_100106988 | 3300031548 | Bacteria | 2141 |
| 567 | Ga0307408_100846601 | 3300031548 | Bacteria | 833 |
| 568 | Ga0265313_10005693 | 3300031595 | Bacteria | 9089 |
| 569 | Ga0307508_10422939 | 3300031616 | Bacteria | 924 |
| 570 | Ga0307508_10635106 | 3300031616 | Bacteria | 672 |
| 571 | Ga0316575_10010287 | 3300031665 | Bacteria | 3433 |
| 572 | Ga0316575_10057693 | 3300031665 | Bacteria | 1548 |
| 573 | Ga0316575_10084712 | 3300031665 | Bacteria | 1280 |
| 574 | Ga0316575_10156426 | 3300031665 | Bacteria | 942 |
| 575 | Ga0316579_10576348 | 3300031691 | Bacteria | 545 |
| 576 | Ga0265314_10005013 | 3300031711 | Bacteria | 12066 |
| 577 | Ga0265314_10639754 | 3300031711 | Bacteria | 544 |
| 578 | Ga0265342_10046558 | 3300031712 | Bacteria | 2606 |
| 579 | Ga0316576_10002081 | 3300031727 | Bacteria | 11247 |
| 580 | Ga0316576_10014055 | 3300031727 | Bacteria | 5338 |
| 581 | Ga0316576_10027818 | 3300031727 | Bacteria | 3977 |
| 582 | Ga0316576_10183421 | 3300031727 | Bacteria | 1578 |
| 583 | Ga0316576_10193452 | 3300031727 | Bacteria | 1533 |
| 584 | Ga0316576_10791416 | 3300031727 | Bacteria | 683 |
| 585 | Ga0316576_10825715 | 3300031727 | Bacteria | 666 |
| 586 | Ga0316578_10067900 | 3300031728 | Bacteria | 2108 |
| 587 | Ga0316578_10185041 | 3300031728 | Bacteria | 1255 |
| 588 | Ga0316578_10411326 | 3300031728 | Bacteria | 801 |
| 589 | Ga0316578_10578966 | 3300031728 | Bacteria | 658 |
| 590 | Ga0316578_10737196 | 3300031728 | Bacteria | 573 |
| 591 | Ga0307516_10000794 | 3300031730 | Bacteria | 43134 |
| 592 | Ga0307405_10273768 | 3300031731 | Bacteria | 1267 |
| 593 | Ga0307405_10834885 | 3300031731 | Bacteria | 774 |
| 594 | Ga0316577_10188022 | 3300031733 | Bacteria | 1167 |
| 595 | Ga0316577_10692902 | 3300031733 | Bacteria | 579 |
| 596 | Ga0247548_109242 | 3300031814 | Bacteria | 505 |
| 597 | Ga0316042_123163 | 3300031816 | Bacteria | 634 |
| 598 | Ga0307410_10317148 | 3300031852 | Bacteria | 1235 |
| 599 | Ga0307406_10946672 | 3300031901 | Bacteria | 736 |
| 600 | Ga0307406_10979171 | 3300031901 | Bacteria | 724 |
| 601 | Ga0307407_10832953 | 3300031903 | Bacteria | 704 |
| 602 | Ga0307407_11567500 | 3300031903 | Bacteria | 522 |
| 603 | Ga0307412_12041327 | 3300031911 | Bacteria | 531 |
| 604 | Ga0307412_12155639 | 3300031911 | Bacteria | 518 |
| 605 | Ga0307409_101375571 | 3300031995 | Bacteria | 732 |
| 606 | Ga0307409_101475498 | 3300031995 | Bacteria | 707 |
| 607 | Ga0307416_100061146 | 3300032002 | Bacteria | 3072 |
| 608 | Ga0307416_100360376 | 3300032002 | Bacteria | 1476 |
| 609 | Ga0307414_11521203 | 3300032004 | Bacteria | 623 |
| 610 | Ga0307414_11565707 | 3300032004 | Bacteria | 614 |
| 611 | Ga0307411_10117261 | 3300032005 | Bacteria | 1918 |
| 612 | Ga0307411_10349344 | 3300032005 | Bacteria | 1205 |
| 613 | Ga0307411_11327483 | 3300032005 | Bacteria | 656 |
| 614 | Ga0316053_103317 | 3300032120 | Bacteria | 951 |
| 615 | Ga0316053_104287 | 3300032120 | Bacteria | 875 |
| 616 | Ga0316053_104697 | 3300032120 | Bacteria | 849 |
| 617 | Ga0307415_100814957 | 3300032126 | Bacteria | 853 |
| 618 | Ga0316593_10001722 | 3300032168 | Bacteria | 4950 |
| 619 | Ga0316593_10128541 | 3300032168 | Bacteria | 913 |
| 620 | Ga0316593_10197532 | 3300032168 | Bacteria | 743 |
| 621 | Ga0316593_10280182 | 3300032168 | Bacteria | 628 |
| 622 | Ga0307510_10270889 | 3300033180 | Bacteria | 1174 |
| 623 | Ga0316592_1160632 | 3300033524 | Bacteria | 532 |
| 624 | Ga0316588_1197444 | 3300033528 | Bacteria | 525 |
| 625 | Ga0316587_1029325 | 3300033529 | Bacteria | 967 |
| 626 | Ga0316587_1045737 | 3300033529 | Bacteria | 796 |
| 627 | Ga0316587_1085458 | 3300033529 | Bacteria | 599 |
| 628 | Ga0316587_1109367 | 3300033529 | Bacteria | 536 |
| 629 | Ga0316596_1125910 | 3300033541 | Bacteria | 698 |
| 630 | Ga0316212_1058301 | 3300033547 | Bacteria | 555 |
| 631 | Ga0373959_0084114 | 3300034820 | Bacteria | 737 |
| 632 | Ga0373939_0347443 | 3300035114 | Bacteria | 603 |
| 633 | Ga0316574_0000008 | 3300035398 | Bacteria | 48126 |
| 634 | Ga0316574_0035259 | 3300035398 | Bacteria | 3056 |
| 635 | Ga0316574_0036237 | 3300035398 | Bacteria | 3019 |
| 636 | Ga0316574_0047826 | 3300035398 | Bacteria | 2656 |
| 637 | Ga0316574_0133252 | 3300035398 | Bacteria | 1599 |
| 638 | Ga0316574_0227365 | 3300035398 | Bacteria | 1194 |
| 639 | Ga0316574_0293725 | 3300035398 | Bacteria | 1034 |
| 640 | Ga0316574_0537941 | 3300035398 | Bacteria | 726 |
| 641 | Ga0316574_0998585 | 3300035398 | Bacteria | 504 |
| 642 | Ga0373935_0963129 | 3300035692 | Bacteria | 633 |
| 643 | Ga0373933_0390731 | 3300035724 | Bacteria | 907 |
| 644 | Ga0265778_055594 | 3300036457 | Bacteria | 548 |
| 645 | Ga0265778_060894 | 3300036457 | Bacteria | 528 |
| 646 | Ga0265778_062811 | 3300036457 | Bacteria | 521 |
| 647 | Ga0316582_0117086 | 3300036647 | Bacteria | 1780 |
| 648 | Ga0316582_0909758 | 3300036647 | Unclassified | 602 |
| 649 | Ga0316584_0006318 | 3300036712 | Bacteria | 8025 |
| 650 | Ga0316584_0112662 | 3300036712 | Bacteria | 2035 |
| 651 | Ga0316584_0235760 | 3300036712 | Bacteria | 1340 |
| 652 | Ga0316584_0320079 | 3300036712 | Bacteria | 1119 |
| 653 | Ga0316584_0400486 | 3300036712 | Bacteria | 978 |
| 654 | Ga0395899_0621662 | 3300037312 | Bacteria | 686 |
| 655 | Ga0395900_0063904 | 3300037418 | Bacteria | 3783 |
| 656 | Ga0395900_0125647 | 3300037418 | Bacteria | 2631 |
| 657 | Ga0395900_0462554 | 3300037418 | Bacteria | 1223 |
| 658 | Ga0395898_0002854 | 3300037466 | Bacteria | 19754 |
| 659 | Ga0395898_0010069 | 3300037466 | Bacteria | 9895 |
| 660 | Ga0395898_0188826 | 3300037466 | Bacteria | 1969 |
| 661 | Ga0395898_0375533 | 3300037466 | Bacteria | 1356 |
| 662 | Ga0436364_0164812 | 3300037853 | Bacteria | 1297 |
| 663 | Ga0436364_1222050 | 3300037853 | Bacteria | 564 |
| 664 | Ga0395901_0174298 | 3300038443 | Bacteria | 2256 |
| 665 | Ga0400490_28919 | 3300038726 | Bacteria | 7529 |
| 666 | Ga0400490_53651 | 3300038726 | Bacteria | 3454 |
| 667 | Ga0400488_36511 | 3300038741 | Bacteria | 2289 |
| 668 | Ga0400488_56057 | 3300038741 | Bacteria | 4432 |
| 669 | Ga0400483_273147 | 3300039062 | Bacteria | 1100 |
| 670 | Ga0400487_04101 | 3300039110 | Bacteria | 13055 |
| 671 | Ga0400487_31583 | 3300039110 | Bacteria | 11327 |
| 672 | Ga0436365_1797910 | 3300039437 | Bacteria | 783 |
| 673 | Ga0436365_1901520 | 3300039437 | Bacteria | 878 |
| 674 | Ga0436361_0193979 | 3300039447 | Bacteria | 589 |
| 675 | Ga0436362_0935429 | 3300039453 | Bacteria | 527 |
| 676 | Ga0436362_1215006 | 3300039453 | Bacteria | 706 |
| 677 | Ga0439436_0126878 | 3300041404 | Bacteria | 715 |
| 678 | Ga0439439_0050483 | 3300041406 | Bacteria | 1090 |
| 679 | Ga0439461_0218811 | 3300041410 | Bacteria | 518 |
| 680 | Ga0451798_0012111 | 3300041458 | Bacteria | 562 |
| 681 | Ga0451807_0002537 | 3300041486 | Bacteria | 882 |
| 682 | Ga0452271_28477 | 3300041916 | Bacteria | 608 |
| 683 | Ga0439431_0120431 | 3300041997 | Bacteria | 732 |
| 684 | Ga0439431_0193156 | 3300041997 | Bacteria | 591 |
| 685 | Ga0439433_0079396 | 3300041999 | Bacteria | 797 |
| 686 | Ga0439442_041737 | 3300042002 | Bacteria | 964 |
| 687 | Ga0439443_097767 | 3300042003 | Bacteria | 560 |
| 688 | Ga0439445_0076482 | 3300042004 | Bacteria | 932 |
| 689 | Ga0439452_000426 | 3300042010 | Bacteria | 24406 |
| 690 | Ga0439456_154930 | 3300042013 | Bacteria | 535 |
| 691 | Ga0450920_002893 | 3300042122 | Bacteria | 2954 |
| 692 | Ga0450923_000690 | 3300042125 | Bacteria | 3961 |
| 693 | Ga0450895_029275 | 3300042132 | Bacteria | 533 |
| 694 | Ga0450896_000264 | 3300042133 | Bacteria | 4827 |
| 695 | Ga0450898_074331 | 3300042134 | Bacteria | 685 |
| 696 | Ga0450907_005068 | 3300042146 | Bacteria | 2235 |
| 697 | Ga0450910_013101 | 3300042147 | Bacteria | 1204 |
| 698 | Ga0439446_0010932 | 3300042156 | Bacteria | 2454 |
| 699 | Ga0439446_0385838 | 3300042156 | Bacteria | 504 |
| 700 | Ga0450908_010340 | 3300042184 | Bacteria | 1722 |
| 701 | Ga0439434_0024041 | 3300042435 | Bacteria | 1837 |
| 702 | Ga0439434_0083345 | 3300042435 | Bacteria | 1016 |
| 703 | Ga0439434_0117598 | 3300042435 | Bacteria | 865 |
| 704 | Ga0439435_0029012 | 3300042436 | Bacteria | 1491 |
| 705 | Ga0439464_0004826 | 3300042439 | Bacteria | 3456 |
| 706 | Ga0450918_003499 | 3300042531 | Bacteria | 2915 |
| 707 | Ga0450918_016616 | 3300042531 | Bacteria | 1279 |
| 708 | Ga0450893_0115065 | 3300042532 | Bacteria | 558 |
| 709 | Ga0451577_0007767 | 3300042876 | Bacteria | 10512 |
| 710 | Ga0451577_0121837 | 3300042876 | Bacteria | 2336 |
| 711 | Ga0451577_0141164 | 3300042876 | Bacteria | 2165 |
| 712 | Ga0451577_0235064 | 3300042876 | Bacteria | 1657 |
| 713 | Ga0451577_0440250 | 3300042876 | Bacteria | 1183 |
| 714 | Ga0451577_0649751 | 3300042876 | Bacteria | 956 |
| 715 | Ga0451577_1189484 | 3300042876 | Bacteria | 680 |
| 716 | Ga0466969_0005066 | 3300044656 | Bacteria | 7008 |
| 717 | Ga0466969_0040693 | 3300044656 | Bacteria | 2328 |
| 718 | Ga0466969_0318689 | 3300044656 | Bacteria | 704 |
| 719 | Ga0453683_0010066 | 3300044673 | Bacteria | 6286 |
| 720 | Ga0453683_0082624 | 3300044673 | Bacteria | 2013 |
| 721 | Ga0466966_0000786 | 3300044684 | Bacteria | 20203 |
| 722 | Ga0466966_0291869 | 3300044684 | Bacteria | 980 |
| 723 | Ga0466961_0010757 | 3300044693 | Bacteria | 5845 |
| 724 | Ga0466961_0160163 | 3300044693 | Bacteria | 1403 |
| 725 | Ga0466961_0347682 | 3300044693 | Bacteria | 903 |
| 726 | Ga0466963_0088166 | 3300044694 | Bacteria | 2111 |
| 727 | Ga0466964_0003849 | 3300044706 | Bacteria | 5508 |
| 728 | Ga0453684_0032098 | 3300044712 | Bacteria | 7358 |
| 729 | Ga0453684_0042866 | 3300044712 | Bacteria | 6091 |
| 730 | Ga0453684_0267228 | 3300044712 | Bacteria | 1956 |
| 731 | Ga0453684_0444488 | 3300044712 | Bacteria | 1444 |
| 732 | Ga0453684_0445858 | 3300044712 | Bacteria | 1442 |
| 733 | Ga0453684_1473551 | 3300044712 | Bacteria | 703 |
| 734 | Ga0466971_0000163 | 3300044719 | Bacteria | 24784 |
| 735 | Ga0466970_0012565 | 3300044765 | Bacteria | 4332 |
| 736 | Ga0466970_0210690 | 3300044765 | Bacteria | 1083 |
| 737 | Ga0466970_0876217 | 3300044765 | Bacteria | 527 |
| 738 | Ga0466957_0030205 | 3300044842 | Bacteria | 3235 |
| 739 | Ga0466957_0177687 | 3300044842 | Bacteria | 1389 |
| 740 | Ga0466959_0003333 | 3300045049 | Bacteria | 10492 |
| 741 | Ga0466959_0008064 | 3300045049 | Bacteria | 7424 |
| 742 | Ga0466959_0483189 | 3300045049 | Bacteria | 838 |
| 743 | Ga0451576_0004342 | 3300045051 | Bacteria | 18509 |
| 744 | Ga0451576_0032859 | 3300045051 | Bacteria | 5517 |
| 745 | Ga0451576_0203336 | 3300045051 | Bacteria | 2068 |
| 746 | Ga0451576_0299623 | 3300045051 | Bacteria | 1681 |
| 747 | Ga0451576_0409214 | 3300045051 | Bacteria | 1423 |
| 748 | Ga0451576_1080226 | 3300045051 | Bacteria | 840 |
| 749 | Ga0495617_258465 | 3300046452 | Bacteria | 536 |
| 750 | Ga0495650_0000028 | 3300046471 | Bacteria | 473012 |
| 751 | Ga0495580_0006674 | 3300046472 | Bacteria | 9368 |
| 752 | Ga0495594_0531328 | 3300046499 | Bacteria | 668 |
| 753 | Ga0495645_0790949 | 3300046543 | Bacteria | 570 |
| 754 | Ga0495633_0338660 | 3300046558 | Bacteria | 682 |
| 755 | Ga0495668_0811442 | 3300046616 | Bacteria | 518 |
| 756 | Ga0495613_0368154 | 3300046689 | Bacteria | 984 |
| 757 | Ga0495649_0348945 | 3300046694 | Bacteria | 748 |
| 758 | Ga0495660_0294296 | 3300046810 | Bacteria | 738 |
| 759 | Ga0495593_0142352 | 3300047673 | Bacteria | 1215 |
| 760 | Ga0496102_0080906 | 3300048905 | Bacteria | 2994 |
| 761 | Ga0496104_0048171 | 3300048907 | Bacteria | 4018 |
| 762 | Ga0496105_0098503 | 3300048908 | Bacteria | 2414 |
| 763 | Ga0496106_0175338 | 3300048909 | Bacteria | 1701 |
| 764 | Ga0496106_0255709 | 3300048909 | Bacteria | 1401 |
| 765 | Ga0496108_0373735 | 3300048911 | Bacteria | 1244 |
| 766 | Ga0496108_1211794 | 3300048911 | Bacteria | 638 |
| 767 | Ga0496109_0021996 | 3300048912 | Bacteria | 5645 |
| 768 | Ga0496109_1343239 | 3300048912 | Bacteria | 651 |
| 769 | Ga0496110_0514972 | 3300048913 | Bacteria | 1088 |
| 770 | Ga0496111_0063990 | 3300048914 | Bacteria | 2668 |
| 771 | Ga0496112_0999450 | 3300048915 | Bacteria | 756 |
| 772 | Ga0496113_0306644 | 3300048916 | Bacteria | 1272 |
| 773 | Ga0496114_0890133 | 3300048917 | Bacteria | 771 |
| 774 | Ga0496115_0339614 | 3300048918 | Bacteria | 1226 |
| 775 | Ga0496116_0040569 | 3300048919 | Bacteria | 3204 |
| 776 | Ga0496117_0049034 | 3300048920 | Bacteria | 3008 |
| 777 | Ga0496119_0056891 | 3300048922 | Bacteria | 2366 |
| 778 | Ga0496120_0250355 | 3300048923 | Bacteria | 832 |
| 779 | Ga0496121_0112251 | 3300048924 | Bacteria | 2076 |
| 780 | Ga0496124_0097785 | 3300048927 | Bacteria | 2383 |
| 781 | Ga0496125_0703258 | 3300048928 | Bacteria | 536 |
| 782 | Ga0496126_0006195 | 3300048929 | Bacteria | 13385 |
| 783 | Ga0496126_0858887 | 3300048929 | Bacteria | 691 |
| 784 | Ga0501031_0115012 | 3300049568 | Bacteria | 1757 |
| 785 | Ga0501032_0009894 | 3300049569 | Bacteria | 6891 |
| 786 | Ga0501032_0066756 | 3300049569 | Bacteria | 2404 |
| 787 | Ga0501032_0301958 | 3300049569 | Bacteria | 1035 |
| 788 | Ga0501032_0689572 | 3300049569 | Bacteria | 648 |
| 789 | Ga0501033_0001168 | 3300049570 | Bacteria | 23698 |
| 790 | Ga0501033_0163918 | 3300049570 | Bacteria | 1599 |
| 791 | Ga0501033_0449901 | 3300049570 | Bacteria | 895 |
| 792 | Ga0501034_0002051 | 3300049571 | Bacteria | 25291 |
| 793 | Ga0501034_0218058 | 3300049571 | Bacteria | 1861 |
| 794 | Ga0501034_0290360 | 3300049571 | Bacteria | 1573 |
| 795 | Ga0501036_0000113 | 3300049572 | Bacteria | 50142 |
| 796 | Ga0501036_0573282 | 3300049572 | Bacteria | 937 |
| 797 | Ga0501037_0018417 | 3300049573 | Bacteria | 5147 |
| 798 | Ga0501037_0069861 | 3300049573 | Bacteria | 2556 |
| 799 | Ga0501037_0153237 | 3300049573 | Bacteria | 1646 |
| 800 | Ga0501037_1067014 | 3300049573 | Bacteria | 524 |
| 801 | Ga0501038_0001322 | 3300049574 | Bacteria | 22542 |
| 802 | Ga0501038_0149920 | 3300049574 | Bacteria | 1902 |
| 803 | Ga0501038_0554907 | 3300049574 | Bacteria | 873 |
| 804 | Ga0501038_0952707 | 3300049574 | Bacteria | 632 |
| 805 | Ga0501039_0080377 | 3300049575 | Bacteria | 2537 |
| 806 | Ga0501039_0296177 | 3300049575 | Bacteria | 1272 |
| 807 | Ga0501039_0677630 | 3300049575 | Bacteria | 807 |
| 808 | Ga0501039_0912959 | 3300049575 | Bacteria | 683 |
| 809 | Ga0501040_0150960 | 3300049576 | Bacteria | 1639 |
| 810 | Ga0501040_0177791 | 3300049576 | Bacteria | 1508 |
| 811 | Ga0501041_0132475 | 3300049577 | Bacteria | 1553 |
| 812 | Ga0501041_0206402 | 3300049577 | Bacteria | 1232 |
| 813 | Ga0501041_0238682 | 3300049577 | Bacteria | 1142 |
| 814 | Ga0501041_0715798 | 3300049577 | Bacteria | 641 |
| 815 | Ga0501041_0854342 | 3300049577 | Bacteria | 584 |
| 816 | Ga0501042_0373765 | 3300049578 | Bacteria | 1032 |
| 817 | Ga0501042_1036441 | 3300049578 | Bacteria | 598 |
| 818 | Ga0501042_1065945 | 3300049578 | Bacteria | 589 |
| 819 | Ga0501043_0001910 | 3300049579 | Bacteria | 17856 |
| 820 | Ga0501043_0578335 | 3300049579 | Bacteria | 832 |
| 821 | Ga0501046_1231592 | 3300049580 | Bacteria | 513 |
| 822 | Ga0501047_0004828 | 3300049581 | Bacteria | 12669 |
| 823 | Ga0501048_1366183 | 3300049582 | Bacteria | 509 |
| 824 | Ga0501067_0040984 | 3300049583 | Bacteria | 2571 |
| 825 | Ga0501067_0137701 | 3300049583 | Bacteria | 1359 |
| 826 | Ga0501068_0076151 | 3300049584 | Bacteria | 2053 |
| 827 | Ga0501068_0203673 | 3300049584 | Bacteria | 1255 |
| 828 | Ga0501069_0004062 | 3300049585 | Bacteria | 7556 |
| 829 | Ga0501069_0264716 | 3300049585 | Bacteria | 1004 |
| 830 | Ga0501069_0298343 | 3300049585 | Bacteria | 945 |
| 831 | Ga0501070_0001800 | 3300049586 | Bacteria | 18908 |
| 832 | Ga0501070_0008139 | 3300049586 | Bacteria | 8869 |
| 833 | Ga0501070_0403826 | 3300049586 | Bacteria | 1105 |
| 834 | Ga0501071_0173047 | 3300049587 | Bacteria | 1617 |
| 835 | Ga0501071_0460106 | 3300049587 | Bacteria | 974 |
| 836 | Ga0501072_0053074 | 3300049588 | Bacteria | 3192 |
| 837 | Ga0501073_0005924 | 3300049589 | Bacteria | 9122 |
| 838 | Ga0501073_0179996 | 3300049589 | Bacteria | 1463 |
| 839 | Ga0501073_0484346 | 3300049589 | Bacteria | 855 |
| 840 | Ga0501074_0001684 | 3300049590 | Bacteria | 15052 |
| 841 | Ga0501074_0206914 | 3300049590 | Bacteria | 1398 |
| 842 | Ga0501075_0045553 | 3300049591 | Bacteria | 3292 |
| 843 | Ga0501075_0353365 | 3300049591 | Bacteria | 1120 |
| 844 | Ga0501075_0444276 | 3300049591 | Bacteria | 989 |
| 845 | Ga0501076_0118732 | 3300049592 | Bacteria | 2141 |
| 846 | Ga0501076_0226463 | 3300049592 | Bacteria | 1528 |
| 847 | Ga0501076_0439570 | 3300049592 | Bacteria | 1074 |
| 848 | Ga0501076_0526696 | 3300049592 | Bacteria | 974 |
| 849 | Ga0501076_0892340 | 3300049592 | Bacteria | 733 |
| 850 | Ga0501076_1467435 | 3300049592 | Bacteria | 560 |
| 851 | Ga0501077_0051134 | 3300049593 | Bacteria | 2626 |
| 852 | Ga0501077_0231758 | 3300049593 | Bacteria | 1174 |
| 853 | Ga0501235_107102 | 3300049669 | Bacteria | 688 |
| 854 | Ga0501079_0189001 | 3300049741 | Bacteria | 1607 |
| 855 | Ga0501079_0227407 | 3300049741 | Bacteria | 1457 |
| 856 | Ga0501079_0948068 | 3300049741 | Bacteria | 678 |
| 857 | Ga0501079_0982524 | 3300049741 | Bacteria | 665 |
| 858 | Ga0501079_1372274 | 3300049741 | Bacteria | 556 |
| 859 | Ga0501080_0010309 | 3300049742 | Bacteria | 8545 |
| 860 | Ga0501080_0220020 | 3300049742 | Bacteria | 1738 |
| 861 | Ga0501080_0969982 | 3300049742 | Bacteria | 738 |
| 862 | Ga0501081_0018675 | 3300049743 | Bacteria | 4608 |
| 863 | Ga0501081_0175591 | 3300049743 | Bacteria | 1548 |
| 864 | Ga0501081_0288189 | 3300049743 | Bacteria | 1203 |
| 865 | Ga0501081_0446034 | 3300049743 | Bacteria | 961 |
| 866 | Ga0501081_0797532 | 3300049743 | Bacteria | 711 |
| 867 | Ga0501083_0206592 | 3300049744 | Bacteria | 1281 |
| 868 | Ga0501035_0004700 | 3300049822 | Bacteria | 12966 |
| 869 | Ga0501035_0029347 | 3300049822 | Bacteria | 5015 |
| 870 | Ga0501035_0080209 | 3300049822 | Bacteria | 2882 |
| 871 | Ga0501035_1182974 | 3300049822 | Bacteria | 594 |
| 872 | Ga0501044_0000213 | 3300049823 | Bacteria | 73593 |
| 873 | Ga0501044_0005117 | 3300049823 | Bacteria | 14627 |
| 874 | Ga0501044_0152988 | 3300049823 | Bacteria | 2288 |
| 875 | Ga0501044_0849224 | 3300049823 | Bacteria | 790 |
| 876 | Ga0501045_0093118 | 3300049824 | Bacteria | 2229 |
| 877 | Ga0501045_0278582 | 3300049824 | Bacteria | 1245 |
| 878 | Ga0501045_0833633 | 3300049824 | Bacteria | 678 |
| 879 | Ga0501045_1158417 | 3300049824 | Bacteria | 565 |
| 880 | nmdc:mga03683_557527_c1 | 3300050489 | Unclassified | 558 |
| 881 | nmdc:mga00v17_108_c1 | 3300050491 | Bacteria | 49222 |
| 882 | nmdc:mga00v17_32982_c1 | 3300050491 | Bacteria | 3065 |
| 883 | nmdc:mga05p37_65384_c1 | 3300050507 | Bacteria | 4474 |
| 884 | nmdc:mga09592_798815_c1 | 3300050508 | Bacteria | 798 |
| 885 | nmdc:mga0qj67_17472_c1 | 3300050509 | Bacteria | 5454 |
| 886 | nmdc:mga06r32_119848_c1 | 3300050510 | Bacteria | 2595 |
| 887 | nmdc:mga08y16_139811_c1 | 3300050511 | Bacteria | 2517 |
| 888 | nmdc:mga08y16_8740_c1 | 3300050511 | Bacteria | 10624 |
| 889 | nmdc:mga0n895_1333096_c1 | 3300050512 | Bacteria | 688 |
| 890 | nmdc:mga0n895_143_c1 | 3300050512 | Bacteria | 43481 |
| 891 | nmdc:mga0rr50_113092_c1 | 3300050513 | Bacteria | 2151 |
| 892 | nmdc:mga0rr50_1692828_c1 | 3300050513 | Bacteria | 533 |
| 893 | nmdc:mga08x19_1020095_c1 | 3300050514 | Bacteria | 588 |
| 894 | nmdc:mga0a205_87_c1 | 3300050515 | Bacteria | 51120 |
| 895 | Ga0495601_0207595 | 3300053077 | Bacteria | 1280 |
| 896 | Ga0495619_0402886 | 3300053085 | Bacteria | 945 |
| 897 | Ga0500556_0000737 | 3300053104 | Bacteria | 19686 |
| 898 | Ga0500562_108873 | 3300053108 | Bacteria | 755 |
| 899 | Ga0500595_017641 | 3300053119 | Bacteria | 2630 |
| 900 | Ga0500568_0215661 | 3300053139 | Bacteria | 702 |
| 901 | Ga0500622_0000001 | 3300053156 | Bacteria | 657715 |
| 902 | Ga0500622_0008492 | 3300053156 | Bacteria | 5740 |
| 903 | Ga0500637_0111178 | 3300053178 | Bacteria | 1589 |
| 904 | Ga0501084_0015172 | 3300054114 | Bacteria | 6387 |
| 905 | Ga0501084_0548143 | 3300054114 | Bacteria | 977 |
| 906 | Ga0587073_0083192 | 3300059492 | Bacteria | 799 |
| 907 | Ga0587073_0121639 | 3300059492 | Bacteria | 705 |
| 908 | Ga0587077_262131 | 3300059493 | Bacteria | 504 |
| 909 | Ga0587080_050382 | 3300059503 | Bacteria | 785 |
| 910 | Ga0587082_101970 | 3300059504 | Bacteria | 626 |
| 911 | Ga0587086_079837 | 3300059507 | Bacteria | 575 |
| 912 | Ga0587089_063698 | 3300059509 | Bacteria | 614 |
| 913 | Ga0587090_095523 | 3300059510 | Bacteria | 615 |
| 914 | Ga0587091_212207 | 3300059511 | Bacteria | 525 |
| 915 | Ga0587094_110831 | 3300059513 | Bacteria | 540 |
| 916 | Ga0587101_031787 | 3300059623 | Bacteria | 827 |
| 917 | Ga0587130_045208 | 3300059631 | Bacteria | 541 |
| 918 | Ga0587062_108958 | 3300059639 | Bacteria | 548 |
| 919 | Ga0587067_120104 | 3300059640 | Bacteria | 630 |
| 920 | Ga0587100_035105 | 3300059648 | Bacteria | 546 |
| 921 | Ga0587124_031020 | 3300059660 | Bacteria | 591 |
| 922 | Ga0587071_116898 | 3300060344 | Bacteria | 633 |
| 923 | Ga0587071_157477 | 3300060344 | Bacteria | 569 |
| 924 | Ga0501082_0290748 | 3300060353 | Bacteria | 1423 |
| 925 | Ga0501082_0474553 | 3300060353 | Bacteria | 1093 |
| 926 | Ga0501082_0783371 | 3300060353 | Bacteria | 834 |
| 927 | Ga0466962_0005596 | 3300061719 | Bacteria | 6033 |
| 928 | Ga0530510_0847068 | 3300061734 | Bacteria | 698 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2842391507 | 2842392710 | 66 |
| 2 | iso_pu_bacteria | 2919134579 | 2919136261 | 66 |
| 3 | 3300049576 | Ga0501040_0177791 | Ga0501040_0177791_541_771 | 74 |
| 4 | 3300049577 | Ga0501041_0206402 | Ga0501041_0206402_954_1184 | 74 |
| 5 | 3300049822 | Ga0501035_1182974 | Ga0501035_1182974_145_375 | 74 |
| 6 | 3300046558 | Ga0495633_0338660 | Ga0495633_0338660_290_523 | 75 |
| 7 | iso_pu_bacteria | 2928157003 | 2928160255 | 75 |
| 8 | iso_pu_bacteria | 2928163908 | 2928168747 | 75 |
| 9 | iso_pu_bacteria | 2981990288 | 2981994594 | 75 |
| 10 | iso_pu_bacteria | 641736154 | 642419664 | 75 |
| 11 | 3300005289 | Ga0065704_10010159 | Ga0065704_100101591 | 76 |
| 12 | 3300005548 | Ga0070665_100000420 | Ga0070665_10000042025 | 76 |
| 13 | 3300006051 | Ga0075364_10070422 | Ga0075364_100704222 | 76 |
| 14 | 3300006177 | Ga0075362_10619577 | Ga0075362_106195772 | 76 |
| 15 | 3300013100 | Ga0157373_10722918 | Ga0157373_107229182 | 76 |
| 16 | 3300013102 | Ga0157371_10157817 | Ga0157371_101578172 | 76 |
| 17 | 3300013104 | Ga0157370_10096369 | Ga0157370_100963692 | 76 |
| 18 | 3300013307 | Ga0157372_10162230 | Ga0157372_101622302 | 76 |
| 19 | 3300028379 | Ga0268266_10000115 | Ga0268266_1000011541 | 76 |
| 20 | 3300041486 | Ga0451807_0002537 | Ga0451807_0002537_448_681 | 76 |
| 21 | 3300041916 | Ga0452271_28477 | Ga0452271_28477_34_345 | 76 |
| 22 | 3300042010 | Ga0439452_000426 | Ga0439452_000426_23597_23908 | 76 |
| 23 | 3300042439 | Ga0439464_0004826 | Ga0439464_0004826_1739_2050 | 76 |
| 24 | 3300046471 | Ga0495650_0000028 | Ga0495650_0000028_435049_435360 | 76 |
| 25 | 3300046694 | Ga0495649_0348945 | Ga0495649_0348945_10_249 | 76 |
| 26 | 3300048919 | Ga0496116_0040569 | Ga0496116_0040569_17_328 | 76 |
| 27 | 3300048920 | Ga0496117_0049034 | Ga0496117_0049034_1471_1782 | 76 |
| 28 | 3300048922 | Ga0496119_0056891 | Ga0496119_0056891_528_839 | 76 |
| 29 | 3300048924 | Ga0496121_0112251 | Ga0496121_0112251_528_839 | 76 |
| 30 | 3300050489 | nmdc:mga03683_557527_c1 | nmdc:mga03683_557527_c1_235_546 | 76 |
| 31 | 3300050491 | nmdc:mga00v17_32982_c1 | nmdc:mga00v17_32982_c1_1679_1990 | 76 |
| 32 | 3300005365 | Ga0070688_100857655 | Ga0070688_1008576552 | 77 |
| 33 | 3300005366 | Ga0070659_100436156 | Ga0070659_1004361562 | 77 |
| 34 | 3300005455 | Ga0070663_100426932 | Ga0070663_1004269322 | 77 |
| 35 | 3300005539 | Ga0068853_100019298 | Ga0068853_1000192983 | 77 |
| 36 | 3300005563 | Ga0068855_100258645 | Ga0068855_1002586452 | 77 |
| 37 | 3300005577 | Ga0068857_100125984 | Ga0068857_1001259842 | 77 |
| 38 | 3300013297 | Ga0157378_12707541 | Ga0157378_127075411 | 77 |
| 39 | 3300020080 | Ga0206350_10072159 | Ga0206350_100721591 | 77 |
| 40 | 3300025294 | Ga0209025_1000003 | Ga0209025_1000003616 | 77 |
| 41 | 3300025919 | Ga0207657_10077276 | Ga0207657_100772762 | 77 |
| 42 | 3300025924 | Ga0207694_10184119 | Ga0207694_101841192 | 77 |
| 43 | 3300025949 | Ga0207667_10203259 | Ga0207667_102032592 | 77 |
| 44 | 3300026041 | Ga0207639_10240488 | Ga0207639_102404882 | 77 |
| 45 | 3300026067 | Ga0207678_10559948 | Ga0207678_105599482 | 77 |
| 46 | 3300026116 | Ga0207674_10293165 | Ga0207674_102931652 | 77 |
| 47 | 3300031665 | Ga0316575_10010287 | Ga0316575_100102872 | 77 |
| 48 | 3300031727 | Ga0316576_10791416 | Ga0316576_107914162 | 77 |
| 49 | 3300035398 | Ga0316574_0227365 | Ga0316574_0227365_648_884 | 77 |
| 50 | 3300037312 | Ga0395899_0621662 | Ga0395899_0621662_315_551 | 77 |
| 51 | 3300037418 | Ga0395900_0063904 | Ga0395900_0063904_676_912 | 77 |
| 52 | 3300037466 | Ga0395898_0375533 | Ga0395898_0375533_741_977 | 77 |
| 53 | 3300038443 | Ga0395901_0174298 | Ga0395901_0174298_655_891 | 77 |
| 54 | 3300044673 | Ga0453683_0082624 | Ga0453683_0082624_202_441 | 77 |
| 55 | 3300044765 | Ga0466970_0210690 | Ga0466970_0210690_172_408 | 77 |
| 56 | 3300049568 | Ga0501031_0115012 | Ga0501031_0115012_339_575 | 77 |
| 57 | 3300049569 | Ga0501032_0009894 | Ga0501032_0009894_1110_1346 | 77 |
| 58 | 3300049569 | Ga0501032_0066756 | Ga0501032_0066756_2065_2301 | 77 |
| 59 | 3300049569 | Ga0501032_0689572 | Ga0501032_0689572_95_331 | 77 |
| 60 | 3300049570 | Ga0501033_0001168 | Ga0501033_0001168_16772_17008 | 77 |
| 61 | 3300049570 | Ga0501033_0163918 | Ga0501033_0163918_271_507 | 77 |
| 62 | 3300049570 | Ga0501033_0449901 | Ga0501033_0449901_15_251 | 77 |
| 63 | 3300049571 | Ga0501034_0002051 | Ga0501034_0002051_13776_14012 | 77 |
| 64 | 3300049571 | Ga0501034_0218058 | Ga0501034_0218058_53_289 | 77 |
| 65 | 3300049571 | Ga0501034_0290360 | Ga0501034_0290360_874_1110 | 77 |
| 66 | 3300049572 | Ga0501036_0000113 | Ga0501036_0000113_16591_16827 | 77 |
| 67 | 3300049573 | Ga0501037_0018417 | Ga0501037_0018417_2995_3231 | 77 |
| 68 | 3300049573 | Ga0501037_0069861 | Ga0501037_0069861_2080_2316 | 77 |
| 69 | 3300049573 | Ga0501037_0153237 | Ga0501037_0153237_1013_1249 | 77 |
| 70 | 3300049573 | Ga0501037_1067014 | Ga0501037_1067014_16_252 | 77 |
| 71 | 3300049574 | Ga0501038_0001322 | Ga0501038_0001322_11143_11379 | 77 |
| 72 | 3300049574 | Ga0501038_0149920 | Ga0501038_0149920_871_1107 | 77 |
| 73 | 3300049574 | Ga0501038_0952707 | Ga0501038_0952707_279_515 | 77 |
| 74 | 3300049575 | Ga0501039_0080377 | Ga0501039_0080377_1507_1743 | 77 |
| 75 | 3300049578 | Ga0501042_1065945 | Ga0501042_1065945_295_537 | 77 |
| 76 | 3300049579 | Ga0501043_0001910 | Ga0501043_0001910_11322_11558 | 77 |
| 77 | 3300049579 | Ga0501043_0578335 | Ga0501043_0578335_449_685 | 77 |
| 78 | 3300049581 | Ga0501047_0004828 | Ga0501047_0004828_7297_7533 | 77 |
| 79 | 3300049591 | Ga0501075_0444276 | Ga0501075_0444276_16_258 | 77 |
| 80 | 3300049822 | Ga0501035_0004700 | Ga0501035_0004700_5265_5501 | 77 |
| 81 | 3300049822 | Ga0501035_0029347 | Ga0501035_0029347_2179_2415 | 77 |
| 82 | 3300049823 | Ga0501044_0005117 | Ga0501044_0005117_8595_8831 | 77 |
| 83 | 3300049823 | Ga0501044_0152988 | Ga0501044_0152988_83_319 | 77 |
| 84 | iso_pu_bacteria | 2687453129 | 2687578283 | 77 |
| 85 | iso_pu_bacteria | 2734482258 | 2735816853 | 77 |
| 86 | iso_pu_bacteria | 2919704043 | 2919704853 | 77 |
| 87 | iso_pu_bacteria | 2952252522 | 2952253479 | 77 |
| 88 | 3300005334 | Ga0068869_101477263 | Ga0068869_1014772632 | 78 |
| 89 | 3300005343 | Ga0070687_101274618 | Ga0070687_1012746181 | 78 |
| 90 | 3300005440 | Ga0070705_100316720 | Ga0070705_1003167201 | 78 |
| 91 | 3300005444 | Ga0070694_100325892 | Ga0070694_1003258921 | 78 |
| 92 | 3300005445 | Ga0070708_100108966 | Ga0070708_1001089663 | 78 |
| 93 | 3300005458 | Ga0070681_10013550 | Ga0070681_100135507 | 78 |
| 94 | 3300005467 | Ga0070706_100020554 | Ga0070706_1000205542 | 78 |
| 95 | 3300005468 | Ga0070707_100014717 | Ga0070707_1000147177 | 78 |
| 96 | 3300005530 | Ga0070679_102132180 | Ga0070679_1021321801 | 78 |
| 97 | 3300005545 | Ga0070695_100023651 | Ga0070695_1000236512 | 78 |
| 98 | 3300005547 | Ga0070693_100494731 | Ga0070693_1004947312 | 78 |
| 99 | 3300006871 | Ga0075434_101218375 | Ga0075434_1012183752 | 78 |
| 100 | 3300006914 | Ga0075436_100708208 | Ga0075436_1007082082 | 78 |
| 101 | 3300009551 | Ga0105238_10981007 | Ga0105238_109810072 | 78 |
| 102 | 3300025910 | Ga0207684_10322850 | Ga0207684_103228502 | 78 |
| 103 | 3300025912 | Ga0207707_10024220 | Ga0207707_100242203 | 78 |
| 104 | 3300025921 | Ga0207652_11849962 | Ga0207652_118499621 | 78 |
| 105 | 3300025922 | Ga0207646_10087813 | Ga0207646_100878132 | 78 |
| 106 | 3300025942 | Ga0207689_11571841 | Ga0207689_115718412 | 78 |
| 107 | 3300031239 | Ga0265328_10336108 | Ga0265328_103361081 | 78 |
| 108 | 3300031251 | Ga0265327_10001579 | Ga0265327_100015796 | 78 |
| 109 | 3300031911 | Ga0307412_12155639 | Ga0307412_121556392 | 78 |
| 110 | 3300038726 | Ga0400490_28919 | Ga0400490_28919_7248_7499 | 78 |
| 111 | 3300038726 | Ga0400490_53651 | Ga0400490_53651_1903_2142 | 78 |
| 112 | 3300038741 | Ga0400488_36511 | Ga0400488_36511_1840_2091 | 78 |
| 113 | 3300039110 | Ga0400487_31583 | Ga0400487_31583_7945_8196 | 78 |
| 114 | 3300042156 | Ga0439446_0385838 | Ga0439446_0385838_117_356 | 78 |
| 115 | 3300044712 | Ga0453684_0042866 | Ga0453684_0042866_4045_4287 | 78 |
| 116 | 3300045051 | Ga0451576_0004342 | Ga0451576_0004342_15344_15592 | 78 |
| 117 | 3300049585 | Ga0501069_0004062 | Ga0501069_0004062_3795_4034 | 78 |
| 118 | 3300049586 | Ga0501070_0001800 | Ga0501070_0001800_14737_14976 | 78 |
| 119 | 3300049586 | Ga0501070_0008139 | Ga0501070_0008139_3589_3828 | 78 |
| 120 | 3300049590 | Ga0501074_0001684 | Ga0501074_0001684_13586_13825 | 78 |
| 121 | 3300049741 | Ga0501079_0948068 | Ga0501079_0948068_86_325 | 78 |
| 122 | 3300049742 | Ga0501080_0969982 | Ga0501080_0969982_148_387 | 78 |
| 123 | 3300050512 | nmdc:mga0n895_1333096_c1 | nmdc:mga0n895_1333096_c1_67_306 | 78 |
| 124 | 3300050514 | nmdc:mga08x19_1020095_c1 | nmdc:mga08x19_1020095_c1_87_326 | 78 |
| 125 | 3300053156 | Ga0500622_0000001 | Ga0500622_0000001_189634_189873 | 78 |
| 126 | 3300060344 | Ga0587071_157477 | Ga0587071_157477_172_465 | 78 |
| 127 | 3300002774 | JGI25150J39212_1003589 | JGI25150J39212_10035893 | 79 |
| 128 | 3300003187 | JGI25151J46595_10043569 | JGI25151J46595_100435691 | 79 |
| 129 | 3300005331 | Ga0070670_100007886 | Ga0070670_1000078867 | 79 |
| 130 | 3300005335 | Ga0070666_11239743 | Ga0070666_112397432 | 79 |
| 131 | 3300005353 | Ga0070669_100919071 | Ga0070669_1009190711 | 79 |
| 132 | 3300005367 | Ga0070667_100038957 | Ga0070667_1000389573 | 79 |
| 133 | 3300005539 | Ga0068853_100062295 | Ga0068853_1000622953 | 79 |
| 134 | 3300005617 | Ga0068859_101250012 | Ga0068859_1012500121 | 79 |
| 135 | 3300005719 | Ga0068861_100512000 | Ga0068861_1005120002 | 79 |
| 136 | 3300005841 | Ga0068863_101724470 | Ga0068863_1017244702 | 79 |
| 137 | 3300005843 | Ga0068860_102653695 | Ga0068860_1026536951 | 79 |
| 138 | 3300006931 | Ga0097620_101250205 | Ga0097620_1012502051 | 79 |
| 139 | 3300009093 | Ga0105240_10064123 | Ga0105240_100641235 | 79 |
| 140 | 3300009545 | Ga0105237_10744897 | Ga0105237_107448972 | 79 |
| 141 | 3300013307 | Ga0157372_12316301 | Ga0157372_123163011 | 79 |
| 142 | 3300025913 | Ga0207695_10300720 | Ga0207695_103007202 | 79 |
| 143 | 3300025923 | Ga0207681_10820437 | Ga0207681_108204371 | 79 |
| 144 | 3300025986 | Ga0207658_10082320 | Ga0207658_100823203 | 79 |
| 145 | 3300026041 | Ga0207639_10051978 | Ga0207639_100519783 | 79 |
| 146 | 3300026118 | Ga0207675_100931080 | Ga0207675_1009310801 | 79 |
| 147 | 3300031247 | Ga0265340_10336449 | Ga0265340_103364492 | 79 |
| 148 | 3300031344 | Ga0265316_10350619 | Ga0265316_103506192 | 79 |
| 149 | 3300031711 | Ga0265314_10639754 | Ga0265314_106397541 | 79 |
| 150 | 3300031727 | Ga0316576_10183421 | Ga0316576_101834212 | 79 |
| 151 | 3300031727 | Ga0316576_10825715 | Ga0316576_108257152 | 79 |
| 152 | 3300031728 | Ga0316578_10185041 | Ga0316578_101850412 | 79 |
| 153 | 3300031733 | Ga0316577_10188022 | Ga0316577_101880221 | 79 |
| 154 | 3300032004 | Ga0307414_11521203 | Ga0307414_115212031 | 79 |
| 155 | 3300032005 | Ga0307411_11327483 | Ga0307411_113274831 | 79 |
| 156 | 3300032168 | Ga0316593_10001722 | Ga0316593_100017226 | 79 |
| 157 | 3300032168 | Ga0316593_10197532 | Ga0316593_101975321 | 79 |
| 158 | 3300033524 | Ga0316592_1160632 | Ga0316592_11606321 | 79 |
| 159 | 3300033528 | Ga0316588_1197444 | Ga0316588_11974442 | 79 |
| 160 | 3300033529 | Ga0316587_1045737 | Ga0316587_10457371 | 79 |
| 161 | 3300033529 | Ga0316587_1085458 | Ga0316587_10854581 | 79 |
| 162 | 3300035114 | Ga0373939_0347443 | Ga0373939_0347443_345_587 | 79 |
| 163 | 3300035398 | Ga0316574_0293725 | Ga0316574_0293725_491_736 | 79 |
| 164 | 3300035398 | Ga0316574_0998585 | Ga0316574_0998585_225_470 | 79 |
| 165 | 3300036712 | Ga0316584_0112662 | Ga0316584_0112662_1121_1366 | 79 |
| 166 | 3300039062 | Ga0400483_273147 | Ga0400483_273147_19_264 | 79 |
| 167 | 3300046616 | Ga0495668_0811442 | Ga0495668_0811442_69_341 | 79 |
| 168 | 3300049741 | Ga0501079_1372274 | Ga0501079_1372274_214_474 | 79 |
| 169 | 3300049743 | Ga0501081_0797532 | Ga0501081_0797532_186_431 | 79 |
| 170 | 3300050513 | nmdc:mga0rr50_1692828_c1 | nmdc:mga0rr50_1692828_c1_54_296 | 79 |
| 171 | 3300005335 | Ga0070666_10268853 | Ga0070666_102688532 | 80 |
| 172 | 3300005338 | Ga0068868_100018297 | Ga0068868_1000182973 | 80 |
| 173 | 3300005340 | Ga0070689_102237712 | Ga0070689_1022377122 | 80 |
| 174 | 3300005355 | Ga0070671_100018983 | Ga0070671_1000189832 | 80 |
| 175 | 3300005539 | Ga0068853_101516803 | Ga0068853_1015168031 | 80 |
| 176 | 3300005548 | Ga0070665_100239429 | Ga0070665_1002394292 | 80 |
| 177 | 3300005617 | Ga0068859_100040454 | Ga0068859_1000404543 | 80 |
| 178 | 3300005618 | Ga0068864_100462411 | Ga0068864_1004624112 | 80 |
| 179 | 3300005718 | Ga0068866_10408965 | Ga0068866_104089652 | 80 |
| 180 | 3300005841 | Ga0068863_100150149 | Ga0068863_1001501493 | 80 |
| 181 | 3300005843 | Ga0068860_100009171 | Ga0068860_1000091716 | 80 |
| 182 | 3300006237 | Ga0097621_100050132 | Ga0097621_1000501322 | 80 |
| 183 | 3300006358 | Ga0068871_100099687 | Ga0068871_1000996873 | 80 |
| 184 | 3300006881 | Ga0068865_100205301 | Ga0068865_1002053012 | 80 |
| 185 | 3300006931 | Ga0097620_100040454 | Ga0097620_1000404543 | 80 |
| 186 | 3300007788 | Ga0099795_10000007 | Ga0099795_1000000779 | 80 |
| 187 | 3300009098 | Ga0105245_10077868 | Ga0105245_100778683 | 80 |
| 188 | 3300009101 | Ga0105247_10202276 | Ga0105247_102022762 | 80 |
| 189 | 3300009176 | Ga0105242_10012052 | Ga0105242_100120526 | 80 |
| 190 | 3300009177 | Ga0105248_10149045 | Ga0105248_101490452 | 80 |
| 191 | 3300009545 | Ga0105237_11981725 | Ga0105237_119817251 | 80 |
| 192 | 3300009551 | Ga0105238_10897787 | Ga0105238_108977872 | 80 |
| 193 | 3300009553 | Ga0105249_13428472 | Ga0105249_134284722 | 80 |
| 194 | 3300010159 | Ga0099796_10000033 | Ga0099796_1000003315 | 80 |
| 195 | 3300013296 | Ga0157374_10011021 | Ga0157374_100110213 | 80 |
| 196 | 3300013297 | Ga0157378_10021389 | Ga0157378_100213893 | 80 |
| 197 | 3300013306 | Ga0163162_10037655 | Ga0163162_100376552 | 80 |
| 198 | 3300013308 | Ga0157375_10014209 | Ga0157375_100142096 | 80 |
| 199 | 3300014325 | Ga0163163_10006099 | Ga0163163_100060998 | 80 |
| 200 | 3300014968 | Ga0157379_10010154 | Ga0157379_100101548 | 80 |
| 201 | 3300014969 | Ga0157376_10050407 | Ga0157376_100504072 | 80 |
| 202 | 3300025899 | Ga0207642_10637313 | Ga0207642_106373132 | 80 |
| 203 | 3300025903 | Ga0207680_10208797 | Ga0207680_102087972 | 80 |
| 204 | 3300025927 | Ga0207687_10007462 | Ga0207687_100074623 | 80 |
| 205 | 3300025931 | Ga0207644_11409299 | Ga0207644_114092992 | 80 |
| 206 | 3300025934 | Ga0207686_11060713 | Ga0207686_110607132 | 80 |
| 207 | 3300025938 | Ga0207704_10174804 | Ga0207704_101748042 | 80 |
| 208 | 3300025941 | Ga0207711_10024852 | Ga0207711_100248524 | 80 |
| 209 | 3300025960 | Ga0207651_10620583 | Ga0207651_106205832 | 80 |
| 210 | 3300025986 | Ga0207658_10008826 | Ga0207658_100088264 | 80 |
| 211 | 3300026023 | Ga0207677_10015325 | Ga0207677_100153252 | 80 |
| 212 | 3300026035 | Ga0207703_10030489 | Ga0207703_100304892 | 80 |
| 213 | 3300026088 | Ga0207641_10044038 | Ga0207641_100440383 | 80 |
| 214 | 3300026095 | Ga0207676_10008857 | Ga0207676_100088577 | 80 |
| 215 | 3300027512 | Ga0209179_1000074 | Ga0209179_10000744 | 80 |
| 216 | 3300028379 | Ga0268266_10151887 | Ga0268266_101518873 | 80 |
| 217 | 3300028381 | Ga0268264_10024968 | Ga0268264_100249685 | 80 |
| 218 | 3300031727 | Ga0316576_10027818 | Ga0316576_100278183 | 80 |
| 219 | 3300031727 | Ga0316576_10193452 | Ga0316576_101934522 | 80 |
| 220 | 3300031728 | Ga0316578_10411326 | Ga0316578_104113261 | 80 |
| 221 | 3300031728 | Ga0316578_10737196 | Ga0316578_107371961 | 80 |
| 222 | 3300033529 | Ga0316587_1109367 | Ga0316587_11093671 | 80 |
| 223 | 3300035398 | Ga0316574_0035259 | Ga0316574_0035259_687_935 | 80 |
| 224 | 3300035398 | Ga0316574_0133252 | Ga0316574_0133252_1265_1513 | 80 |
| 225 | 3300036647 | Ga0316582_0909758 | Ga0316582_0909758_298_546 | 80 |
| 226 | 3300036712 | Ga0316584_0320079 | Ga0316584_0320079_342_590 | 80 |
| 227 | 3300036712 | Ga0316584_0400486 | Ga0316584_0400486_447_701 | 80 |
| 228 | 3300048907 | Ga0496104_0048171 | Ga0496104_0048171_2644_2889 | 80 |
| 229 | 3300048908 | Ga0496105_0098503 | Ga0496105_0098503_1003_1248 | 80 |
| 230 | 3300048909 | Ga0496106_0175338 | Ga0496106_0175338_463_708 | 80 |
| 231 | 3300048911 | Ga0496108_0373735 | Ga0496108_0373735_709_954 | 80 |
| 232 | 3300048912 | Ga0496109_0021996 | Ga0496109_0021996_1499_1744 | 80 |
| 233 | 3300048913 | Ga0496110_0514972 | Ga0496110_0514972_414_659 | 80 |
| 234 | 3300048914 | Ga0496111_0063990 | Ga0496111_0063990_676_921 | 80 |
| 235 | 3300048917 | Ga0496114_0890133 | Ga0496114_0890133_22_267 | 80 |
| 236 | 3300049587 | Ga0501071_0173047 | Ga0501071_0173047_154_402 | 80 |
| 237 | 3300005334 | Ga0068869_101434245 | Ga0068869_1014342451 | 81 |
| 238 | 3300005455 | Ga0070663_101054531 | Ga0070663_1010545312 | 81 |
| 239 | 3300005544 | Ga0070686_101709399 | Ga0070686_1017093992 | 81 |
| 240 | 3300005614 | Ga0068856_101672083 | Ga0068856_1016720832 | 81 |
| 241 | 3300005617 | Ga0068859_100851133 | Ga0068859_1008511332 | 81 |
| 242 | 3300006931 | Ga0097620_100851044 | Ga0097620_1008510441 | 81 |
| 243 | 3300009177 | Ga0105248_11508008 | Ga0105248_115080082 | 81 |
| 244 | 3300009553 | Ga0105249_10432225 | Ga0105249_104322252 | 81 |
| 245 | 3300013307 | Ga0157372_11511617 | Ga0157372_115116172 | 81 |
| 246 | 3300025961 | Ga0207712_10039914 | Ga0207712_100399142 | 81 |
| 247 | 3300026035 | Ga0207703_12147007 | Ga0207703_121470071 | 81 |
| 248 | 3300028558 | Ga0265326_10018777 | Ga0265326_100187772 | 81 |
| 249 | 3300028563 | Ga0265319_1021224 | Ga0265319_10212243 | 81 |
| 250 | 3300028573 | Ga0265334_10002111 | Ga0265334_100021113 | 81 |
| 251 | 3300028577 | Ga0265318_10004693 | Ga0265318_100046933 | 81 |
| 252 | 3300028794 | Ga0307515_10186257 | Ga0307515_101862572 | 81 |
| 253 | 3300028800 | Ga0265338_10011547 | Ga0265338_100115473 | 81 |
| 254 | 3300028800 | Ga0265338_10072991 | Ga0265338_100729913 | 81 |
| 255 | 3300031235 | Ga0265330_10029285 | Ga0265330_100292853 | 81 |
| 256 | 3300031238 | Ga0265332_10016032 | Ga0265332_100160323 | 81 |
| 257 | 3300031239 | Ga0265328_10013268 | Ga0265328_100132682 | 81 |
| 258 | 3300031240 | Ga0265320_10004829 | Ga0265320_100048294 | 81 |
| 259 | 3300031241 | Ga0265325_10010022 | Ga0265325_100100224 | 81 |
| 260 | 3300031242 | Ga0265329_10007475 | Ga0265329_100074753 | 81 |
| 261 | 3300031247 | Ga0265340_10123453 | Ga0265340_101234532 | 81 |
| 262 | 3300031247 | Ga0265340_10240202 | Ga0265340_102402021 | 81 |
| 263 | 3300031247 | Ga0265340_10248262 | Ga0265340_102482622 | 81 |
| 264 | 3300031249 | Ga0265339_10025490 | Ga0265339_100254902 | 81 |
| 265 | 3300031250 | Ga0265331_10003518 | Ga0265331_100035185 | 81 |
| 266 | 3300031344 | Ga0265316_10014952 | Ga0265316_100149527 | 81 |
| 267 | 3300031507 | Ga0307509_10209473 | Ga0307509_102094732 | 81 |
| 268 | 3300031595 | Ga0265313_10005693 | Ga0265313_100056933 | 81 |
| 269 | 3300031691 | Ga0316579_10576348 | Ga0316579_105763481 | 81 |
| 270 | 3300031711 | Ga0265314_10005013 | Ga0265314_100050138 | 81 |
| 271 | 3300031712 | Ga0265342_10046558 | Ga0265342_100465583 | 81 |
| 272 | 3300031728 | Ga0316578_10578966 | Ga0316578_105789661 | 81 |
| 273 | 3300032168 | Ga0316593_10128541 | Ga0316593_101285412 | 81 |
| 274 | 3300032168 | Ga0316593_10280182 | Ga0316593_102801821 | 81 |
| 275 | 3300033529 | Ga0316587_1029325 | Ga0316587_10293251 | 81 |
| 276 | 3300033541 | Ga0316596_1125910 | Ga0316596_11259101 | 81 |
| 277 | 3300035398 | Ga0316574_0047826 | Ga0316574_0047826_1839_2090 | 81 |
| 278 | 3300046452 | Ga0495617_258465 | Ga0495617_258465_114_371 | 81 |
| 279 | 3300049582 | Ga0501048_1366183 | Ga0501048_1366183_200_451 | 81 |
| 280 | 3300049586 | Ga0501070_0403826 | Ga0501070_0403826_215_472 | 81 |
| 281 | 3300049589 | Ga0501073_0179996 | Ga0501073_0179996_868_1125 | 81 |
| 282 | 3300049744 | Ga0501083_0206592 | Ga0501083_0206592_580_837 | 81 |
| 283 | 3300049823 | Ga0501044_0849224 | Ga0501044_0849224_22_273 | 81 |
| 284 | 3300053108 | Ga0500562_108873 | Ga0500562_108873_223_480 | 81 |
| 285 | 3300059492 | Ga0587073_0083192 | Ga0587073_0083192_245_502 | 81 |
| 286 | 3300059631 | Ga0587130_045208 | Ga0587130_045208_247_504 | 81 |
| 287 | 3300059639 | Ga0587062_108958 | Ga0587062_108958_171_428 | 81 |
| 288 | 3300005436 | Ga0070713_101066172 | Ga0070713_1010661722 | 82 |
| 289 | 3300005437 | Ga0070710_10354064 | Ga0070710_103540641 | 82 |
| 290 | 3300005548 | Ga0070665_100342301 | Ga0070665_1003423012 | 82 |
| 291 | 3300005578 | Ga0068854_101242774 | Ga0068854_1012427742 | 82 |
| 292 | 3300005842 | Ga0068858_101262095 | Ga0068858_1012620952 | 82 |
| 293 | 3300009093 | Ga0105240_10023126 | Ga0105240_100231266 | 82 |
| 294 | 3300009093 | Ga0105240_10077531 | Ga0105240_100775311 | 82 |
| 295 | 3300009101 | Ga0105247_10100837 | Ga0105247_101008372 | 82 |
| 296 | 3300009545 | Ga0105237_10147148 | Ga0105237_101471483 | 82 |
| 297 | 3300009551 | Ga0105238_10190175 | Ga0105238_101901752 | 82 |
| 298 | 3300010375 | Ga0105239_12095766 | Ga0105239_120957662 | 82 |
| 299 | 3300014325 | Ga0163163_10176521 | Ga0163163_101765212 | 82 |
| 300 | 3300014325 | Ga0163163_10422158 | Ga0163163_104221582 | 82 |
| 301 | 3300014968 | Ga0157379_10048326 | Ga0157379_100483262 | 82 |
| 302 | 3300020069 | Ga0197907_10442029 | Ga0197907_104420292 | 82 |
| 303 | 3300025981 | Ga0207640_11164260 | Ga0207640_111642602 | 82 |
| 304 | 3300025986 | Ga0207658_12061416 | Ga0207658_120614161 | 82 |
| 305 | 3300026035 | Ga0207703_10279009 | Ga0207703_102790092 | 82 |
| 306 | 3300028379 | Ga0268266_10001499 | Ga0268266_100014999 | 82 |
| 307 | 3300031665 | Ga0316575_10084712 | Ga0316575_100847122 | 82 |
| 308 | 3300031665 | Ga0316575_10156426 | Ga0316575_101564262 | 82 |
| 309 | 3300031727 | Ga0316576_10014055 | Ga0316576_100140556 | 82 |
| 310 | 3300031814 | Ga0247548_109242 | Ga0247548_1092421 | 82 |
| 311 | 3300031816 | Ga0316042_123163 | Ga0316042_1231632 | 82 |
| 312 | 3300031995 | Ga0307409_101375571 | Ga0307409_1013755712 | 82 |
| 313 | 3300032120 | Ga0316053_103317 | Ga0316053_1033172 | 82 |
| 314 | 3300035398 | Ga0316574_0036237 | Ga0316574_0036237_1314_1568 | 82 |
| 315 | 3300035398 | Ga0316574_0537941 | Ga0316574_0537941_395_649 | 82 |
| 316 | 3300036457 | Ga0265778_062811 | Ga0265778_062811_45_299 | 82 |
| 317 | 3300036712 | Ga0316584_0235760 | Ga0316584_0235760_628_882 | 82 |
| 318 | 3300037853 | Ga0436364_1222050 | Ga0436364_1222050_25_279 | 82 |
| 319 | 3300039437 | Ga0436365_1797910 | Ga0436365_1797910_52_306 | 82 |
| 320 | 3300044656 | Ga0466969_0040693 | Ga0466969_0040693_550_804 | 82 |
| 321 | 3300044693 | Ga0466961_0160163 | Ga0466961_0160163_540_794 | 82 |
| 322 | 3300044765 | Ga0466970_0876217 | Ga0466970_0876217_41_295 | 82 |
| 323 | 3300045049 | Ga0466959_0008064 | Ga0466959_0008064_309_563 | 82 |
| 324 | 3300045051 | Ga0451576_1080226 | Ga0451576_1080226_381_641 | 82 |
| 325 | 3300048912 | Ga0496109_1343239 | Ga0496109_1343239_202_456 | 82 |
| 326 | 3300048923 | Ga0496120_0250355 | Ga0496120_0250355_379_633 | 82 |
| 327 | 3300048927 | Ga0496124_0097785 | Ga0496124_0097785_120_374 | 82 |
| 328 | 3300048928 | Ga0496125_0703258 | Ga0496125_0703258_25_279 | 82 |
| 329 | 3300048929 | Ga0496126_0006195 | Ga0496126_0006195_6396_6650 | 82 |
| 330 | 3300048929 | Ga0496126_0858887 | Ga0496126_0858887_246_500 | 82 |
| 331 | 3300053119 | Ga0500595_017641 | Ga0500595_017641_1342_1596 | 82 |
| 332 | 3300059503 | Ga0587080_050382 | Ga0587080_050382_271_525 | 82 |
| 333 | 3300059504 | Ga0587082_101970 | Ga0587082_101970_110_364 | 82 |
| 334 | 3300059509 | Ga0587089_063698 | Ga0587089_063698_169_423 | 82 |
| 335 | 3300059510 | Ga0587090_095523 | Ga0587090_095523_106_360 | 82 |
| 336 | 3300059511 | Ga0587091_212207 | Ga0587091_212207_184_438 | 82 |
| 337 | 3300059513 | Ga0587094_110831 | Ga0587094_110831_98_352 | 82 |
| 338 | 3300059623 | Ga0587101_031787 | Ga0587101_031787_315_569 | 82 |
| 339 | 3300059640 | Ga0587067_120104 | Ga0587067_120104_284_538 | 82 |
| 340 | 3300059648 | Ga0587100_035105 | Ga0587100_035105_193_447 | 82 |
| 341 | 3300059660 | Ga0587124_031020 | Ga0587124_031020_189_443 | 82 |
| 342 | 3300005290 | Ga0065712_10326864 | Ga0065712_103268642 | 83 |
| 343 | 3300005295 | Ga0065707_10728472 | Ga0065707_107284722 | 83 |
| 344 | 3300005327 | Ga0070658_10405905 | Ga0070658_104059051 | 83 |
| 345 | 3300005328 | Ga0070676_10628618 | Ga0070676_106286182 | 83 |
| 346 | 3300005328 | Ga0070676_10692443 | Ga0070676_106924431 | 83 |
| 347 | 3300005328 | Ga0070676_11373448 | Ga0070676_113734481 | 83 |
| 348 | 3300005331 | Ga0070670_101575436 | Ga0070670_1015754362 | 83 |
| 349 | 3300005334 | Ga0068869_100104307 | Ga0068869_1001043072 | 83 |
| 350 | 3300005335 | Ga0070666_10013838 | Ga0070666_100138383 | 83 |
| 351 | 3300005336 | Ga0070680_100068715 | Ga0070680_1000687152 | 83 |
| 352 | 3300005336 | Ga0070680_100069721 | Ga0070680_1000697213 | 83 |
| 353 | 3300005337 | Ga0070682_100134969 | Ga0070682_1001349692 | 83 |
| 354 | 3300005338 | Ga0068868_100032185 | Ga0068868_1000321853 | 83 |
| 355 | 3300005340 | Ga0070689_100820682 | Ga0070689_1008206822 | 83 |
| 356 | 3300005345 | Ga0070692_11349642 | Ga0070692_113496421 | 83 |
| 357 | 3300005353 | Ga0070669_100160143 | Ga0070669_1001601432 | 83 |
| 358 | 3300005353 | Ga0070669_100566157 | Ga0070669_1005661572 | 83 |
| 359 | 3300005353 | Ga0070669_100844812 | Ga0070669_1008448122 | 83 |
| 360 | 3300005354 | Ga0070675_100074763 | Ga0070675_1000747632 | 83 |
| 361 | 3300005354 | Ga0070675_101794310 | Ga0070675_1017943101 | 83 |
| 362 | 3300005355 | Ga0070671_100015878 | Ga0070671_1000158783 | 83 |
| 363 | 3300005356 | Ga0070674_100283647 | Ga0070674_1002836472 | 83 |
| 364 | 3300005356 | Ga0070674_100896987 | Ga0070674_1008969872 | 83 |
| 365 | 3300005364 | Ga0070673_100121783 | Ga0070673_1001217831 | 83 |
| 366 | 3300005364 | Ga0070673_101096215 | Ga0070673_1010962151 | 83 |
| 367 | 3300005367 | Ga0070667_100004160 | Ga0070667_1000041609 | 83 |
| 368 | 3300005434 | Ga0070709_10053834 | Ga0070709_100538342 | 83 |
| 369 | 3300005434 | Ga0070709_10264091 | Ga0070709_102640912 | 83 |
| 370 | 3300005435 | Ga0070714_100008875 | Ga0070714_1000088752 | 83 |
| 371 | 3300005435 | Ga0070714_100103127 | Ga0070714_1001031272 | 83 |
| 372 | 3300005435 | Ga0070714_100160828 | Ga0070714_1001608282 | 83 |
| 373 | 3300005436 | Ga0070713_100002296 | Ga0070713_1000022964 | 83 |
| 374 | 3300005436 | Ga0070713_100022771 | Ga0070713_1000227712 | 83 |
| 375 | 3300005436 | Ga0070713_100263809 | Ga0070713_1002638092 | 83 |
| 376 | 3300005437 | Ga0070710_10010095 | Ga0070710_100100954 | 83 |
| 377 | 3300005437 | Ga0070710_10598765 | Ga0070710_105987651 | 83 |
| 378 | 3300005437 | Ga0070710_11115080 | Ga0070710_111150801 | 83 |
| 379 | 3300005439 | Ga0070711_100001034 | Ga0070711_1000010348 | 83 |
| 380 | 3300005440 | Ga0070705_100182697 | Ga0070705_1001826972 | 83 |
| 381 | 3300005441 | Ga0070700_100023816 | Ga0070700_1000238162 | 83 |
| 382 | 3300005441 | Ga0070700_101026947 | Ga0070700_1010269472 | 83 |
| 383 | 3300005444 | Ga0070694_100467465 | Ga0070694_1004674651 | 83 |
| 384 | 3300005456 | Ga0070678_100175756 | Ga0070678_1001757562 | 83 |
| 385 | 3300005456 | Ga0070678_101671105 | Ga0070678_1016711052 | 83 |
| 386 | 3300005457 | Ga0070662_100876270 | Ga0070662_1008762701 | 83 |
| 387 | 3300005458 | Ga0070681_10012472 | Ga0070681_100124724 | 83 |
| 388 | 3300005458 | Ga0070681_10063063 | Ga0070681_100630633 | 83 |
| 389 | 3300005458 | Ga0070681_11055348 | Ga0070681_110553482 | 83 |
| 390 | 3300005458 | Ga0070681_12019274 | Ga0070681_120192741 | 83 |
| 391 | 3300005459 | Ga0068867_100002191 | Ga0068867_1000021913 | 83 |
| 392 | 3300005459 | Ga0068867_100091261 | Ga0068867_1000912613 | 83 |
| 393 | 3300005459 | Ga0068867_100356763 | Ga0068867_1003567632 | 83 |
| 394 | 3300005467 | Ga0070706_101358474 | Ga0070706_1013584741 | 83 |
| 395 | 3300005530 | Ga0070679_100001170 | Ga0070679_1000011703 | 83 |
| 396 | 3300005530 | Ga0070679_100038227 | Ga0070679_1000382275 | 83 |
| 397 | 3300005536 | Ga0070697_101101118 | Ga0070697_1011011181 | 83 |
| 398 | 3300005543 | Ga0070672_101287315 | Ga0070672_1012873151 | 83 |
| 399 | 3300005545 | Ga0070695_100126445 | Ga0070695_1001264452 | 83 |
| 400 | 3300005547 | Ga0070693_100192663 | Ga0070693_1001926632 | 83 |
| 401 | 3300005548 | Ga0070665_100022414 | Ga0070665_1000224143 | 83 |
| 402 | 3300005549 | Ga0070704_100473864 | Ga0070704_1004738641 | 83 |
| 403 | 3300005549 | Ga0070704_100511689 | Ga0070704_1005116892 | 83 |
| 404 | 3300005549 | Ga0070704_100867542 | Ga0070704_1008675422 | 83 |
| 405 | 3300005563 | Ga0068855_100005297 | Ga0068855_10000529713 | 83 |
| 406 | 3300005563 | Ga0068855_100006825 | Ga0068855_1000068258 | 83 |
| 407 | 3300005563 | Ga0068855_101211058 | Ga0068855_1012110582 | 83 |
| 408 | 3300005578 | Ga0068854_100048603 | Ga0068854_1000486032 | 83 |
| 409 | 3300005578 | Ga0068854_100904691 | Ga0068854_1009046912 | 83 |
| 410 | 3300005578 | Ga0068854_101103810 | Ga0068854_1011038101 | 83 |
| 411 | 3300005614 | Ga0068856_100005786 | Ga0068856_1000057868 | 83 |
| 412 | 3300005614 | Ga0068856_100217082 | Ga0068856_1002170821 | 83 |
| 413 | 3300005614 | Ga0068856_100274337 | Ga0068856_1002743372 | 83 |
| 414 | 3300005616 | Ga0068852_100573487 | Ga0068852_1005734872 | 83 |
| 415 | 3300005617 | Ga0068859_100249892 | Ga0068859_1002498922 | 83 |
| 416 | 3300005617 | Ga0068859_101470346 | Ga0068859_1014703462 | 83 |
| 417 | 3300005618 | Ga0068864_100374585 | Ga0068864_1003745852 | 83 |
| 418 | 3300005718 | Ga0068866_10002926 | Ga0068866_100029266 | 83 |
| 419 | 3300005718 | Ga0068866_10102612 | Ga0068866_101026122 | 83 |
| 420 | 3300005840 | Ga0068870_10211360 | Ga0068870_102113602 | 83 |
| 421 | 3300005841 | Ga0068863_100115613 | Ga0068863_1001156133 | 83 |
| 422 | 3300005842 | Ga0068858_100019950 | Ga0068858_1000199503 | 83 |
| 423 | 3300005843 | Ga0068860_100036507 | Ga0068860_1000365072 | 83 |
| 424 | 3300005843 | Ga0068860_100746585 | Ga0068860_1007465852 | 83 |
| 425 | 3300005844 | Ga0068862_100656714 | Ga0068862_1006567142 | 83 |
| 426 | 3300005844 | Ga0068862_100764424 | Ga0068862_1007644242 | 83 |
| 427 | 3300006028 | Ga0070717_10009383 | Ga0070717_100093833 | 83 |
| 428 | 3300006028 | Ga0070717_10410798 | Ga0070717_104107982 | 83 |
| 429 | 3300006163 | Ga0070715_10000114 | Ga0070715_1000011415 | 83 |
| 430 | 3300006163 | Ga0070715_10282225 | Ga0070715_102822252 | 83 |
| 431 | 3300006173 | Ga0070716_100015835 | Ga0070716_1000158354 | 83 |
| 432 | 3300006173 | Ga0070716_100018080 | Ga0070716_1000180803 | 83 |
| 433 | 3300006173 | Ga0070716_100090958 | Ga0070716_1000909582 | 83 |
| 434 | 3300006175 | Ga0070712_100001088 | Ga0070712_1000010888 | 83 |
| 435 | 3300006175 | Ga0070712_100032180 | Ga0070712_1000321802 | 83 |
| 436 | 3300006175 | Ga0070712_100162831 | Ga0070712_1001628311 | 83 |
| 437 | 3300006237 | Ga0097621_100045269 | Ga0097621_1000452692 | 83 |
| 438 | 3300006237 | Ga0097621_100534101 | Ga0097621_1005341012 | 83 |
| 439 | 3300006358 | Ga0068871_100019101 | Ga0068871_1000191014 | 83 |
| 440 | 3300006844 | Ga0075428_100006700 | Ga0075428_10000670012 | 83 |
| 441 | 3300006846 | Ga0075430_100107480 | Ga0075430_1001074803 | 83 |
| 442 | 3300006847 | Ga0075431_100126085 | Ga0075431_1001260852 | 83 |
| 443 | 3300006847 | Ga0075431_100919261 | Ga0075431_1009192612 | 83 |
| 444 | 3300006852 | Ga0075433_10000312 | Ga0075433_1000031230 | 83 |
| 445 | 3300006871 | Ga0075434_100000027 | Ga0075434_10000002735 | 83 |
| 446 | 3300006871 | Ga0075434_100033428 | Ga0075434_1000334284 | 83 |
| 447 | 3300006881 | Ga0068865_100003798 | Ga0068865_1000037981 | 83 |
| 448 | 3300006881 | Ga0068865_100051478 | Ga0068865_1000514782 | 83 |
| 449 | 3300006881 | Ga0068865_100321700 | Ga0068865_1003217001 | 83 |
| 450 | 3300006914 | Ga0075436_100509366 | Ga0075436_1005093661 | 83 |
| 451 | 3300006914 | Ga0075436_100512741 | Ga0075436_1005127412 | 83 |
| 452 | 3300006931 | Ga0097620_100249886 | Ga0097620_1002498862 | 83 |
| 453 | 3300006931 | Ga0097620_101470263 | Ga0097620_1014702632 | 83 |
| 454 | 3300007076 | Ga0075435_100089709 | Ga0075435_1000897092 | 83 |
| 455 | 3300007076 | Ga0075435_100102338 | Ga0075435_1001023382 | 83 |
| 456 | 3300007076 | Ga0075435_100435432 | Ga0075435_1004354322 | 83 |
| 457 | 3300007265 | Ga0099794_10145581 | Ga0099794_101455812 | 83 |
| 458 | 3300009093 | Ga0105240_10009095 | Ga0105240_100090952 | 83 |
| 459 | 3300009093 | Ga0105240_10985979 | Ga0105240_109859792 | 83 |
| 460 | 3300009094 | Ga0111539_10006985 | Ga0111539_100069853 | 83 |
| 461 | 3300009094 | Ga0111539_10193409 | Ga0111539_101934092 | 83 |
| 462 | 3300009147 | Ga0114129_10240458 | Ga0114129_102404582 | 83 |
| 463 | 3300009174 | Ga0105241_10330138 | Ga0105241_103301383 | 83 |
| 464 | 3300009176 | Ga0105242_10079411 | Ga0105242_100794114 | 83 |
| 465 | 3300009176 | Ga0105242_10250626 | Ga0105242_102506263 | 83 |
| 466 | 3300009545 | Ga0105237_10114154 | Ga0105237_101141543 | 83 |
| 467 | 3300009551 | Ga0105238_10003358 | Ga0105238_1000335811 | 83 |
| 468 | 3300009553 | Ga0105249_11301663 | Ga0105249_113016632 | 83 |
| 469 | 3300010159 | Ga0099796_10010448 | Ga0099796_100104482 | 83 |
| 470 | 3300010375 | Ga0105239_10654436 | Ga0105239_106544362 | 83 |
| 471 | 3300013100 | Ga0157373_10578476 | Ga0157373_105784762 | 83 |
| 472 | 3300013104 | Ga0157370_10011541 | Ga0157370_100115419 | 83 |
| 473 | 3300013104 | Ga0157370_10484692 | Ga0157370_104846922 | 83 |
| 474 | 3300013105 | Ga0157369_10039660 | Ga0157369_100396603 | 83 |
| 475 | 3300013105 | Ga0157369_10097953 | Ga0157369_100979532 | 83 |
| 476 | 3300013105 | Ga0157369_11374442 | Ga0157369_113744422 | 83 |
| 477 | 3300013307 | Ga0157372_11015739 | Ga0157372_110157392 | 83 |
| 478 | 3300014326 | Ga0157380_10007838 | Ga0157380_100078386 | 83 |
| 479 | 3300014745 | Ga0157377_10196529 | Ga0157377_101965292 | 83 |
| 480 | 3300014745 | Ga0157377_10349101 | Ga0157377_103491012 | 83 |
| 481 | 3300020069 | Ga0197907_10405711 | Ga0197907_104057112 | 83 |
| 482 | 3300020075 | Ga0206349_1423094 | Ga0206349_14230941 | 83 |
| 483 | 3300020076 | Ga0206355_1527855 | Ga0206355_15278551 | 83 |
| 484 | 3300020077 | Ga0206351_10505028 | Ga0206351_105050282 | 83 |
| 485 | 3300020078 | Ga0206352_10989618 | Ga0206352_109896182 | 83 |
| 486 | 3300020081 | Ga0206354_10471473 | Ga0206354_104714732 | 83 |
| 487 | 3300020081 | Ga0206354_11309011 | Ga0206354_113090111 | 83 |
| 488 | 3300020082 | Ga0206353_10649310 | Ga0206353_106493102 | 83 |
| 489 | 3300020082 | Ga0206353_10906586 | Ga0206353_109065861 | 83 |
| 490 | 3300020610 | Ga0154015_1228595 | Ga0154015_12285952 | 83 |
| 491 | 3300020610 | Ga0154015_1535633 | Ga0154015_15356332 | 83 |
| 492 | 3300021377 | Ga0213874_10010595 | Ga0213874_100105952 | 83 |
| 493 | 3300021441 | Ga0213871_10003766 | Ga0213871_100037663 | 83 |
| 494 | 3300022467 | Ga0224712_10295700 | Ga0224712_102957002 | 83 |
| 495 | 3300022467 | Ga0224712_10317742 | Ga0224712_103177422 | 83 |
| 496 | 3300022467 | Ga0224712_10351264 | Ga0224712_103512642 | 83 |
| 497 | 3300025885 | Ga0207653_10072720 | Ga0207653_100727202 | 83 |
| 498 | 3300025898 | Ga0207692_10006619 | Ga0207692_100066194 | 83 |
| 499 | 3300025898 | Ga0207692_10904545 | Ga0207692_109045451 | 83 |
| 500 | 3300025899 | Ga0207642_10009077 | Ga0207642_100090773 | 83 |
| 501 | 3300025900 | Ga0207710_10003821 | Ga0207710_100038216 | 83 |
| 502 | 3300025903 | Ga0207680_10051955 | Ga0207680_100519552 | 83 |
| 503 | 3300025905 | Ga0207685_10044484 | Ga0207685_100444842 | 83 |
| 504 | 3300025906 | Ga0207699_10008031 | Ga0207699_100080312 | 83 |
| 505 | 3300025906 | Ga0207699_10099195 | Ga0207699_100991952 | 83 |
| 506 | 3300025907 | Ga0207645_10000348 | Ga0207645_1000034830 | 83 |
| 507 | 3300025907 | Ga0207645_10522636 | Ga0207645_105226362 | 83 |
| 508 | 3300025908 | Ga0207643_10246781 | Ga0207643_102467812 | 83 |
| 509 | 3300025909 | Ga0207705_10597061 | Ga0207705_105970612 | 83 |
| 510 | 3300025910 | Ga0207684_11179288 | Ga0207684_111792882 | 83 |
| 511 | 3300025911 | Ga0207654_10874813 | Ga0207654_108748132 | 83 |
| 512 | 3300025912 | Ga0207707_10000202 | Ga0207707_1000020249 | 83 |
| 513 | 3300025912 | Ga0207707_10049339 | Ga0207707_100493393 | 83 |
| 514 | 3300025912 | Ga0207707_10998299 | Ga0207707_109982991 | 83 |
| 515 | 3300025913 | Ga0207695_10079448 | Ga0207695_100794483 | 83 |
| 516 | 3300025913 | Ga0207695_10148579 | Ga0207695_101485792 | 83 |
| 517 | 3300025913 | Ga0207695_10186441 | Ga0207695_101864413 | 83 |
| 518 | 3300025914 | Ga0207671_10059420 | Ga0207671_100594203 | 83 |
| 519 | 3300025914 | Ga0207671_10131595 | Ga0207671_101315953 | 83 |
| 520 | 3300025915 | Ga0207693_10000216 | Ga0207693_1000021613 | 83 |
| 521 | 3300025915 | Ga0207693_10149640 | Ga0207693_101496402 | 83 |
| 522 | 3300025916 | Ga0207663_10001899 | Ga0207663_100018993 | 83 |
| 523 | 3300025916 | Ga0207663_11158201 | Ga0207663_111582012 | 83 |
| 524 | 3300025917 | Ga0207660_10001921 | Ga0207660_100019213 | 83 |
| 525 | 3300025917 | Ga0207660_10245840 | Ga0207660_102458402 | 83 |
| 526 | 3300025921 | Ga0207652_10002554 | Ga0207652_100025544 | 83 |
| 527 | 3300025921 | Ga0207652_10031203 | Ga0207652_100312033 | 83 |
| 528 | 3300025923 | Ga0207681_10388533 | Ga0207681_103885332 | 83 |
| 529 | 3300025923 | Ga0207681_10665723 | Ga0207681_106657232 | 83 |
| 530 | 3300025924 | Ga0207694_10001276 | Ga0207694_100012766 | 83 |
| 531 | 3300025925 | Ga0207650_10860774 | Ga0207650_108607742 | 83 |
| 532 | 3300025926 | Ga0207659_10735132 | Ga0207659_107351321 | 83 |
| 533 | 3300025926 | Ga0207659_10910438 | Ga0207659_109104382 | 83 |
| 534 | 3300025927 | Ga0207687_10008944 | Ga0207687_100089444 | 83 |
| 535 | 3300025928 | Ga0207700_10062255 | Ga0207700_100622552 | 83 |
| 536 | 3300025928 | Ga0207700_10288652 | Ga0207700_102886522 | 83 |
| 537 | 3300025928 | Ga0207700_11554874 | Ga0207700_115548741 | 83 |
| 538 | 3300025929 | Ga0207664_10046950 | Ga0207664_100469504 | 83 |
| 539 | 3300025929 | Ga0207664_10383889 | Ga0207664_103838892 | 83 |
| 540 | 3300025931 | Ga0207644_10045386 | Ga0207644_100453863 | 83 |
| 541 | 3300025931 | Ga0207644_10838239 | Ga0207644_108382391 | 83 |
| 542 | 3300025933 | Ga0207706_10193601 | Ga0207706_101936012 | 83 |
| 543 | 3300025933 | Ga0207706_10757415 | Ga0207706_107574152 | 83 |
| 544 | 3300025934 | Ga0207686_10015664 | Ga0207686_100156643 | 83 |
| 545 | 3300025934 | Ga0207686_10428730 | Ga0207686_104287302 | 83 |
| 546 | 3300025934 | Ga0207686_11818198 | Ga0207686_118181981 | 83 |
| 547 | 3300025937 | Ga0207669_10008128 | Ga0207669_100081286 | 83 |
| 548 | 3300025937 | Ga0207669_10698626 | Ga0207669_106986262 | 83 |
| 549 | 3300025938 | Ga0207704_10025385 | Ga0207704_100253854 | 83 |
| 550 | 3300025938 | Ga0207704_10164081 | Ga0207704_101640811 | 83 |
| 551 | 3300025939 | Ga0207665_10025478 | Ga0207665_100254782 | 83 |
| 552 | 3300025939 | Ga0207665_10032084 | Ga0207665_100320842 | 83 |
| 553 | 3300025939 | Ga0207665_10313879 | Ga0207665_103138791 | 83 |
| 554 | 3300025940 | Ga0207691_10404384 | Ga0207691_104043842 | 83 |
| 555 | 3300025941 | Ga0207711_10044292 | Ga0207711_100442923 | 83 |
| 556 | 3300025942 | Ga0207689_10291810 | Ga0207689_102918102 | 83 |
| 557 | 3300025949 | Ga0207667_10005725 | Ga0207667_1000572510 | 83 |
| 558 | 3300025949 | Ga0207667_10016648 | Ga0207667_100166483 | 83 |
| 559 | 3300025949 | Ga0207667_10222004 | Ga0207667_102220042 | 83 |
| 560 | 3300025960 | Ga0207651_10097285 | Ga0207651_100972852 | 83 |
| 561 | 3300025961 | Ga0207712_10177423 | Ga0207712_101774232 | 83 |
| 562 | 3300025961 | Ga0207712_11935549 | Ga0207712_119355492 | 83 |
| 563 | 3300025986 | Ga0207658_10049346 | Ga0207658_100493462 | 83 |
| 564 | 3300026023 | Ga0207677_10029488 | Ga0207677_100294883 | 83 |
| 565 | 3300026035 | Ga0207703_10902227 | Ga0207703_109022272 | 83 |
| 566 | 3300026035 | Ga0207703_11427913 | Ga0207703_114279131 | 83 |
| 567 | 3300026075 | Ga0207708_10964897 | Ga0207708_109648972 | 83 |
| 568 | 3300026078 | Ga0207702_10029702 | Ga0207702_100297026 | 83 |
| 569 | 3300026078 | Ga0207702_10059820 | Ga0207702_100598202 | 83 |
| 570 | 3300026078 | Ga0207702_10374624 | Ga0207702_103746242 | 83 |
| 571 | 3300026088 | Ga0207641_10069596 | Ga0207641_100695963 | 83 |
| 572 | 3300026089 | Ga0207648_10004874 | Ga0207648_100048749 | 83 |
| 573 | 3300026089 | Ga0207648_10128023 | Ga0207648_101280233 | 83 |
| 574 | 3300026089 | Ga0207648_10527718 | Ga0207648_105277182 | 83 |
| 575 | 3300026095 | Ga0207676_10324632 | Ga0207676_103246322 | 83 |
| 576 | 3300026116 | Ga0207674_10152939 | Ga0207674_101529393 | 83 |
| 577 | 3300026116 | Ga0207674_10930031 | Ga0207674_109300312 | 83 |
| 578 | 3300026118 | Ga0207675_100140996 | Ga0207675_1001409962 | 83 |
| 579 | 3300026118 | Ga0207675_100820984 | Ga0207675_1008209842 | 83 |
| 580 | 3300026118 | Ga0207675_101598953 | Ga0207675_1015989532 | 83 |
| 581 | 3300026121 | Ga0207683_10004156 | Ga0207683_100041566 | 83 |
| 582 | 3300026121 | Ga0207683_10538789 | Ga0207683_105387892 | 83 |
| 583 | 3300027907 | Ga0207428_10002854 | Ga0207428_1000285412 | 83 |
| 584 | 3300027907 | Ga0207428_10027919 | Ga0207428_100279192 | 83 |
| 585 | 3300027907 | Ga0207428_10103630 | Ga0207428_101036303 | 83 |
| 586 | 3300028379 | Ga0268266_10098841 | Ga0268266_100988412 | 83 |
| 587 | 3300028380 | Ga0268265_10660502 | Ga0268265_106605022 | 83 |
| 588 | 3300028381 | Ga0268264_10678760 | Ga0268264_106787601 | 83 |
| 589 | 3300028794 | Ga0307515_10012124 | Ga0307515_100121247 | 83 |
| 590 | 3300028794 | Ga0307515_10425173 | Ga0307515_104251732 | 83 |
| 591 | 3300031507 | Ga0307509_10000099 | Ga0307509_1000009919 | 83 |
| 592 | 3300031616 | Ga0307508_10422939 | Ga0307508_104229392 | 83 |
| 593 | 3300032004 | Ga0307414_11565707 | Ga0307414_115657071 | 83 |
| 594 | 3300035692 | Ga0373935_0963129 | Ga0373935_0963129_347_601 | 83 |
| 595 | 3300037418 | Ga0395900_0125647 | Ga0395900_0125647_446_700 | 83 |
| 596 | 3300037418 | Ga0395900_0462554 | Ga0395900_0462554_55_309 | 83 |
| 597 | 3300037466 | Ga0395898_0002854 | Ga0395898_0002854_7441_7695 | 83 |
| 598 | 3300037466 | Ga0395898_0010069 | Ga0395898_0010069_7434_7688 | 83 |
| 599 | 3300037466 | Ga0395898_0188826 | Ga0395898_0188826_1253_1507 | 83 |
| 600 | 3300038741 | Ga0400488_56057 | Ga0400488_56057_1521_1781 | 83 |
| 601 | 3300039110 | Ga0400487_04101 | Ga0400487_04101_11007_11267 | 83 |
| 602 | 3300039437 | Ga0436365_1901520 | Ga0436365_1901520_18_269 | 83 |
| 603 | 3300039447 | Ga0436361_0193979 | Ga0436361_0193979_101_358 | 83 |
| 604 | 3300042532 | Ga0450893_0115065 | Ga0450893_0115065_151_405 | 83 |
| 605 | 3300042876 | Ga0451577_0007767 | Ga0451577_0007767_3707_3964 | 83 |
| 606 | 3300042876 | Ga0451577_0121837 | Ga0451577_0121837_885_1142 | 83 |
| 607 | 3300044656 | Ga0466969_0005066 | Ga0466969_0005066_6563_6817 | 83 |
| 608 | 3300044656 | Ga0466969_0318689 | Ga0466969_0318689_196_450 | 83 |
| 609 | 3300044673 | Ga0453683_0010066 | Ga0453683_0010066_1385_1642 | 83 |
| 610 | 3300044684 | Ga0466966_0000786 | Ga0466966_0000786_1201_1455 | 83 |
| 611 | 3300044684 | Ga0466966_0291869 | Ga0466966_0291869_579_833 | 83 |
| 612 | 3300044693 | Ga0466961_0010757 | Ga0466961_0010757_483_737 | 83 |
| 613 | 3300044693 | Ga0466961_0347682 | Ga0466961_0347682_222_476 | 83 |
| 614 | 3300044694 | Ga0466963_0088166 | Ga0466963_0088166_1595_1849 | 83 |
| 615 | 3300044706 | Ga0466964_0003849 | Ga0466964_0003849_1204_1458 | 83 |
| 616 | 3300044712 | Ga0453684_0032098 | Ga0453684_0032098_346_603 | 83 |
| 617 | 3300044719 | Ga0466971_0000163 | Ga0466971_0000163_8248_8502 | 83 |
| 618 | 3300044765 | Ga0466970_0012565 | Ga0466970_0012565_192_446 | 83 |
| 619 | 3300044842 | Ga0466957_0030205 | Ga0466957_0030205_362_616 | 83 |
| 620 | 3300044842 | Ga0466957_0177687 | Ga0466957_0177687_92_346 | 83 |
| 621 | 3300045049 | Ga0466959_0003333 | Ga0466959_0003333_290_544 | 83 |
| 622 | 3300045049 | Ga0466959_0483189 | Ga0466959_0483189_286_540 | 83 |
| 623 | 3300045051 | Ga0451576_0299623 | Ga0451576_0299623_541_798 | 83 |
| 624 | 3300046472 | Ga0495580_0006674 | Ga0495580_0006674_17_274 | 83 |
| 625 | 3300046499 | Ga0495594_0531328 | Ga0495594_0531328_380_634 | 83 |
| 626 | 3300046689 | Ga0495613_0368154 | Ga0495613_0368154_705_959 | 83 |
| 627 | 3300046810 | Ga0495660_0294296 | Ga0495660_0294296_211_471 | 83 |
| 628 | 3300047673 | Ga0495593_0142352 | Ga0495593_0142352_864_1118 | 83 |
| 629 | 3300048905 | Ga0496102_0080906 | Ga0496102_0080906_510_761 | 83 |
| 630 | 3300048909 | Ga0496106_0255709 | Ga0496106_0255709_60_311 | 83 |
| 631 | 3300048911 | Ga0496108_1211794 | Ga0496108_1211794_225_476 | 83 |
| 632 | 3300048915 | Ga0496112_0999450 | Ga0496112_0999450_197_448 | 83 |
| 633 | 3300048916 | Ga0496113_0306644 | Ga0496113_0306644_1001_1255 | 83 |
| 634 | 3300049574 | Ga0501038_0554907 | Ga0501038_0554907_58_366 | 83 |
| 635 | 3300049575 | Ga0501039_0912959 | Ga0501039_0912959_369_629 | 83 |
| 636 | 3300049577 | Ga0501041_0132475 | Ga0501041_0132475_239_499 | 83 |
| 637 | 3300049580 | Ga0501046_1231592 | Ga0501046_1231592_84_344 | 83 |
| 638 | 3300049583 | Ga0501067_0137701 | Ga0501067_0137701_168_428 | 83 |
| 639 | 3300049584 | Ga0501068_0076151 | Ga0501068_0076151_1592_1852 | 83 |
| 640 | 3300049585 | Ga0501069_0298343 | Ga0501069_0298343_658_918 | 83 |
| 641 | 3300049588 | Ga0501072_0053074 | Ga0501072_0053074_1280_1540 | 83 |
| 642 | 3300049591 | Ga0501075_0045553 | Ga0501075_0045553_492_752 | 83 |
| 643 | 3300049592 | Ga0501076_0118732 | Ga0501076_0118732_191_451 | 83 |
| 644 | 3300049741 | Ga0501079_0227407 | Ga0501079_0227407_631_891 | 83 |
| 645 | 3300049743 | Ga0501081_0175591 | Ga0501081_0175591_792_1052 | 83 |
| 646 | 3300049822 | Ga0501035_0080209 | Ga0501035_0080209_1254_1562 | 83 |
| 647 | 3300049823 | Ga0501044_0000213 | Ga0501044_0000213_14803_15111 | 83 |
| 648 | 3300049824 | Ga0501045_0833633 | Ga0501045_0833633_102_362 | 83 |
| 649 | 3300050507 | nmdc:mga05p37_65384_c1 | nmdc:mga05p37_65384_c1_1084_1344 | 83 |
| 650 | 3300050508 | nmdc:mga09592_798815_c1 | nmdc:mga09592_798815_c1_224_484 | 83 |
| 651 | 3300050509 | nmdc:mga0qj67_17472_c1 | nmdc:mga0qj67_17472_c1_3995_4249 | 83 |
| 652 | 3300050510 | nmdc:mga06r32_119848_c1 | nmdc:mga06r32_119848_c1_2040_2294 | 83 |
| 653 | 3300050511 | nmdc:mga08y16_139811_c1 | nmdc:mga08y16_139811_c1_1108_1368 | 83 |
| 654 | 3300050511 | nmdc:mga08y16_8740_c1 | nmdc:mga08y16_8740_c1_8936_9196 | 83 |
| 655 | 3300050512 | nmdc:mga0n895_143_c1 | nmdc:mga0n895_143_c1_21104_21364 | 83 |
| 656 | 3300050513 | nmdc:mga0rr50_113092_c1 | nmdc:mga0rr50_113092_c1_713_973 | 83 |
| 657 | 3300050515 | nmdc:mga0a205_87_c1 | nmdc:mga0a205_87_c1_26463_26723 | 83 |
| 658 | 3300053139 | Ga0500568_0215661 | Ga0500568_0215661_197_460 | 83 |
| 659 | 3300053156 | Ga0500622_0008492 | Ga0500622_0008492_4817_5080 | 83 |
| 660 | 3300053178 | Ga0500637_0111178 | Ga0500637_0111178_372_653 | 83 |
| 661 | 3300059493 | Ga0587077_262131 | Ga0587077_262131_32_283 | 83 |
| 662 | 3300059507 | Ga0587086_079837 | Ga0587086_079837_161_412 | 83 |
| 663 | 3300060344 | Ga0587071_116898 | Ga0587071_116898_100_354 | 83 |
| 664 | 3300060353 | Ga0501082_0474553 | Ga0501082_0474553_484_744 | 83 |
| 665 | 3300061719 | Ga0466962_0005596 | Ga0466962_0005596_1324_1578 | 83 |
| 666 | 3300004799 | Ga0058863_11949113 | Ga0058863_119491132 | 84 |
| 667 | 3300004800 | Ga0058861_12065226 | Ga0058861_120652261 | 84 |
| 668 | 3300005329 | Ga0070683_101041747 | Ga0070683_1010417471 | 84 |
| 669 | 3300005329 | Ga0070683_101809044 | Ga0070683_1018090442 | 84 |
| 670 | 3300005329 | Ga0070683_101836071 | Ga0070683_1018360712 | 84 |
| 671 | 3300005336 | Ga0070680_100049273 | Ga0070680_1000492733 | 84 |
| 672 | 3300005366 | Ga0070659_101398060 | Ga0070659_1013980602 | 84 |
| 673 | 3300005367 | Ga0070667_100000046 | Ga0070667_10000004655 | 84 |
| 674 | 3300005458 | Ga0070681_10694133 | Ga0070681_106941332 | 84 |
| 675 | 3300005518 | Ga0070699_100410948 | Ga0070699_1004109481 | 84 |
| 676 | 3300005530 | Ga0070679_100512099 | Ga0070679_1005120992 | 84 |
| 677 | 3300005530 | Ga0070679_102069949 | Ga0070679_1020699492 | 84 |
| 678 | 3300005546 | Ga0070696_100344676 | Ga0070696_1003446762 | 84 |
| 679 | 3300005563 | Ga0068855_100032463 | Ga0068855_1000324632 | 84 |
| 680 | 3300005564 | Ga0070664_101807266 | Ga0070664_1018072662 | 84 |
| 681 | 3300005616 | Ga0068852_101178901 | Ga0068852_1011789012 | 84 |
| 682 | 3300005617 | Ga0068859_100041725 | Ga0068859_1000417254 | 84 |
| 683 | 3300005834 | Ga0068851_10294574 | Ga0068851_102945742 | 84 |
| 684 | 3300005841 | Ga0068863_100391573 | Ga0068863_1003915732 | 84 |
| 685 | 3300005841 | Ga0068863_100818969 | Ga0068863_1008189692 | 84 |
| 686 | 3300006038 | Ga0075365_10000123 | Ga0075365_1000012321 | 84 |
| 687 | 3300006042 | Ga0075368_10058206 | Ga0075368_100582061 | 84 |
| 688 | 3300006051 | Ga0075364_10000745 | Ga0075364_100007452 | 84 |
| 689 | 3300006178 | Ga0075367_10000270 | Ga0075367_100002706 | 84 |
| 690 | 3300006186 | Ga0075369_10000133 | Ga0075369_100001339 | 84 |
| 691 | 3300006237 | Ga0097621_100821922 | Ga0097621_1008219222 | 84 |
| 692 | 3300006880 | Ga0075429_100004834 | Ga0075429_1000048342 | 84 |
| 693 | 3300006931 | Ga0097620_100041725 | Ga0097620_1000417254 | 84 |
| 694 | 3300009092 | Ga0105250_10030267 | Ga0105250_100302673 | 84 |
| 695 | 3300009093 | Ga0105240_10010581 | Ga0105240_100105813 | 84 |
| 696 | 3300009101 | Ga0105247_10118162 | Ga0105247_101181622 | 84 |
| 697 | 3300009174 | Ga0105241_11940537 | Ga0105241_119405372 | 84 |
| 698 | 3300009177 | Ga0105248_10152340 | Ga0105248_101523402 | 84 |
| 699 | 3300009545 | Ga0105237_10473642 | Ga0105237_104736421 | 84 |
| 700 | 3300009545 | Ga0105237_11942984 | Ga0105237_119429841 | 84 |
| 701 | 3300009551 | Ga0105238_10343773 | Ga0105238_103437732 | 84 |
| 702 | 3300009553 | Ga0105249_10216856 | Ga0105249_102168563 | 84 |
| 703 | 3300009987 | Ga0105030_100115 | Ga0105030_1001155 | 84 |
| 704 | 3300014325 | Ga0163163_10122312 | Ga0163163_101223123 | 84 |
| 705 | 3300014326 | Ga0157380_10102109 | Ga0157380_101021092 | 84 |
| 706 | 3300014326 | Ga0157380_11718502 | Ga0157380_117185021 | 84 |
| 707 | 3300020077 | Ga0206351_10986797 | Ga0206351_109867972 | 84 |
| 708 | 3300020078 | Ga0206352_10417728 | Ga0206352_104177281 | 84 |
| 709 | 3300020080 | Ga0206350_11527223 | Ga0206350_115272232 | 84 |
| 710 | 3300020610 | Ga0154015_1114833 | Ga0154015_11148331 | 84 |
| 711 | 3300025321 | Ga0207656_10196151 | Ga0207656_101961512 | 84 |
| 712 | 3300025711 | Ga0207696_1054385 | Ga0207696_10543852 | 84 |
| 713 | 3300025900 | Ga0207710_10068075 | Ga0207710_100680752 | 84 |
| 714 | 3300025903 | Ga0207680_10022402 | Ga0207680_100224023 | 84 |
| 715 | 3300025911 | Ga0207654_10484983 | Ga0207654_104849832 | 84 |
| 716 | 3300025912 | Ga0207707_10014584 | Ga0207707_100145845 | 84 |
| 717 | 3300025913 | Ga0207695_10010951 | Ga0207695_100109514 | 84 |
| 718 | 3300025913 | Ga0207695_11092592 | Ga0207695_110925922 | 84 |
| 719 | 3300025914 | Ga0207671_10405741 | Ga0207671_104057411 | 84 |
| 720 | 3300025914 | Ga0207671_10722301 | Ga0207671_107223012 | 84 |
| 721 | 3300025914 | Ga0207671_11460347 | Ga0207671_114603471 | 84 |
| 722 | 3300025919 | Ga0207657_10318477 | Ga0207657_103184772 | 84 |
| 723 | 3300025924 | Ga0207694_10960856 | Ga0207694_109608562 | 84 |
| 724 | 3300025924 | Ga0207694_11153545 | Ga0207694_111535452 | 84 |
| 725 | 3300025932 | Ga0207690_10977755 | Ga0207690_109777552 | 84 |
| 726 | 3300025941 | Ga0207711_10486760 | Ga0207711_104867602 | 84 |
| 727 | 3300025949 | Ga0207667_10108588 | Ga0207667_101085882 | 84 |
| 728 | 3300025961 | Ga0207712_10121945 | Ga0207712_101219453 | 84 |
| 729 | 3300025986 | Ga0207658_10001515 | Ga0207658_1000151522 | 84 |
| 730 | 3300026088 | Ga0207641_11170754 | Ga0207641_111707542 | 84 |
| 731 | 3300026142 | Ga0207698_11139805 | Ga0207698_111398052 | 84 |
| 732 | 3300027526 | Ga0209968_1036269 | Ga0209968_10362691 | 84 |
| 733 | 3300027543 | Ga0209999_1049771 | Ga0209999_10497712 | 84 |
| 734 | 3300027617 | Ga0210002_1009907 | Ga0210002_10099072 | 84 |
| 735 | 3300027682 | Ga0209971_1020840 | Ga0209971_10208401 | 84 |
| 736 | 3300027866 | Ga0209813_10051262 | Ga0209813_100512621 | 84 |
| 737 | 3300027876 | Ga0209974_10224265 | Ga0209974_102242652 | 84 |
| 738 | 3300030863 | Ga0265766_1025514 | Ga0265766_10255142 | 84 |
| 739 | 3300031242 | Ga0265329_10048463 | Ga0265329_100484632 | 84 |
| 740 | 3300031247 | Ga0265340_10015618 | Ga0265340_100156183 | 84 |
| 741 | 3300031548 | Ga0307408_100106988 | Ga0307408_1001069883 | 84 |
| 742 | 3300031548 | Ga0307408_100846601 | Ga0307408_1008466011 | 84 |
| 743 | 3300031665 | Ga0316575_10057693 | Ga0316575_100576932 | 84 |
| 744 | 3300031727 | Ga0316576_10002081 | Ga0316576_100020813 | 84 |
| 745 | 3300031728 | Ga0316578_10067900 | Ga0316578_100679002 | 84 |
| 746 | 3300031731 | Ga0307405_10273768 | Ga0307405_102737682 | 84 |
| 747 | 3300031731 | Ga0307405_10834885 | Ga0307405_108348852 | 84 |
| 748 | 3300031733 | Ga0316577_10692902 | Ga0316577_106929021 | 84 |
| 749 | 3300031852 | Ga0307410_10317148 | Ga0307410_103171482 | 84 |
| 750 | 3300031901 | Ga0307406_10946672 | Ga0307406_109466722 | 84 |
| 751 | 3300031901 | Ga0307406_10979171 | Ga0307406_109791712 | 84 |
| 752 | 3300031903 | Ga0307407_10832953 | Ga0307407_108329532 | 84 |
| 753 | 3300031903 | Ga0307407_11567500 | Ga0307407_115675002 | 84 |
| 754 | 3300031911 | Ga0307412_12041327 | Ga0307412_120413272 | 84 |
| 755 | 3300031995 | Ga0307409_101475498 | Ga0307409_1014754982 | 84 |
| 756 | 3300032002 | Ga0307416_100061146 | Ga0307416_1000611463 | 84 |
| 757 | 3300032002 | Ga0307416_100360376 | Ga0307416_1003603762 | 84 |
| 758 | 3300032005 | Ga0307411_10117261 | Ga0307411_101172612 | 84 |
| 759 | 3300032005 | Ga0307411_10349344 | Ga0307411_103493442 | 84 |
| 760 | 3300032126 | Ga0307415_100814957 | Ga0307415_1008149572 | 84 |
| 761 | 3300034820 | Ga0373959_0084114 | Ga0373959_0084114_124_384 | 84 |
| 762 | 3300035398 | Ga0316574_0000008 | Ga0316574_0000008_44407_44667 | 84 |
| 763 | 3300036647 | Ga0316582_0117086 | Ga0316582_0117086_791_1051 | 84 |
| 764 | 3300036712 | Ga0316584_0006318 | Ga0316584_0006318_5568_5828 | 84 |
| 765 | 3300039453 | Ga0436362_0935429 | Ga0436362_0935429_182_460 | 84 |
| 766 | 3300039453 | Ga0436362_1215006 | Ga0436362_1215006_340_597 | 84 |
| 767 | 3300041404 | Ga0439436_0126878 | Ga0439436_0126878_409_672 | 84 |
| 768 | 3300041406 | Ga0439439_0050483 | Ga0439439_0050483_592_855 | 84 |
| 769 | 3300041410 | Ga0439461_0218811 | Ga0439461_0218811_226_489 | 84 |
| 770 | 3300041458 | Ga0451798_0012111 | Ga0451798_0012111_220_477 | 84 |
| 771 | 3300041997 | Ga0439431_0120431 | Ga0439431_0120431_209_472 | 84 |
| 772 | 3300041997 | Ga0439431_0193156 | Ga0439431_0193156_313_576 | 84 |
| 773 | 3300041999 | Ga0439433_0079396 | Ga0439433_0079396_473_736 | 84 |
| 774 | 3300042002 | Ga0439442_041737 | Ga0439442_041737_565_828 | 84 |
| 775 | 3300042003 | Ga0439443_097767 | Ga0439443_097767_76_342 | 84 |
| 776 | 3300042004 | Ga0439445_0076482 | Ga0439445_0076482_342_605 | 84 |
| 777 | 3300042013 | Ga0439456_154930 | Ga0439456_154930_53_319 | 84 |
| 778 | 3300042122 | Ga0450920_002893 | Ga0450920_002893_917_1180 | 84 |
| 779 | 3300042125 | Ga0450923_000690 | Ga0450923_000690_2888_3151 | 84 |
| 780 | 3300042132 | Ga0450895_029275 | Ga0450895_029275_148_411 | 84 |
| 781 | 3300042133 | Ga0450896_000264 | Ga0450896_000264_159_422 | 84 |
| 782 | 3300042134 | Ga0450898_074331 | Ga0450898_074331_363_626 | 84 |
| 783 | 3300042146 | Ga0450907_005068 | Ga0450907_005068_912_1175 | 84 |
| 784 | 3300042147 | Ga0450910_013101 | Ga0450910_013101_521_784 | 84 |
| 785 | 3300042156 | Ga0439446_0010932 | Ga0439446_0010932_1348_1611 | 84 |
| 786 | 3300042184 | Ga0450908_010340 | Ga0450908_010340_185_448 | 84 |
| 787 | 3300042435 | Ga0439434_0024041 | Ga0439434_0024041_607_870 | 84 |
| 788 | 3300042435 | Ga0439434_0083345 | Ga0439434_0083345_379_642 | 84 |
| 789 | 3300042435 | Ga0439434_0117598 | Ga0439434_0117598_325_588 | 84 |
| 790 | 3300042436 | Ga0439435_0029012 | Ga0439435_0029012_47_313 | 84 |
| 791 | 3300042531 | Ga0450918_003499 | Ga0450918_003499_1161_1424 | 84 |
| 792 | 3300042531 | Ga0450918_016616 | Ga0450918_016616_815_1078 | 84 |
| 793 | 3300042876 | Ga0451577_0141164 | Ga0451577_0141164_588_845 | 84 |
| 794 | 3300042876 | Ga0451577_0235064 | Ga0451577_0235064_1058_1318 | 84 |
| 795 | 3300042876 | Ga0451577_0440250 | Ga0451577_0440250_199_459 | 84 |
| 796 | 3300042876 | Ga0451577_0649751 | Ga0451577_0649751_94_354 | 84 |
| 797 | 3300042876 | Ga0451577_1189484 | Ga0451577_1189484_349_609 | 84 |
| 798 | 3300044712 | Ga0453684_0267228 | Ga0453684_0267228_1186_1446 | 84 |
| 799 | 3300044712 | Ga0453684_0444488 | Ga0453684_0444488_887_1147 | 84 |
| 800 | 3300044712 | Ga0453684_0445858 | Ga0453684_0445858_1140_1400 | 84 |
| 801 | 3300044712 | Ga0453684_1473551 | Ga0453684_1473551_376_633 | 84 |
| 802 | 3300045051 | Ga0451576_0032859 | Ga0451576_0032859_748_1008 | 84 |
| 803 | 3300045051 | Ga0451576_0203336 | Ga0451576_0203336_1470_1727 | 84 |
| 804 | 3300045051 | Ga0451576_0409214 | Ga0451576_0409214_749_1009 | 84 |
| 805 | 3300049569 | Ga0501032_0301958 | Ga0501032_0301958_219_482 | 84 |
| 806 | 3300049572 | Ga0501036_0573282 | Ga0501036_0573282_429_692 | 84 |
| 807 | 3300049575 | Ga0501039_0296177 | Ga0501039_0296177_373_636 | 84 |
| 808 | 3300049575 | Ga0501039_0677630 | Ga0501039_0677630_178_441 | 84 |
| 809 | 3300049576 | Ga0501040_0150960 | Ga0501040_0150960_1033_1296 | 84 |
| 810 | 3300049577 | Ga0501041_0238682 | Ga0501041_0238682_91_354 | 84 |
| 811 | 3300049577 | Ga0501041_0715798 | Ga0501041_0715798_45_308 | 84 |
| 812 | 3300049577 | Ga0501041_0854342 | Ga0501041_0854342_171_434 | 84 |
| 813 | 3300049578 | Ga0501042_0373765 | Ga0501042_0373765_101_364 | 84 |
| 814 | 3300049578 | Ga0501042_1036441 | Ga0501042_1036441_311_574 | 84 |
| 815 | 3300049583 | Ga0501067_0040984 | Ga0501067_0040984_1941_2204 | 84 |
| 816 | 3300049584 | Ga0501068_0203673 | Ga0501068_0203673_152_415 | 84 |
| 817 | 3300049585 | Ga0501069_0264716 | Ga0501069_0264716_232_495 | 84 |
| 818 | 3300049587 | Ga0501071_0460106 | Ga0501071_0460106_637_900 | 84 |
| 819 | 3300049589 | Ga0501073_0005924 | Ga0501073_0005924_6613_6876 | 84 |
| 820 | 3300049589 | Ga0501073_0484346 | Ga0501073_0484346_165_428 | 84 |
| 821 | 3300049590 | Ga0501074_0206914 | Ga0501074_0206914_511_774 | 84 |
| 822 | 3300049591 | Ga0501075_0353365 | Ga0501075_0353365_526_789 | 84 |
| 823 | 3300049592 | Ga0501076_0226463 | Ga0501076_0226463_28_291 | 84 |
| 824 | 3300049592 | Ga0501076_0439570 | Ga0501076_0439570_475_738 | 84 |
| 825 | 3300049592 | Ga0501076_0526696 | Ga0501076_0526696_94_357 | 84 |
| 826 | 3300049592 | Ga0501076_0892340 | Ga0501076_0892340_277_540 | 84 |
| 827 | 3300049592 | Ga0501076_1467435 | Ga0501076_1467435_68_331 | 84 |
| 828 | 3300049593 | Ga0501077_0051134 | Ga0501077_0051134_1828_2091 | 84 |
| 829 | 3300049593 | Ga0501077_0231758 | Ga0501077_0231758_466_729 | 84 |
| 830 | 3300049669 | Ga0501235_107102 | Ga0501235_107102_244_504 | 84 |
| 831 | 3300049741 | Ga0501079_0189001 | Ga0501079_0189001_608_871 | 84 |
| 832 | 3300049741 | Ga0501079_0982524 | Ga0501079_0982524_32_295 | 84 |
| 833 | 3300049742 | Ga0501080_0010309 | Ga0501080_0010309_6767_7030 | 84 |
| 834 | 3300049742 | Ga0501080_0220020 | Ga0501080_0220020_1064_1327 | 84 |
| 835 | 3300049743 | Ga0501081_0018675 | Ga0501081_0018675_4191_4454 | 84 |
| 836 | 3300049743 | Ga0501081_0288189 | Ga0501081_0288189_888_1151 | 84 |
| 837 | 3300049743 | Ga0501081_0446034 | Ga0501081_0446034_196_459 | 84 |
| 838 | 3300049824 | Ga0501045_0093118 | Ga0501045_0093118_1907_2170 | 84 |
| 839 | 3300049824 | Ga0501045_0278582 | Ga0501045_0278582_65_328 | 84 |
| 840 | 3300049824 | Ga0501045_1158417 | Ga0501045_1158417_266_529 | 84 |
| 841 | 3300050491 | nmdc:mga00v17_108_c1 | nmdc:mga00v17_108_c1_31763_32059 | 84 |
| 842 | 3300053104 | Ga0500556_0000737 | Ga0500556_0000737_12943_13209 | 84 |
| 843 | 3300054114 | Ga0501084_0015172 | Ga0501084_0015172_2428_2691 | 84 |
| 844 | 3300054114 | Ga0501084_0548143 | Ga0501084_0548143_282_545 | 84 |
| 845 | 3300059492 | Ga0587073_0121639 | Ga0587073_0121639_131_388 | 84 |
| 846 | 3300060353 | Ga0501082_0290748 | Ga0501082_0290748_696_959 | 84 |
| 847 | 3300060353 | Ga0501082_0783371 | Ga0501082_0783371_386_649 | 84 |
| 848 | 3300061734 | Ga0530510_0847068 | Ga0530510_0847068_49_312 | 84 |
| 849 | 3300000546 | LJNas_1012025 | LJNas_10120252 | 85 |
| 850 | 3300005354 | Ga0070675_100819619 | Ga0070675_1008196191 | 85 |
| 851 | 3300005364 | Ga0070673_101449785 | Ga0070673_1014497851 | 85 |
| 852 | 3300005439 | Ga0070711_100008013 | Ga0070711_1000080132 | 85 |
| 853 | 3300005456 | Ga0070678_100991635 | Ga0070678_1009916351 | 85 |
| 854 | 3300005548 | Ga0070665_100713597 | Ga0070665_1007135971 | 85 |
| 855 | 3300005618 | Ga0068864_100613100 | Ga0068864_1006131002 | 85 |
| 856 | 3300006163 | Ga0070715_10187865 | Ga0070715_101878651 | 85 |
| 857 | 3300006173 | Ga0070716_100097671 | Ga0070716_1000976712 | 85 |
| 858 | 3300006175 | Ga0070712_100407717 | Ga0070712_1004077172 | 85 |
| 859 | 3300006237 | Ga0097621_100380210 | Ga0097621_1003802102 | 85 |
| 860 | 3300007265 | Ga0099794_10077367 | Ga0099794_100773672 | 85 |
| 861 | 3300007788 | Ga0099795_10020640 | Ga0099795_100206402 | 85 |
| 862 | 3300010159 | Ga0099796_10001828 | Ga0099796_100018283 | 85 |
| 863 | 3300019166 | Ga0184595_111233 | Ga0184595_1112332 | 85 |
| 864 | 3300019166 | Ga0184595_115396 | Ga0184595_1153962 | 85 |
| 865 | 3300019176 | Ga0184596_108580 | Ga0184596_1085802 | 85 |
| 866 | 3300019177 | Ga0184592_112061 | Ga0184592_1120611 | 85 |
| 867 | 3300019181 | Ga0184594_102903 | Ga0184594_1029031 | 85 |
| 868 | 3300019181 | Ga0184594_106280 | Ga0184594_1062801 | 85 |
| 869 | 3300019183 | Ga0184601_141254 | Ga0184601_1412541 | 85 |
| 870 | 3300019188 | Ga0184599_104977 | Ga0184599_1049772 | 85 |
| 871 | 3300019190 | Ga0184600_102423 | Ga0184600_1024232 | 85 |
| 872 | 3300019192 | Ga0184603_130163 | Ga0184603_1301631 | 85 |
| 873 | 3300023552 | Ga0247551_102277 | Ga0247551_1022772 | 85 |
| 874 | 3300023672 | Ga0247553_112138 | Ga0247553_1121381 | 85 |
| 875 | 3300024225 | Ga0224572_1020614 | Ga0224572_10206142 | 85 |
| 876 | 3300025905 | Ga0207685_10202116 | Ga0207685_102021162 | 85 |
| 877 | 3300025915 | Ga0207693_10354350 | Ga0207693_103543502 | 85 |
| 878 | 3300025916 | Ga0207663_10020373 | Ga0207663_100203734 | 85 |
| 879 | 3300025923 | Ga0207681_10895643 | Ga0207681_108956431 | 85 |
| 880 | 3300025926 | Ga0207659_10717300 | Ga0207659_107173002 | 85 |
| 881 | 3300025939 | Ga0207665_10125025 | Ga0207665_101250252 | 85 |
| 882 | 3300025949 | Ga0207667_11222646 | Ga0207667_112226461 | 85 |
| 883 | 3300025960 | Ga0207651_11341447 | Ga0207651_113414471 | 85 |
| 884 | 3300026095 | Ga0207676_10535210 | Ga0207676_105352101 | 85 |
| 885 | 3300026121 | Ga0207683_10512380 | Ga0207683_105123802 | 85 |
| 886 | 3300027512 | Ga0209179_1001253 | Ga0209179_10012532 | 85 |
| 887 | 3300028016 | Ga0265354_1001940 | Ga0265354_10019403 | 85 |
| 888 | 3300028017 | Ga0265356_1042562 | Ga0265356_10425621 | 85 |
| 889 | 3300028023 | Ga0265357_1005632 | Ga0265357_10056322 | 85 |
| 890 | 3300028036 | Ga0265355_1000217 | Ga0265355_10002172 | 85 |
| 891 | 3300028800 | Ga0265338_10981117 | Ga0265338_109811171 | 85 |
| 892 | 3300030760 | Ga0265762_1015920 | Ga0265762_10159202 | 85 |
| 893 | 3300030760 | Ga0265762_1028726 | Ga0265762_10287262 | 85 |
| 894 | 3300030760 | Ga0265762_1041940 | Ga0265762_10419402 | 85 |
| 895 | 3300030762 | Ga0265775_106920 | Ga0265775_1069202 | 85 |
| 896 | 3300030762 | Ga0265775_108790 | Ga0265775_1087901 | 85 |
| 897 | 3300030763 | Ga0265763_1001528 | Ga0265763_10015282 | 85 |
| 898 | 3300030763 | Ga0265763_1009000 | Ga0265763_10090002 | 85 |
| 899 | 3300030763 | Ga0265763_1054121 | Ga0265763_10541211 | 85 |
| 900 | 3300030836 | Ga0265767_102081 | Ga0265767_1020812 | 85 |
| 901 | 3300030863 | Ga0265766_1003039 | Ga0265766_10030392 | 85 |
| 902 | 3300030863 | Ga0265766_1015288 | Ga0265766_10152881 | 85 |
| 903 | 3300030877 | Ga0265777_109944 | Ga0265777_1099442 | 85 |
| 904 | 3300030877 | Ga0265777_121609 | Ga0265777_1216091 | 85 |
| 905 | 3300030877 | Ga0265777_123747 | Ga0265777_1237472 | 85 |
| 906 | 3300030878 | Ga0265770_1020946 | Ga0265770_10209462 | 85 |
| 907 | 3300030878 | Ga0265770_1131537 | Ga0265770_11315372 | 85 |
| 908 | 3300030878 | Ga0265770_1157943 | Ga0265770_11579431 | 85 |
| 909 | 3300030879 | Ga0265765_1007126 | Ga0265765_10071262 | 85 |
| 910 | 3300030879 | Ga0265765_1051988 | Ga0265765_10519882 | 85 |
| 911 | 3300030880 | Ga0265776_103094 | Ga0265776_1030942 | 85 |
| 912 | 3300030882 | Ga0265764_101304 | Ga0265764_1013042 | 85 |
| 913 | 3300030886 | Ga0265772_101130 | Ga0265772_1011302 | 85 |
| 914 | 3300030886 | Ga0265772_107555 | Ga0265772_1075551 | 85 |
| 915 | 3300030888 | Ga0265769_110822 | Ga0265769_1108222 | 85 |
| 916 | 3300030889 | Ga0265761_112875 | Ga0265761_1128751 | 85 |
| 917 | 3300030963 | Ga0265768_103830 | Ga0265768_1038302 | 85 |
| 918 | 3300031010 | Ga0265771_1015496 | Ga0265771_10154961 | 85 |
| 919 | 3300031018 | Ga0265773_1010359 | Ga0265773_10103592 | 85 |
| 920 | 3300031090 | Ga0265760_10057296 | Ga0265760_100572962 | 85 |
| 921 | 3300031090 | Ga0265760_10120466 | Ga0265760_101204661 | 85 |
| 922 | 3300031241 | Ga0265325_10522956 | Ga0265325_105229561 | 85 |
| 923 | 3300031241 | Ga0265325_10527284 | Ga0265325_105272842 | 85 |
| 924 | 3300031249 | Ga0265339_10127256 | Ga0265339_101272562 | 85 |
| 925 | 3300031616 | Ga0307508_10635106 | Ga0307508_106351062 | 85 |
| 926 | 3300031730 | Ga0307516_10000794 | Ga0307516_1000079411 | 85 |
| 927 | 3300032120 | Ga0316053_104287 | Ga0316053_1042872 | 85 |
| 928 | 3300032120 | Ga0316053_104697 | Ga0316053_1046972 | 85 |
| 929 | 3300033180 | Ga0307510_10270889 | Ga0307510_102708892 | 85 |
| 930 | 3300033547 | Ga0316212_1058301 | Ga0316212_10583011 | 85 |
| 931 | 3300035724 | Ga0373933_0390731 | Ga0373933_0390731_26_283 | 85 |
| 932 | 3300036457 | Ga0265778_055594 | Ga0265778_055594_248_505 | 85 |
| 933 | 3300036457 | Ga0265778_060894 | Ga0265778_060894_211_468 | 85 |
| 934 | 3300037853 | Ga0436364_0164812 | Ga0436364_0164812_643_900 | 85 |
| 935 | 3300046543 | Ga0495645_0790949 | Ga0495645_0790949_291_548 | 85 |
| 936 | 3300048918 | Ga0496115_0339614 | Ga0496115_0339614_123_380 | 85 |
| 937 | 3300053077 | Ga0495601_0207595 | Ga0495601_0207595_48_305 | 85 |
| 938 | 3300053085 | Ga0495619_0402886 | Ga0495619_0402886_71_328 | 85 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8bvj-assembly1.cif.gz_U | hfq-crc-esta translation repression complex | 0.9736 | 8 | 68 |
| 3hfn-assembly1.cif.gz_B | crystal structure of an hfq protein from anabaena sp. | 0.9683 | 11 | 64 |
| 3sb2-assembly1.cif.gz_C | crystal structure of the rna chaperone hfq from herbaspirillum seropedicae smr1 | 0.9674 | 7 | 66 |
| 3hfo-assembly1.cif.gz_B | crystal structure of an hfq protein from synechocystis sp. | 0.9655 | 11 | 66 |
| 2yht-assembly1.cif.gz_A | crystal structure of hfq riboregulator from e. coli (p1 space group) | 0.9631 | 6 | 68 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3hfnB00 | Mainly Beta;Roll;SH3 type barrels.; | 0.9683 | 11 | 64 | 2.30.30.100 |
| 3hfoB00 | Mainly Beta;Roll;SH3 type barrels.; | 0.9654 | 11 | 66 | 2.30.30.100 |
| 3hsbD00 | Mainly Beta;Roll;SH3 type barrels.; | 0.9462 | 6 | 70 | 2.30.30.100 |
| 3qsuF00 | Mainly Beta;Roll;SH3 type barrels.; | 0.9444 | 6 | 63 | 2.30.30.100 |
| af_A0A1D6E9S1_12_126_2.30.30.100 | Mainly Beta;Roll;SH3 type barrels.; | 0.9075 | 19 | 66 | 2.30.30.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A383CSK0-F1-model_v4 | Sm domain-containing protein | 1.01 | 9 | 70 |
GO:0003723
GO:0005829 GO:0006355 GO:0043487 GO:0045974 |
| AF-A0A1G3Y8L1-F1-model_v4 | RNA chaperone Hfq | 0.9891 | 9 | 72 |
GO:0003723
GO:0005829 GO:0006355 GO:0043487 GO:0045974 |
| AF-A0A7D5GWE5-F1-model_v4 | RNA-binding protein Hfq | 0.9796 | 7 | 70 |
GO:0003723
GO:0005829 GO:0006355 GO:0043487 GO:0045974 |
| AF-A0A5M8SLT8-F1-model_v4 | Hfq-related domain-containing protein | 0.9769 | 11 | 65 |
|
| AF-A0A259EW12-F1-model_v4 | RNA-binding protein Hfq | 0.9765 | 8 | 72 |
GO:0003723
GO:0005829 GO:0006355 GO:0043487 GO:0045974 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar