F485743

General Info

Members Datasets Scaffolds Average Seq Length
920 465 1840 156

Family's Representative Sequence

Representative Sequence 3300049583|Ga0501067_0446331|Ga0501067_0446331_150_671
Length 173
Sequence VDGRDKPGHDEREERNEMSRRHRADKREITPDPKFKNEVVTKFMNSVMSHGKKSVAEQIVYGAFDIIQSKTKQDPLGIFRTALDNVMPSLEVRSRRVGGATYQVPVEVRSERRQALAIRWLLTAARGRNEKTMIDKLSGELLDAANNRGNAVKKREDTHRMAEANRAFSHYRW

Samples

Sample ID Description Type Environment
1 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
2 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
3 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
4 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
12 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
14 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
15 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
16 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
17 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
18 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
62 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
83 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
97 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
103 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
104 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
105 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
106 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
107 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
108 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300023436 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.stno.R1 Metatranscriptome Rhizosphere
110 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
112 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
114 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
116 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
168 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
169 3300029277 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1 Metatranscriptome Rhizosphere
170 3300029285 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 Metatranscriptome Rhizosphere
171 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
172 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300030762 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300030877 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300030882 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
177 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
178 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
179 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
180 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
181 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
182 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
183 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
184 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
185 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
186 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
187 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
188 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
189 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
190 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
191 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
192 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
193 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
194 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
195 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
196 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
197 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
198 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
199 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
200 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
201 3300032120 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
202 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
205 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
206 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
207 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
208 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
209 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
210 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
211 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
212 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
213 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
214 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
215 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
216 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
217 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
218 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
219 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
220 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
221 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
222 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
223 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
224 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
225 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
227 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
228 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
229 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
230 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
231 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
232 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
233 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
234 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
235 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
236 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
237 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
238 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
239 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
240 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
241 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
242 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
243 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
244 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
245 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
246 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
247 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
248 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
249 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
250 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
251 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
252 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
253 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
254 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
255 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
256 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
257 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
258 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
259 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
260 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
261 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
262 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
263 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
264 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
265 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
266 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
267 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
268 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
269 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
270 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
271 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
272 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
273 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
274 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
275 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
276 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
277 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
278 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
279 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
280 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
281 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
282 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
283 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
284 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
285 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
286 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
287 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
288 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
289 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
290 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
291 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
292 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
293 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
294 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
295 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
296 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
297 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
298 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
299 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
300 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
301 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
302 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
303 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
304 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
305 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
306 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
307 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
308 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
309 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
310 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
311 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
312 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
313 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
314 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
315 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
316 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
317 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
318 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
319 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
320 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
321 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
322 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
323 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
324 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
325 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
326 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
327 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
328 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
329 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
330 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
331 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
332 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
333 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
334 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
335 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
336 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
337 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
339 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
341 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
342 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
343 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
344 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
345 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
346 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
348 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
349 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
350 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
351 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
352 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
353 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
354 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
355 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
356 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
357 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
358 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
359 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
360 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
361 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
362 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
363 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
364 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
365 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
366 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
367 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
368 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
369 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
370 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
371 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
372 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
373 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
374 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
375 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
376 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
377 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
378 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
379 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
380 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
381 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
382 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
383 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
384 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
385 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
386 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
387 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
388 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
389 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
390 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
391 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
392 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
393 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
394 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
395 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
396 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
397 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
398 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
399 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
400 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
401 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
402 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
403 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
404 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
405 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
406 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
407 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
408 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
409 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
410 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
411 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
412 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
413 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
414 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
415 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
416 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
417 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
418 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
419 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
420 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
421 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
422 2508501050 Microvirga lupini Lut6 Isolate Nodule
423 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
424 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
425 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
426 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
427 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
428 2643221719 Rhizobium sp. Root274 Isolate Unclassified
429 2643221733 Bosea sp. Root381 Isolate Unclassified
430 2643221734 Bosea sp. Root670 Isolate Unclassified
431 2643221736 Bosea sp. Root483D1 Isolate Unclassified
432 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
433 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
434 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
435 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
436 2773857925 Microvirga vignae BR3299 Isolate Unclassified
437 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
438 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
439 2818991467 Bosea vestrisii 3192 Isolate Unclassified
440 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
441 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
442 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
443 2841760612 Bosea sp. Tri-49 Isolate Nodule
444 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
445 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
446 2844104063 Bosea sp. Tri-39 Isolate Nodule
447 2851182111 Bosea sp. Tri-44 Isolate Nodule
448 2851246043 Bosea sp. Tri-54 Isolate Nodule
449 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
450 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
451 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
452 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
453 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
454 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
455 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
456 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
457 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
458 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
459 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
460 641522639 Methylobacterium sp. 4-46 Isolate Nodule
461 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
462 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
463 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
464 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
465 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 83.48
Metatranscriptomes 11.74
Isolates 4.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.43
Nodule 1.52
Rhizoplane 2.07
Rhizosphere 80.43
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501067_0446331 3300049583 Bacteria 722
2 RicEn_C5064 2010549000 Bacteria 1433
3 JGI25159J45721_1010523 3300002987 Bacteria 2348
4 Ga0006778J45830_1058666 3300003162 Bacteria 2010
5 Ga0006759J45824_1010259 3300003163 Bacteria 1163
6 Ga0006759J45824_1036006 3300003163 Bacteria 2458
7 Ga0006759J45824_1123174 3300003163 Bacteria 1199
8 JGI25151J46595_10000998 3300003187 Bacteria 21390
9 Ga0006777J48905_1015771 3300003308 Bacteria 1518
10 Ga0006777J48905_1026045 3300003308 Bacteria 2154
11 Ga0006777J48905_1056620 3300003308 Bacteria 784
12 Ga0007417J51691_1008472 3300003544 Bacteria 1430
13 Ga0007417J51691_1016055 3300003544 Bacteria 3006
14 Ga0007417J51691_1050143 3300003544 Bacteria 1268
15 Ga0007410J51695_1019967 3300003574 Bacteria 3516
16 Ga0007410J51695_1022321 3300003574 Bacteria 3797
17 Ga0007410J51695_1045401 3300003574 Bacteria 931
18 Ga0007416J51690_1017104 3300003577 Bacteria 1847
19 Ga0007416J51690_1019837 3300003577 Bacteria 1301
20 Ga0006562J51391_1021653 3300003578 Bacteria 1577
21 Ga0007429J51699_1019329 3300003579 Bacteria 1256
22 Ga0007429J51699_1022307 3300003579 Bacteria 1956
23 Ga0032354_1013396 3300003693 Bacteria 1256
24 Ga0032354_1014807 3300003693 Bacteria 2623
25 Ga0006780_1006913 3300003735 Bacteria 1612
26 Ga0006780_1010347 3300003735 Bacteria 1172
27 Ga0006780_1015395 3300003735 Bacteria 1324
28 Ga0055526_1011375 3300003771 Bacteria 4014
29 Ga0055526_1012869 3300003771 Bacteria 3598
30 Ga0055524_1009061 3300003775 Bacteria 4081
31 Ga0055524_1011452 3300003775 Bacteria 3467
32 Ga0058860_10222892 3300004801 Bacteria 1799
33 Ga0065165_1007156 3300005262 Bacteria 5580
34 Ga0070658_10203068 3300005327 Bacteria 1673
35 Ga0070676_10770732 3300005328 Bacteria 708
36 Ga0070666_11256222 3300005335 Bacteria 552
37 Ga0070680_100239697 3300005336 Bacteria 1533
38 Ga0070689_100067740 3300005340 Bacteria 2783
39 Ga0070668_100019774 3300005347 Bacteria 5071
40 Ga0070668_100924570 3300005347 Bacteria 781
41 Ga0070669_100430150 3300005353 Bacteria 1085
42 Ga0070674_100521485 3300005356 Bacteria 993
43 Ga0070659_100255557 3300005366 Bacteria 1453
44 Ga0070659_101292119 3300005366 Bacteria 647
45 Ga0070667_100033801 3300005367 Bacteria 4277
46 Ga0070667_100426348 3300005367 Bacteria 1210
47 Ga0070709_10338542 3300005434 Bacteria 1109
48 Ga0070709_10525039 3300005434 Bacteria 902
49 Ga0070714_100380545 3300005435 Bacteria 1331
50 Ga0070714_100413833 3300005435 Bacteria 1276
51 Ga0070714_100816354 3300005435 Bacteria 904
52 Ga0070714_100896845 3300005435 Bacteria 861
53 Ga0070713_100073081 3300005436 Bacteria 2902
54 Ga0070713_100379555 3300005436 Bacteria 1317
55 Ga0070713_100393778 3300005436 Bacteria 1293
56 Ga0070713_101574583 3300005436 Bacteria 638
57 Ga0070710_10019419 3300005437 Bacteria 3512
58 Ga0070710_10474792 3300005437 Bacteria 852
59 Ga0070701_10531009 3300005438 Bacteria 769
60 Ga0070711_100077038 3300005439 Bacteria 2365
61 Ga0070700_100105136 3300005441 Bacteria 1866
62 Ga0070678_101049927 3300005456 Bacteria 751
63 Ga0070681_10289924 3300005458 Bacteria 1547
64 Ga0070681_10391849 3300005458 Bacteria 1300
65 Ga0070681_11149290 3300005458 Bacteria 698
66 Ga0068867_100984532 3300005459 Bacteria 764
67 Ga0070706_100121868 3300005467 Bacteria 2431
68 Ga0070707_100060990 3300005468 Bacteria 3617
69 Ga0070707_100613211 3300005468 Bacteria 1051
70 Ga0070698_100610978 3300005471 Bacteria 1031
71 Ga0070699_100401774 3300005518 Bacteria 1239
72 Ga0070679_100531560 3300005530 Bacteria 1120
73 Ga0070679_100576523 3300005530 Bacteria 1069
74 Ga0070679_100886680 3300005530 Bacteria 835
75 Ga0070679_101263957 3300005530 Bacteria 684
76 Ga0070684_101174139 3300005535 Bacteria 722
77 Ga0070697_100196869 3300005536 Bacteria 1712
78 Ga0070695_100164130 3300005545 Bacteria 1562
79 Ga0070665_100137672 3300005548 Bacteria 2444
80 Ga0070664_100156019 3300005564 Bacteria 2017
81 Ga0068857_101036085 3300005577 Bacteria 791
82 Ga0068857_101065576 3300005577 Bacteria 780
83 Ga0068854_100224472 3300005578 Bacteria 1488
84 Ga0068856_100777101 3300005614 Bacteria 978
85 Ga0068852_101147338 3300005616 Bacteria 798
86 Ga0068864_100895908 3300005618 Bacteria 876
87 Ga0068870_10071526 3300005840 Bacteria 1893
88 Ga0068863_100024921 3300005841 Bacteria 5706
89 Ga0068863_100392322 3300005841 Bacteria 1357
90 Ga0068863_101725029 3300005841 Bacteria 636
91 Ga0068858_100240777 3300005842 Bacteria 1717
92 Ga0081455_10365467 3300005937 Bacteria 1013
93 Ga0081539_10326545 3300005985 Bacteria 651
94 Ga0070717_10135885 3300006028 Bacteria 2117
95 Ga0070717_10308617 3300006028 Bacteria 1408
96 Ga0070717_10593615 3300006028 Bacteria 1004
97 Ga0075365_10161632 3300006038 Bacteria 1560
98 Ga0075363_100077170 3300006048 Bacteria 1818
99 Ga0075363_100282314 3300006048 Bacteria 961
100 Ga0070715_10558697 3300006163 Bacteria 665
101 Ga0070715_10636192 3300006163 Bacteria 630
102 Ga0070715_10775470 3300006163 Bacteria 580
103 Ga0070716_100348996 3300006173 Bacteria 1047
104 Ga0070716_100894887 3300006173 Bacteria 695
105 Ga0070712_100129215 3300006175 Bacteria 1913
106 Ga0070712_100232534 3300006175 Bacteria 1465
107 Ga0070712_100315018 3300006175 Bacteria 1271
108 Ga0075362_10091023 3300006177 Bacteria 1416
109 Ga0075362_10184951 3300006177 Bacteria 1010
110 Ga0075367_10460000 3300006178 Bacteria 806
111 Ga0075366_10106372 3300006195 Bacteria 1686
112 Ga0075366_10498497 3300006195 Bacteria 753
113 Ga0075428_100375428 3300006844 Bacteria 1524
114 Ga0075430_100066186 3300006846 Bacteria 3034
115 Ga0075431_100109846 3300006847 Bacteria 2846
116 Ga0099795_10000098 3300007788 Bacteria 14585
117 Ga0105240_10792336 3300009093 Bacteria 1027
118 Ga0105240_10878810 3300009093 Bacteria 966
119 Ga0111539_10139589 3300009094 Bacteria 2838
120 Ga0111539_10625731 3300009094 Bacteria 1253
121 Ga0105245_10709312 3300009098 Bacteria 1040
122 Ga0105245_11084031 3300009098 Bacteria 847
123 Ga0105247_10609493 3300009101 Bacteria 811
124 Ga0114129_10357308 3300009147 Bacteria 1934
125 Ga0114129_11314695 3300009147 Bacteria 895
126 Ga0105243_10593529 3300009148 Bacteria 1065
127 Ga0105248_10036522 3300009177 Bacteria 5496
128 Ga0105248_11389846 3300009177 Bacteria 794
129 Ga0105248_12180919 3300009177 Bacteria 630
130 Ga0105237_10587943 3300009545 Bacteria 1120
131 Ga0105238_10105938 3300009551 Bacteria 2793
132 Ga0105238_10400601 3300009551 Bacteria 1365
133 Ga0105249_10475539 3300009553 Bacteria 1291
134 Ga0105249_10679734 3300009553 Bacteria 1088
135 Ga0105035_109896 3300009988 Bacteria 831
136 Ga0099796_10008991 3300010159 Bacteria 2685
137 Ga0105239_10384331 3300010375 Bacteria 1587
138 Ga0105239_10775093 3300010375 Bacteria 1098
139 Ga0105239_10959790 3300010375 Bacteria 982
140 Ga0105239_11194822 3300010375 Bacteria 876
141 Ga0105246_10067496 3300011119 Bacteria 2506
142 Ga0105246_10504559 3300011119 Bacteria 1028
143 Ga0157369_11858569 3300013105 Bacteria 611
144 Ga0171462_1060 3300013250 Bacteria 19065
145 Ga0157374_10597224 3300013296 Bacteria 1114
146 Ga0157374_11976697 3300013296 Bacteria 609
147 Ga0157378_11985598 3300013297 Bacteria 631
148 Ga0163162_10749374 3300013306 Bacteria 1096
149 Ga0163162_10791098 3300013306 Bacteria 1066
150 Ga0163162_10853178 3300013306 Bacteria 1026
151 Ga0157372_10005461 3300013307 Bacteria 13506
152 Ga0157372_10836403 3300013307 Bacteria 1069
153 Ga0157372_12202194 3300013307 Bacteria 633
154 Ga0163163_10282390 3300014325 Bacteria 1712
155 Ga0163163_10963239 3300014325 Bacteria 917
156 Ga0163163_11259345 3300014325 Bacteria 802
157 Ga0157380_10073797 3300014326 Bacteria 2768
158 Ga0182008_10071381 3300014497 Bacteria 1708
159 Ga0157379_10408576 3300014968 Bacteria 1249
160 Ga0157379_10871156 3300014968 Bacteria 853
161 Ga0182005_1011902 3300015265 Bacteria 2467
162 Ga0182005_1030841 3300015265 Bacteria 1461
163 Ga0197907_10383026 3300020069 Bacteria 961
164 Ga0197907_10611404 3300020069 Bacteria 656
165 Ga0206356_10203437 3300020070 Bacteria 1668
166 Ga0206356_11041350 3300020070 Bacteria 991
167 Ga0206352_11316727 3300020078 Bacteria 1036
168 Ga0206350_10361844 3300020080 Bacteria 1408
169 Ga0206350_10871634 3300020080 Bacteria 2162
170 Ga0206354_10418299 3300020081 Bacteria 2523
171 Ga0206354_11461142 3300020081 Bacteria 576
172 Ga0213873_10032527 3300021358 Bacteria 1304
173 Ga0213873_10083012 3300021358 Bacteria 899
174 Ga0213872_10002583 3300021361 Bacteria 10542
175 Ga0213872_10018648 3300021361 Bacteria 3198
176 Ga0213872_10076120 3300021361 Bacteria 1510
177 Ga0213872_10120365 3300021361 Bacteria 1161
178 Ga0213872_10269602 3300021361 Bacteria 713
179 Ga0213874_10004974 3300021377 Bacteria 3070
180 Ga0213876_10032089 3300021384 Bacteria 2770
181 Ga0213876_10187793 3300021384 Bacteria 1099
182 Ga0213876_10291478 3300021384 Bacteria 867
183 Ga0213875_10001918 3300021388 Bacteria 12881
184 Ga0213875_10009354 3300021388 Bacteria 4971
185 Ga0213875_10027997 3300021388 Bacteria 2680
186 Ga0213875_10028201 3300021388 Bacteria 2668
187 Ga0213875_10032543 3300021388 Bacteria 2463
188 Ga0213875_10378324 3300021388 Bacteria 674
189 Ga0213871_10001835 3300021441 Bacteria 3726
190 Ga0213871_10027643 3300021441 Bacteria 1458
191 Ga0213871_10057008 3300021441 Bacteria 1082
192 Ga0224712_10051833 3300022467 Bacteria 1600
193 Ga0224712_10117759 3300022467 Bacteria 1147
194 Ga0224712_10182396 3300022467 Bacteria 946
195 Ga0224712_10463085 3300022467 Bacteria 610
196 Ga0256743_109706 3300023436 Bacteria 1488
197 Ga0209673_1081273 3300025273 Bacteria 742
198 Ga0209130_1000845 3300025284 Bacteria 25573
199 Ga0209130_1025254 3300025284 Bacteria 1288
200 Ga0209675_1000772 3300025291 Bacteria 21411
201 Ga0209025_1005170 3300025294 Bacteria 10795
202 Ga0209025_1007328 3300025294 Bacteria 8263
203 Ga0209564_1002904 3300025295 Bacteria 12487
204 Ga0209564_1002939 3300025295 Bacteria 12377
205 Ga0209758_1036517 3300025297 Bacteria 1916
206 Ga0209758_1051119 3300025297 Bacteria 1442
207 Ga0209256_1003845 3300025299 Bacteria 10043
208 Ga0209256_1005787 3300025299 Bacteria 6896
209 Ga0207692_10013314 3300025898 Bacteria 3564
210 Ga0207692_10609215 3300025898 Bacteria 703
211 Ga0207688_10521182 3300025901 Bacteria 745
212 Ga0207680_10737050 3300025903 Bacteria 706
213 Ga0207685_10588991 3300025905 Bacteria 596
214 Ga0207699_10218643 3300025906 Bacteria 1299
215 Ga0207699_10675872 3300025906 Bacteria 755
216 Ga0207699_10998311 3300025906 Bacteria 619
217 Ga0207645_10546980 3300025907 Bacteria 785
218 Ga0207643_10103238 3300025908 Bacteria 1673
219 Ga0207705_10891198 3300025909 Bacteria 689
220 Ga0207705_11113445 3300025909 Bacteria 608
221 Ga0207684_10095939 3300025910 Bacteria 2531
222 Ga0207707_10198389 3300025912 Bacteria 1750
223 Ga0207707_10366673 3300025912 Bacteria 1240
224 Ga0207695_10715029 3300025913 Bacteria 882
225 Ga0207695_11075944 3300025913 Bacteria 684
226 Ga0207671_10315534 3300025914 Bacteria 1236
227 Ga0207693_10124923 3300025915 Bacteria 2022
228 Ga0207693_10144611 3300025915 Bacteria 1870
229 Ga0207693_10199267 3300025915 Bacteria 1574
230 Ga0207663_10131537 3300025916 Bacteria 1730
231 Ga0207663_10550741 3300025916 Bacteria 902
232 Ga0207663_10969186 3300025916 Bacteria 681
233 Ga0207660_10206444 3300025917 Bacteria 1537
234 Ga0207660_10347288 3300025917 Bacteria 1189
235 Ga0207660_10832786 3300025917 Bacteria 753
236 Ga0207662_10113149 3300025918 Bacteria 1694
237 Ga0207657_11212994 3300025919 Bacteria 573
238 Ga0207652_10207524 3300025921 Bacteria 1764
239 Ga0207652_10436251 3300025921 Bacteria 1181
240 Ga0207652_10777551 3300025921 Bacteria 851
241 Ga0207646_10041541 3300025922 Bacteria 4134
242 Ga0207681_10411382 3300025923 Bacteria 1094
243 Ga0207694_10261783 3300025924 Bacteria 1417
244 Ga0207694_10795736 3300025924 Bacteria 799
245 Ga0207650_11273067 3300025925 Bacteria 626
246 Ga0207687_10596062 3300025927 Bacteria 931
247 Ga0207700_10063660 3300025928 Bacteria 2806
248 Ga0207700_10319205 3300025928 Bacteria 1346
249 Ga0207700_10395123 3300025928 Bacteria 1211
250 Ga0207700_10435950 3300025928 Bacteria 1153
251 Ga0207700_10453425 3300025928 Bacteria 1131
252 Ga0207700_10648018 3300025928 Bacteria 942
253 Ga0207700_10909394 3300025928 Bacteria 788
254 Ga0207700_11177486 3300025928 Bacteria 684
255 Ga0207664_10179857 3300025929 Bacteria 1815
256 Ga0207664_10726553 3300025929 Bacteria 893
257 Ga0207706_10089938 3300025933 Bacteria 2699
258 Ga0207670_10160779 3300025936 Bacteria 1676
259 Ga0207704_11034849 3300025938 Bacteria 696
260 Ga0207665_10361693 3300025939 Bacteria 1097
261 Ga0207665_10420865 3300025939 Bacteria 1020
262 Ga0207665_10871307 3300025939 Bacteria 713
263 Ga0207691_10617462 3300025940 Bacteria 917
264 Ga0207711_10020060 3300025941 Bacteria 5571
265 Ga0207679_10029035 3300025945 Bacteria 3847
266 Ga0207651_10520223 3300025960 Bacteria 1031
267 Ga0207668_10083868 3300025972 Bacteria 2320
268 Ga0207668_10552746 3300025972 Bacteria 997
269 Ga0207640_10298155 3300025981 Bacteria 1274
270 Ga0207640_10340165 3300025981 Bacteria 1202
271 Ga0207658_10038859 3300025986 Bacteria 3432
272 Ga0207658_10300857 3300025986 Bacteria 1382
273 Ga0207658_10352452 3300025986 Bacteria 1282
274 Ga0207677_10902636 3300026023 Bacteria 797
275 Ga0207639_10361938 3300026041 Bacteria 1298
276 Ga0207678_10512373 3300026067 Bacteria 1046
277 Ga0207678_11043344 3300026067 Bacteria 724
278 Ga0207708_10054496 3300026075 Bacteria 3049
279 Ga0207702_10093097 3300026078 Bacteria 2643
280 Ga0207702_12091273 3300026078 Bacteria 556
281 Ga0207641_10018124 3300026088 Bacteria 5769
282 Ga0207641_10604434 3300026088 Bacteria 1074
283 Ga0207641_10616124 3300026088 Bacteria 1064
284 Ga0207676_10916968 3300026095 Bacteria 860
285 Ga0207674_10665836 3300026116 Bacteria 1005
286 Ga0207674_11511019 3300026116 Bacteria 641
287 Ga0207674_11580544 3300026116 Bacteria 624
288 Ga0207675_101143321 3300026118 Bacteria 799
289 Ga0207683_10648280 3300026121 Bacteria 978
290 Ga0207698_12136976 3300026142 Bacteria 573
291 Ga0209371_1042358 3300027312 Bacteria 916
292 Ga0268266_10241074 3300028379 Bacteria 1669
293 Ga0268266_10944114 3300028379 Bacteria 834
294 Ga0268266_11425066 3300028379 Bacteria 668
295 Ga0268265_10997427 3300028380 Bacteria 827
296 Ga0268265_11120573 3300028380 Bacteria 782
297 Ga0307515_10161055 3300028794 Bacteria 2288
298 Ga0265338_10094319 3300028800 Bacteria 2462
299 Ga0311001_1093816 3300029277 Bacteria 1764
300 Ga0310981_1015680 3300029285 Bacteria 956
301 Ga0268256_1038117 3300030500 Bacteria 1096
302 Ga0265762_1107797 3300030760 Bacteria 624
303 Ga0265775_107056 3300030762 Bacteria 669
304 Ga0265777_112116 3300030877 Bacteria 648
305 Ga0265764_109349 3300030882 Bacteria 604
306 Ga0265330_10022775 3300031235 Bacteria 2850
307 Ga0265328_10000059 3300031239 Bacteria 65115
308 Ga0265328_10003554 3300031239 Bacteria 6873
309 Ga0265328_10009974 3300031239 Bacteria 3842
310 Ga0265320_10206266 3300031240 Bacteria 877
311 Ga0265325_10073142 3300031241 Bacteria 1717
312 Ga0265325_10242556 3300031241 Bacteria 818
313 Ga0265329_10007573 3300031242 Bacteria 4185
314 Ga0265329_10098760 3300031242 Bacteria 929
315 Ga0265340_10001769 3300031247 Bacteria 12330
316 Ga0265340_10009506 3300031247 Bacteria 5214
317 Ga0265340_10029175 3300031247 Bacteria 2771
318 Ga0265340_10041235 3300031247 Bacteria 2270
319 Ga0265340_10066138 3300031247 Bacteria 1721
320 Ga0265340_10066458 3300031247 Bacteria 1716
321 Ga0265340_10078146 3300031247 Bacteria 1561
322 Ga0265339_10002133 3300031249 Bacteria 14410
323 Ga0265339_10168920 3300031249 Bacteria 1096
324 Ga0265339_10171865 3300031249 Bacteria 1084
325 Ga0265331_10000308 3300031250 Bacteria 53310
326 Ga0265331_10001760 3300031250 Bacteria 15552
327 Ga0265331_10006977 3300031250 Bacteria 6596
328 Ga0265331_10095207 3300031250 Bacteria 1374
329 Ga0265331_10101386 3300031250 Bacteria 1324
330 Ga0265331_10227157 3300031250 Bacteria 838
331 Ga0265331_10245082 3300031250 Bacteria 804
332 Ga0265327_10066223 3300031251 Bacteria 1824
333 Ga0265316_10000404 3300031344 Bacteria 49263
334 Ga0265316_10037483 3300031344 Bacteria 3912
335 Ga0265316_10049992 3300031344 Bacteria 3290
336 Ga0307408_100093348 3300031548 Bacteria 2276
337 Ga0265313_10000031 3300031595 Bacteria 128981
338 Ga0265313_10013098 3300031595 Bacteria 5004
339 Ga0265313_10057452 3300031595 Bacteria 1836
340 Ga0265313_10059699 3300031595 Bacteria 1793
341 Ga0316575_10106890 3300031665 Bacteria 1140
342 Ga0316575_10111151 3300031665 Bacteria 1118
343 Ga0316579_10599125 3300031691 Bacteria 533
344 Ga0265314_10158338 3300031711 Bacteria 1381
345 Ga0265314_10282545 3300031711 Bacteria 938
346 Ga0265314_10303630 3300031711 Bacteria 894
347 Ga0265342_10008958 3300031712 Bacteria 7108
348 Ga0265342_10177718 3300031712 Bacteria 1167
349 Ga0307405_10397878 3300031731 Bacteria 1077
350 Ga0316577_10191409 3300031733 Bacteria 1156
351 Ga0307413_10311709 3300031824 Bacteria 1198
352 Ga0307410_10074475 3300031852 Bacteria 2364
353 Ga0307410_10710815 3300031852 Bacteria 848
354 Ga0307406_10083248 3300031901 Bacteria 2133
355 Ga0307407_10032572 3300031903 Bacteria 2835
356 Ga0307409_100258466 3300031995 Bacteria 1596
357 Ga0307409_101369555 3300031995 Bacteria 733
358 Ga0307416_100083180 3300032002 Bacteria 2714
359 Ga0307416_101335304 3300032002 Bacteria 823
360 Ga0307414_10074675 3300032004 Bacteria 2457
361 Ga0316053_105404 3300032120 Bacteria 810
362 Ga0316593_10192369 3300032168 Bacteria 752
363 Ga0316592_1031860 3300033524 Bacteria 1149
364 Ga0373926_0299024 3300035083 Bacteria 628
365 Ga0373934_0017524 3300035086 Bacteria 2735
366 Ga0373944_0359541 3300035089 Bacteria 555
367 Ga0373923_0114545 3300035111 Bacteria 1200
368 Ga0373932_0141670 3300035112 Bacteria 818
369 Ga0373936_0049000 3300035113 Bacteria 1706
370 Ga0373936_0195525 3300035113 Bacteria 891
371 Ga0373945_0077986 3300035116 Bacteria 1265
372 Ga0373953_0028142 3300035117 Bacteria 2165
373 Ga0373954_0128876 3300035118 Bacteria 1231
374 Ga0373954_0265130 3300035118 Bacteria 846
375 Ga0373956_0207539 3300035119 Bacteria 929
376 Ga0373943_0000918 3300035170 Bacteria 12966
377 Ga0373943_0125014 3300035170 Bacteria 1371
378 Ga0373943_0128930 3300035170 Bacteria 1352
379 Ga0373943_0257746 3300035170 Bacteria 981
380 Ga0373943_0569076 3300035170 Bacteria 666
381 Ga0373946_0026916 3300035171 Bacteria 2272
382 Ga0373946_0169640 3300035171 Bacteria 1029
383 Ga0373946_0405871 3300035171 Bacteria 688
384 Ga0373955_0664028 3300035172 Bacteria 639
385 Ga0316574_0017432 3300035398 Bacteria 4203
386 Ga0316574_0621674 3300035398 Bacteria 666
387 Ga0373924_0011533 3300035410 Bacteria 3285
388 Ga0373924_0070759 3300035410 Bacteria 1471
389 Ga0373924_0115263 3300035410 Bacteria 1164
390 Ga0373931_0240750 3300035691 Bacteria 1097
391 Ga0373931_0739310 3300035691 Bacteria 652
392 Ga0373935_0021700 3300035692 Bacteria 3933
393 Ga0373935_0139794 3300035692 Bacteria 1635
394 Ga0373927_0101308 3300035695 Bacteria 1873
395 Ga0373927_0160772 3300035695 Bacteria 1471
396 Ga0373927_0306658 3300035695 Bacteria 1045
397 Ga0373927_0440609 3300035695 Bacteria 860
398 Ga0373927_0450316 3300035695 Bacteria 850
399 Ga0373933_0026815 3300035724 Bacteria 3312
400 Ga0373933_0340849 3300035724 Bacteria 973
401 Ga0373947_0018231 3300035725 Bacteria 4040
402 Ga0373947_0032321 3300035725 Bacteria 3083
403 Ga0373947_0217781 3300035725 Bacteria 1254
404 Ga0373947_1020119 3300035725 Bacteria 564
405 Ga0373937_0000922 3300036401 Bacteria 24939
406 Ga0373937_0046989 3300036401 Bacteria 3948
407 Ga0373937_0123067 3300036401 Bacteria 2418
408 Ga0373937_0195480 3300036401 Bacteria 1901
409 Ga0373937_0408826 3300036401 Bacteria 1288
410 Ga0373937_0410148 3300036401 Bacteria 1285
411 Ga0373937_0581629 3300036401 Bacteria 1063
412 Ga0373937_1379960 3300036401 Bacteria 652
413 Ga0373937_1600044 3300036401 Bacteria 599
414 Ga0265778_028515 3300036457 Bacteria 715
415 Ga0316582_0611377 3300036647 Bacteria 750
416 Ga0316584_0099898 3300036712 Bacteria 2173
417 Ga0316584_0646624 3300036712 Bacteria 729
418 Ga0373925_0020230 3300037068 Bacteria 4843
419 Ga0373925_0038166 3300037068 Bacteria 3550
420 Ga0373925_0065943 3300037068 Bacteria 2728
421 Ga0373925_0478968 3300037068 Bacteria 1021
422 Ga0373925_0600246 3300037068 Bacteria 907
423 Ga0373925_1228752 3300037068 Bacteria 615
424 Ga0395900_0364481 3300037418 Bacteria 1416
425 Ga0395900_0696059 3300037418 Bacteria 950
426 Ga0395898_0261061 3300037466 Bacteria 1652
427 Ga0395905_0047110 3300037471 Bacteria 4042
428 Ga0395905_0077750 3300037471 Bacteria 3109
429 Ga0436364_0026312 3300037853 Bacteria 5505
430 Ga0436364_0067153 3300037853 Bacteria 5031
431 Ga0436364_0136064 3300037853 Bacteria 4467
432 Ga0436364_0262364 3300037853 Bacteria 1847
433 Ga0436364_0311741 3300037853 Bacteria 910
434 Ga0436364_0389284 3300037853 Bacteria 5767
435 Ga0436364_0496103 3300037853 Bacteria 1098
436 Ga0436364_0552456 3300037853 Bacteria 2075
437 Ga0436364_0574640 3300037853 Bacteria 5763
438 Ga0436364_0784007 3300037853 Bacteria 675
439 Ga0436364_0821174 3300037853 Bacteria 920
440 Ga0436364_0912738 3300037853 Bacteria 996
441 Ga0436364_1142408 3300037853 Bacteria 642
442 Ga0436364_1247484 3300037853 Bacteria 685
443 Ga0436364_1361457 3300037853 Bacteria 519
444 Ga0395901_0400536 3300038443 Bacteria 1410
445 Ga0242420_128757 3300038996 Bacteria 557
446 Ga0400483_032406 3300039062 Bacteria 1974
447 Ga0400483_033097 3300039062 Bacteria 5512
448 Ga0400483_052164 3300039062 Bacteria 5619
449 Ga0400483_186097 3300039062 Bacteria 4414
450 Ga0400483_211902 3300039062 Bacteria 6572
451 Ga0400489_88380 3300039093 Bacteria 13920
452 Ga0237816_06353 3300039145 Bacteria 768
453 Ga0436365_0099132 3300039437 Bacteria 546
454 Ga0436365_0101855 3300039437 Bacteria 1126
455 Ga0436365_0134618 3300039437 Bacteria 2905
456 Ga0436365_0350875 3300039437 Bacteria 1007
457 Ga0436365_0432071 3300039437 Bacteria 1437
458 Ga0436365_0455844 3300039437 Bacteria 5484
459 Ga0436365_0877254 3300039437 Bacteria 1111
460 Ga0436365_0941632 3300039437 Bacteria 706
461 Ga0436365_1188082 3300039437 Bacteria 881
462 Ga0436365_1377575 3300039437 Bacteria 1390
463 Ga0436365_1506243 3300039437 Bacteria 598
464 Ga0436365_1630350 3300039437 Bacteria 686
465 Ga0436360_0132547 3300039438 Bacteria 1471
466 Ga0436360_0354756 3300039438 Bacteria 1315
467 Ga0436360_0412700 3300039438 Bacteria 556
468 Ga0436360_0482190 3300039438 Bacteria 3156
469 Ga0436360_0642530 3300039438 Bacteria 2669
470 Ga0436360_0691728 3300039438 Bacteria 1496
471 Ga0436360_0692134 3300039438 Bacteria 543
472 Ga0436360_0712565 3300039438 Bacteria 2242
473 Ga0436360_0750634 3300039438 Bacteria 991
474 Ga0436360_0762232 3300039438 Bacteria 1895
475 Ga0436360_0820467 3300039438 Bacteria 1864
476 Ga0436360_0922519 3300039438 Bacteria 1058
477 Ga0436360_1045531 3300039438 Bacteria 1875
478 Ga0436360_1046148 3300039438 Bacteria 541
479 Ga0436360_1049092 3300039438 Bacteria 808
480 Ga0436360_1158442 3300039438 Bacteria 2129
481 Ga0436360_1163812 3300039438 Bacteria 1225
482 Ga0436360_1267009 3300039438 Bacteria 1074
483 Ga0436360_1300469 3300039438 Bacteria 1171
484 Ga0436361_0073048 3300039447 Bacteria 747
485 Ga0436361_0394929 3300039447 Bacteria 752
486 Ga0436361_0463638 3300039447 Bacteria 4987
487 Ga0436361_0564699 3300039447 Bacteria 547
488 Ga0436361_0606387 3300039447 Bacteria 8387
489 Ga0436361_0825970 3300039447 Bacteria 963
490 Ga0436361_0909258 3300039447 Bacteria 2585
491 Ga0436361_1050384 3300039447 Bacteria 527
492 Ga0436361_1098516 3300039447 Bacteria 871
493 Ga0436363_0089847 3300039450 Bacteria 1378
494 Ga0436363_0097764 3300039450 Bacteria 608
495 Ga0436363_0445429 3300039450 Bacteria 946
496 Ga0436363_0626107 3300039450 Bacteria 644
497 Ga0436363_0764721 3300039450 Bacteria 1218
498 Ga0436363_0802862 3300039450 Bacteria 703
499 Ga0436363_0804382 3300039450 Bacteria 1258
500 Ga0436363_0886299 3300039450 Bacteria 730
501 Ga0436363_0887481 3300039450 Bacteria 759
502 Ga0436363_0931784 3300039450 Bacteria 3731
503 Ga0436363_1029642 3300039450 Bacteria 1046
504 Ga0436363_1401173 3300039450 Bacteria 720
505 Ga0436363_1425622 3300039450 Bacteria 1034
506 Ga0436363_1459617 3300039450 Bacteria 1028
507 Ga0436362_0053316 3300039453 Bacteria 1849
508 Ga0436362_0204187 3300039453 Bacteria 1415
509 Ga0436362_0502692 3300039453 Bacteria 715
510 Ga0436362_0833081 3300039453 Bacteria 588
511 Ga0436362_0959369 3300039453 Bacteria 1775
512 Ga0436362_1036040 3300039453 Bacteria 921
513 Ga0436362_1175474 3300039453 Bacteria 2287
514 Ga0436362_1221127 3300039453 Bacteria 695
515 Ga0436362_1298877 3300039453 Bacteria 996
516 Ga0451805_024535 3300041461 Bacteria 853
517 Ga0451849_0990398 3300041505 Bacteria 670
518 Ga0451855_1804371 3300041511 Bacteria 686
519 Ga0439445_0089811 3300042004 Bacteria 865
520 Ga0439449_0212519 3300042007 Bacteria 725
521 Ga0439450_188232 3300042008 Bacteria 550
522 Ga0450902_040382 3300042137 Bacteria 794
523 Ga0439459_0031525 3300042438 Bacteria 1081
524 Ga0439460_0116174 3300042461 Bacteria 872
525 Ga0451577_0073407 3300042876 Bacteria 3052
526 Ga0466972_0216659 3300044658 Bacteria 896
527 Ga0466966_0139838 3300044684 Bacteria 1480
528 Ga0466966_0171651 3300044684 Bacteria 1318
529 Ga0466961_0221581 3300044693 Bacteria 1166
530 Ga0466963_0263275 3300044694 Bacteria 1211
531 Ga0466963_0391939 3300044694 Bacteria 979
532 Ga0466963_0644539 3300044694 Bacteria 748
533 Ga0453684_0049274 3300044712 Bacteria 5557
534 Ga0453684_0065354 3300044712 Bacteria 4640
535 Ga0453684_0360885 3300044712 Bacteria 1636
536 Ga0466971_0403839 3300044719 Bacteria 666
537 Ga0466968_0005785 3300044735 Bacteria 4639
538 Ga0466968_0047732 3300044735 Bacteria 1821
539 Ga0466970_0099510 3300044765 Bacteria 1583
540 Ga0466970_0233471 3300044765 Bacteria 1028
541 Ga0466970_0369138 3300044765 Bacteria 816
542 Ga0466957_0034269 3300044842 Bacteria 3046
543 Ga0466957_0334113 3300044842 Bacteria 1025
544 Ga0466957_0599002 3300044842 Bacteria 771
545 Ga0466959_0008535 3300045049 Bacteria 7250
546 Ga0466959_0227083 3300045049 Bacteria 1293
547 Ga0466959_0688699 3300045049 Bacteria 685
548 Ga0451576_0013414 3300045051 Bacteria 9168
549 Ga0451576_0019189 3300045051 Bacteria 7468
550 Ga0451576_1484497 3300045051 Bacteria 704
551 Ga0466958_0010904 3300045836 Bacteria 5104
552 Ga0466958_0769111 3300045836 Bacteria 628
553 Ga0466958_1000119 3300045836 Bacteria 546
554 Ga0466967_0430576 3300045976 Bacteria 1287
555 Ga0466967_0524589 3300045976 Bacteria 1164
556 Ga0495629_0398968 3300046459 Bacteria 935
557 Ga0495629_0498940 3300046459 Bacteria 821
558 Ga0495651_0215306 3300046462 Bacteria 1334
559 Ga0495651_0301803 3300046462 Bacteria 1074
560 Ga0495580_0193883 3300046472 Bacteria 1401
561 Ga0495664_0126699 3300046477 Bacteria 1545
562 Ga0495664_0350496 3300046477 Bacteria 889
563 Ga0495664_0444635 3300046477 Bacteria 776
564 Ga0495664_0555541 3300046477 Bacteria 684
565 Ga0495608_0020259 3300046511 Bacteria 4572
566 Ga0495608_0470082 3300046511 Bacteria 764
567 Ga0495610_0041907 3300046512 Bacteria 2294
568 Ga0495618_0363012 3300046514 Bacteria 891
569 Ga0495628_0111177 3300046516 Bacteria 2107
570 Ga0495628_0852406 3300046516 Bacteria 635
571 Ga0495630_0565788 3300046517 Bacteria 872
572 Ga0495630_0609621 3300046517 Bacteria 837
573 Ga0495643_0193420 3300046522 Bacteria 981
574 Ga0495652_0480675 3300046529 Bacteria 865
575 Ga0495652_0604443 3300046529 Bacteria 748
576 Ga0495640_0118134 3300046533 Bacteria 1726
577 Ga0495640_0276097 3300046533 Bacteria 1047
578 Ga0495640_0281870 3300046533 Bacteria 1035
579 Ga0495640_0416148 3300046533 Bacteria 824
580 Ga0495645_0177017 3300046543 Bacteria 1464
581 Ga0495667_0011265 3300046559 Bacteria 6052
582 Ga0495667_0111876 3300046559 Bacteria 1764
583 Ga0495667_0253002 3300046559 Bacteria 1121
584 Ga0495656_0253503 3300046615 Bacteria 890
585 Ga0495634_0585212 3300046642 Bacteria 649
586 Ga0495634_0595726 3300046642 Bacteria 642
587 Ga0495635_0115828 3300046663 Bacteria 1829
588 Ga0495635_0818761 3300046663 Bacteria 599
589 Ga0495599_0204769 3300046678 Bacteria 1211
590 Ga0495599_0478230 3300046678 Bacteria 735
591 Ga0495646_0043169 3300046680 Bacteria 2763
592 Ga0495647_0114017 3300046681 Bacteria 1131
593 Ga0495613_0344953 3300046689 Bacteria 1024
594 Ga0495670_0023718 3300046691 Bacteria 3029
595 Ga0495671_0118021 3300046692 Bacteria 1295
596 Ga0495600_0187500 3300046809 Bacteria 1331
597 Ga0495581_0132627 3300047315 Bacteria 1452
598 Ga0495581_0444152 3300047315 Bacteria 756
599 Ga0495604_0122106 3300047317 Bacteria 1884
600 Ga0495604_0714751 3300047317 Bacteria 635
601 Ga0495674_0131216 3300047319 Bacteria 2111
602 Ga0495674_0135998 3300047319 Bacteria 2068
603 Ga0495674_0337658 3300047319 Bacteria 1225
604 Ga0495672_0055640 3300047320 Bacteria 2308
605 Ga0495680_0432262 3300047322 Bacteria 904
606 Ga0495680_0617636 3300047322 Bacteria 724
607 Ga0495675_0342966 3300047444 Bacteria 880
608 Ga0495684_0092397 3300047471 Bacteria 2292
609 Ga0495684_0282660 3300047471 Bacteria 1197
610 Ga0495684_0291274 3300047471 Bacteria 1175
611 Ga0495593_0178631 3300047673 Bacteria 1069
612 Ga0495593_0440891 3300047673 Bacteria 652
613 Ga0495602_0000485 3300048088 Bacteria 36933
614 Ga0495602_0270153 3300048088 Bacteria 1257
615 Ga0496100_0057829 3300048903 Bacteria 2542
616 Ga0496100_0944927 3300048903 Bacteria 678
617 Ga0496100_1088585 3300048903 Bacteria 630
618 Ga0496103_0441661 3300048906 Bacteria 835
619 Ga0496104_0331446 3300048907 Bacteria 1435
620 Ga0496106_0521066 3300048909 Bacteria 955
621 Ga0496106_0691840 3300048909 Bacteria 813
622 Ga0496106_1483829 3300048909 Bacteria 522
623 Ga0496107_0172032 3300048910 Bacteria 1608
624 Ga0496107_0832662 3300048910 Bacteria 675
625 Ga0496108_0187130 3300048911 Bacteria 1794
626 Ga0496110_0934239 3300048913 Bacteria 774
627 Ga0496112_0650192 3300048915 Bacteria 984
628 Ga0496112_0666289 3300048915 Bacteria 970
629 Ga0496113_0215805 3300048916 Bacteria 1528
630 Ga0496114_0022466 3300048917 Bacteria 5143
631 Ga0496115_0248001 3300048918 Bacteria 1467
632 Ga0496115_0416443 3300048918 Bacteria 1089
633 Ga0496117_0046309 3300048920 Bacteria 3129
634 Ga0496117_0081488 3300048920 Bacteria 2123
635 Ga0496118_0226893 3300048921 Bacteria 1081
636 Ga0496119_0014326 3300048922 Bacteria 6218
637 Ga0496120_0039336 3300048923 Bacteria 2791
638 Ga0496122_0034813 3300048925 Bacteria 4111
639 Ga0496122_0142908 3300048925 Bacteria 1493
640 Ga0496122_0342058 3300048925 Bacteria 785
641 Ga0496123_0035488 3300048926 Bacteria 3551
642 Ga0496123_0465134 3300048926 Bacteria 560
643 Ga0496124_0430630 3300048927 Bacteria 906
644 Ga0496125_0077073 3300048928 Bacteria 2572
645 Ga0496126_0037130 3300048929 Bacteria 4549
646 Ga0501306_015180 3300049127 Bacteria 1023
647 Ga0501306_068133 3300049127 Bacteria 597
648 Ga0501308_003368 3300049128 Bacteria 1476
649 Ga0501309_007103 3300049129 Bacteria 1381
650 Ga0501310_000683 3300049130 Bacteria 3000
651 Ga0501310_005178 3300049130 Bacteria 1333
652 Ga0501304_001554 3300049160 Bacteria 1493
653 Ga0501305_028110 3300049161 Bacteria 865
654 Ga0501305_028583 3300049161 Bacteria 859
655 Ga0501305_031375 3300049161 Bacteria 830
656 Ga0501305_049749 3300049161 Bacteria 701
657 Ga0501307_001852 3300049162 Bacteria 1884
658 Ga0501312_000345 3300049528 Bacteria 3532
659 Ga0501314_002948 3300049530 Bacteria 1347
660 Ga0501314_004521 3300049530 Bacteria 1156
661 Ga0501314_020724 3300049530 Bacteria 682
662 Ga0501315_004343 3300049531 Bacteria 1477
663 Ga0501315_022158 3300049531 Bacteria 865
664 Ga0501315_032445 3300049531 Bacteria 759
665 Ga0501316_002496 3300049532 Bacteria 1703
666 Ga0501316_040537 3300049532 Bacteria 648
667 Ga0501316_050396 3300049532 Bacteria 598
668 Ga0501317_000277 3300049533 Bacteria 3296
669 Ga0501317_020258 3300049533 Bacteria 895
670 Ga0501318_000161 3300049534 Bacteria 3372
671 Ga0501318_020082 3300049534 Bacteria 839
672 Ga0501319_004211 3300049535 Bacteria 994
673 Ga0501319_006428 3300049535 Bacteria 867
674 Ga0501321_008612 3300049537 Bacteria 1086
675 Ga0501322_000431 3300049538 Bacteria 1962
676 Ga0501335_026376 3300049551 Bacteria 641
677 Ga0501031_0063468 3300049568 Bacteria 2406
678 Ga0501031_0773388 3300049568 Bacteria 616
679 Ga0501032_0168379 3300049569 Bacteria 1437
680 Ga0501032_0169368 3300049569 Bacteria 1432
681 Ga0501032_0384316 3300049569 Bacteria 903
682 Ga0501032_0497975 3300049569 Bacteria 779
683 Ga0501032_0931068 3300049569 Bacteria 547
684 Ga0501033_0012312 3300049570 Bacteria 6529
685 Ga0501033_0063517 3300049570 Bacteria 2717
686 Ga0501033_0612923 3300049570 Bacteria 746
687 Ga0501034_0034397 3300049571 Bacteria 5137
688 Ga0501034_0039819 3300049571 Bacteria 4759
689 Ga0501034_0048634 3300049571 Bacteria 4280
690 Ga0501034_0086405 3300049571 Bacteria 3137
691 Ga0501034_0129964 3300049571 Bacteria 2502
692 Ga0501034_0237333 3300049571 Bacteria 1770
693 Ga0501034_0250745 3300049571 Bacteria 1715
694 Ga0501034_0498819 3300049571 Bacteria 1131
695 Ga0501034_0535543 3300049571 Bacteria 1081
696 Ga0501034_0576733 3300049571 Bacteria 1032
697 Ga0501036_0175736 3300049572 Bacteria 1803
698 Ga0501036_0312760 3300049572 Bacteria 1313
699 Ga0501036_0313371 3300049572 Bacteria 1312
700 Ga0501037_0013539 3300049573 Bacteria 6007
701 Ga0501037_0034255 3300049573 Bacteria 3747
702 Ga0501037_0082879 3300049573 Bacteria 2323
703 Ga0501037_0098680 3300049573 Bacteria 2110
704 Ga0501037_0133592 3300049573 Bacteria 1778
705 Ga0501037_0559009 3300049573 Bacteria 771
706 Ga0501038_0035903 3300049574 Bacteria 4350
707 Ga0501038_0163747 3300049574 Bacteria 1805
708 Ga0501038_0304259 3300049574 Bacteria 1251
709 Ga0501038_0656260 3300049574 Bacteria 789
710 Ga0501038_0712322 3300049574 Bacteria 751
711 Ga0501038_1085678 3300049574 Bacteria 585
712 Ga0501039_0102026 3300049575 Bacteria 2239
713 Ga0501039_0165934 3300049575 Bacteria 1736
714 Ga0501039_0564415 3300049575 Bacteria 893
715 Ga0501042_0418199 3300049578 Bacteria 971
716 Ga0501042_0427825 3300049578 Bacteria 960
717 Ga0501043_0189844 3300049579 Bacteria 1598
718 Ga0501043_0401744 3300049579 Bacteria 1035
719 Ga0501046_0091963 3300049580 Bacteria 2333
720 Ga0501046_0555579 3300049580 Bacteria 818
721 Ga0501047_0090947 3300049581 Bacteria 2929
722 Ga0501047_0106961 3300049581 Bacteria 2678
723 Ga0501047_0130314 3300049581 Bacteria 2395
724 Ga0501047_0259811 3300049581 Bacteria 1584
725 Ga0501047_0487821 3300049581 Bacteria 1059
726 Ga0501047_0492821 3300049581 Bacteria 1052
727 Ga0501047_0531505 3300049581 Bacteria 1001
728 Ga0501047_0713589 3300049581 Bacteria 820
729 Ga0501047_0915723 3300049581 Bacteria 690
730 Ga0501048_0144326 3300049582 Bacteria 1684
731 Ga0501048_0482404 3300049582 Bacteria 889
732 Ga0501067_0016522 3300049583 Bacteria 4077
733 Ga0501067_0125509 3300049583 Bacteria 1428
734 Ga0501067_0342004 3300049583 Bacteria 834
735 Ga0501068_0142232 3300049584 Bacteria 1504
736 Ga0501068_0433657 3300049584 Bacteria 849
737 Ga0501069_0136436 3300049585 Bacteria 1406
738 Ga0501069_0178140 3300049585 Bacteria 1228
739 Ga0501069_0198667 3300049585 Bacteria 1162
740 Ga0501070_0030178 3300049586 Bacteria 4543
741 Ga0501070_0064080 3300049586 Bacteria 3044
742 Ga0501070_0115075 3300049586 Bacteria 2222
743 Ga0501070_0343637 3300049586 Bacteria 1212
744 Ga0501071_0186977 3300049587 Bacteria 1553
745 Ga0501071_0413290 3300049587 Bacteria 1031
746 Ga0501071_0579129 3300049587 Bacteria 862
747 Ga0501072_0230389 3300049588 Bacteria 1476
748 Ga0501072_0572371 3300049588 Bacteria 891
749 Ga0501072_0575228 3300049588 Bacteria 889
750 Ga0501073_0014091 3300049589 Bacteria 5809
751 Ga0501073_0018783 3300049589 Bacteria 4997
752 Ga0501073_0033095 3300049589 Bacteria 3683
753 Ga0501073_0229877 3300049589 Bacteria 1281
754 Ga0501073_0481714 3300049589 Bacteria 858
755 Ga0501073_0488957 3300049589 Bacteria 851
756 Ga0501073_0699411 3300049589 Bacteria 699
757 Ga0501073_0731688 3300049589 Bacteria 682
758 Ga0501073_0735041 3300049589 Bacteria 681
759 Ga0501073_0754933 3300049589 Bacteria 671
760 Ga0501074_0029627 3300049590 Bacteria 3965
761 Ga0501074_0142168 3300049590 Bacteria 1716
762 Ga0501074_0183239 3300049590 Bacteria 1493
763 Ga0501074_0788082 3300049590 Bacteria 670
764 Ga0501076_0800382 3300049592 Bacteria 778
765 Ga0501077_0040887 3300049593 Bacteria 2952
766 Ga0501077_0531919 3300049593 Bacteria 754
767 Ga0501238_000510 3300049671 Bacteria 4455
768 Ga0501247_022228 3300049677 Bacteria 829
769 Ga0501259_132926 3300049688 Bacteria 602
770 Ga0501079_0485729 3300049741 Bacteria 971
771 Ga0501079_0610234 3300049741 Bacteria 859
772 Ga0501080_0032514 3300049742 Bacteria 4866
773 Ga0501080_0057218 3300049742 Bacteria 3630
774 Ga0501080_0150116 3300049742 Bacteria 2154
775 Ga0501080_0294704 3300049742 Bacteria 1472
776 Ga0501080_0379714 3300049742 Bacteria 1273
777 Ga0501081_0894952 3300049743 Bacteria 669
778 Ga0501083_0005155 3300049744 Bacteria 9248
779 Ga0501083_0028982 3300049744 Bacteria 3812
780 Ga0501083_0032553 3300049744 Bacteria 3575
781 Ga0501083_0050437 3300049744 Bacteria 2801
782 Ga0501083_0068545 3300049744 Bacteria 2361
783 Ga0501083_0095492 3300049744 Bacteria 1961
784 Ga0501083_0417359 3300049744 Bacteria 873
785 Ga0501083_0473995 3300049744 Bacteria 815
786 Ga0501083_0541800 3300049744 Bacteria 757
787 Ga0501035_0036292 3300049822 Bacteria 4468
788 Ga0501035_0098049 3300049822 Bacteria 2573
789 Ga0501035_0200897 3300049822 Bacteria 1710
790 Ga0501035_0269893 3300049822 Bacteria 1440
791 Ga0501035_0425899 3300049822 Bacteria 1101
792 Ga0501044_0053063 3300049823 Bacteria 4173
793 Ga0501044_0061730 3300049823 Bacteria 3833
794 Ga0501044_0188460 3300049823 Bacteria 2026
795 Ga0501044_0211728 3300049823 Bacteria 1892
796 Ga0501044_0290790 3300049823 Bacteria 1565
797 Ga0501044_0330521 3300049823 Bacteria 1447
798 Ga0501044_0678553 3300049823 Bacteria 917
799 Ga0501044_0879212 3300049823 Bacteria 772
800 Ga0501044_1130440 3300049823 Bacteria 652
801 Ga0501045_0262842 3300049824 Bacteria 1285
802 Ga0501212_010338 3300049851 Bacteria 1328
803 nmdc:mga03683_341226_c1 3300050489 Bacteria 708
804 nmdc:mga03n38_653033_c1 3300050490 Bacteria 603
805 nmdc:mga0k408_150606_c1 3300050493 Bacteria 1385
806 nmdc:mga0k408_313269_c1 3300050493 Bacteria 936
807 nmdc:mga06z11_161611_c1 3300050494 Bacteria 1280
808 nmdc:mga07m45_453955_c1 3300050496 Bacteria 743
809 nmdc:mga05p37_875685_c1 3300050507 Bacteria 972
810 nmdc:mga09592_163503_c1 3300050508 Bacteria 1158
811 nmdc:mga06r32_69327_c1 3300050510 Bacteria 3408
812 nmdc:mga08y16_457969_c1 3300050511 Bacteria 1300
813 nmdc:mga08y16_703702_c1 3300050511 Bacteria 1010
814 nmdc:mga0n895_81925_c1 3300050512 Bacteria 3216
815 Ga0495601_0005148 3300053077 Bacteria 7599
816 Ga0495601_0145863 3300053077 Bacteria 1545
817 Ga0495601_0160784 3300053077 Bacteria 1468
818 Ga0495612_0001186 3300053078 Bacteria 10745
819 Ga0495612_0176459 3300053078 Bacteria 937
820 Ga0495595_0006042 3300053084 Bacteria 4922
821 Ga0495595_0088509 3300053084 Bacteria 1483
822 Ga0495619_0263086 3300053085 Bacteria 1195
823 Ga0495619_0644914 3300053085 Bacteria 722
824 Ga0500643_004537 3300053087 Bacteria 6234
825 Ga0500566_0218248 3300053094 Bacteria 950
826 Ga0500641_0039459 3300053096 Bacteria 1902
827 Ga0500650_0198727 3300053098 Bacteria 914
828 Ga0500554_088867 3300053102 Bacteria 1025
829 Ga0500569_092460 3300053109 Bacteria 982
830 Ga0500595_011638 3300053119 Bacteria 3433
831 Ga0500608_163751 3300053122 Bacteria 961
832 Ga0500652_000140 3300053131 Bacteria 27358
833 Ga0500559_0028203 3300053136 Bacteria 2398
834 Ga0500568_0032927 3300053139 Bacteria 2129
835 Ga0500577_0046253 3300053142 Bacteria 1612
836 Ga0500616_0067312 3300053153 Bacteria 1837
837 Ga0500622_0018116 3300053156 Bacteria 3745
838 Ga0500636_0018083 3300053177 Bacteria 4167
839 Ga0500636_0278219 3300053177 Bacteria 837
840 Ga0501084_0188858 3300054114 Bacteria 1738
841 Ga0501084_0582831 3300054114 Bacteria 945
842 Ga0501084_0911847 3300054114 Bacteria 739
843 Ga0587084_001885 3300059477 Bacteria 2077
844 Ga0587084_028019 3300059477 Bacteria 889
845 Ga0587066_014955 3300059490 Bacteria 1200
846 Ga0587073_0078518 3300059492 Bacteria 814
847 Ga0587077_017795 3300059493 Bacteria 1215
848 Ga0587082_073793 3300059504 Bacteria 698
849 Ga0587083_0028720 3300059505 Bacteria 1091
850 Ga0587088_095401 3300059508 Bacteria 657
851 Ga0587089_031603 3300059509 Bacteria 784
852 Ga0587090_006217 3300059510 Bacteria 1525
853 Ga0587098_048214 3300059604 Bacteria 639
854 Ga0587098_059081 3300059604 Bacteria 599
855 Ga0587101_107187 3300059623 Bacteria 563
856 Ga0587062_016433 3300059639 Bacteria 1000
857 Ga0587062_048532 3300059639 Bacteria 712
858 Ga0587062_050693 3300059639 Bacteria 702
859 Ga0587067_034366 3300059640 Bacteria 953
860 Ga0587067_075086 3300059640 Bacteria 738
861 Ga0587067_168923 3300059640 Bacteria 562
862 Ga0587068_009911 3300059641 Bacteria 1411
863 Ga0587068_034293 3300059641 Bacteria 894
864 Ga0587102_011045 3300059649 Bacteria 902
865 Ga0587107_051534 3300059652 Bacteria 699
866 Ga0587119_025095 3300059658 Bacteria 784
867 Ga0587124_006180 3300059660 Bacteria 979
868 Ga0587071_005211 3300060344 Bacteria 1978
869 Ga0587071_023287 3300060344 Bacteria 1150
870 Ga0587111_0021274 3300060346 Bacteria 1249
871 Ga0501082_0068490 3300060353 Bacteria 3055
872 Ga0501082_0325904 3300060353 Bacteria 1338
873 Ga0501082_1252064 3300060353 Bacteria 648
874 Ga0466962_0264109 3300061719 Bacteria 848
875 Ga0466962_0345417 3300061719 Bacteria 741
876 Ga0530510_0541695 3300061734 Bacteria 884
877 2508735858 2508501050 Bacteria 9633614
878 2509078181 2508501114 Bacteria 7082538
879 2510842510 2510461069 Bacteria 5505000
880 2523466051 2523231067 Bacteria 5230452
881 2545677347 2545555834 Bacteria 8130841
882 2644298330 2643221653 Bacteria 4569637
883 2644656557 2643221719 Bacteria 4568197
884 2644731515 2643221733 Bacteria 5690728
885 2644734893 2643221734 Bacteria 5365412
886 2644744406 2643221736 Bacteria 6608466
887 2671694512 2671180139 Bacteria 4196045
888 2738745711 2738541281 Bacteria 5112672
889 2739347255 2738543031 Bacteria 5769731
890 2739354941 2738543032 Bacteria 5115625
891 2774874179 2773857925 Bacteria 6472445
892 2776259131 2775506901 Bacteria 9631051
893 2819242281 2818991272 Bacteria 4622173
894 2819720916 2818991467 Bacteria 5893227
895 2828310142 2828305725 Bacteria 4916900
896 2829749924 2829745981 Bacteria 5406054
897 2835319206 2835312727 Bacteria 7413381
898 2841761372 2841760612 Bacteria 6454112
899 2841913375 2841911363 Bacteria 6173697
900 2841919122 2841917233 Bacteria 6173500
901 2844104397 2844104063 Bacteria 6440972
902 2851184444 2851182111 Bacteria 6047226
903 2851247385 2851246043 Bacteria 6439203
904 2854685314 2854681122 Bacteria 4548679
905 2861692143 2861691609 Bacteria 5628931
906 2882462593 2882456835 Bacteria 6863978
907 2884300458 2884298095 Bacteria 3823049
908 2891088716 2891088606 Bacteria 4762464
909 2894234006 2894232714 Bacteria 8834183
910 2898797002 2898795034 Bacteria 4294459
911 2917699261 2917699015 Bacteria 7043791
912 2939671397 2939669807 Bacteria 5028511
913 2989778441 2989776772 Bacteria 4843317
914 3003667734 3003665799 Bacteria 7279786
915 641640685 641522639 Bacteria 7737025
916 643599639 643348564 Bacteria 8839022
917 8001849270 8001845381 Bacteria 5804942
918 8005248256 8005246636 Bacteria 4933972
919 8005659740 8005658619 Bacteria 4500593
920 8057530445 8057529695 Bacteria 6306553
921 Ga0501067_0446331
922 RicEn_C5064
923 JGI25159J45721_1010523
924 Ga0006778J45830_1058666
925 Ga0006759J45824_1010259
926 Ga0006759J45824_1036006
927 Ga0006759J45824_1123174
928 JGI25151J46595_10000998
929 Ga0006777J48905_1015771
930 Ga0006777J48905_1026045
931 Ga0006777J48905_1056620
932 Ga0007417J51691_1008472
933 Ga0007417J51691_1016055
934 Ga0007417J51691_1050143
935 Ga0007410J51695_1019967
936 Ga0007410J51695_1022321
937 Ga0007410J51695_1045401
938 Ga0007416J51690_1017104
939 Ga0007416J51690_1019837
940 Ga0006562J51391_1021653
941 Ga0007429J51699_1019329
942 Ga0007429J51699_1022307
943 Ga0032354_1013396
944 Ga0032354_1014807
945 Ga0006780_1006913
946 Ga0006780_1010347
947 Ga0006780_1015395
948 Ga0055526_1011375
949 Ga0055526_1012869
950 Ga0055524_1009061
951 Ga0055524_1011452
952 Ga0058860_10222892
953 Ga0065165_1007156
954 Ga0070658_10203068
955 Ga0070676_10770732
956 Ga0070666_11256222
957 Ga0070680_100239697
958 Ga0070689_100067740
959 Ga0070668_100019774
960 Ga0070668_100924570
961 Ga0070669_100430150
962 Ga0070674_100521485
963 Ga0070659_100255557
964 Ga0070659_101292119
965 Ga0070667_100033801
966 Ga0070667_100426348
967 Ga0070709_10338542
968 Ga0070709_10525039
969 Ga0070714_100380545
970 Ga0070714_100413833
971 Ga0070714_100816354
972 Ga0070714_100896845
973 Ga0070713_100073081
974 Ga0070713_100379555
975 Ga0070713_100393778
976 Ga0070713_101574583
977 Ga0070710_10019419
978 Ga0070710_10474792
979 Ga0070701_10531009
980 Ga0070711_100077038
981 Ga0070700_100105136
982 Ga0070678_101049927
983 Ga0070681_10289924
984 Ga0070681_10391849
985 Ga0070681_11149290
986 Ga0068867_100984532
987 Ga0070706_100121868
988 Ga0070707_100060990
989 Ga0070707_100613211
990 Ga0070698_100610978
991 Ga0070699_100401774
992 Ga0070679_100531560
993 Ga0070679_100576523
994 Ga0070679_100886680
995 Ga0070679_101263957
996 Ga0070684_101174139
997 Ga0070697_100196869
998 Ga0070695_100164130
999 Ga0070665_100137672
1000 Ga0070664_100156019
1001 Ga0068857_101036085
1002 Ga0068857_101065576
1003 Ga0068854_100224472
1004 Ga0068856_100777101
1005 Ga0068852_101147338
1006 Ga0068864_100895908
1007 Ga0068870_10071526
1008 Ga0068863_100024921
1009 Ga0068863_100392322
1010 Ga0068863_101725029
1011 Ga0068858_100240777
1012 Ga0081455_10365467
1013 Ga0081539_10326545
1014 Ga0070717_10135885
1015 Ga0070717_10308617
1016 Ga0070717_10593615
1017 Ga0075365_10161632
1018 Ga0075363_100077170
1019 Ga0075363_100282314
1020 Ga0070715_10558697
1021 Ga0070715_10636192
1022 Ga0070715_10775470
1023 Ga0070716_100348996
1024 Ga0070716_100894887
1025 Ga0070712_100129215
1026 Ga0070712_100232534
1027 Ga0070712_100315018
1028 Ga0075362_10091023
1029 Ga0075362_10184951
1030 Ga0075367_10460000
1031 Ga0075366_10106372
1032 Ga0075366_10498497
1033 Ga0075428_100375428
1034 Ga0075430_100066186
1035 Ga0075431_100109846
1036 Ga0099795_10000098
1037 Ga0105240_10792336
1038 Ga0105240_10878810
1039 Ga0111539_10139589
1040 Ga0111539_10625731
1041 Ga0105245_10709312
1042 Ga0105245_11084031
1043 Ga0105247_10609493
1044 Ga0114129_10357308
1045 Ga0114129_11314695
1046 Ga0105243_10593529
1047 Ga0105248_10036522
1048 Ga0105248_11389846
1049 Ga0105248_12180919
1050 Ga0105237_10587943
1051 Ga0105238_10105938
1052 Ga0105238_10400601
1053 Ga0105249_10475539
1054 Ga0105249_10679734
1055 Ga0105035_109896
1056 Ga0099796_10008991
1057 Ga0105239_10384331
1058 Ga0105239_10775093
1059 Ga0105239_10959790
1060 Ga0105239_11194822
1061 Ga0105246_10067496
1062 Ga0105246_10504559
1063 Ga0157369_11858569
1064 Ga0171462_1060
1065 Ga0157374_10597224
1066 Ga0157374_11976697
1067 Ga0157378_11985598
1068 Ga0163162_10749374
1069 Ga0163162_10791098
1070 Ga0163162_10853178
1071 Ga0157372_10005461
1072 Ga0157372_10836403
1073 Ga0157372_12202194
1074 Ga0163163_10282390
1075 Ga0163163_10963239
1076 Ga0163163_11259345
1077 Ga0157380_10073797
1078 Ga0182008_10071381
1079 Ga0157379_10408576
1080 Ga0157379_10871156
1081 Ga0182005_1011902
1082 Ga0182005_1030841
1083 Ga0197907_10383026
1084 Ga0197907_10611404
1085 Ga0206356_10203437
1086 Ga0206356_11041350
1087 Ga0206352_11316727
1088 Ga0206350_10361844
1089 Ga0206350_10871634
1090 Ga0206354_10418299
1091 Ga0206354_11461142
1092 Ga0213873_10032527
1093 Ga0213873_10083012
1094 Ga0213872_10002583
1095 Ga0213872_10018648
1096 Ga0213872_10076120
1097 Ga0213872_10120365
1098 Ga0213872_10269602
1099 Ga0213874_10004974
1100 Ga0213876_10032089
1101 Ga0213876_10187793
1102 Ga0213876_10291478
1103 Ga0213875_10001918
1104 Ga0213875_10009354
1105 Ga0213875_10027997
1106 Ga0213875_10028201
1107 Ga0213875_10032543
1108 Ga0213875_10378324
1109 Ga0213871_10001835
1110 Ga0213871_10027643
1111 Ga0213871_10057008
1112 Ga0224712_10051833
1113 Ga0224712_10117759
1114 Ga0224712_10182396
1115 Ga0224712_10463085
1116 Ga0256743_109706
1117 Ga0209673_1081273
1118 Ga0209130_1000845
1119 Ga0209130_1025254
1120 Ga0209675_1000772
1121 Ga0209025_1005170
1122 Ga0209025_1007328
1123 Ga0209564_1002904
1124 Ga0209564_1002939
1125 Ga0209758_1036517
1126 Ga0209758_1051119
1127 Ga0209256_1003845
1128 Ga0209256_1005787
1129 Ga0207692_10013314
1130 Ga0207692_10609215
1131 Ga0207688_10521182
1132 Ga0207680_10737050
1133 Ga0207685_10588991
1134 Ga0207699_10218643
1135 Ga0207699_10675872
1136 Ga0207699_10998311
1137 Ga0207645_10546980
1138 Ga0207643_10103238
1139 Ga0207705_10891198
1140 Ga0207705_11113445
1141 Ga0207684_10095939
1142 Ga0207707_10198389
1143 Ga0207707_10366673
1144 Ga0207695_10715029
1145 Ga0207695_11075944
1146 Ga0207671_10315534
1147 Ga0207693_10124923
1148 Ga0207693_10144611
1149 Ga0207693_10199267
1150 Ga0207663_10131537
1151 Ga0207663_10550741
1152 Ga0207663_10969186
1153 Ga0207660_10206444
1154 Ga0207660_10347288
1155 Ga0207660_10832786
1156 Ga0207662_10113149
1157 Ga0207657_11212994
1158 Ga0207652_10207524
1159 Ga0207652_10436251
1160 Ga0207652_10777551
1161 Ga0207646_10041541
1162 Ga0207681_10411382
1163 Ga0207694_10261783
1164 Ga0207694_10795736
1165 Ga0207650_11273067
1166 Ga0207687_10596062
1167 Ga0207700_10063660
1168 Ga0207700_10319205
1169 Ga0207700_10395123
1170 Ga0207700_10435950
1171 Ga0207700_10453425
1172 Ga0207700_10648018
1173 Ga0207700_10909394
1174 Ga0207700_11177486
1175 Ga0207664_10179857
1176 Ga0207664_10726553
1177 Ga0207706_10089938
1178 Ga0207670_10160779
1179 Ga0207704_11034849
1180 Ga0207665_10361693
1181 Ga0207665_10420865
1182 Ga0207665_10871307
1183 Ga0207691_10617462
1184 Ga0207711_10020060
1185 Ga0207679_10029035
1186 Ga0207651_10520223
1187 Ga0207668_10083868
1188 Ga0207668_10552746
1189 Ga0207640_10298155
1190 Ga0207640_10340165
1191 Ga0207658_10038859
1192 Ga0207658_10300857
1193 Ga0207658_10352452
1194 Ga0207677_10902636
1195 Ga0207639_10361938
1196 Ga0207678_10512373
1197 Ga0207678_11043344
1198 Ga0207708_10054496
1199 Ga0207702_10093097
1200 Ga0207702_12091273
1201 Ga0207641_10018124
1202 Ga0207641_10604434
1203 Ga0207641_10616124
1204 Ga0207676_10916968
1205 Ga0207674_10665836
1206 Ga0207674_11511019
1207 Ga0207674_11580544
1208 Ga0207675_101143321
1209 Ga0207683_10648280
1210 Ga0207698_12136976
1211 Ga0209371_1042358
1212 Ga0268266_10241074
1213 Ga0268266_10944114
1214 Ga0268266_11425066
1215 Ga0268265_10997427
1216 Ga0268265_11120573
1217 Ga0307515_10161055
1218 Ga0265338_10094319
1219 Ga0311001_1093816
1220 Ga0310981_1015680
1221 Ga0268256_1038117
1222 Ga0265762_1107797
1223 Ga0265775_107056
1224 Ga0265777_112116
1225 Ga0265764_109349
1226 Ga0265330_10022775
1227 Ga0265328_10000059
1228 Ga0265328_10003554
1229 Ga0265328_10009974
1230 Ga0265320_10206266
1231 Ga0265325_10073142
1232 Ga0265325_10242556
1233 Ga0265329_10007573
1234 Ga0265329_10098760
1235 Ga0265340_10001769
1236 Ga0265340_10009506
1237 Ga0265340_10029175
1238 Ga0265340_10041235
1239 Ga0265340_10066138
1240 Ga0265340_10066458
1241 Ga0265340_10078146
1242 Ga0265339_10002133
1243 Ga0265339_10168920
1244 Ga0265339_10171865
1245 Ga0265331_10000308
1246 Ga0265331_10001760
1247 Ga0265331_10006977
1248 Ga0265331_10095207
1249 Ga0265331_10101386
1250 Ga0265331_10227157
1251 Ga0265331_10245082
1252 Ga0265327_10066223
1253 Ga0265316_10000404
1254 Ga0265316_10037483
1255 Ga0265316_10049992
1256 Ga0307408_100093348
1257 Ga0265313_10000031
1258 Ga0265313_10013098
1259 Ga0265313_10057452
1260 Ga0265313_10059699
1261 Ga0316575_10106890
1262 Ga0316575_10111151
1263 Ga0316579_10599125
1264 Ga0265314_10158338
1265 Ga0265314_10282545
1266 Ga0265314_10303630
1267 Ga0265342_10008958
1268 Ga0265342_10177718
1269 Ga0307405_10397878
1270 Ga0316577_10191409
1271 Ga0307413_10311709
1272 Ga0307410_10074475
1273 Ga0307410_10710815
1274 Ga0307406_10083248
1275 Ga0307407_10032572
1276 Ga0307409_100258466
1277 Ga0307409_101369555
1278 Ga0307416_100083180
1279 Ga0307416_101335304
1280 Ga0307414_10074675
1281 Ga0316053_105404
1282 Ga0316593_10192369
1283 Ga0316592_1031860
1284 Ga0373926_0299024
1285 Ga0373934_0017524
1286 Ga0373944_0359541
1287 Ga0373923_0114545
1288 Ga0373932_0141670
1289 Ga0373936_0049000
1290 Ga0373936_0195525
1291 Ga0373945_0077986
1292 Ga0373953_0028142
1293 Ga0373954_0128876
1294 Ga0373954_0265130
1295 Ga0373956_0207539
1296 Ga0373943_0000918
1297 Ga0373943_0125014
1298 Ga0373943_0128930
1299 Ga0373943_0257746
1300 Ga0373943_0569076
1301 Ga0373946_0026916
1302 Ga0373946_0169640
1303 Ga0373946_0405871
1304 Ga0373955_0664028
1305 Ga0316574_0017432
1306 Ga0316574_0621674
1307 Ga0373924_0011533
1308 Ga0373924_0070759
1309 Ga0373924_0115263
1310 Ga0373931_0240750
1311 Ga0373931_0739310
1312 Ga0373935_0021700
1313 Ga0373935_0139794
1314 Ga0373927_0101308
1315 Ga0373927_0160772
1316 Ga0373927_0306658
1317 Ga0373927_0440609
1318 Ga0373927_0450316
1319 Ga0373933_0026815
1320 Ga0373933_0340849
1321 Ga0373947_0018231
1322 Ga0373947_0032321
1323 Ga0373947_0217781
1324 Ga0373947_1020119
1325 Ga0373937_0000922
1326 Ga0373937_0046989
1327 Ga0373937_0123067
1328 Ga0373937_0195480
1329 Ga0373937_0408826
1330 Ga0373937_0410148
1331 Ga0373937_0581629
1332 Ga0373937_1379960
1333 Ga0373937_1600044
1334 Ga0265778_028515
1335 Ga0316582_0611377
1336 Ga0316584_0099898
1337 Ga0316584_0646624
1338 Ga0373925_0020230
1339 Ga0373925_0038166
1340 Ga0373925_0065943
1341 Ga0373925_0478968
1342 Ga0373925_0600246
1343 Ga0373925_1228752
1344 Ga0395900_0364481
1345 Ga0395900_0696059
1346 Ga0395898_0261061
1347 Ga0395905_0047110
1348 Ga0395905_0077750
1349 Ga0436364_0026312
1350 Ga0436364_0067153
1351 Ga0436364_0136064
1352 Ga0436364_0262364
1353 Ga0436364_0311741
1354 Ga0436364_0389284
1355 Ga0436364_0496103
1356 Ga0436364_0552456
1357 Ga0436364_0574640
1358 Ga0436364_0784007
1359 Ga0436364_0821174
1360 Ga0436364_0912738
1361 Ga0436364_1142408
1362 Ga0436364_1247484
1363 Ga0436364_1361457
1364 Ga0395901_0400536
1365 Ga0242420_128757
1366 Ga0400483_032406
1367 Ga0400483_033097
1368 Ga0400483_052164
1369 Ga0400483_186097
1370 Ga0400483_211902
1371 Ga0400489_88380
1372 Ga0237816_06353
1373 Ga0436365_0099132
1374 Ga0436365_0101855
1375 Ga0436365_0134618
1376 Ga0436365_0350875
1377 Ga0436365_0432071
1378 Ga0436365_0455844
1379 Ga0436365_0877254
1380 Ga0436365_0941632
1381 Ga0436365_1188082
1382 Ga0436365_1377575
1383 Ga0436365_1506243
1384 Ga0436365_1630350
1385 Ga0436360_0132547
1386 Ga0436360_0354756
1387 Ga0436360_0412700
1388 Ga0436360_0482190
1389 Ga0436360_0642530
1390 Ga0436360_0691728
1391 Ga0436360_0692134
1392 Ga0436360_0712565
1393 Ga0436360_0750634
1394 Ga0436360_0762232
1395 Ga0436360_0820467
1396 Ga0436360_0922519
1397 Ga0436360_1045531
1398 Ga0436360_1046148
1399 Ga0436360_1049092
1400 Ga0436360_1158442
1401 Ga0436360_1163812
1402 Ga0436360_1267009
1403 Ga0436360_1300469
1404 Ga0436361_0073048
1405 Ga0436361_0394929
1406 Ga0436361_0463638
1407 Ga0436361_0564699
1408 Ga0436361_0606387
1409 Ga0436361_0825970
1410 Ga0436361_0909258
1411 Ga0436361_1050384
1412 Ga0436361_1098516
1413 Ga0436363_0089847
1414 Ga0436363_0097764
1415 Ga0436363_0445429
1416 Ga0436363_0626107
1417 Ga0436363_0764721
1418 Ga0436363_0802862
1419 Ga0436363_0804382
1420 Ga0436363_0886299
1421 Ga0436363_0887481
1422 Ga0436363_0931784
1423 Ga0436363_1029642
1424 Ga0436363_1401173
1425 Ga0436363_1425622
1426 Ga0436363_1459617
1427 Ga0436362_0053316
1428 Ga0436362_0204187
1429 Ga0436362_0502692
1430 Ga0436362_0833081
1431 Ga0436362_0959369
1432 Ga0436362_1036040
1433 Ga0436362_1175474
1434 Ga0436362_1221127
1435 Ga0436362_1298877
1436 Ga0451805_024535
1437 Ga0451849_0990398
1438 Ga0451855_1804371
1439 Ga0439445_0089811
1440 Ga0439449_0212519
1441 Ga0439450_188232
1442 Ga0450902_040382
1443 Ga0439459_0031525
1444 Ga0439460_0116174
1445 Ga0451577_0073407
1446 Ga0466972_0216659
1447 Ga0466966_0139838
1448 Ga0466966_0171651
1449 Ga0466961_0221581
1450 Ga0466963_0263275
1451 Ga0466963_0391939
1452 Ga0466963_0644539
1453 Ga0453684_0049274
1454 Ga0453684_0065354
1455 Ga0453684_0360885
1456 Ga0466971_0403839
1457 Ga0466968_0005785
1458 Ga0466968_0047732
1459 Ga0466970_0099510
1460 Ga0466970_0233471
1461 Ga0466970_0369138
1462 Ga0466957_0034269
1463 Ga0466957_0334113
1464 Ga0466957_0599002
1465 Ga0466959_0008535
1466 Ga0466959_0227083
1467 Ga0466959_0688699
1468 Ga0451576_0013414
1469 Ga0451576_0019189
1470 Ga0451576_1484497
1471 Ga0466958_0010904
1472 Ga0466958_0769111
1473 Ga0466958_1000119
1474 Ga0466967_0430576
1475 Ga0466967_0524589
1476 Ga0495629_0398968
1477 Ga0495629_0498940
1478 Ga0495651_0215306
1479 Ga0495651_0301803
1480 Ga0495580_0193883
1481 Ga0495664_0126699
1482 Ga0495664_0350496
1483 Ga0495664_0444635
1484 Ga0495664_0555541
1485 Ga0495608_0020259
1486 Ga0495608_0470082
1487 Ga0495610_0041907
1488 Ga0495618_0363012
1489 Ga0495628_0111177
1490 Ga0495628_0852406
1491 Ga0495630_0565788
1492 Ga0495630_0609621
1493 Ga0495643_0193420
1494 Ga0495652_0480675
1495 Ga0495652_0604443
1496 Ga0495640_0118134
1497 Ga0495640_0276097
1498 Ga0495640_0281870
1499 Ga0495640_0416148
1500 Ga0495645_0177017
1501 Ga0495667_0011265
1502 Ga0495667_0111876
1503 Ga0495667_0253002
1504 Ga0495656_0253503
1505 Ga0495634_0585212
1506 Ga0495634_0595726
1507 Ga0495635_0115828
1508 Ga0495635_0818761
1509 Ga0495599_0204769
1510 Ga0495599_0478230
1511 Ga0495646_0043169
1512 Ga0495647_0114017
1513 Ga0495613_0344953
1514 Ga0495670_0023718
1515 Ga0495671_0118021
1516 Ga0495600_0187500
1517 Ga0495581_0132627
1518 Ga0495581_0444152
1519 Ga0495604_0122106
1520 Ga0495604_0714751
1521 Ga0495674_0131216
1522 Ga0495674_0135998
1523 Ga0495674_0337658
1524 Ga0495672_0055640
1525 Ga0495680_0432262
1526 Ga0495680_0617636
1527 Ga0495675_0342966
1528 Ga0495684_0092397
1529 Ga0495684_0282660
1530 Ga0495684_0291274
1531 Ga0495593_0178631
1532 Ga0495593_0440891
1533 Ga0495602_0000485
1534 Ga0495602_0270153
1535 Ga0496100_0057829
1536 Ga0496100_0944927
1537 Ga0496100_1088585
1538 Ga0496103_0441661
1539 Ga0496104_0331446
1540 Ga0496106_0521066
1541 Ga0496106_0691840
1542 Ga0496106_1483829
1543 Ga0496107_0172032
1544 Ga0496107_0832662
1545 Ga0496108_0187130
1546 Ga0496110_0934239
1547 Ga0496112_0650192
1548 Ga0496112_0666289
1549 Ga0496113_0215805
1550 Ga0496114_0022466
1551 Ga0496115_0248001
1552 Ga0496115_0416443
1553 Ga0496117_0046309
1554 Ga0496117_0081488
1555 Ga0496118_0226893
1556 Ga0496119_0014326
1557 Ga0496120_0039336
1558 Ga0496122_0034813
1559 Ga0496122_0142908
1560 Ga0496122_0342058
1561 Ga0496123_0035488
1562 Ga0496123_0465134
1563 Ga0496124_0430630
1564 Ga0496125_0077073
1565 Ga0496126_0037130
1566 Ga0501306_015180
1567 Ga0501306_068133
1568 Ga0501308_003368
1569 Ga0501309_007103
1570 Ga0501310_000683
1571 Ga0501310_005178
1572 Ga0501304_001554
1573 Ga0501305_028110
1574 Ga0501305_028583
1575 Ga0501305_031375
1576 Ga0501305_049749
1577 Ga0501307_001852
1578 Ga0501312_000345
1579 Ga0501314_002948
1580 Ga0501314_004521
1581 Ga0501314_020724
1582 Ga0501315_004343
1583 Ga0501315_022158
1584 Ga0501315_032445
1585 Ga0501316_002496
1586 Ga0501316_040537
1587 Ga0501316_050396
1588 Ga0501317_000277
1589 Ga0501317_020258
1590 Ga0501318_000161
1591 Ga0501318_020082
1592 Ga0501319_004211
1593 Ga0501319_006428
1594 Ga0501321_008612
1595 Ga0501322_000431
1596 Ga0501335_026376
1597 Ga0501031_0063468
1598 Ga0501031_0773388
1599 Ga0501032_0168379
1600 Ga0501032_0169368
1601 Ga0501032_0384316
1602 Ga0501032_0497975
1603 Ga0501032_0931068
1604 Ga0501033_0012312
1605 Ga0501033_0063517
1606 Ga0501033_0612923
1607 Ga0501034_0034397
1608 Ga0501034_0039819
1609 Ga0501034_0048634
1610 Ga0501034_0086405
1611 Ga0501034_0129964
1612 Ga0501034_0237333
1613 Ga0501034_0250745
1614 Ga0501034_0498819
1615 Ga0501034_0535543
1616 Ga0501034_0576733
1617 Ga0501036_0175736
1618 Ga0501036_0312760
1619 Ga0501036_0313371
1620 Ga0501037_0013539
1621 Ga0501037_0034255
1622 Ga0501037_0082879
1623 Ga0501037_0098680
1624 Ga0501037_0133592
1625 Ga0501037_0559009
1626 Ga0501038_0035903
1627 Ga0501038_0163747
1628 Ga0501038_0304259
1629 Ga0501038_0656260
1630 Ga0501038_0712322
1631 Ga0501038_1085678
1632 Ga0501039_0102026
1633 Ga0501039_0165934
1634 Ga0501039_0564415
1635 Ga0501042_0418199
1636 Ga0501042_0427825
1637 Ga0501043_0189844
1638 Ga0501043_0401744
1639 Ga0501046_0091963
1640 Ga0501046_0555579
1641 Ga0501047_0090947
1642 Ga0501047_0106961
1643 Ga0501047_0130314
1644 Ga0501047_0259811
1645 Ga0501047_0487821
1646 Ga0501047_0492821
1647 Ga0501047_0531505
1648 Ga0501047_0713589
1649 Ga0501047_0915723
1650 Ga0501048_0144326
1651 Ga0501048_0482404
1652 Ga0501067_0016522
1653 Ga0501067_0125509
1654 Ga0501067_0342004
1655 Ga0501068_0142232
1656 Ga0501068_0433657
1657 Ga0501069_0136436
1658 Ga0501069_0178140
1659 Ga0501069_0198667
1660 Ga0501070_0030178
1661 Ga0501070_0064080
1662 Ga0501070_0115075
1663 Ga0501070_0343637
1664 Ga0501071_0186977
1665 Ga0501071_0413290
1666 Ga0501071_0579129
1667 Ga0501072_0230389
1668 Ga0501072_0572371
1669 Ga0501072_0575228
1670 Ga0501073_0014091
1671 Ga0501073_0018783
1672 Ga0501073_0033095
1673 Ga0501073_0229877
1674 Ga0501073_0481714
1675 Ga0501073_0488957
1676 Ga0501073_0699411
1677 Ga0501073_0731688
1678 Ga0501073_0735041
1679 Ga0501073_0754933
1680 Ga0501074_0029627
1681 Ga0501074_0142168
1682 Ga0501074_0183239
1683 Ga0501074_0788082
1684 Ga0501076_0800382
1685 Ga0501077_0040887
1686 Ga0501077_0531919
1687 Ga0501238_000510
1688 Ga0501247_022228
1689 Ga0501259_132926
1690 Ga0501079_0485729
1691 Ga0501079_0610234
1692 Ga0501080_0032514
1693 Ga0501080_0057218
1694 Ga0501080_0150116
1695 Ga0501080_0294704
1696 Ga0501080_0379714
1697 Ga0501081_0894952
1698 Ga0501083_0005155
1699 Ga0501083_0028982
1700 Ga0501083_0032553
1701 Ga0501083_0050437
1702 Ga0501083_0068545
1703 Ga0501083_0095492
1704 Ga0501083_0417359
1705 Ga0501083_0473995
1706 Ga0501083_0541800
1707 Ga0501035_0036292
1708 Ga0501035_0098049
1709 Ga0501035_0200897
1710 Ga0501035_0269893
1711 Ga0501035_0425899
1712 Ga0501044_0053063
1713 Ga0501044_0061730
1714 Ga0501044_0188460
1715 Ga0501044_0211728
1716 Ga0501044_0290790
1717 Ga0501044_0330521
1718 Ga0501044_0678553
1719 Ga0501044_0879212
1720 Ga0501044_1130440
1721 Ga0501045_0262842
1722 Ga0501212_010338
1723 nmdc:mga03683_341226_c1
1724 nmdc:mga03n38_653033_c1
1725 nmdc:mga0k408_150606_c1
1726 nmdc:mga0k408_313269_c1
1727 nmdc:mga06z11_161611_c1
1728 nmdc:mga07m45_453955_c1
1729 nmdc:mga05p37_875685_c1
1730 nmdc:mga09592_163503_c1
1731 nmdc:mga06r32_69327_c1
1732 nmdc:mga08y16_457969_c1
1733 nmdc:mga08y16_703702_c1
1734 nmdc:mga0n895_81925_c1
1735 Ga0495601_0005148
1736 Ga0495601_0145863
1737 Ga0495601_0160784
1738 Ga0495612_0001186
1739 Ga0495612_0176459
1740 Ga0495595_0006042
1741 Ga0495595_0088509
1742 Ga0495619_0263086
1743 Ga0495619_0644914
1744 Ga0500643_004537
1745 Ga0500566_0218248
1746 Ga0500641_0039459
1747 Ga0500650_0198727
1748 Ga0500554_088867
1749 Ga0500569_092460
1750 Ga0500595_011638
1751 Ga0500608_163751
1752 Ga0500652_000140
1753 Ga0500559_0028203
1754 Ga0500568_0032927
1755 Ga0500577_0046253
1756 Ga0500616_0067312
1757 Ga0500622_0018116
1758 Ga0500636_0018083
1759 Ga0500636_0278219
1760 Ga0501084_0188858
1761 Ga0501084_0582831
1762 Ga0501084_0911847
1763 Ga0587084_001885
1764 Ga0587084_028019
1765 Ga0587066_014955
1766 Ga0587073_0078518
1767 Ga0587077_017795
1768 Ga0587082_073793
1769 Ga0587083_0028720
1770 Ga0587088_095401
1771 Ga0587089_031603
1772 Ga0587090_006217
1773 Ga0587098_048214
1774 Ga0587098_059081
1775 Ga0587101_107187
1776 Ga0587062_016433
1777 Ga0587062_048532
1778 Ga0587062_050693
1779 Ga0587067_034366
1780 Ga0587067_075086
1781 Ga0587067_168923
1782 Ga0587068_009911
1783 Ga0587068_034293
1784 Ga0587102_011045
1785 Ga0587107_051534
1786 Ga0587119_025095
1787 Ga0587124_006180
1788 Ga0587071_005211
1789 Ga0587071_023287
1790 Ga0587111_0021274
1791 Ga0501082_0068490
1792 Ga0501082_0325904
1793 Ga0501082_1252064
1794 Ga0466962_0264109
1795 Ga0466962_0345417
1796 Ga0530510_0541695
1797 2508735858
1798 2509078181
1799 2510842510
1800 2523466051
1801 2545677347
1802 2644298330
1803 2644656557
1804 2644731515
1805 2644734893
1806 2644744406
1807 2671694512
1808 2738745711
1809 2739347255
1810 2739354941
1811 2774874179
1812 2776259131
1813 2819242281
1814 2819720916
1815 2828310142
1816 2829749924
1817 2835319206
1818 2841761372
1819 2841913375
1820 2841919122
1821 2844104397
1822 2851184444
1823 2851247385
1824 2854685314
1825 2861692143
1826 2882462593
1827 2884300458
1828 2891088716
1829 2894234006
1830 2898797002
1831 2917699261
1832 2939671397
1833 2989778441
1834 3003667734
1835 641640685
1836 643599639
1837 8001849270
1838 8005248256
1839 8005659740
1840 8057530445

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00177

Ribosomal_S7

Ribosomal protein S7p/S5e

19

166

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
8cdv-assembly1.cif.gz_H rnase r bound to a 30s degradation intermediate (state ii) 0.9829 18 127
7nhn-assembly1.cif.gz_h vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes 0.9788 12 151
7nhl-assembly1.cif.gz_h vgaa-lc, an antibiotic resistance abcf, in complex with 70s ribosome from staphylococcus aureus 0.9753 12 151
1hus-assembly1.cif.gz_A ribosomal protein s7 0.9707 10 148
7nhn-assembly1.cif.gz_h vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes 0.9653 12 151
ID Description Score Start End Superfamily
1husA00 Mainly Alpha;Orthogonal Bundle;Ribosomal Protein S7;Ribosomal protein S7/S5 0.9701 10 148 1.10.455.10
1husA00 Mainly Alpha;Orthogonal Bundle;Ribosomal Protein S7;Ribosomal protein S7/S5 0.9629 10 148 1.10.455.10
af_P48940_2_156_1.10.455.10 Mainly Alpha;Orthogonal Bundle;Ribosomal Protein S7;Ribosomal protein S7/S5 0.9581 3 156 1.10.455.10
5x8rg00 Mainly Alpha;Orthogonal Bundle;Ribosomal Protein S7;Ribosomal protein S7/S5 0.9558 4 151 1.10.455.10
5mmjg00 Mainly Alpha;Orthogonal Bundle;Ribosomal Protein S7;Ribosomal protein S7/S5 0.9547 2 154 1.10.455.10
ID Description Score Start End GO Terms
AF-A0A3S1UAE0-F1-model_v4 30S ribosomal protein S7 0.9967 34 156 GO:0000049
GO:0003735
GO:0006412
GO:0015935
GO:0019843
AF-A0A7Y2PLF6-F1-model_v4 Ribosomal protein S7 0.9926 12 148 GO:0003735
GO:0006412
GO:0015935
GO:0019843
AF-A0A3S1UAE0-F1-model_v4 30S ribosomal protein S7 0.9887 34 156 GO:0000049
GO:0003735
GO:0006412
GO:0015935
GO:0019843
AF-Q02VK9-F1-model_v4 Small ribosomal subunit protein uS7 (30S ribosomal protein S7) 0.9829 3 156 GO:0000049
GO:0003735
GO:0006412
GO:0015935
GO:0019843
AF-A0A838VDW6-F1-model_v4 30S ribosomal protein S7 0.9826 51 156 GO:0000049
GO:0003735
GO:0006412
GO:0015935
GO:0019843

Map