F485743
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 920 | 465 | 1840 | 156 |
Family's Representative Sequence
| Representative Sequence | 3300049583|Ga0501067_0446331|Ga0501067_0446331_150_671 |
| Length | 173 |
| Sequence | VDGRDKPGHDEREERNEMSRRHRADKREITPDPKFKNEVVTKFMNSVMSHGKKSVAEQIVYGAFDIIQSKTKQDPLGIFRTALDNVMPSLEVRSRRVGGATYQVPVEVRSERRQALAIRWLLTAARGRNEKTMIDKLSGELLDAANNRGNAVKKREDTHRMAEANRAFSHYRW |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 2 | 2010549000 | Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes | Metagenome | Endosphere |
| 3 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 4 | 3300003162 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 5 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 6 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 7 | 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 8 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 9 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 10 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 11 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 12 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 13 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 14 | 3300003735 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 15 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 16 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 17 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 18 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 19 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 50 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 51 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 52 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 53 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 54 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 55 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 56 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 57 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 58 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 59 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 61 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 62 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 66 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 67 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 68 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 69 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 70 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 71 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 72 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009988 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG | Metagenome | Rhizosphere |
| 83 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 84 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 88 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 95 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 97 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 98 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 100 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 101 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 102 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 103 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 104 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 105 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 106 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 107 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 108 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 109 | 3300023436 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.stno.R1 | Metatranscriptome | Rhizosphere |
| 110 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 111 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 113 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 115 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 117 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 168 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 169 | 3300029277 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1 | Metatranscriptome | Rhizosphere |
| 170 | 3300029285 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 | Metatranscriptome | Rhizosphere |
| 171 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 172 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 173 | 3300030762 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 174 | 3300030877 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 175 | 3300030882 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 176 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 177 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 178 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 179 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 180 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 181 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 182 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 183 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 184 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 185 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 186 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 187 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 188 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 189 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 190 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 191 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 192 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 193 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 194 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 195 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 196 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 197 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 198 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 199 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 200 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 201 | 3300032120 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 202 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 203 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 204 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 205 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 206 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 207 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 208 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 209 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 210 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 211 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 212 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 213 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 214 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 215 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 216 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 217 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 218 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 219 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 220 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 221 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 222 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 223 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 224 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 225 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 226 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 227 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 228 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 229 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 230 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 231 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 232 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 233 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 234 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 235 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 236 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 237 | 3300039145 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 | Metagenome | Unclassified |
| 238 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 239 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 240 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 241 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 242 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 243 | 3300041461 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT | Metatranscriptome | Rhizoplane |
| 244 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 245 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 246 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 247 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 248 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 249 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 250 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 251 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 252 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 253 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 254 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 255 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 256 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 257 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 258 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 259 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 260 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 261 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 262 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 263 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 264 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 265 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 266 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 300 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 301 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 302 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 303 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 304 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 305 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 306 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 307 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 308 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 309 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 310 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 311 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 312 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 313 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 314 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 315 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 316 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 317 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 318 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 319 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 320 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 321 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 322 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 323 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 324 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 325 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 326 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 327 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 328 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 329 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 330 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 331 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 332 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 333 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 334 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 335 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 336 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 359 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 360 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 361 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 369 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 370 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 371 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 372 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 373 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 374 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 384 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 385 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 386 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 387 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 388 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 389 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 390 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 391 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 392 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 393 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 394 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 395 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 396 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 397 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 398 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 399 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 400 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 401 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 402 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 403 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 404 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 405 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 406 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 407 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 408 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 409 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 410 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 411 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 412 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 413 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 414 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 415 | 3300059658 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 416 | 3300059660 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 417 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 418 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 419 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 420 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 421 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 422 | 2508501050 | Microvirga lupini Lut6 | Isolate | Nodule |
| 423 | 2508501114 | Microvirga lotononidis WSM3557 | Isolate | Nodule |
| 424 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 425 | 2523231067 | Pleomorphomonas oryzae DSM 16300 | Isolate | Unclassified |
| 426 | 2545555834 | Methylobacterium sp. WSM2598 | Isolate | Nodule |
| 427 | 2643221653 | Rhizobium sp. Root1240 | Isolate | Unclassified |
| 428 | 2643221719 | Rhizobium sp. Root274 | Isolate | Unclassified |
| 429 | 2643221733 | Bosea sp. Root381 | Isolate | Unclassified |
| 430 | 2643221734 | Bosea sp. Root670 | Isolate | Unclassified |
| 431 | 2643221736 | Bosea sp. Root483D1 | Isolate | Unclassified |
| 432 | 2671180139 | Chelativorans sp. A52C2 | Isolate | Unclassified |
| 433 | 2738541281 | Methylobacterium sp. GV094 | Isolate | Unclassified |
| 434 | 2738543031 | Pleomorphomonas sp. CF100 | Isolate | Unclassified |
| 435 | 2738543032 | Methylobacterium sp. GV104 | Isolate | Unclassified |
| 436 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 437 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 438 | 2818991272 | Rhizobium sp. SLBN-4 | Isolate | Unclassified |
| 439 | 2818991467 | Bosea vestrisii 3192 | Isolate | Unclassified |
| 440 | 2828305725 | Xanthobacter tagetidis DSM 11105 | Isolate | Unclassified |
| 441 | 2829745981 | Methylorubrum rhodinum DSM 2163 | Isolate | Rhizosphere |
| 442 | 2835312727 | Microvirga calopogonii CCBAU 65841 | Isolate | Nodule |
| 443 | 2841760612 | Bosea sp. Tri-49 | Isolate | Nodule |
| 444 | 2841911363 | Bosea caraganae RCAM04685 | Isolate | Nodule |
| 445 | 2841917233 | Bosea caraganae RCAM04680 | Isolate | Nodule |
| 446 | 2844104063 | Bosea sp. Tri-39 | Isolate | Nodule |
| 447 | 2851182111 | Bosea sp. Tri-44 | Isolate | Nodule |
| 448 | 2851246043 | Bosea sp. Tri-54 | Isolate | Nodule |
| 449 | 2854681122 | Luteovulum sphaeroides SCJ | Isolate | Unclassified |
| 450 | 2861691609 | Methylorubrum thiocyanatum DSM 11490 | Isolate | Rhizosphere |
| 451 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 452 | 2884298095 | Microvirga thermotolerans HR1 | Isolate | Rhizosphere |
| 453 | 2891088606 | Methylosinus sp. 3S-1 | Isolate | Rhizosphere |
| 454 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 455 | 2898795034 | Rhodobacter sp. SGA-6-6 | Isolate | Rhizosphere |
| 456 | 2917699015 | Bosea sp. F3-2 | Isolate | Rhizosphere |
| 457 | 2939669807 | Kaistia defluvii 3207 | Isolate | Rhizosphere |
| 458 | 2989776772 | Rhizobium glycinendophyticum CL12 | Isolate | Unclassified |
| 459 | 3003665799 | Methylobacterium aquaticum BG2 | Isolate | Unclassified |
| 460 | 641522639 | Methylobacterium sp. 4-46 | Isolate | Nodule |
| 461 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
| 462 | 8001845381 | Ancylobacter sonchi VKM B-3145 | Isolate | Unclassified |
| 463 | 8005246636 | Rhizobium wuzhouense W44 | Isolate | Rhizosphere |
| 464 | 8005658619 | Rhizobium terrae CC-HIH110 | Isolate | Unclassified |
| 465 | 8057529695 | Bosea vestrisii A18/4-2 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 83.48 |
| Metatranscriptomes | 11.74 |
| Isolates | 4.78 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.43 |
| Nodule | 1.52 |
| Rhizoplane | 2.07 |
| Rhizosphere | 80.43 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501067_0446331 | 3300049583 | Bacteria | 722 |
| 2 | RicEn_C5064 | 2010549000 | Bacteria | 1433 |
| 3 | JGI25159J45721_1010523 | 3300002987 | Bacteria | 2348 |
| 4 | Ga0006778J45830_1058666 | 3300003162 | Bacteria | 2010 |
| 5 | Ga0006759J45824_1010259 | 3300003163 | Bacteria | 1163 |
| 6 | Ga0006759J45824_1036006 | 3300003163 | Bacteria | 2458 |
| 7 | Ga0006759J45824_1123174 | 3300003163 | Bacteria | 1199 |
| 8 | JGI25151J46595_10000998 | 3300003187 | Bacteria | 21390 |
| 9 | Ga0006777J48905_1015771 | 3300003308 | Bacteria | 1518 |
| 10 | Ga0006777J48905_1026045 | 3300003308 | Bacteria | 2154 |
| 11 | Ga0006777J48905_1056620 | 3300003308 | Bacteria | 784 |
| 12 | Ga0007417J51691_1008472 | 3300003544 | Bacteria | 1430 |
| 13 | Ga0007417J51691_1016055 | 3300003544 | Bacteria | 3006 |
| 14 | Ga0007417J51691_1050143 | 3300003544 | Bacteria | 1268 |
| 15 | Ga0007410J51695_1019967 | 3300003574 | Bacteria | 3516 |
| 16 | Ga0007410J51695_1022321 | 3300003574 | Bacteria | 3797 |
| 17 | Ga0007410J51695_1045401 | 3300003574 | Bacteria | 931 |
| 18 | Ga0007416J51690_1017104 | 3300003577 | Bacteria | 1847 |
| 19 | Ga0007416J51690_1019837 | 3300003577 | Bacteria | 1301 |
| 20 | Ga0006562J51391_1021653 | 3300003578 | Bacteria | 1577 |
| 21 | Ga0007429J51699_1019329 | 3300003579 | Bacteria | 1256 |
| 22 | Ga0007429J51699_1022307 | 3300003579 | Bacteria | 1956 |
| 23 | Ga0032354_1013396 | 3300003693 | Bacteria | 1256 |
| 24 | Ga0032354_1014807 | 3300003693 | Bacteria | 2623 |
| 25 | Ga0006780_1006913 | 3300003735 | Bacteria | 1612 |
| 26 | Ga0006780_1010347 | 3300003735 | Bacteria | 1172 |
| 27 | Ga0006780_1015395 | 3300003735 | Bacteria | 1324 |
| 28 | Ga0055526_1011375 | 3300003771 | Bacteria | 4014 |
| 29 | Ga0055526_1012869 | 3300003771 | Bacteria | 3598 |
| 30 | Ga0055524_1009061 | 3300003775 | Bacteria | 4081 |
| 31 | Ga0055524_1011452 | 3300003775 | Bacteria | 3467 |
| 32 | Ga0058860_10222892 | 3300004801 | Bacteria | 1799 |
| 33 | Ga0065165_1007156 | 3300005262 | Bacteria | 5580 |
| 34 | Ga0070658_10203068 | 3300005327 | Bacteria | 1673 |
| 35 | Ga0070676_10770732 | 3300005328 | Bacteria | 708 |
| 36 | Ga0070666_11256222 | 3300005335 | Bacteria | 552 |
| 37 | Ga0070680_100239697 | 3300005336 | Bacteria | 1533 |
| 38 | Ga0070689_100067740 | 3300005340 | Bacteria | 2783 |
| 39 | Ga0070668_100019774 | 3300005347 | Bacteria | 5071 |
| 40 | Ga0070668_100924570 | 3300005347 | Bacteria | 781 |
| 41 | Ga0070669_100430150 | 3300005353 | Bacteria | 1085 |
| 42 | Ga0070674_100521485 | 3300005356 | Bacteria | 993 |
| 43 | Ga0070659_100255557 | 3300005366 | Bacteria | 1453 |
| 44 | Ga0070659_101292119 | 3300005366 | Bacteria | 647 |
| 45 | Ga0070667_100033801 | 3300005367 | Bacteria | 4277 |
| 46 | Ga0070667_100426348 | 3300005367 | Bacteria | 1210 |
| 47 | Ga0070709_10338542 | 3300005434 | Bacteria | 1109 |
| 48 | Ga0070709_10525039 | 3300005434 | Bacteria | 902 |
| 49 | Ga0070714_100380545 | 3300005435 | Bacteria | 1331 |
| 50 | Ga0070714_100413833 | 3300005435 | Bacteria | 1276 |
| 51 | Ga0070714_100816354 | 3300005435 | Bacteria | 904 |
| 52 | Ga0070714_100896845 | 3300005435 | Bacteria | 861 |
| 53 | Ga0070713_100073081 | 3300005436 | Bacteria | 2902 |
| 54 | Ga0070713_100379555 | 3300005436 | Bacteria | 1317 |
| 55 | Ga0070713_100393778 | 3300005436 | Bacteria | 1293 |
| 56 | Ga0070713_101574583 | 3300005436 | Bacteria | 638 |
| 57 | Ga0070710_10019419 | 3300005437 | Bacteria | 3512 |
| 58 | Ga0070710_10474792 | 3300005437 | Bacteria | 852 |
| 59 | Ga0070701_10531009 | 3300005438 | Bacteria | 769 |
| 60 | Ga0070711_100077038 | 3300005439 | Bacteria | 2365 |
| 61 | Ga0070700_100105136 | 3300005441 | Bacteria | 1866 |
| 62 | Ga0070678_101049927 | 3300005456 | Bacteria | 751 |
| 63 | Ga0070681_10289924 | 3300005458 | Bacteria | 1547 |
| 64 | Ga0070681_10391849 | 3300005458 | Bacteria | 1300 |
| 65 | Ga0070681_11149290 | 3300005458 | Bacteria | 698 |
| 66 | Ga0068867_100984532 | 3300005459 | Bacteria | 764 |
| 67 | Ga0070706_100121868 | 3300005467 | Bacteria | 2431 |
| 68 | Ga0070707_100060990 | 3300005468 | Bacteria | 3617 |
| 69 | Ga0070707_100613211 | 3300005468 | Bacteria | 1051 |
| 70 | Ga0070698_100610978 | 3300005471 | Bacteria | 1031 |
| 71 | Ga0070699_100401774 | 3300005518 | Bacteria | 1239 |
| 72 | Ga0070679_100531560 | 3300005530 | Bacteria | 1120 |
| 73 | Ga0070679_100576523 | 3300005530 | Bacteria | 1069 |
| 74 | Ga0070679_100886680 | 3300005530 | Bacteria | 835 |
| 75 | Ga0070679_101263957 | 3300005530 | Bacteria | 684 |
| 76 | Ga0070684_101174139 | 3300005535 | Bacteria | 722 |
| 77 | Ga0070697_100196869 | 3300005536 | Bacteria | 1712 |
| 78 | Ga0070695_100164130 | 3300005545 | Bacteria | 1562 |
| 79 | Ga0070665_100137672 | 3300005548 | Bacteria | 2444 |
| 80 | Ga0070664_100156019 | 3300005564 | Bacteria | 2017 |
| 81 | Ga0068857_101036085 | 3300005577 | Bacteria | 791 |
| 82 | Ga0068857_101065576 | 3300005577 | Bacteria | 780 |
| 83 | Ga0068854_100224472 | 3300005578 | Bacteria | 1488 |
| 84 | Ga0068856_100777101 | 3300005614 | Bacteria | 978 |
| 85 | Ga0068852_101147338 | 3300005616 | Bacteria | 798 |
| 86 | Ga0068864_100895908 | 3300005618 | Bacteria | 876 |
| 87 | Ga0068870_10071526 | 3300005840 | Bacteria | 1893 |
| 88 | Ga0068863_100024921 | 3300005841 | Bacteria | 5706 |
| 89 | Ga0068863_100392322 | 3300005841 | Bacteria | 1357 |
| 90 | Ga0068863_101725029 | 3300005841 | Bacteria | 636 |
| 91 | Ga0068858_100240777 | 3300005842 | Bacteria | 1717 |
| 92 | Ga0081455_10365467 | 3300005937 | Bacteria | 1013 |
| 93 | Ga0081539_10326545 | 3300005985 | Bacteria | 651 |
| 94 | Ga0070717_10135885 | 3300006028 | Bacteria | 2117 |
| 95 | Ga0070717_10308617 | 3300006028 | Bacteria | 1408 |
| 96 | Ga0070717_10593615 | 3300006028 | Bacteria | 1004 |
| 97 | Ga0075365_10161632 | 3300006038 | Bacteria | 1560 |
| 98 | Ga0075363_100077170 | 3300006048 | Bacteria | 1818 |
| 99 | Ga0075363_100282314 | 3300006048 | Bacteria | 961 |
| 100 | Ga0070715_10558697 | 3300006163 | Bacteria | 665 |
| 101 | Ga0070715_10636192 | 3300006163 | Bacteria | 630 |
| 102 | Ga0070715_10775470 | 3300006163 | Bacteria | 580 |
| 103 | Ga0070716_100348996 | 3300006173 | Bacteria | 1047 |
| 104 | Ga0070716_100894887 | 3300006173 | Bacteria | 695 |
| 105 | Ga0070712_100129215 | 3300006175 | Bacteria | 1913 |
| 106 | Ga0070712_100232534 | 3300006175 | Bacteria | 1465 |
| 107 | Ga0070712_100315018 | 3300006175 | Bacteria | 1271 |
| 108 | Ga0075362_10091023 | 3300006177 | Bacteria | 1416 |
| 109 | Ga0075362_10184951 | 3300006177 | Bacteria | 1010 |
| 110 | Ga0075367_10460000 | 3300006178 | Bacteria | 806 |
| 111 | Ga0075366_10106372 | 3300006195 | Bacteria | 1686 |
| 112 | Ga0075366_10498497 | 3300006195 | Bacteria | 753 |
| 113 | Ga0075428_100375428 | 3300006844 | Bacteria | 1524 |
| 114 | Ga0075430_100066186 | 3300006846 | Bacteria | 3034 |
| 115 | Ga0075431_100109846 | 3300006847 | Bacteria | 2846 |
| 116 | Ga0099795_10000098 | 3300007788 | Bacteria | 14585 |
| 117 | Ga0105240_10792336 | 3300009093 | Bacteria | 1027 |
| 118 | Ga0105240_10878810 | 3300009093 | Bacteria | 966 |
| 119 | Ga0111539_10139589 | 3300009094 | Bacteria | 2838 |
| 120 | Ga0111539_10625731 | 3300009094 | Bacteria | 1253 |
| 121 | Ga0105245_10709312 | 3300009098 | Bacteria | 1040 |
| 122 | Ga0105245_11084031 | 3300009098 | Bacteria | 847 |
| 123 | Ga0105247_10609493 | 3300009101 | Bacteria | 811 |
| 124 | Ga0114129_10357308 | 3300009147 | Bacteria | 1934 |
| 125 | Ga0114129_11314695 | 3300009147 | Bacteria | 895 |
| 126 | Ga0105243_10593529 | 3300009148 | Bacteria | 1065 |
| 127 | Ga0105248_10036522 | 3300009177 | Bacteria | 5496 |
| 128 | Ga0105248_11389846 | 3300009177 | Bacteria | 794 |
| 129 | Ga0105248_12180919 | 3300009177 | Bacteria | 630 |
| 130 | Ga0105237_10587943 | 3300009545 | Bacteria | 1120 |
| 131 | Ga0105238_10105938 | 3300009551 | Bacteria | 2793 |
| 132 | Ga0105238_10400601 | 3300009551 | Bacteria | 1365 |
| 133 | Ga0105249_10475539 | 3300009553 | Bacteria | 1291 |
| 134 | Ga0105249_10679734 | 3300009553 | Bacteria | 1088 |
| 135 | Ga0105035_109896 | 3300009988 | Bacteria | 831 |
| 136 | Ga0099796_10008991 | 3300010159 | Bacteria | 2685 |
| 137 | Ga0105239_10384331 | 3300010375 | Bacteria | 1587 |
| 138 | Ga0105239_10775093 | 3300010375 | Bacteria | 1098 |
| 139 | Ga0105239_10959790 | 3300010375 | Bacteria | 982 |
| 140 | Ga0105239_11194822 | 3300010375 | Bacteria | 876 |
| 141 | Ga0105246_10067496 | 3300011119 | Bacteria | 2506 |
| 142 | Ga0105246_10504559 | 3300011119 | Bacteria | 1028 |
| 143 | Ga0157369_11858569 | 3300013105 | Bacteria | 611 |
| 144 | Ga0171462_1060 | 3300013250 | Bacteria | 19065 |
| 145 | Ga0157374_10597224 | 3300013296 | Bacteria | 1114 |
| 146 | Ga0157374_11976697 | 3300013296 | Bacteria | 609 |
| 147 | Ga0157378_11985598 | 3300013297 | Bacteria | 631 |
| 148 | Ga0163162_10749374 | 3300013306 | Bacteria | 1096 |
| 149 | Ga0163162_10791098 | 3300013306 | Bacteria | 1066 |
| 150 | Ga0163162_10853178 | 3300013306 | Bacteria | 1026 |
| 151 | Ga0157372_10005461 | 3300013307 | Bacteria | 13506 |
| 152 | Ga0157372_10836403 | 3300013307 | Bacteria | 1069 |
| 153 | Ga0157372_12202194 | 3300013307 | Bacteria | 633 |
| 154 | Ga0163163_10282390 | 3300014325 | Bacteria | 1712 |
| 155 | Ga0163163_10963239 | 3300014325 | Bacteria | 917 |
| 156 | Ga0163163_11259345 | 3300014325 | Bacteria | 802 |
| 157 | Ga0157380_10073797 | 3300014326 | Bacteria | 2768 |
| 158 | Ga0182008_10071381 | 3300014497 | Bacteria | 1708 |
| 159 | Ga0157379_10408576 | 3300014968 | Bacteria | 1249 |
| 160 | Ga0157379_10871156 | 3300014968 | Bacteria | 853 |
| 161 | Ga0182005_1011902 | 3300015265 | Bacteria | 2467 |
| 162 | Ga0182005_1030841 | 3300015265 | Bacteria | 1461 |
| 163 | Ga0197907_10383026 | 3300020069 | Bacteria | 961 |
| 164 | Ga0197907_10611404 | 3300020069 | Bacteria | 656 |
| 165 | Ga0206356_10203437 | 3300020070 | Bacteria | 1668 |
| 166 | Ga0206356_11041350 | 3300020070 | Bacteria | 991 |
| 167 | Ga0206352_11316727 | 3300020078 | Bacteria | 1036 |
| 168 | Ga0206350_10361844 | 3300020080 | Bacteria | 1408 |
| 169 | Ga0206350_10871634 | 3300020080 | Bacteria | 2162 |
| 170 | Ga0206354_10418299 | 3300020081 | Bacteria | 2523 |
| 171 | Ga0206354_11461142 | 3300020081 | Bacteria | 576 |
| 172 | Ga0213873_10032527 | 3300021358 | Bacteria | 1304 |
| 173 | Ga0213873_10083012 | 3300021358 | Bacteria | 899 |
| 174 | Ga0213872_10002583 | 3300021361 | Bacteria | 10542 |
| 175 | Ga0213872_10018648 | 3300021361 | Bacteria | 3198 |
| 176 | Ga0213872_10076120 | 3300021361 | Bacteria | 1510 |
| 177 | Ga0213872_10120365 | 3300021361 | Bacteria | 1161 |
| 178 | Ga0213872_10269602 | 3300021361 | Bacteria | 713 |
| 179 | Ga0213874_10004974 | 3300021377 | Bacteria | 3070 |
| 180 | Ga0213876_10032089 | 3300021384 | Bacteria | 2770 |
| 181 | Ga0213876_10187793 | 3300021384 | Bacteria | 1099 |
| 182 | Ga0213876_10291478 | 3300021384 | Bacteria | 867 |
| 183 | Ga0213875_10001918 | 3300021388 | Bacteria | 12881 |
| 184 | Ga0213875_10009354 | 3300021388 | Bacteria | 4971 |
| 185 | Ga0213875_10027997 | 3300021388 | Bacteria | 2680 |
| 186 | Ga0213875_10028201 | 3300021388 | Bacteria | 2668 |
| 187 | Ga0213875_10032543 | 3300021388 | Bacteria | 2463 |
| 188 | Ga0213875_10378324 | 3300021388 | Bacteria | 674 |
| 189 | Ga0213871_10001835 | 3300021441 | Bacteria | 3726 |
| 190 | Ga0213871_10027643 | 3300021441 | Bacteria | 1458 |
| 191 | Ga0213871_10057008 | 3300021441 | Bacteria | 1082 |
| 192 | Ga0224712_10051833 | 3300022467 | Bacteria | 1600 |
| 193 | Ga0224712_10117759 | 3300022467 | Bacteria | 1147 |
| 194 | Ga0224712_10182396 | 3300022467 | Bacteria | 946 |
| 195 | Ga0224712_10463085 | 3300022467 | Bacteria | 610 |
| 196 | Ga0256743_109706 | 3300023436 | Bacteria | 1488 |
| 197 | Ga0209673_1081273 | 3300025273 | Bacteria | 742 |
| 198 | Ga0209130_1000845 | 3300025284 | Bacteria | 25573 |
| 199 | Ga0209130_1025254 | 3300025284 | Bacteria | 1288 |
| 200 | Ga0209675_1000772 | 3300025291 | Bacteria | 21411 |
| 201 | Ga0209025_1005170 | 3300025294 | Bacteria | 10795 |
| 202 | Ga0209025_1007328 | 3300025294 | Bacteria | 8263 |
| 203 | Ga0209564_1002904 | 3300025295 | Bacteria | 12487 |
| 204 | Ga0209564_1002939 | 3300025295 | Bacteria | 12377 |
| 205 | Ga0209758_1036517 | 3300025297 | Bacteria | 1916 |
| 206 | Ga0209758_1051119 | 3300025297 | Bacteria | 1442 |
| 207 | Ga0209256_1003845 | 3300025299 | Bacteria | 10043 |
| 208 | Ga0209256_1005787 | 3300025299 | Bacteria | 6896 |
| 209 | Ga0207692_10013314 | 3300025898 | Bacteria | 3564 |
| 210 | Ga0207692_10609215 | 3300025898 | Bacteria | 703 |
| 211 | Ga0207688_10521182 | 3300025901 | Bacteria | 745 |
| 212 | Ga0207680_10737050 | 3300025903 | Bacteria | 706 |
| 213 | Ga0207685_10588991 | 3300025905 | Bacteria | 596 |
| 214 | Ga0207699_10218643 | 3300025906 | Bacteria | 1299 |
| 215 | Ga0207699_10675872 | 3300025906 | Bacteria | 755 |
| 216 | Ga0207699_10998311 | 3300025906 | Bacteria | 619 |
| 217 | Ga0207645_10546980 | 3300025907 | Bacteria | 785 |
| 218 | Ga0207643_10103238 | 3300025908 | Bacteria | 1673 |
| 219 | Ga0207705_10891198 | 3300025909 | Bacteria | 689 |
| 220 | Ga0207705_11113445 | 3300025909 | Bacteria | 608 |
| 221 | Ga0207684_10095939 | 3300025910 | Bacteria | 2531 |
| 222 | Ga0207707_10198389 | 3300025912 | Bacteria | 1750 |
| 223 | Ga0207707_10366673 | 3300025912 | Bacteria | 1240 |
| 224 | Ga0207695_10715029 | 3300025913 | Bacteria | 882 |
| 225 | Ga0207695_11075944 | 3300025913 | Bacteria | 684 |
| 226 | Ga0207671_10315534 | 3300025914 | Bacteria | 1236 |
| 227 | Ga0207693_10124923 | 3300025915 | Bacteria | 2022 |
| 228 | Ga0207693_10144611 | 3300025915 | Bacteria | 1870 |
| 229 | Ga0207693_10199267 | 3300025915 | Bacteria | 1574 |
| 230 | Ga0207663_10131537 | 3300025916 | Bacteria | 1730 |
| 231 | Ga0207663_10550741 | 3300025916 | Bacteria | 902 |
| 232 | Ga0207663_10969186 | 3300025916 | Bacteria | 681 |
| 233 | Ga0207660_10206444 | 3300025917 | Bacteria | 1537 |
| 234 | Ga0207660_10347288 | 3300025917 | Bacteria | 1189 |
| 235 | Ga0207660_10832786 | 3300025917 | Bacteria | 753 |
| 236 | Ga0207662_10113149 | 3300025918 | Bacteria | 1694 |
| 237 | Ga0207657_11212994 | 3300025919 | Bacteria | 573 |
| 238 | Ga0207652_10207524 | 3300025921 | Bacteria | 1764 |
| 239 | Ga0207652_10436251 | 3300025921 | Bacteria | 1181 |
| 240 | Ga0207652_10777551 | 3300025921 | Bacteria | 851 |
| 241 | Ga0207646_10041541 | 3300025922 | Bacteria | 4134 |
| 242 | Ga0207681_10411382 | 3300025923 | Bacteria | 1094 |
| 243 | Ga0207694_10261783 | 3300025924 | Bacteria | 1417 |
| 244 | Ga0207694_10795736 | 3300025924 | Bacteria | 799 |
| 245 | Ga0207650_11273067 | 3300025925 | Bacteria | 626 |
| 246 | Ga0207687_10596062 | 3300025927 | Bacteria | 931 |
| 247 | Ga0207700_10063660 | 3300025928 | Bacteria | 2806 |
| 248 | Ga0207700_10319205 | 3300025928 | Bacteria | 1346 |
| 249 | Ga0207700_10395123 | 3300025928 | Bacteria | 1211 |
| 250 | Ga0207700_10435950 | 3300025928 | Bacteria | 1153 |
| 251 | Ga0207700_10453425 | 3300025928 | Bacteria | 1131 |
| 252 | Ga0207700_10648018 | 3300025928 | Bacteria | 942 |
| 253 | Ga0207700_10909394 | 3300025928 | Bacteria | 788 |
| 254 | Ga0207700_11177486 | 3300025928 | Bacteria | 684 |
| 255 | Ga0207664_10179857 | 3300025929 | Bacteria | 1815 |
| 256 | Ga0207664_10726553 | 3300025929 | Bacteria | 893 |
| 257 | Ga0207706_10089938 | 3300025933 | Bacteria | 2699 |
| 258 | Ga0207670_10160779 | 3300025936 | Bacteria | 1676 |
| 259 | Ga0207704_11034849 | 3300025938 | Bacteria | 696 |
| 260 | Ga0207665_10361693 | 3300025939 | Bacteria | 1097 |
| 261 | Ga0207665_10420865 | 3300025939 | Bacteria | 1020 |
| 262 | Ga0207665_10871307 | 3300025939 | Bacteria | 713 |
| 263 | Ga0207691_10617462 | 3300025940 | Bacteria | 917 |
| 264 | Ga0207711_10020060 | 3300025941 | Bacteria | 5571 |
| 265 | Ga0207679_10029035 | 3300025945 | Bacteria | 3847 |
| 266 | Ga0207651_10520223 | 3300025960 | Bacteria | 1031 |
| 267 | Ga0207668_10083868 | 3300025972 | Bacteria | 2320 |
| 268 | Ga0207668_10552746 | 3300025972 | Bacteria | 997 |
| 269 | Ga0207640_10298155 | 3300025981 | Bacteria | 1274 |
| 270 | Ga0207640_10340165 | 3300025981 | Bacteria | 1202 |
| 271 | Ga0207658_10038859 | 3300025986 | Bacteria | 3432 |
| 272 | Ga0207658_10300857 | 3300025986 | Bacteria | 1382 |
| 273 | Ga0207658_10352452 | 3300025986 | Bacteria | 1282 |
| 274 | Ga0207677_10902636 | 3300026023 | Bacteria | 797 |
| 275 | Ga0207639_10361938 | 3300026041 | Bacteria | 1298 |
| 276 | Ga0207678_10512373 | 3300026067 | Bacteria | 1046 |
| 277 | Ga0207678_11043344 | 3300026067 | Bacteria | 724 |
| 278 | Ga0207708_10054496 | 3300026075 | Bacteria | 3049 |
| 279 | Ga0207702_10093097 | 3300026078 | Bacteria | 2643 |
| 280 | Ga0207702_12091273 | 3300026078 | Bacteria | 556 |
| 281 | Ga0207641_10018124 | 3300026088 | Bacteria | 5769 |
| 282 | Ga0207641_10604434 | 3300026088 | Bacteria | 1074 |
| 283 | Ga0207641_10616124 | 3300026088 | Bacteria | 1064 |
| 284 | Ga0207676_10916968 | 3300026095 | Bacteria | 860 |
| 285 | Ga0207674_10665836 | 3300026116 | Bacteria | 1005 |
| 286 | Ga0207674_11511019 | 3300026116 | Bacteria | 641 |
| 287 | Ga0207674_11580544 | 3300026116 | Bacteria | 624 |
| 288 | Ga0207675_101143321 | 3300026118 | Bacteria | 799 |
| 289 | Ga0207683_10648280 | 3300026121 | Bacteria | 978 |
| 290 | Ga0207698_12136976 | 3300026142 | Bacteria | 573 |
| 291 | Ga0209371_1042358 | 3300027312 | Bacteria | 916 |
| 292 | Ga0268266_10241074 | 3300028379 | Bacteria | 1669 |
| 293 | Ga0268266_10944114 | 3300028379 | Bacteria | 834 |
| 294 | Ga0268266_11425066 | 3300028379 | Bacteria | 668 |
| 295 | Ga0268265_10997427 | 3300028380 | Bacteria | 827 |
| 296 | Ga0268265_11120573 | 3300028380 | Bacteria | 782 |
| 297 | Ga0307515_10161055 | 3300028794 | Bacteria | 2288 |
| 298 | Ga0265338_10094319 | 3300028800 | Bacteria | 2462 |
| 299 | Ga0311001_1093816 | 3300029277 | Bacteria | 1764 |
| 300 | Ga0310981_1015680 | 3300029285 | Bacteria | 956 |
| 301 | Ga0268256_1038117 | 3300030500 | Bacteria | 1096 |
| 302 | Ga0265762_1107797 | 3300030760 | Bacteria | 624 |
| 303 | Ga0265775_107056 | 3300030762 | Bacteria | 669 |
| 304 | Ga0265777_112116 | 3300030877 | Bacteria | 648 |
| 305 | Ga0265764_109349 | 3300030882 | Bacteria | 604 |
| 306 | Ga0265330_10022775 | 3300031235 | Bacteria | 2850 |
| 307 | Ga0265328_10000059 | 3300031239 | Bacteria | 65115 |
| 308 | Ga0265328_10003554 | 3300031239 | Bacteria | 6873 |
| 309 | Ga0265328_10009974 | 3300031239 | Bacteria | 3842 |
| 310 | Ga0265320_10206266 | 3300031240 | Bacteria | 877 |
| 311 | Ga0265325_10073142 | 3300031241 | Bacteria | 1717 |
| 312 | Ga0265325_10242556 | 3300031241 | Bacteria | 818 |
| 313 | Ga0265329_10007573 | 3300031242 | Bacteria | 4185 |
| 314 | Ga0265329_10098760 | 3300031242 | Bacteria | 929 |
| 315 | Ga0265340_10001769 | 3300031247 | Bacteria | 12330 |
| 316 | Ga0265340_10009506 | 3300031247 | Bacteria | 5214 |
| 317 | Ga0265340_10029175 | 3300031247 | Bacteria | 2771 |
| 318 | Ga0265340_10041235 | 3300031247 | Bacteria | 2270 |
| 319 | Ga0265340_10066138 | 3300031247 | Bacteria | 1721 |
| 320 | Ga0265340_10066458 | 3300031247 | Bacteria | 1716 |
| 321 | Ga0265340_10078146 | 3300031247 | Bacteria | 1561 |
| 322 | Ga0265339_10002133 | 3300031249 | Bacteria | 14410 |
| 323 | Ga0265339_10168920 | 3300031249 | Bacteria | 1096 |
| 324 | Ga0265339_10171865 | 3300031249 | Bacteria | 1084 |
| 325 | Ga0265331_10000308 | 3300031250 | Bacteria | 53310 |
| 326 | Ga0265331_10001760 | 3300031250 | Bacteria | 15552 |
| 327 | Ga0265331_10006977 | 3300031250 | Bacteria | 6596 |
| 328 | Ga0265331_10095207 | 3300031250 | Bacteria | 1374 |
| 329 | Ga0265331_10101386 | 3300031250 | Bacteria | 1324 |
| 330 | Ga0265331_10227157 | 3300031250 | Bacteria | 838 |
| 331 | Ga0265331_10245082 | 3300031250 | Bacteria | 804 |
| 332 | Ga0265327_10066223 | 3300031251 | Bacteria | 1824 |
| 333 | Ga0265316_10000404 | 3300031344 | Bacteria | 49263 |
| 334 | Ga0265316_10037483 | 3300031344 | Bacteria | 3912 |
| 335 | Ga0265316_10049992 | 3300031344 | Bacteria | 3290 |
| 336 | Ga0307408_100093348 | 3300031548 | Bacteria | 2276 |
| 337 | Ga0265313_10000031 | 3300031595 | Bacteria | 128981 |
| 338 | Ga0265313_10013098 | 3300031595 | Bacteria | 5004 |
| 339 | Ga0265313_10057452 | 3300031595 | Bacteria | 1836 |
| 340 | Ga0265313_10059699 | 3300031595 | Bacteria | 1793 |
| 341 | Ga0316575_10106890 | 3300031665 | Bacteria | 1140 |
| 342 | Ga0316575_10111151 | 3300031665 | Bacteria | 1118 |
| 343 | Ga0316579_10599125 | 3300031691 | Bacteria | 533 |
| 344 | Ga0265314_10158338 | 3300031711 | Bacteria | 1381 |
| 345 | Ga0265314_10282545 | 3300031711 | Bacteria | 938 |
| 346 | Ga0265314_10303630 | 3300031711 | Bacteria | 894 |
| 347 | Ga0265342_10008958 | 3300031712 | Bacteria | 7108 |
| 348 | Ga0265342_10177718 | 3300031712 | Bacteria | 1167 |
| 349 | Ga0307405_10397878 | 3300031731 | Bacteria | 1077 |
| 350 | Ga0316577_10191409 | 3300031733 | Bacteria | 1156 |
| 351 | Ga0307413_10311709 | 3300031824 | Bacteria | 1198 |
| 352 | Ga0307410_10074475 | 3300031852 | Bacteria | 2364 |
| 353 | Ga0307410_10710815 | 3300031852 | Bacteria | 848 |
| 354 | Ga0307406_10083248 | 3300031901 | Bacteria | 2133 |
| 355 | Ga0307407_10032572 | 3300031903 | Bacteria | 2835 |
| 356 | Ga0307409_100258466 | 3300031995 | Bacteria | 1596 |
| 357 | Ga0307409_101369555 | 3300031995 | Bacteria | 733 |
| 358 | Ga0307416_100083180 | 3300032002 | Bacteria | 2714 |
| 359 | Ga0307416_101335304 | 3300032002 | Bacteria | 823 |
| 360 | Ga0307414_10074675 | 3300032004 | Bacteria | 2457 |
| 361 | Ga0316053_105404 | 3300032120 | Bacteria | 810 |
| 362 | Ga0316593_10192369 | 3300032168 | Bacteria | 752 |
| 363 | Ga0316592_1031860 | 3300033524 | Bacteria | 1149 |
| 364 | Ga0373926_0299024 | 3300035083 | Bacteria | 628 |
| 365 | Ga0373934_0017524 | 3300035086 | Bacteria | 2735 |
| 366 | Ga0373944_0359541 | 3300035089 | Bacteria | 555 |
| 367 | Ga0373923_0114545 | 3300035111 | Bacteria | 1200 |
| 368 | Ga0373932_0141670 | 3300035112 | Bacteria | 818 |
| 369 | Ga0373936_0049000 | 3300035113 | Bacteria | 1706 |
| 370 | Ga0373936_0195525 | 3300035113 | Bacteria | 891 |
| 371 | Ga0373945_0077986 | 3300035116 | Bacteria | 1265 |
| 372 | Ga0373953_0028142 | 3300035117 | Bacteria | 2165 |
| 373 | Ga0373954_0128876 | 3300035118 | Bacteria | 1231 |
| 374 | Ga0373954_0265130 | 3300035118 | Bacteria | 846 |
| 375 | Ga0373956_0207539 | 3300035119 | Bacteria | 929 |
| 376 | Ga0373943_0000918 | 3300035170 | Bacteria | 12966 |
| 377 | Ga0373943_0125014 | 3300035170 | Bacteria | 1371 |
| 378 | Ga0373943_0128930 | 3300035170 | Bacteria | 1352 |
| 379 | Ga0373943_0257746 | 3300035170 | Bacteria | 981 |
| 380 | Ga0373943_0569076 | 3300035170 | Bacteria | 666 |
| 381 | Ga0373946_0026916 | 3300035171 | Bacteria | 2272 |
| 382 | Ga0373946_0169640 | 3300035171 | Bacteria | 1029 |
| 383 | Ga0373946_0405871 | 3300035171 | Bacteria | 688 |
| 384 | Ga0373955_0664028 | 3300035172 | Bacteria | 639 |
| 385 | Ga0316574_0017432 | 3300035398 | Bacteria | 4203 |
| 386 | Ga0316574_0621674 | 3300035398 | Bacteria | 666 |
| 387 | Ga0373924_0011533 | 3300035410 | Bacteria | 3285 |
| 388 | Ga0373924_0070759 | 3300035410 | Bacteria | 1471 |
| 389 | Ga0373924_0115263 | 3300035410 | Bacteria | 1164 |
| 390 | Ga0373931_0240750 | 3300035691 | Bacteria | 1097 |
| 391 | Ga0373931_0739310 | 3300035691 | Bacteria | 652 |
| 392 | Ga0373935_0021700 | 3300035692 | Bacteria | 3933 |
| 393 | Ga0373935_0139794 | 3300035692 | Bacteria | 1635 |
| 394 | Ga0373927_0101308 | 3300035695 | Bacteria | 1873 |
| 395 | Ga0373927_0160772 | 3300035695 | Bacteria | 1471 |
| 396 | Ga0373927_0306658 | 3300035695 | Bacteria | 1045 |
| 397 | Ga0373927_0440609 | 3300035695 | Bacteria | 860 |
| 398 | Ga0373927_0450316 | 3300035695 | Bacteria | 850 |
| 399 | Ga0373933_0026815 | 3300035724 | Bacteria | 3312 |
| 400 | Ga0373933_0340849 | 3300035724 | Bacteria | 973 |
| 401 | Ga0373947_0018231 | 3300035725 | Bacteria | 4040 |
| 402 | Ga0373947_0032321 | 3300035725 | Bacteria | 3083 |
| 403 | Ga0373947_0217781 | 3300035725 | Bacteria | 1254 |
| 404 | Ga0373947_1020119 | 3300035725 | Bacteria | 564 |
| 405 | Ga0373937_0000922 | 3300036401 | Bacteria | 24939 |
| 406 | Ga0373937_0046989 | 3300036401 | Bacteria | 3948 |
| 407 | Ga0373937_0123067 | 3300036401 | Bacteria | 2418 |
| 408 | Ga0373937_0195480 | 3300036401 | Bacteria | 1901 |
| 409 | Ga0373937_0408826 | 3300036401 | Bacteria | 1288 |
| 410 | Ga0373937_0410148 | 3300036401 | Bacteria | 1285 |
| 411 | Ga0373937_0581629 | 3300036401 | Bacteria | 1063 |
| 412 | Ga0373937_1379960 | 3300036401 | Bacteria | 652 |
| 413 | Ga0373937_1600044 | 3300036401 | Bacteria | 599 |
| 414 | Ga0265778_028515 | 3300036457 | Bacteria | 715 |
| 415 | Ga0316582_0611377 | 3300036647 | Bacteria | 750 |
| 416 | Ga0316584_0099898 | 3300036712 | Bacteria | 2173 |
| 417 | Ga0316584_0646624 | 3300036712 | Bacteria | 729 |
| 418 | Ga0373925_0020230 | 3300037068 | Bacteria | 4843 |
| 419 | Ga0373925_0038166 | 3300037068 | Bacteria | 3550 |
| 420 | Ga0373925_0065943 | 3300037068 | Bacteria | 2728 |
| 421 | Ga0373925_0478968 | 3300037068 | Bacteria | 1021 |
| 422 | Ga0373925_0600246 | 3300037068 | Bacteria | 907 |
| 423 | Ga0373925_1228752 | 3300037068 | Bacteria | 615 |
| 424 | Ga0395900_0364481 | 3300037418 | Bacteria | 1416 |
| 425 | Ga0395900_0696059 | 3300037418 | Bacteria | 950 |
| 426 | Ga0395898_0261061 | 3300037466 | Bacteria | 1652 |
| 427 | Ga0395905_0047110 | 3300037471 | Bacteria | 4042 |
| 428 | Ga0395905_0077750 | 3300037471 | Bacteria | 3109 |
| 429 | Ga0436364_0026312 | 3300037853 | Bacteria | 5505 |
| 430 | Ga0436364_0067153 | 3300037853 | Bacteria | 5031 |
| 431 | Ga0436364_0136064 | 3300037853 | Bacteria | 4467 |
| 432 | Ga0436364_0262364 | 3300037853 | Bacteria | 1847 |
| 433 | Ga0436364_0311741 | 3300037853 | Bacteria | 910 |
| 434 | Ga0436364_0389284 | 3300037853 | Bacteria | 5767 |
| 435 | Ga0436364_0496103 | 3300037853 | Bacteria | 1098 |
| 436 | Ga0436364_0552456 | 3300037853 | Bacteria | 2075 |
| 437 | Ga0436364_0574640 | 3300037853 | Bacteria | 5763 |
| 438 | Ga0436364_0784007 | 3300037853 | Bacteria | 675 |
| 439 | Ga0436364_0821174 | 3300037853 | Bacteria | 920 |
| 440 | Ga0436364_0912738 | 3300037853 | Bacteria | 996 |
| 441 | Ga0436364_1142408 | 3300037853 | Bacteria | 642 |
| 442 | Ga0436364_1247484 | 3300037853 | Bacteria | 685 |
| 443 | Ga0436364_1361457 | 3300037853 | Bacteria | 519 |
| 444 | Ga0395901_0400536 | 3300038443 | Bacteria | 1410 |
| 445 | Ga0242420_128757 | 3300038996 | Bacteria | 557 |
| 446 | Ga0400483_032406 | 3300039062 | Bacteria | 1974 |
| 447 | Ga0400483_033097 | 3300039062 | Bacteria | 5512 |
| 448 | Ga0400483_052164 | 3300039062 | Bacteria | 5619 |
| 449 | Ga0400483_186097 | 3300039062 | Bacteria | 4414 |
| 450 | Ga0400483_211902 | 3300039062 | Bacteria | 6572 |
| 451 | Ga0400489_88380 | 3300039093 | Bacteria | 13920 |
| 452 | Ga0237816_06353 | 3300039145 | Bacteria | 768 |
| 453 | Ga0436365_0099132 | 3300039437 | Bacteria | 546 |
| 454 | Ga0436365_0101855 | 3300039437 | Bacteria | 1126 |
| 455 | Ga0436365_0134618 | 3300039437 | Bacteria | 2905 |
| 456 | Ga0436365_0350875 | 3300039437 | Bacteria | 1007 |
| 457 | Ga0436365_0432071 | 3300039437 | Bacteria | 1437 |
| 458 | Ga0436365_0455844 | 3300039437 | Bacteria | 5484 |
| 459 | Ga0436365_0877254 | 3300039437 | Bacteria | 1111 |
| 460 | Ga0436365_0941632 | 3300039437 | Bacteria | 706 |
| 461 | Ga0436365_1188082 | 3300039437 | Bacteria | 881 |
| 462 | Ga0436365_1377575 | 3300039437 | Bacteria | 1390 |
| 463 | Ga0436365_1506243 | 3300039437 | Bacteria | 598 |
| 464 | Ga0436365_1630350 | 3300039437 | Bacteria | 686 |
| 465 | Ga0436360_0132547 | 3300039438 | Bacteria | 1471 |
| 466 | Ga0436360_0354756 | 3300039438 | Bacteria | 1315 |
| 467 | Ga0436360_0412700 | 3300039438 | Bacteria | 556 |
| 468 | Ga0436360_0482190 | 3300039438 | Bacteria | 3156 |
| 469 | Ga0436360_0642530 | 3300039438 | Bacteria | 2669 |
| 470 | Ga0436360_0691728 | 3300039438 | Bacteria | 1496 |
| 471 | Ga0436360_0692134 | 3300039438 | Bacteria | 543 |
| 472 | Ga0436360_0712565 | 3300039438 | Bacteria | 2242 |
| 473 | Ga0436360_0750634 | 3300039438 | Bacteria | 991 |
| 474 | Ga0436360_0762232 | 3300039438 | Bacteria | 1895 |
| 475 | Ga0436360_0820467 | 3300039438 | Bacteria | 1864 |
| 476 | Ga0436360_0922519 | 3300039438 | Bacteria | 1058 |
| 477 | Ga0436360_1045531 | 3300039438 | Bacteria | 1875 |
| 478 | Ga0436360_1046148 | 3300039438 | Bacteria | 541 |
| 479 | Ga0436360_1049092 | 3300039438 | Bacteria | 808 |
| 480 | Ga0436360_1158442 | 3300039438 | Bacteria | 2129 |
| 481 | Ga0436360_1163812 | 3300039438 | Bacteria | 1225 |
| 482 | Ga0436360_1267009 | 3300039438 | Bacteria | 1074 |
| 483 | Ga0436360_1300469 | 3300039438 | Bacteria | 1171 |
| 484 | Ga0436361_0073048 | 3300039447 | Bacteria | 747 |
| 485 | Ga0436361_0394929 | 3300039447 | Bacteria | 752 |
| 486 | Ga0436361_0463638 | 3300039447 | Bacteria | 4987 |
| 487 | Ga0436361_0564699 | 3300039447 | Bacteria | 547 |
| 488 | Ga0436361_0606387 | 3300039447 | Bacteria | 8387 |
| 489 | Ga0436361_0825970 | 3300039447 | Bacteria | 963 |
| 490 | Ga0436361_0909258 | 3300039447 | Bacteria | 2585 |
| 491 | Ga0436361_1050384 | 3300039447 | Bacteria | 527 |
| 492 | Ga0436361_1098516 | 3300039447 | Bacteria | 871 |
| 493 | Ga0436363_0089847 | 3300039450 | Bacteria | 1378 |
| 494 | Ga0436363_0097764 | 3300039450 | Bacteria | 608 |
| 495 | Ga0436363_0445429 | 3300039450 | Bacteria | 946 |
| 496 | Ga0436363_0626107 | 3300039450 | Bacteria | 644 |
| 497 | Ga0436363_0764721 | 3300039450 | Bacteria | 1218 |
| 498 | Ga0436363_0802862 | 3300039450 | Bacteria | 703 |
| 499 | Ga0436363_0804382 | 3300039450 | Bacteria | 1258 |
| 500 | Ga0436363_0886299 | 3300039450 | Bacteria | 730 |
| 501 | Ga0436363_0887481 | 3300039450 | Bacteria | 759 |
| 502 | Ga0436363_0931784 | 3300039450 | Bacteria | 3731 |
| 503 | Ga0436363_1029642 | 3300039450 | Bacteria | 1046 |
| 504 | Ga0436363_1401173 | 3300039450 | Bacteria | 720 |
| 505 | Ga0436363_1425622 | 3300039450 | Bacteria | 1034 |
| 506 | Ga0436363_1459617 | 3300039450 | Bacteria | 1028 |
| 507 | Ga0436362_0053316 | 3300039453 | Bacteria | 1849 |
| 508 | Ga0436362_0204187 | 3300039453 | Bacteria | 1415 |
| 509 | Ga0436362_0502692 | 3300039453 | Bacteria | 715 |
| 510 | Ga0436362_0833081 | 3300039453 | Bacteria | 588 |
| 511 | Ga0436362_0959369 | 3300039453 | Bacteria | 1775 |
| 512 | Ga0436362_1036040 | 3300039453 | Bacteria | 921 |
| 513 | Ga0436362_1175474 | 3300039453 | Bacteria | 2287 |
| 514 | Ga0436362_1221127 | 3300039453 | Bacteria | 695 |
| 515 | Ga0436362_1298877 | 3300039453 | Bacteria | 996 |
| 516 | Ga0451805_024535 | 3300041461 | Bacteria | 853 |
| 517 | Ga0451849_0990398 | 3300041505 | Bacteria | 670 |
| 518 | Ga0451855_1804371 | 3300041511 | Bacteria | 686 |
| 519 | Ga0439445_0089811 | 3300042004 | Bacteria | 865 |
| 520 | Ga0439449_0212519 | 3300042007 | Bacteria | 725 |
| 521 | Ga0439450_188232 | 3300042008 | Bacteria | 550 |
| 522 | Ga0450902_040382 | 3300042137 | Bacteria | 794 |
| 523 | Ga0439459_0031525 | 3300042438 | Bacteria | 1081 |
| 524 | Ga0439460_0116174 | 3300042461 | Bacteria | 872 |
| 525 | Ga0451577_0073407 | 3300042876 | Bacteria | 3052 |
| 526 | Ga0466972_0216659 | 3300044658 | Bacteria | 896 |
| 527 | Ga0466966_0139838 | 3300044684 | Bacteria | 1480 |
| 528 | Ga0466966_0171651 | 3300044684 | Bacteria | 1318 |
| 529 | Ga0466961_0221581 | 3300044693 | Bacteria | 1166 |
| 530 | Ga0466963_0263275 | 3300044694 | Bacteria | 1211 |
| 531 | Ga0466963_0391939 | 3300044694 | Bacteria | 979 |
| 532 | Ga0466963_0644539 | 3300044694 | Bacteria | 748 |
| 533 | Ga0453684_0049274 | 3300044712 | Bacteria | 5557 |
| 534 | Ga0453684_0065354 | 3300044712 | Bacteria | 4640 |
| 535 | Ga0453684_0360885 | 3300044712 | Bacteria | 1636 |
| 536 | Ga0466971_0403839 | 3300044719 | Bacteria | 666 |
| 537 | Ga0466968_0005785 | 3300044735 | Bacteria | 4639 |
| 538 | Ga0466968_0047732 | 3300044735 | Bacteria | 1821 |
| 539 | Ga0466970_0099510 | 3300044765 | Bacteria | 1583 |
| 540 | Ga0466970_0233471 | 3300044765 | Bacteria | 1028 |
| 541 | Ga0466970_0369138 | 3300044765 | Bacteria | 816 |
| 542 | Ga0466957_0034269 | 3300044842 | Bacteria | 3046 |
| 543 | Ga0466957_0334113 | 3300044842 | Bacteria | 1025 |
| 544 | Ga0466957_0599002 | 3300044842 | Bacteria | 771 |
| 545 | Ga0466959_0008535 | 3300045049 | Bacteria | 7250 |
| 546 | Ga0466959_0227083 | 3300045049 | Bacteria | 1293 |
| 547 | Ga0466959_0688699 | 3300045049 | Bacteria | 685 |
| 548 | Ga0451576_0013414 | 3300045051 | Bacteria | 9168 |
| 549 | Ga0451576_0019189 | 3300045051 | Bacteria | 7468 |
| 550 | Ga0451576_1484497 | 3300045051 | Bacteria | 704 |
| 551 | Ga0466958_0010904 | 3300045836 | Bacteria | 5104 |
| 552 | Ga0466958_0769111 | 3300045836 | Bacteria | 628 |
| 553 | Ga0466958_1000119 | 3300045836 | Bacteria | 546 |
| 554 | Ga0466967_0430576 | 3300045976 | Bacteria | 1287 |
| 555 | Ga0466967_0524589 | 3300045976 | Bacteria | 1164 |
| 556 | Ga0495629_0398968 | 3300046459 | Bacteria | 935 |
| 557 | Ga0495629_0498940 | 3300046459 | Bacteria | 821 |
| 558 | Ga0495651_0215306 | 3300046462 | Bacteria | 1334 |
| 559 | Ga0495651_0301803 | 3300046462 | Bacteria | 1074 |
| 560 | Ga0495580_0193883 | 3300046472 | Bacteria | 1401 |
| 561 | Ga0495664_0126699 | 3300046477 | Bacteria | 1545 |
| 562 | Ga0495664_0350496 | 3300046477 | Bacteria | 889 |
| 563 | Ga0495664_0444635 | 3300046477 | Bacteria | 776 |
| 564 | Ga0495664_0555541 | 3300046477 | Bacteria | 684 |
| 565 | Ga0495608_0020259 | 3300046511 | Bacteria | 4572 |
| 566 | Ga0495608_0470082 | 3300046511 | Bacteria | 764 |
| 567 | Ga0495610_0041907 | 3300046512 | Bacteria | 2294 |
| 568 | Ga0495618_0363012 | 3300046514 | Bacteria | 891 |
| 569 | Ga0495628_0111177 | 3300046516 | Bacteria | 2107 |
| 570 | Ga0495628_0852406 | 3300046516 | Bacteria | 635 |
| 571 | Ga0495630_0565788 | 3300046517 | Bacteria | 872 |
| 572 | Ga0495630_0609621 | 3300046517 | Bacteria | 837 |
| 573 | Ga0495643_0193420 | 3300046522 | Bacteria | 981 |
| 574 | Ga0495652_0480675 | 3300046529 | Bacteria | 865 |
| 575 | Ga0495652_0604443 | 3300046529 | Bacteria | 748 |
| 576 | Ga0495640_0118134 | 3300046533 | Bacteria | 1726 |
| 577 | Ga0495640_0276097 | 3300046533 | Bacteria | 1047 |
| 578 | Ga0495640_0281870 | 3300046533 | Bacteria | 1035 |
| 579 | Ga0495640_0416148 | 3300046533 | Bacteria | 824 |
| 580 | Ga0495645_0177017 | 3300046543 | Bacteria | 1464 |
| 581 | Ga0495667_0011265 | 3300046559 | Bacteria | 6052 |
| 582 | Ga0495667_0111876 | 3300046559 | Bacteria | 1764 |
| 583 | Ga0495667_0253002 | 3300046559 | Bacteria | 1121 |
| 584 | Ga0495656_0253503 | 3300046615 | Bacteria | 890 |
| 585 | Ga0495634_0585212 | 3300046642 | Bacteria | 649 |
| 586 | Ga0495634_0595726 | 3300046642 | Bacteria | 642 |
| 587 | Ga0495635_0115828 | 3300046663 | Bacteria | 1829 |
| 588 | Ga0495635_0818761 | 3300046663 | Bacteria | 599 |
| 589 | Ga0495599_0204769 | 3300046678 | Bacteria | 1211 |
| 590 | Ga0495599_0478230 | 3300046678 | Bacteria | 735 |
| 591 | Ga0495646_0043169 | 3300046680 | Bacteria | 2763 |
| 592 | Ga0495647_0114017 | 3300046681 | Bacteria | 1131 |
| 593 | Ga0495613_0344953 | 3300046689 | Bacteria | 1024 |
| 594 | Ga0495670_0023718 | 3300046691 | Bacteria | 3029 |
| 595 | Ga0495671_0118021 | 3300046692 | Bacteria | 1295 |
| 596 | Ga0495600_0187500 | 3300046809 | Bacteria | 1331 |
| 597 | Ga0495581_0132627 | 3300047315 | Bacteria | 1452 |
| 598 | Ga0495581_0444152 | 3300047315 | Bacteria | 756 |
| 599 | Ga0495604_0122106 | 3300047317 | Bacteria | 1884 |
| 600 | Ga0495604_0714751 | 3300047317 | Bacteria | 635 |
| 601 | Ga0495674_0131216 | 3300047319 | Bacteria | 2111 |
| 602 | Ga0495674_0135998 | 3300047319 | Bacteria | 2068 |
| 603 | Ga0495674_0337658 | 3300047319 | Bacteria | 1225 |
| 604 | Ga0495672_0055640 | 3300047320 | Bacteria | 2308 |
| 605 | Ga0495680_0432262 | 3300047322 | Bacteria | 904 |
| 606 | Ga0495680_0617636 | 3300047322 | Bacteria | 724 |
| 607 | Ga0495675_0342966 | 3300047444 | Bacteria | 880 |
| 608 | Ga0495684_0092397 | 3300047471 | Bacteria | 2292 |
| 609 | Ga0495684_0282660 | 3300047471 | Bacteria | 1197 |
| 610 | Ga0495684_0291274 | 3300047471 | Bacteria | 1175 |
| 611 | Ga0495593_0178631 | 3300047673 | Bacteria | 1069 |
| 612 | Ga0495593_0440891 | 3300047673 | Bacteria | 652 |
| 613 | Ga0495602_0000485 | 3300048088 | Bacteria | 36933 |
| 614 | Ga0495602_0270153 | 3300048088 | Bacteria | 1257 |
| 615 | Ga0496100_0057829 | 3300048903 | Bacteria | 2542 |
| 616 | Ga0496100_0944927 | 3300048903 | Bacteria | 678 |
| 617 | Ga0496100_1088585 | 3300048903 | Bacteria | 630 |
| 618 | Ga0496103_0441661 | 3300048906 | Bacteria | 835 |
| 619 | Ga0496104_0331446 | 3300048907 | Bacteria | 1435 |
| 620 | Ga0496106_0521066 | 3300048909 | Bacteria | 955 |
| 621 | Ga0496106_0691840 | 3300048909 | Bacteria | 813 |
| 622 | Ga0496106_1483829 | 3300048909 | Bacteria | 522 |
| 623 | Ga0496107_0172032 | 3300048910 | Bacteria | 1608 |
| 624 | Ga0496107_0832662 | 3300048910 | Bacteria | 675 |
| 625 | Ga0496108_0187130 | 3300048911 | Bacteria | 1794 |
| 626 | Ga0496110_0934239 | 3300048913 | Bacteria | 774 |
| 627 | Ga0496112_0650192 | 3300048915 | Bacteria | 984 |
| 628 | Ga0496112_0666289 | 3300048915 | Bacteria | 970 |
| 629 | Ga0496113_0215805 | 3300048916 | Bacteria | 1528 |
| 630 | Ga0496114_0022466 | 3300048917 | Bacteria | 5143 |
| 631 | Ga0496115_0248001 | 3300048918 | Bacteria | 1467 |
| 632 | Ga0496115_0416443 | 3300048918 | Bacteria | 1089 |
| 633 | Ga0496117_0046309 | 3300048920 | Bacteria | 3129 |
| 634 | Ga0496117_0081488 | 3300048920 | Bacteria | 2123 |
| 635 | Ga0496118_0226893 | 3300048921 | Bacteria | 1081 |
| 636 | Ga0496119_0014326 | 3300048922 | Bacteria | 6218 |
| 637 | Ga0496120_0039336 | 3300048923 | Bacteria | 2791 |
| 638 | Ga0496122_0034813 | 3300048925 | Bacteria | 4111 |
| 639 | Ga0496122_0142908 | 3300048925 | Bacteria | 1493 |
| 640 | Ga0496122_0342058 | 3300048925 | Bacteria | 785 |
| 641 | Ga0496123_0035488 | 3300048926 | Bacteria | 3551 |
| 642 | Ga0496123_0465134 | 3300048926 | Bacteria | 560 |
| 643 | Ga0496124_0430630 | 3300048927 | Bacteria | 906 |
| 644 | Ga0496125_0077073 | 3300048928 | Bacteria | 2572 |
| 645 | Ga0496126_0037130 | 3300048929 | Bacteria | 4549 |
| 646 | Ga0501306_015180 | 3300049127 | Bacteria | 1023 |
| 647 | Ga0501306_068133 | 3300049127 | Bacteria | 597 |
| 648 | Ga0501308_003368 | 3300049128 | Bacteria | 1476 |
| 649 | Ga0501309_007103 | 3300049129 | Bacteria | 1381 |
| 650 | Ga0501310_000683 | 3300049130 | Bacteria | 3000 |
| 651 | Ga0501310_005178 | 3300049130 | Bacteria | 1333 |
| 652 | Ga0501304_001554 | 3300049160 | Bacteria | 1493 |
| 653 | Ga0501305_028110 | 3300049161 | Bacteria | 865 |
| 654 | Ga0501305_028583 | 3300049161 | Bacteria | 859 |
| 655 | Ga0501305_031375 | 3300049161 | Bacteria | 830 |
| 656 | Ga0501305_049749 | 3300049161 | Bacteria | 701 |
| 657 | Ga0501307_001852 | 3300049162 | Bacteria | 1884 |
| 658 | Ga0501312_000345 | 3300049528 | Bacteria | 3532 |
| 659 | Ga0501314_002948 | 3300049530 | Bacteria | 1347 |
| 660 | Ga0501314_004521 | 3300049530 | Bacteria | 1156 |
| 661 | Ga0501314_020724 | 3300049530 | Bacteria | 682 |
| 662 | Ga0501315_004343 | 3300049531 | Bacteria | 1477 |
| 663 | Ga0501315_022158 | 3300049531 | Bacteria | 865 |
| 664 | Ga0501315_032445 | 3300049531 | Bacteria | 759 |
| 665 | Ga0501316_002496 | 3300049532 | Bacteria | 1703 |
| 666 | Ga0501316_040537 | 3300049532 | Bacteria | 648 |
| 667 | Ga0501316_050396 | 3300049532 | Bacteria | 598 |
| 668 | Ga0501317_000277 | 3300049533 | Bacteria | 3296 |
| 669 | Ga0501317_020258 | 3300049533 | Bacteria | 895 |
| 670 | Ga0501318_000161 | 3300049534 | Bacteria | 3372 |
| 671 | Ga0501318_020082 | 3300049534 | Bacteria | 839 |
| 672 | Ga0501319_004211 | 3300049535 | Bacteria | 994 |
| 673 | Ga0501319_006428 | 3300049535 | Bacteria | 867 |
| 674 | Ga0501321_008612 | 3300049537 | Bacteria | 1086 |
| 675 | Ga0501322_000431 | 3300049538 | Bacteria | 1962 |
| 676 | Ga0501335_026376 | 3300049551 | Bacteria | 641 |
| 677 | Ga0501031_0063468 | 3300049568 | Bacteria | 2406 |
| 678 | Ga0501031_0773388 | 3300049568 | Bacteria | 616 |
| 679 | Ga0501032_0168379 | 3300049569 | Bacteria | 1437 |
| 680 | Ga0501032_0169368 | 3300049569 | Bacteria | 1432 |
| 681 | Ga0501032_0384316 | 3300049569 | Bacteria | 903 |
| 682 | Ga0501032_0497975 | 3300049569 | Bacteria | 779 |
| 683 | Ga0501032_0931068 | 3300049569 | Bacteria | 547 |
| 684 | Ga0501033_0012312 | 3300049570 | Bacteria | 6529 |
| 685 | Ga0501033_0063517 | 3300049570 | Bacteria | 2717 |
| 686 | Ga0501033_0612923 | 3300049570 | Bacteria | 746 |
| 687 | Ga0501034_0034397 | 3300049571 | Bacteria | 5137 |
| 688 | Ga0501034_0039819 | 3300049571 | Bacteria | 4759 |
| 689 | Ga0501034_0048634 | 3300049571 | Bacteria | 4280 |
| 690 | Ga0501034_0086405 | 3300049571 | Bacteria | 3137 |
| 691 | Ga0501034_0129964 | 3300049571 | Bacteria | 2502 |
| 692 | Ga0501034_0237333 | 3300049571 | Bacteria | 1770 |
| 693 | Ga0501034_0250745 | 3300049571 | Bacteria | 1715 |
| 694 | Ga0501034_0498819 | 3300049571 | Bacteria | 1131 |
| 695 | Ga0501034_0535543 | 3300049571 | Bacteria | 1081 |
| 696 | Ga0501034_0576733 | 3300049571 | Bacteria | 1032 |
| 697 | Ga0501036_0175736 | 3300049572 | Bacteria | 1803 |
| 698 | Ga0501036_0312760 | 3300049572 | Bacteria | 1313 |
| 699 | Ga0501036_0313371 | 3300049572 | Bacteria | 1312 |
| 700 | Ga0501037_0013539 | 3300049573 | Bacteria | 6007 |
| 701 | Ga0501037_0034255 | 3300049573 | Bacteria | 3747 |
| 702 | Ga0501037_0082879 | 3300049573 | Bacteria | 2323 |
| 703 | Ga0501037_0098680 | 3300049573 | Bacteria | 2110 |
| 704 | Ga0501037_0133592 | 3300049573 | Bacteria | 1778 |
| 705 | Ga0501037_0559009 | 3300049573 | Bacteria | 771 |
| 706 | Ga0501038_0035903 | 3300049574 | Bacteria | 4350 |
| 707 | Ga0501038_0163747 | 3300049574 | Bacteria | 1805 |
| 708 | Ga0501038_0304259 | 3300049574 | Bacteria | 1251 |
| 709 | Ga0501038_0656260 | 3300049574 | Bacteria | 789 |
| 710 | Ga0501038_0712322 | 3300049574 | Bacteria | 751 |
| 711 | Ga0501038_1085678 | 3300049574 | Bacteria | 585 |
| 712 | Ga0501039_0102026 | 3300049575 | Bacteria | 2239 |
| 713 | Ga0501039_0165934 | 3300049575 | Bacteria | 1736 |
| 714 | Ga0501039_0564415 | 3300049575 | Bacteria | 893 |
| 715 | Ga0501042_0418199 | 3300049578 | Bacteria | 971 |
| 716 | Ga0501042_0427825 | 3300049578 | Bacteria | 960 |
| 717 | Ga0501043_0189844 | 3300049579 | Bacteria | 1598 |
| 718 | Ga0501043_0401744 | 3300049579 | Bacteria | 1035 |
| 719 | Ga0501046_0091963 | 3300049580 | Bacteria | 2333 |
| 720 | Ga0501046_0555579 | 3300049580 | Bacteria | 818 |
| 721 | Ga0501047_0090947 | 3300049581 | Bacteria | 2929 |
| 722 | Ga0501047_0106961 | 3300049581 | Bacteria | 2678 |
| 723 | Ga0501047_0130314 | 3300049581 | Bacteria | 2395 |
| 724 | Ga0501047_0259811 | 3300049581 | Bacteria | 1584 |
| 725 | Ga0501047_0487821 | 3300049581 | Bacteria | 1059 |
| 726 | Ga0501047_0492821 | 3300049581 | Bacteria | 1052 |
| 727 | Ga0501047_0531505 | 3300049581 | Bacteria | 1001 |
| 728 | Ga0501047_0713589 | 3300049581 | Bacteria | 820 |
| 729 | Ga0501047_0915723 | 3300049581 | Bacteria | 690 |
| 730 | Ga0501048_0144326 | 3300049582 | Bacteria | 1684 |
| 731 | Ga0501048_0482404 | 3300049582 | Bacteria | 889 |
| 732 | Ga0501067_0016522 | 3300049583 | Bacteria | 4077 |
| 733 | Ga0501067_0125509 | 3300049583 | Bacteria | 1428 |
| 734 | Ga0501067_0342004 | 3300049583 | Bacteria | 834 |
| 735 | Ga0501068_0142232 | 3300049584 | Bacteria | 1504 |
| 736 | Ga0501068_0433657 | 3300049584 | Bacteria | 849 |
| 737 | Ga0501069_0136436 | 3300049585 | Bacteria | 1406 |
| 738 | Ga0501069_0178140 | 3300049585 | Bacteria | 1228 |
| 739 | Ga0501069_0198667 | 3300049585 | Bacteria | 1162 |
| 740 | Ga0501070_0030178 | 3300049586 | Bacteria | 4543 |
| 741 | Ga0501070_0064080 | 3300049586 | Bacteria | 3044 |
| 742 | Ga0501070_0115075 | 3300049586 | Bacteria | 2222 |
| 743 | Ga0501070_0343637 | 3300049586 | Bacteria | 1212 |
| 744 | Ga0501071_0186977 | 3300049587 | Bacteria | 1553 |
| 745 | Ga0501071_0413290 | 3300049587 | Bacteria | 1031 |
| 746 | Ga0501071_0579129 | 3300049587 | Bacteria | 862 |
| 747 | Ga0501072_0230389 | 3300049588 | Bacteria | 1476 |
| 748 | Ga0501072_0572371 | 3300049588 | Bacteria | 891 |
| 749 | Ga0501072_0575228 | 3300049588 | Bacteria | 889 |
| 750 | Ga0501073_0014091 | 3300049589 | Bacteria | 5809 |
| 751 | Ga0501073_0018783 | 3300049589 | Bacteria | 4997 |
| 752 | Ga0501073_0033095 | 3300049589 | Bacteria | 3683 |
| 753 | Ga0501073_0229877 | 3300049589 | Bacteria | 1281 |
| 754 | Ga0501073_0481714 | 3300049589 | Bacteria | 858 |
| 755 | Ga0501073_0488957 | 3300049589 | Bacteria | 851 |
| 756 | Ga0501073_0699411 | 3300049589 | Bacteria | 699 |
| 757 | Ga0501073_0731688 | 3300049589 | Bacteria | 682 |
| 758 | Ga0501073_0735041 | 3300049589 | Bacteria | 681 |
| 759 | Ga0501073_0754933 | 3300049589 | Bacteria | 671 |
| 760 | Ga0501074_0029627 | 3300049590 | Bacteria | 3965 |
| 761 | Ga0501074_0142168 | 3300049590 | Bacteria | 1716 |
| 762 | Ga0501074_0183239 | 3300049590 | Bacteria | 1493 |
| 763 | Ga0501074_0788082 | 3300049590 | Bacteria | 670 |
| 764 | Ga0501076_0800382 | 3300049592 | Bacteria | 778 |
| 765 | Ga0501077_0040887 | 3300049593 | Bacteria | 2952 |
| 766 | Ga0501077_0531919 | 3300049593 | Bacteria | 754 |
| 767 | Ga0501238_000510 | 3300049671 | Bacteria | 4455 |
| 768 | Ga0501247_022228 | 3300049677 | Bacteria | 829 |
| 769 | Ga0501259_132926 | 3300049688 | Bacteria | 602 |
| 770 | Ga0501079_0485729 | 3300049741 | Bacteria | 971 |
| 771 | Ga0501079_0610234 | 3300049741 | Bacteria | 859 |
| 772 | Ga0501080_0032514 | 3300049742 | Bacteria | 4866 |
| 773 | Ga0501080_0057218 | 3300049742 | Bacteria | 3630 |
| 774 | Ga0501080_0150116 | 3300049742 | Bacteria | 2154 |
| 775 | Ga0501080_0294704 | 3300049742 | Bacteria | 1472 |
| 776 | Ga0501080_0379714 | 3300049742 | Bacteria | 1273 |
| 777 | Ga0501081_0894952 | 3300049743 | Bacteria | 669 |
| 778 | Ga0501083_0005155 | 3300049744 | Bacteria | 9248 |
| 779 | Ga0501083_0028982 | 3300049744 | Bacteria | 3812 |
| 780 | Ga0501083_0032553 | 3300049744 | Bacteria | 3575 |
| 781 | Ga0501083_0050437 | 3300049744 | Bacteria | 2801 |
| 782 | Ga0501083_0068545 | 3300049744 | Bacteria | 2361 |
| 783 | Ga0501083_0095492 | 3300049744 | Bacteria | 1961 |
| 784 | Ga0501083_0417359 | 3300049744 | Bacteria | 873 |
| 785 | Ga0501083_0473995 | 3300049744 | Bacteria | 815 |
| 786 | Ga0501083_0541800 | 3300049744 | Bacteria | 757 |
| 787 | Ga0501035_0036292 | 3300049822 | Bacteria | 4468 |
| 788 | Ga0501035_0098049 | 3300049822 | Bacteria | 2573 |
| 789 | Ga0501035_0200897 | 3300049822 | Bacteria | 1710 |
| 790 | Ga0501035_0269893 | 3300049822 | Bacteria | 1440 |
| 791 | Ga0501035_0425899 | 3300049822 | Bacteria | 1101 |
| 792 | Ga0501044_0053063 | 3300049823 | Bacteria | 4173 |
| 793 | Ga0501044_0061730 | 3300049823 | Bacteria | 3833 |
| 794 | Ga0501044_0188460 | 3300049823 | Bacteria | 2026 |
| 795 | Ga0501044_0211728 | 3300049823 | Bacteria | 1892 |
| 796 | Ga0501044_0290790 | 3300049823 | Bacteria | 1565 |
| 797 | Ga0501044_0330521 | 3300049823 | Bacteria | 1447 |
| 798 | Ga0501044_0678553 | 3300049823 | Bacteria | 917 |
| 799 | Ga0501044_0879212 | 3300049823 | Bacteria | 772 |
| 800 | Ga0501044_1130440 | 3300049823 | Bacteria | 652 |
| 801 | Ga0501045_0262842 | 3300049824 | Bacteria | 1285 |
| 802 | Ga0501212_010338 | 3300049851 | Bacteria | 1328 |
| 803 | nmdc:mga03683_341226_c1 | 3300050489 | Bacteria | 708 |
| 804 | nmdc:mga03n38_653033_c1 | 3300050490 | Bacteria | 603 |
| 805 | nmdc:mga0k408_150606_c1 | 3300050493 | Bacteria | 1385 |
| 806 | nmdc:mga0k408_313269_c1 | 3300050493 | Bacteria | 936 |
| 807 | nmdc:mga06z11_161611_c1 | 3300050494 | Bacteria | 1280 |
| 808 | nmdc:mga07m45_453955_c1 | 3300050496 | Bacteria | 743 |
| 809 | nmdc:mga05p37_875685_c1 | 3300050507 | Bacteria | 972 |
| 810 | nmdc:mga09592_163503_c1 | 3300050508 | Bacteria | 1158 |
| 811 | nmdc:mga06r32_69327_c1 | 3300050510 | Bacteria | 3408 |
| 812 | nmdc:mga08y16_457969_c1 | 3300050511 | Bacteria | 1300 |
| 813 | nmdc:mga08y16_703702_c1 | 3300050511 | Bacteria | 1010 |
| 814 | nmdc:mga0n895_81925_c1 | 3300050512 | Bacteria | 3216 |
| 815 | Ga0495601_0005148 | 3300053077 | Bacteria | 7599 |
| 816 | Ga0495601_0145863 | 3300053077 | Bacteria | 1545 |
| 817 | Ga0495601_0160784 | 3300053077 | Bacteria | 1468 |
| 818 | Ga0495612_0001186 | 3300053078 | Bacteria | 10745 |
| 819 | Ga0495612_0176459 | 3300053078 | Bacteria | 937 |
| 820 | Ga0495595_0006042 | 3300053084 | Bacteria | 4922 |
| 821 | Ga0495595_0088509 | 3300053084 | Bacteria | 1483 |
| 822 | Ga0495619_0263086 | 3300053085 | Bacteria | 1195 |
| 823 | Ga0495619_0644914 | 3300053085 | Bacteria | 722 |
| 824 | Ga0500643_004537 | 3300053087 | Bacteria | 6234 |
| 825 | Ga0500566_0218248 | 3300053094 | Bacteria | 950 |
| 826 | Ga0500641_0039459 | 3300053096 | Bacteria | 1902 |
| 827 | Ga0500650_0198727 | 3300053098 | Bacteria | 914 |
| 828 | Ga0500554_088867 | 3300053102 | Bacteria | 1025 |
| 829 | Ga0500569_092460 | 3300053109 | Bacteria | 982 |
| 830 | Ga0500595_011638 | 3300053119 | Bacteria | 3433 |
| 831 | Ga0500608_163751 | 3300053122 | Bacteria | 961 |
| 832 | Ga0500652_000140 | 3300053131 | Bacteria | 27358 |
| 833 | Ga0500559_0028203 | 3300053136 | Bacteria | 2398 |
| 834 | Ga0500568_0032927 | 3300053139 | Bacteria | 2129 |
| 835 | Ga0500577_0046253 | 3300053142 | Bacteria | 1612 |
| 836 | Ga0500616_0067312 | 3300053153 | Bacteria | 1837 |
| 837 | Ga0500622_0018116 | 3300053156 | Bacteria | 3745 |
| 838 | Ga0500636_0018083 | 3300053177 | Bacteria | 4167 |
| 839 | Ga0500636_0278219 | 3300053177 | Bacteria | 837 |
| 840 | Ga0501084_0188858 | 3300054114 | Bacteria | 1738 |
| 841 | Ga0501084_0582831 | 3300054114 | Bacteria | 945 |
| 842 | Ga0501084_0911847 | 3300054114 | Bacteria | 739 |
| 843 | Ga0587084_001885 | 3300059477 | Bacteria | 2077 |
| 844 | Ga0587084_028019 | 3300059477 | Bacteria | 889 |
| 845 | Ga0587066_014955 | 3300059490 | Bacteria | 1200 |
| 846 | Ga0587073_0078518 | 3300059492 | Bacteria | 814 |
| 847 | Ga0587077_017795 | 3300059493 | Bacteria | 1215 |
| 848 | Ga0587082_073793 | 3300059504 | Bacteria | 698 |
| 849 | Ga0587083_0028720 | 3300059505 | Bacteria | 1091 |
| 850 | Ga0587088_095401 | 3300059508 | Bacteria | 657 |
| 851 | Ga0587089_031603 | 3300059509 | Bacteria | 784 |
| 852 | Ga0587090_006217 | 3300059510 | Bacteria | 1525 |
| 853 | Ga0587098_048214 | 3300059604 | Bacteria | 639 |
| 854 | Ga0587098_059081 | 3300059604 | Bacteria | 599 |
| 855 | Ga0587101_107187 | 3300059623 | Bacteria | 563 |
| 856 | Ga0587062_016433 | 3300059639 | Bacteria | 1000 |
| 857 | Ga0587062_048532 | 3300059639 | Bacteria | 712 |
| 858 | Ga0587062_050693 | 3300059639 | Bacteria | 702 |
| 859 | Ga0587067_034366 | 3300059640 | Bacteria | 953 |
| 860 | Ga0587067_075086 | 3300059640 | Bacteria | 738 |
| 861 | Ga0587067_168923 | 3300059640 | Bacteria | 562 |
| 862 | Ga0587068_009911 | 3300059641 | Bacteria | 1411 |
| 863 | Ga0587068_034293 | 3300059641 | Bacteria | 894 |
| 864 | Ga0587102_011045 | 3300059649 | Bacteria | 902 |
| 865 | Ga0587107_051534 | 3300059652 | Bacteria | 699 |
| 866 | Ga0587119_025095 | 3300059658 | Bacteria | 784 |
| 867 | Ga0587124_006180 | 3300059660 | Bacteria | 979 |
| 868 | Ga0587071_005211 | 3300060344 | Bacteria | 1978 |
| 869 | Ga0587071_023287 | 3300060344 | Bacteria | 1150 |
| 870 | Ga0587111_0021274 | 3300060346 | Bacteria | 1249 |
| 871 | Ga0501082_0068490 | 3300060353 | Bacteria | 3055 |
| 872 | Ga0501082_0325904 | 3300060353 | Bacteria | 1338 |
| 873 | Ga0501082_1252064 | 3300060353 | Bacteria | 648 |
| 874 | Ga0466962_0264109 | 3300061719 | Bacteria | 848 |
| 875 | Ga0466962_0345417 | 3300061719 | Bacteria | 741 |
| 876 | Ga0530510_0541695 | 3300061734 | Bacteria | 884 |
| 877 | 2508735858 | 2508501050 | Bacteria | 9633614 |
| 878 | 2509078181 | 2508501114 | Bacteria | 7082538 |
| 879 | 2510842510 | 2510461069 | Bacteria | 5505000 |
| 880 | 2523466051 | 2523231067 | Bacteria | 5230452 |
| 881 | 2545677347 | 2545555834 | Bacteria | 8130841 |
| 882 | 2644298330 | 2643221653 | Bacteria | 4569637 |
| 883 | 2644656557 | 2643221719 | Bacteria | 4568197 |
| 884 | 2644731515 | 2643221733 | Bacteria | 5690728 |
| 885 | 2644734893 | 2643221734 | Bacteria | 5365412 |
| 886 | 2644744406 | 2643221736 | Bacteria | 6608466 |
| 887 | 2671694512 | 2671180139 | Bacteria | 4196045 |
| 888 | 2738745711 | 2738541281 | Bacteria | 5112672 |
| 889 | 2739347255 | 2738543031 | Bacteria | 5769731 |
| 890 | 2739354941 | 2738543032 | Bacteria | 5115625 |
| 891 | 2774874179 | 2773857925 | Bacteria | 6472445 |
| 892 | 2776259131 | 2775506901 | Bacteria | 9631051 |
| 893 | 2819242281 | 2818991272 | Bacteria | 4622173 |
| 894 | 2819720916 | 2818991467 | Bacteria | 5893227 |
| 895 | 2828310142 | 2828305725 | Bacteria | 4916900 |
| 896 | 2829749924 | 2829745981 | Bacteria | 5406054 |
| 897 | 2835319206 | 2835312727 | Bacteria | 7413381 |
| 898 | 2841761372 | 2841760612 | Bacteria | 6454112 |
| 899 | 2841913375 | 2841911363 | Bacteria | 6173697 |
| 900 | 2841919122 | 2841917233 | Bacteria | 6173500 |
| 901 | 2844104397 | 2844104063 | Bacteria | 6440972 |
| 902 | 2851184444 | 2851182111 | Bacteria | 6047226 |
| 903 | 2851247385 | 2851246043 | Bacteria | 6439203 |
| 904 | 2854685314 | 2854681122 | Bacteria | 4548679 |
| 905 | 2861692143 | 2861691609 | Bacteria | 5628931 |
| 906 | 2882462593 | 2882456835 | Bacteria | 6863978 |
| 907 | 2884300458 | 2884298095 | Bacteria | 3823049 |
| 908 | 2891088716 | 2891088606 | Bacteria | 4762464 |
| 909 | 2894234006 | 2894232714 | Bacteria | 8834183 |
| 910 | 2898797002 | 2898795034 | Bacteria | 4294459 |
| 911 | 2917699261 | 2917699015 | Bacteria | 7043791 |
| 912 | 2939671397 | 2939669807 | Bacteria | 5028511 |
| 913 | 2989778441 | 2989776772 | Bacteria | 4843317 |
| 914 | 3003667734 | 3003665799 | Bacteria | 7279786 |
| 915 | 641640685 | 641522639 | Bacteria | 7737025 |
| 916 | 643599639 | 643348564 | Bacteria | 8839022 |
| 917 | 8001849270 | 8001845381 | Bacteria | 5804942 |
| 918 | 8005248256 | 8005246636 | Bacteria | 4933972 |
| 919 | 8005659740 | 8005658619 | Bacteria | 4500593 |
| 920 | 8057530445 | 8057529695 | Bacteria | 6306553 |
| 921 | Ga0501067_0446331 | |||
| 922 | RicEn_C5064 | |||
| 923 | JGI25159J45721_1010523 | |||
| 924 | Ga0006778J45830_1058666 | |||
| 925 | Ga0006759J45824_1010259 | |||
| 926 | Ga0006759J45824_1036006 | |||
| 927 | Ga0006759J45824_1123174 | |||
| 928 | JGI25151J46595_10000998 | |||
| 929 | Ga0006777J48905_1015771 | |||
| 930 | Ga0006777J48905_1026045 | |||
| 931 | Ga0006777J48905_1056620 | |||
| 932 | Ga0007417J51691_1008472 | |||
| 933 | Ga0007417J51691_1016055 | |||
| 934 | Ga0007417J51691_1050143 | |||
| 935 | Ga0007410J51695_1019967 | |||
| 936 | Ga0007410J51695_1022321 | |||
| 937 | Ga0007410J51695_1045401 | |||
| 938 | Ga0007416J51690_1017104 | |||
| 939 | Ga0007416J51690_1019837 | |||
| 940 | Ga0006562J51391_1021653 | |||
| 941 | Ga0007429J51699_1019329 | |||
| 942 | Ga0007429J51699_1022307 | |||
| 943 | Ga0032354_1013396 | |||
| 944 | Ga0032354_1014807 | |||
| 945 | Ga0006780_1006913 | |||
| 946 | Ga0006780_1010347 | |||
| 947 | Ga0006780_1015395 | |||
| 948 | Ga0055526_1011375 | |||
| 949 | Ga0055526_1012869 | |||
| 950 | Ga0055524_1009061 | |||
| 951 | Ga0055524_1011452 | |||
| 952 | Ga0058860_10222892 | |||
| 953 | Ga0065165_1007156 | |||
| 954 | Ga0070658_10203068 | |||
| 955 | Ga0070676_10770732 | |||
| 956 | Ga0070666_11256222 | |||
| 957 | Ga0070680_100239697 | |||
| 958 | Ga0070689_100067740 | |||
| 959 | Ga0070668_100019774 | |||
| 960 | Ga0070668_100924570 | |||
| 961 | Ga0070669_100430150 | |||
| 962 | Ga0070674_100521485 | |||
| 963 | Ga0070659_100255557 | |||
| 964 | Ga0070659_101292119 | |||
| 965 | Ga0070667_100033801 | |||
| 966 | Ga0070667_100426348 | |||
| 967 | Ga0070709_10338542 | |||
| 968 | Ga0070709_10525039 | |||
| 969 | Ga0070714_100380545 | |||
| 970 | Ga0070714_100413833 | |||
| 971 | Ga0070714_100816354 | |||
| 972 | Ga0070714_100896845 | |||
| 973 | Ga0070713_100073081 | |||
| 974 | Ga0070713_100379555 | |||
| 975 | Ga0070713_100393778 | |||
| 976 | Ga0070713_101574583 | |||
| 977 | Ga0070710_10019419 | |||
| 978 | Ga0070710_10474792 | |||
| 979 | Ga0070701_10531009 | |||
| 980 | Ga0070711_100077038 | |||
| 981 | Ga0070700_100105136 | |||
| 982 | Ga0070678_101049927 | |||
| 983 | Ga0070681_10289924 | |||
| 984 | Ga0070681_10391849 | |||
| 985 | Ga0070681_11149290 | |||
| 986 | Ga0068867_100984532 | |||
| 987 | Ga0070706_100121868 | |||
| 988 | Ga0070707_100060990 | |||
| 989 | Ga0070707_100613211 | |||
| 990 | Ga0070698_100610978 | |||
| 991 | Ga0070699_100401774 | |||
| 992 | Ga0070679_100531560 | |||
| 993 | Ga0070679_100576523 | |||
| 994 | Ga0070679_100886680 | |||
| 995 | Ga0070679_101263957 | |||
| 996 | Ga0070684_101174139 | |||
| 997 | Ga0070697_100196869 | |||
| 998 | Ga0070695_100164130 | |||
| 999 | Ga0070665_100137672 | |||
| 1000 | Ga0070664_100156019 | |||
| 1001 | Ga0068857_101036085 | |||
| 1002 | Ga0068857_101065576 | |||
| 1003 | Ga0068854_100224472 | |||
| 1004 | Ga0068856_100777101 | |||
| 1005 | Ga0068852_101147338 | |||
| 1006 | Ga0068864_100895908 | |||
| 1007 | Ga0068870_10071526 | |||
| 1008 | Ga0068863_100024921 | |||
| 1009 | Ga0068863_100392322 | |||
| 1010 | Ga0068863_101725029 | |||
| 1011 | Ga0068858_100240777 | |||
| 1012 | Ga0081455_10365467 | |||
| 1013 | Ga0081539_10326545 | |||
| 1014 | Ga0070717_10135885 | |||
| 1015 | Ga0070717_10308617 | |||
| 1016 | Ga0070717_10593615 | |||
| 1017 | Ga0075365_10161632 | |||
| 1018 | Ga0075363_100077170 | |||
| 1019 | Ga0075363_100282314 | |||
| 1020 | Ga0070715_10558697 | |||
| 1021 | Ga0070715_10636192 | |||
| 1022 | Ga0070715_10775470 | |||
| 1023 | Ga0070716_100348996 | |||
| 1024 | Ga0070716_100894887 | |||
| 1025 | Ga0070712_100129215 | |||
| 1026 | Ga0070712_100232534 | |||
| 1027 | Ga0070712_100315018 | |||
| 1028 | Ga0075362_10091023 | |||
| 1029 | Ga0075362_10184951 | |||
| 1030 | Ga0075367_10460000 | |||
| 1031 | Ga0075366_10106372 | |||
| 1032 | Ga0075366_10498497 | |||
| 1033 | Ga0075428_100375428 | |||
| 1034 | Ga0075430_100066186 | |||
| 1035 | Ga0075431_100109846 | |||
| 1036 | Ga0099795_10000098 | |||
| 1037 | Ga0105240_10792336 | |||
| 1038 | Ga0105240_10878810 | |||
| 1039 | Ga0111539_10139589 | |||
| 1040 | Ga0111539_10625731 | |||
| 1041 | Ga0105245_10709312 | |||
| 1042 | Ga0105245_11084031 | |||
| 1043 | Ga0105247_10609493 | |||
| 1044 | Ga0114129_10357308 | |||
| 1045 | Ga0114129_11314695 | |||
| 1046 | Ga0105243_10593529 | |||
| 1047 | Ga0105248_10036522 | |||
| 1048 | Ga0105248_11389846 | |||
| 1049 | Ga0105248_12180919 | |||
| 1050 | Ga0105237_10587943 | |||
| 1051 | Ga0105238_10105938 | |||
| 1052 | Ga0105238_10400601 | |||
| 1053 | Ga0105249_10475539 | |||
| 1054 | Ga0105249_10679734 | |||
| 1055 | Ga0105035_109896 | |||
| 1056 | Ga0099796_10008991 | |||
| 1057 | Ga0105239_10384331 | |||
| 1058 | Ga0105239_10775093 | |||
| 1059 | Ga0105239_10959790 | |||
| 1060 | Ga0105239_11194822 | |||
| 1061 | Ga0105246_10067496 | |||
| 1062 | Ga0105246_10504559 | |||
| 1063 | Ga0157369_11858569 | |||
| 1064 | Ga0171462_1060 | |||
| 1065 | Ga0157374_10597224 | |||
| 1066 | Ga0157374_11976697 | |||
| 1067 | Ga0157378_11985598 | |||
| 1068 | Ga0163162_10749374 | |||
| 1069 | Ga0163162_10791098 | |||
| 1070 | Ga0163162_10853178 | |||
| 1071 | Ga0157372_10005461 | |||
| 1072 | Ga0157372_10836403 | |||
| 1073 | Ga0157372_12202194 | |||
| 1074 | Ga0163163_10282390 | |||
| 1075 | Ga0163163_10963239 | |||
| 1076 | Ga0163163_11259345 | |||
| 1077 | Ga0157380_10073797 | |||
| 1078 | Ga0182008_10071381 | |||
| 1079 | Ga0157379_10408576 | |||
| 1080 | Ga0157379_10871156 | |||
| 1081 | Ga0182005_1011902 | |||
| 1082 | Ga0182005_1030841 | |||
| 1083 | Ga0197907_10383026 | |||
| 1084 | Ga0197907_10611404 | |||
| 1085 | Ga0206356_10203437 | |||
| 1086 | Ga0206356_11041350 | |||
| 1087 | Ga0206352_11316727 | |||
| 1088 | Ga0206350_10361844 | |||
| 1089 | Ga0206350_10871634 | |||
| 1090 | Ga0206354_10418299 | |||
| 1091 | Ga0206354_11461142 | |||
| 1092 | Ga0213873_10032527 | |||
| 1093 | Ga0213873_10083012 | |||
| 1094 | Ga0213872_10002583 | |||
| 1095 | Ga0213872_10018648 | |||
| 1096 | Ga0213872_10076120 | |||
| 1097 | Ga0213872_10120365 | |||
| 1098 | Ga0213872_10269602 | |||
| 1099 | Ga0213874_10004974 | |||
| 1100 | Ga0213876_10032089 | |||
| 1101 | Ga0213876_10187793 | |||
| 1102 | Ga0213876_10291478 | |||
| 1103 | Ga0213875_10001918 | |||
| 1104 | Ga0213875_10009354 | |||
| 1105 | Ga0213875_10027997 | |||
| 1106 | Ga0213875_10028201 | |||
| 1107 | Ga0213875_10032543 | |||
| 1108 | Ga0213875_10378324 | |||
| 1109 | Ga0213871_10001835 | |||
| 1110 | Ga0213871_10027643 | |||
| 1111 | Ga0213871_10057008 | |||
| 1112 | Ga0224712_10051833 | |||
| 1113 | Ga0224712_10117759 | |||
| 1114 | Ga0224712_10182396 | |||
| 1115 | Ga0224712_10463085 | |||
| 1116 | Ga0256743_109706 | |||
| 1117 | Ga0209673_1081273 | |||
| 1118 | Ga0209130_1000845 | |||
| 1119 | Ga0209130_1025254 | |||
| 1120 | Ga0209675_1000772 | |||
| 1121 | Ga0209025_1005170 | |||
| 1122 | Ga0209025_1007328 | |||
| 1123 | Ga0209564_1002904 | |||
| 1124 | Ga0209564_1002939 | |||
| 1125 | Ga0209758_1036517 | |||
| 1126 | Ga0209758_1051119 | |||
| 1127 | Ga0209256_1003845 | |||
| 1128 | Ga0209256_1005787 | |||
| 1129 | Ga0207692_10013314 | |||
| 1130 | Ga0207692_10609215 | |||
| 1131 | Ga0207688_10521182 | |||
| 1132 | Ga0207680_10737050 | |||
| 1133 | Ga0207685_10588991 | |||
| 1134 | Ga0207699_10218643 | |||
| 1135 | Ga0207699_10675872 | |||
| 1136 | Ga0207699_10998311 | |||
| 1137 | Ga0207645_10546980 | |||
| 1138 | Ga0207643_10103238 | |||
| 1139 | Ga0207705_10891198 | |||
| 1140 | Ga0207705_11113445 | |||
| 1141 | Ga0207684_10095939 | |||
| 1142 | Ga0207707_10198389 | |||
| 1143 | Ga0207707_10366673 | |||
| 1144 | Ga0207695_10715029 | |||
| 1145 | Ga0207695_11075944 | |||
| 1146 | Ga0207671_10315534 | |||
| 1147 | Ga0207693_10124923 | |||
| 1148 | Ga0207693_10144611 | |||
| 1149 | Ga0207693_10199267 | |||
| 1150 | Ga0207663_10131537 | |||
| 1151 | Ga0207663_10550741 | |||
| 1152 | Ga0207663_10969186 | |||
| 1153 | Ga0207660_10206444 | |||
| 1154 | Ga0207660_10347288 | |||
| 1155 | Ga0207660_10832786 | |||
| 1156 | Ga0207662_10113149 | |||
| 1157 | Ga0207657_11212994 | |||
| 1158 | Ga0207652_10207524 | |||
| 1159 | Ga0207652_10436251 | |||
| 1160 | Ga0207652_10777551 | |||
| 1161 | Ga0207646_10041541 | |||
| 1162 | Ga0207681_10411382 | |||
| 1163 | Ga0207694_10261783 | |||
| 1164 | Ga0207694_10795736 | |||
| 1165 | Ga0207650_11273067 | |||
| 1166 | Ga0207687_10596062 | |||
| 1167 | Ga0207700_10063660 | |||
| 1168 | Ga0207700_10319205 | |||
| 1169 | Ga0207700_10395123 | |||
| 1170 | Ga0207700_10435950 | |||
| 1171 | Ga0207700_10453425 | |||
| 1172 | Ga0207700_10648018 | |||
| 1173 | Ga0207700_10909394 | |||
| 1174 | Ga0207700_11177486 | |||
| 1175 | Ga0207664_10179857 | |||
| 1176 | Ga0207664_10726553 | |||
| 1177 | Ga0207706_10089938 | |||
| 1178 | Ga0207670_10160779 | |||
| 1179 | Ga0207704_11034849 | |||
| 1180 | Ga0207665_10361693 | |||
| 1181 | Ga0207665_10420865 | |||
| 1182 | Ga0207665_10871307 | |||
| 1183 | Ga0207691_10617462 | |||
| 1184 | Ga0207711_10020060 | |||
| 1185 | Ga0207679_10029035 | |||
| 1186 | Ga0207651_10520223 | |||
| 1187 | Ga0207668_10083868 | |||
| 1188 | Ga0207668_10552746 | |||
| 1189 | Ga0207640_10298155 | |||
| 1190 | Ga0207640_10340165 | |||
| 1191 | Ga0207658_10038859 | |||
| 1192 | Ga0207658_10300857 | |||
| 1193 | Ga0207658_10352452 | |||
| 1194 | Ga0207677_10902636 | |||
| 1195 | Ga0207639_10361938 | |||
| 1196 | Ga0207678_10512373 | |||
| 1197 | Ga0207678_11043344 | |||
| 1198 | Ga0207708_10054496 | |||
| 1199 | Ga0207702_10093097 | |||
| 1200 | Ga0207702_12091273 | |||
| 1201 | Ga0207641_10018124 | |||
| 1202 | Ga0207641_10604434 | |||
| 1203 | Ga0207641_10616124 | |||
| 1204 | Ga0207676_10916968 | |||
| 1205 | Ga0207674_10665836 | |||
| 1206 | Ga0207674_11511019 | |||
| 1207 | Ga0207674_11580544 | |||
| 1208 | Ga0207675_101143321 | |||
| 1209 | Ga0207683_10648280 | |||
| 1210 | Ga0207698_12136976 | |||
| 1211 | Ga0209371_1042358 | |||
| 1212 | Ga0268266_10241074 | |||
| 1213 | Ga0268266_10944114 | |||
| 1214 | Ga0268266_11425066 | |||
| 1215 | Ga0268265_10997427 | |||
| 1216 | Ga0268265_11120573 | |||
| 1217 | Ga0307515_10161055 | |||
| 1218 | Ga0265338_10094319 | |||
| 1219 | Ga0311001_1093816 | |||
| 1220 | Ga0310981_1015680 | |||
| 1221 | Ga0268256_1038117 | |||
| 1222 | Ga0265762_1107797 | |||
| 1223 | Ga0265775_107056 | |||
| 1224 | Ga0265777_112116 | |||
| 1225 | Ga0265764_109349 | |||
| 1226 | Ga0265330_10022775 | |||
| 1227 | Ga0265328_10000059 | |||
| 1228 | Ga0265328_10003554 | |||
| 1229 | Ga0265328_10009974 | |||
| 1230 | Ga0265320_10206266 | |||
| 1231 | Ga0265325_10073142 | |||
| 1232 | Ga0265325_10242556 | |||
| 1233 | Ga0265329_10007573 | |||
| 1234 | Ga0265329_10098760 | |||
| 1235 | Ga0265340_10001769 | |||
| 1236 | Ga0265340_10009506 | |||
| 1237 | Ga0265340_10029175 | |||
| 1238 | Ga0265340_10041235 | |||
| 1239 | Ga0265340_10066138 | |||
| 1240 | Ga0265340_10066458 | |||
| 1241 | Ga0265340_10078146 | |||
| 1242 | Ga0265339_10002133 | |||
| 1243 | Ga0265339_10168920 | |||
| 1244 | Ga0265339_10171865 | |||
| 1245 | Ga0265331_10000308 | |||
| 1246 | Ga0265331_10001760 | |||
| 1247 | Ga0265331_10006977 | |||
| 1248 | Ga0265331_10095207 | |||
| 1249 | Ga0265331_10101386 | |||
| 1250 | Ga0265331_10227157 | |||
| 1251 | Ga0265331_10245082 | |||
| 1252 | Ga0265327_10066223 | |||
| 1253 | Ga0265316_10000404 | |||
| 1254 | Ga0265316_10037483 | |||
| 1255 | Ga0265316_10049992 | |||
| 1256 | Ga0307408_100093348 | |||
| 1257 | Ga0265313_10000031 | |||
| 1258 | Ga0265313_10013098 | |||
| 1259 | Ga0265313_10057452 | |||
| 1260 | Ga0265313_10059699 | |||
| 1261 | Ga0316575_10106890 | |||
| 1262 | Ga0316575_10111151 | |||
| 1263 | Ga0316579_10599125 | |||
| 1264 | Ga0265314_10158338 | |||
| 1265 | Ga0265314_10282545 | |||
| 1266 | Ga0265314_10303630 | |||
| 1267 | Ga0265342_10008958 | |||
| 1268 | Ga0265342_10177718 | |||
| 1269 | Ga0307405_10397878 | |||
| 1270 | Ga0316577_10191409 | |||
| 1271 | Ga0307413_10311709 | |||
| 1272 | Ga0307410_10074475 | |||
| 1273 | Ga0307410_10710815 | |||
| 1274 | Ga0307406_10083248 | |||
| 1275 | Ga0307407_10032572 | |||
| 1276 | Ga0307409_100258466 | |||
| 1277 | Ga0307409_101369555 | |||
| 1278 | Ga0307416_100083180 | |||
| 1279 | Ga0307416_101335304 | |||
| 1280 | Ga0307414_10074675 | |||
| 1281 | Ga0316053_105404 | |||
| 1282 | Ga0316593_10192369 | |||
| 1283 | Ga0316592_1031860 | |||
| 1284 | Ga0373926_0299024 | |||
| 1285 | Ga0373934_0017524 | |||
| 1286 | Ga0373944_0359541 | |||
| 1287 | Ga0373923_0114545 | |||
| 1288 | Ga0373932_0141670 | |||
| 1289 | Ga0373936_0049000 | |||
| 1290 | Ga0373936_0195525 | |||
| 1291 | Ga0373945_0077986 | |||
| 1292 | Ga0373953_0028142 | |||
| 1293 | Ga0373954_0128876 | |||
| 1294 | Ga0373954_0265130 | |||
| 1295 | Ga0373956_0207539 | |||
| 1296 | Ga0373943_0000918 | |||
| 1297 | Ga0373943_0125014 | |||
| 1298 | Ga0373943_0128930 | |||
| 1299 | Ga0373943_0257746 | |||
| 1300 | Ga0373943_0569076 | |||
| 1301 | Ga0373946_0026916 | |||
| 1302 | Ga0373946_0169640 | |||
| 1303 | Ga0373946_0405871 | |||
| 1304 | Ga0373955_0664028 | |||
| 1305 | Ga0316574_0017432 | |||
| 1306 | Ga0316574_0621674 | |||
| 1307 | Ga0373924_0011533 | |||
| 1308 | Ga0373924_0070759 | |||
| 1309 | Ga0373924_0115263 | |||
| 1310 | Ga0373931_0240750 | |||
| 1311 | Ga0373931_0739310 | |||
| 1312 | Ga0373935_0021700 | |||
| 1313 | Ga0373935_0139794 | |||
| 1314 | Ga0373927_0101308 | |||
| 1315 | Ga0373927_0160772 | |||
| 1316 | Ga0373927_0306658 | |||
| 1317 | Ga0373927_0440609 | |||
| 1318 | Ga0373927_0450316 | |||
| 1319 | Ga0373933_0026815 | |||
| 1320 | Ga0373933_0340849 | |||
| 1321 | Ga0373947_0018231 | |||
| 1322 | Ga0373947_0032321 | |||
| 1323 | Ga0373947_0217781 | |||
| 1324 | Ga0373947_1020119 | |||
| 1325 | Ga0373937_0000922 | |||
| 1326 | Ga0373937_0046989 | |||
| 1327 | Ga0373937_0123067 | |||
| 1328 | Ga0373937_0195480 | |||
| 1329 | Ga0373937_0408826 | |||
| 1330 | Ga0373937_0410148 | |||
| 1331 | Ga0373937_0581629 | |||
| 1332 | Ga0373937_1379960 | |||
| 1333 | Ga0373937_1600044 | |||
| 1334 | Ga0265778_028515 | |||
| 1335 | Ga0316582_0611377 | |||
| 1336 | Ga0316584_0099898 | |||
| 1337 | Ga0316584_0646624 | |||
| 1338 | Ga0373925_0020230 | |||
| 1339 | Ga0373925_0038166 | |||
| 1340 | Ga0373925_0065943 | |||
| 1341 | Ga0373925_0478968 | |||
| 1342 | Ga0373925_0600246 | |||
| 1343 | Ga0373925_1228752 | |||
| 1344 | Ga0395900_0364481 | |||
| 1345 | Ga0395900_0696059 | |||
| 1346 | Ga0395898_0261061 | |||
| 1347 | Ga0395905_0047110 | |||
| 1348 | Ga0395905_0077750 | |||
| 1349 | Ga0436364_0026312 | |||
| 1350 | Ga0436364_0067153 | |||
| 1351 | Ga0436364_0136064 | |||
| 1352 | Ga0436364_0262364 | |||
| 1353 | Ga0436364_0311741 | |||
| 1354 | Ga0436364_0389284 | |||
| 1355 | Ga0436364_0496103 | |||
| 1356 | Ga0436364_0552456 | |||
| 1357 | Ga0436364_0574640 | |||
| 1358 | Ga0436364_0784007 | |||
| 1359 | Ga0436364_0821174 | |||
| 1360 | Ga0436364_0912738 | |||
| 1361 | Ga0436364_1142408 | |||
| 1362 | Ga0436364_1247484 | |||
| 1363 | Ga0436364_1361457 | |||
| 1364 | Ga0395901_0400536 | |||
| 1365 | Ga0242420_128757 | |||
| 1366 | Ga0400483_032406 | |||
| 1367 | Ga0400483_033097 | |||
| 1368 | Ga0400483_052164 | |||
| 1369 | Ga0400483_186097 | |||
| 1370 | Ga0400483_211902 | |||
| 1371 | Ga0400489_88380 | |||
| 1372 | Ga0237816_06353 | |||
| 1373 | Ga0436365_0099132 | |||
| 1374 | Ga0436365_0101855 | |||
| 1375 | Ga0436365_0134618 | |||
| 1376 | Ga0436365_0350875 | |||
| 1377 | Ga0436365_0432071 | |||
| 1378 | Ga0436365_0455844 | |||
| 1379 | Ga0436365_0877254 | |||
| 1380 | Ga0436365_0941632 | |||
| 1381 | Ga0436365_1188082 | |||
| 1382 | Ga0436365_1377575 | |||
| 1383 | Ga0436365_1506243 | |||
| 1384 | Ga0436365_1630350 | |||
| 1385 | Ga0436360_0132547 | |||
| 1386 | Ga0436360_0354756 | |||
| 1387 | Ga0436360_0412700 | |||
| 1388 | Ga0436360_0482190 | |||
| 1389 | Ga0436360_0642530 | |||
| 1390 | Ga0436360_0691728 | |||
| 1391 | Ga0436360_0692134 | |||
| 1392 | Ga0436360_0712565 | |||
| 1393 | Ga0436360_0750634 | |||
| 1394 | Ga0436360_0762232 | |||
| 1395 | Ga0436360_0820467 | |||
| 1396 | Ga0436360_0922519 | |||
| 1397 | Ga0436360_1045531 | |||
| 1398 | Ga0436360_1046148 | |||
| 1399 | Ga0436360_1049092 | |||
| 1400 | Ga0436360_1158442 | |||
| 1401 | Ga0436360_1163812 | |||
| 1402 | Ga0436360_1267009 | |||
| 1403 | Ga0436360_1300469 | |||
| 1404 | Ga0436361_0073048 | |||
| 1405 | Ga0436361_0394929 | |||
| 1406 | Ga0436361_0463638 | |||
| 1407 | Ga0436361_0564699 | |||
| 1408 | Ga0436361_0606387 | |||
| 1409 | Ga0436361_0825970 | |||
| 1410 | Ga0436361_0909258 | |||
| 1411 | Ga0436361_1050384 | |||
| 1412 | Ga0436361_1098516 | |||
| 1413 | Ga0436363_0089847 | |||
| 1414 | Ga0436363_0097764 | |||
| 1415 | Ga0436363_0445429 | |||
| 1416 | Ga0436363_0626107 | |||
| 1417 | Ga0436363_0764721 | |||
| 1418 | Ga0436363_0802862 | |||
| 1419 | Ga0436363_0804382 | |||
| 1420 | Ga0436363_0886299 | |||
| 1421 | Ga0436363_0887481 | |||
| 1422 | Ga0436363_0931784 | |||
| 1423 | Ga0436363_1029642 | |||
| 1424 | Ga0436363_1401173 | |||
| 1425 | Ga0436363_1425622 | |||
| 1426 | Ga0436363_1459617 | |||
| 1427 | Ga0436362_0053316 | |||
| 1428 | Ga0436362_0204187 | |||
| 1429 | Ga0436362_0502692 | |||
| 1430 | Ga0436362_0833081 | |||
| 1431 | Ga0436362_0959369 | |||
| 1432 | Ga0436362_1036040 | |||
| 1433 | Ga0436362_1175474 | |||
| 1434 | Ga0436362_1221127 | |||
| 1435 | Ga0436362_1298877 | |||
| 1436 | Ga0451805_024535 | |||
| 1437 | Ga0451849_0990398 | |||
| 1438 | Ga0451855_1804371 | |||
| 1439 | Ga0439445_0089811 | |||
| 1440 | Ga0439449_0212519 | |||
| 1441 | Ga0439450_188232 | |||
| 1442 | Ga0450902_040382 | |||
| 1443 | Ga0439459_0031525 | |||
| 1444 | Ga0439460_0116174 | |||
| 1445 | Ga0451577_0073407 | |||
| 1446 | Ga0466972_0216659 | |||
| 1447 | Ga0466966_0139838 | |||
| 1448 | Ga0466966_0171651 | |||
| 1449 | Ga0466961_0221581 | |||
| 1450 | Ga0466963_0263275 | |||
| 1451 | Ga0466963_0391939 | |||
| 1452 | Ga0466963_0644539 | |||
| 1453 | Ga0453684_0049274 | |||
| 1454 | Ga0453684_0065354 | |||
| 1455 | Ga0453684_0360885 | |||
| 1456 | Ga0466971_0403839 | |||
| 1457 | Ga0466968_0005785 | |||
| 1458 | Ga0466968_0047732 | |||
| 1459 | Ga0466970_0099510 | |||
| 1460 | Ga0466970_0233471 | |||
| 1461 | Ga0466970_0369138 | |||
| 1462 | Ga0466957_0034269 | |||
| 1463 | Ga0466957_0334113 | |||
| 1464 | Ga0466957_0599002 | |||
| 1465 | Ga0466959_0008535 | |||
| 1466 | Ga0466959_0227083 | |||
| 1467 | Ga0466959_0688699 | |||
| 1468 | Ga0451576_0013414 | |||
| 1469 | Ga0451576_0019189 | |||
| 1470 | Ga0451576_1484497 | |||
| 1471 | Ga0466958_0010904 | |||
| 1472 | Ga0466958_0769111 | |||
| 1473 | Ga0466958_1000119 | |||
| 1474 | Ga0466967_0430576 | |||
| 1475 | Ga0466967_0524589 | |||
| 1476 | Ga0495629_0398968 | |||
| 1477 | Ga0495629_0498940 | |||
| 1478 | Ga0495651_0215306 | |||
| 1479 | Ga0495651_0301803 | |||
| 1480 | Ga0495580_0193883 | |||
| 1481 | Ga0495664_0126699 | |||
| 1482 | Ga0495664_0350496 | |||
| 1483 | Ga0495664_0444635 | |||
| 1484 | Ga0495664_0555541 | |||
| 1485 | Ga0495608_0020259 | |||
| 1486 | Ga0495608_0470082 | |||
| 1487 | Ga0495610_0041907 | |||
| 1488 | Ga0495618_0363012 | |||
| 1489 | Ga0495628_0111177 | |||
| 1490 | Ga0495628_0852406 | |||
| 1491 | Ga0495630_0565788 | |||
| 1492 | Ga0495630_0609621 | |||
| 1493 | Ga0495643_0193420 | |||
| 1494 | Ga0495652_0480675 | |||
| 1495 | Ga0495652_0604443 | |||
| 1496 | Ga0495640_0118134 | |||
| 1497 | Ga0495640_0276097 | |||
| 1498 | Ga0495640_0281870 | |||
| 1499 | Ga0495640_0416148 | |||
| 1500 | Ga0495645_0177017 | |||
| 1501 | Ga0495667_0011265 | |||
| 1502 | Ga0495667_0111876 | |||
| 1503 | Ga0495667_0253002 | |||
| 1504 | Ga0495656_0253503 | |||
| 1505 | Ga0495634_0585212 | |||
| 1506 | Ga0495634_0595726 | |||
| 1507 | Ga0495635_0115828 | |||
| 1508 | Ga0495635_0818761 | |||
| 1509 | Ga0495599_0204769 | |||
| 1510 | Ga0495599_0478230 | |||
| 1511 | Ga0495646_0043169 | |||
| 1512 | Ga0495647_0114017 | |||
| 1513 | Ga0495613_0344953 | |||
| 1514 | Ga0495670_0023718 | |||
| 1515 | Ga0495671_0118021 | |||
| 1516 | Ga0495600_0187500 | |||
| 1517 | Ga0495581_0132627 | |||
| 1518 | Ga0495581_0444152 | |||
| 1519 | Ga0495604_0122106 | |||
| 1520 | Ga0495604_0714751 | |||
| 1521 | Ga0495674_0131216 | |||
| 1522 | Ga0495674_0135998 | |||
| 1523 | Ga0495674_0337658 | |||
| 1524 | Ga0495672_0055640 | |||
| 1525 | Ga0495680_0432262 | |||
| 1526 | Ga0495680_0617636 | |||
| 1527 | Ga0495675_0342966 | |||
| 1528 | Ga0495684_0092397 | |||
| 1529 | Ga0495684_0282660 | |||
| 1530 | Ga0495684_0291274 | |||
| 1531 | Ga0495593_0178631 | |||
| 1532 | Ga0495593_0440891 | |||
| 1533 | Ga0495602_0000485 | |||
| 1534 | Ga0495602_0270153 | |||
| 1535 | Ga0496100_0057829 | |||
| 1536 | Ga0496100_0944927 | |||
| 1537 | Ga0496100_1088585 | |||
| 1538 | Ga0496103_0441661 | |||
| 1539 | Ga0496104_0331446 | |||
| 1540 | Ga0496106_0521066 | |||
| 1541 | Ga0496106_0691840 | |||
| 1542 | Ga0496106_1483829 | |||
| 1543 | Ga0496107_0172032 | |||
| 1544 | Ga0496107_0832662 | |||
| 1545 | Ga0496108_0187130 | |||
| 1546 | Ga0496110_0934239 | |||
| 1547 | Ga0496112_0650192 | |||
| 1548 | Ga0496112_0666289 | |||
| 1549 | Ga0496113_0215805 | |||
| 1550 | Ga0496114_0022466 | |||
| 1551 | Ga0496115_0248001 | |||
| 1552 | Ga0496115_0416443 | |||
| 1553 | Ga0496117_0046309 | |||
| 1554 | Ga0496117_0081488 | |||
| 1555 | Ga0496118_0226893 | |||
| 1556 | Ga0496119_0014326 | |||
| 1557 | Ga0496120_0039336 | |||
| 1558 | Ga0496122_0034813 | |||
| 1559 | Ga0496122_0142908 | |||
| 1560 | Ga0496122_0342058 | |||
| 1561 | Ga0496123_0035488 | |||
| 1562 | Ga0496123_0465134 | |||
| 1563 | Ga0496124_0430630 | |||
| 1564 | Ga0496125_0077073 | |||
| 1565 | Ga0496126_0037130 | |||
| 1566 | Ga0501306_015180 | |||
| 1567 | Ga0501306_068133 | |||
| 1568 | Ga0501308_003368 | |||
| 1569 | Ga0501309_007103 | |||
| 1570 | Ga0501310_000683 | |||
| 1571 | Ga0501310_005178 | |||
| 1572 | Ga0501304_001554 | |||
| 1573 | Ga0501305_028110 | |||
| 1574 | Ga0501305_028583 | |||
| 1575 | Ga0501305_031375 | |||
| 1576 | Ga0501305_049749 | |||
| 1577 | Ga0501307_001852 | |||
| 1578 | Ga0501312_000345 | |||
| 1579 | Ga0501314_002948 | |||
| 1580 | Ga0501314_004521 | |||
| 1581 | Ga0501314_020724 | |||
| 1582 | Ga0501315_004343 | |||
| 1583 | Ga0501315_022158 | |||
| 1584 | Ga0501315_032445 | |||
| 1585 | Ga0501316_002496 | |||
| 1586 | Ga0501316_040537 | |||
| 1587 | Ga0501316_050396 | |||
| 1588 | Ga0501317_000277 | |||
| 1589 | Ga0501317_020258 | |||
| 1590 | Ga0501318_000161 | |||
| 1591 | Ga0501318_020082 | |||
| 1592 | Ga0501319_004211 | |||
| 1593 | Ga0501319_006428 | |||
| 1594 | Ga0501321_008612 | |||
| 1595 | Ga0501322_000431 | |||
| 1596 | Ga0501335_026376 | |||
| 1597 | Ga0501031_0063468 | |||
| 1598 | Ga0501031_0773388 | |||
| 1599 | Ga0501032_0168379 | |||
| 1600 | Ga0501032_0169368 | |||
| 1601 | Ga0501032_0384316 | |||
| 1602 | Ga0501032_0497975 | |||
| 1603 | Ga0501032_0931068 | |||
| 1604 | Ga0501033_0012312 | |||
| 1605 | Ga0501033_0063517 | |||
| 1606 | Ga0501033_0612923 | |||
| 1607 | Ga0501034_0034397 | |||
| 1608 | Ga0501034_0039819 | |||
| 1609 | Ga0501034_0048634 | |||
| 1610 | Ga0501034_0086405 | |||
| 1611 | Ga0501034_0129964 | |||
| 1612 | Ga0501034_0237333 | |||
| 1613 | Ga0501034_0250745 | |||
| 1614 | Ga0501034_0498819 | |||
| 1615 | Ga0501034_0535543 | |||
| 1616 | Ga0501034_0576733 | |||
| 1617 | Ga0501036_0175736 | |||
| 1618 | Ga0501036_0312760 | |||
| 1619 | Ga0501036_0313371 | |||
| 1620 | Ga0501037_0013539 | |||
| 1621 | Ga0501037_0034255 | |||
| 1622 | Ga0501037_0082879 | |||
| 1623 | Ga0501037_0098680 | |||
| 1624 | Ga0501037_0133592 | |||
| 1625 | Ga0501037_0559009 | |||
| 1626 | Ga0501038_0035903 | |||
| 1627 | Ga0501038_0163747 | |||
| 1628 | Ga0501038_0304259 | |||
| 1629 | Ga0501038_0656260 | |||
| 1630 | Ga0501038_0712322 | |||
| 1631 | Ga0501038_1085678 | |||
| 1632 | Ga0501039_0102026 | |||
| 1633 | Ga0501039_0165934 | |||
| 1634 | Ga0501039_0564415 | |||
| 1635 | Ga0501042_0418199 | |||
| 1636 | Ga0501042_0427825 | |||
| 1637 | Ga0501043_0189844 | |||
| 1638 | Ga0501043_0401744 | |||
| 1639 | Ga0501046_0091963 | |||
| 1640 | Ga0501046_0555579 | |||
| 1641 | Ga0501047_0090947 | |||
| 1642 | Ga0501047_0106961 | |||
| 1643 | Ga0501047_0130314 | |||
| 1644 | Ga0501047_0259811 | |||
| 1645 | Ga0501047_0487821 | |||
| 1646 | Ga0501047_0492821 | |||
| 1647 | Ga0501047_0531505 | |||
| 1648 | Ga0501047_0713589 | |||
| 1649 | Ga0501047_0915723 | |||
| 1650 | Ga0501048_0144326 | |||
| 1651 | Ga0501048_0482404 | |||
| 1652 | Ga0501067_0016522 | |||
| 1653 | Ga0501067_0125509 | |||
| 1654 | Ga0501067_0342004 | |||
| 1655 | Ga0501068_0142232 | |||
| 1656 | Ga0501068_0433657 | |||
| 1657 | Ga0501069_0136436 | |||
| 1658 | Ga0501069_0178140 | |||
| 1659 | Ga0501069_0198667 | |||
| 1660 | Ga0501070_0030178 | |||
| 1661 | Ga0501070_0064080 | |||
| 1662 | Ga0501070_0115075 | |||
| 1663 | Ga0501070_0343637 | |||
| 1664 | Ga0501071_0186977 | |||
| 1665 | Ga0501071_0413290 | |||
| 1666 | Ga0501071_0579129 | |||
| 1667 | Ga0501072_0230389 | |||
| 1668 | Ga0501072_0572371 | |||
| 1669 | Ga0501072_0575228 | |||
| 1670 | Ga0501073_0014091 | |||
| 1671 | Ga0501073_0018783 | |||
| 1672 | Ga0501073_0033095 | |||
| 1673 | Ga0501073_0229877 | |||
| 1674 | Ga0501073_0481714 | |||
| 1675 | Ga0501073_0488957 | |||
| 1676 | Ga0501073_0699411 | |||
| 1677 | Ga0501073_0731688 | |||
| 1678 | Ga0501073_0735041 | |||
| 1679 | Ga0501073_0754933 | |||
| 1680 | Ga0501074_0029627 | |||
| 1681 | Ga0501074_0142168 | |||
| 1682 | Ga0501074_0183239 | |||
| 1683 | Ga0501074_0788082 | |||
| 1684 | Ga0501076_0800382 | |||
| 1685 | Ga0501077_0040887 | |||
| 1686 | Ga0501077_0531919 | |||
| 1687 | Ga0501238_000510 | |||
| 1688 | Ga0501247_022228 | |||
| 1689 | Ga0501259_132926 | |||
| 1690 | Ga0501079_0485729 | |||
| 1691 | Ga0501079_0610234 | |||
| 1692 | Ga0501080_0032514 | |||
| 1693 | Ga0501080_0057218 | |||
| 1694 | Ga0501080_0150116 | |||
| 1695 | Ga0501080_0294704 | |||
| 1696 | Ga0501080_0379714 | |||
| 1697 | Ga0501081_0894952 | |||
| 1698 | Ga0501083_0005155 | |||
| 1699 | Ga0501083_0028982 | |||
| 1700 | Ga0501083_0032553 | |||
| 1701 | Ga0501083_0050437 | |||
| 1702 | Ga0501083_0068545 | |||
| 1703 | Ga0501083_0095492 | |||
| 1704 | Ga0501083_0417359 | |||
| 1705 | Ga0501083_0473995 | |||
| 1706 | Ga0501083_0541800 | |||
| 1707 | Ga0501035_0036292 | |||
| 1708 | Ga0501035_0098049 | |||
| 1709 | Ga0501035_0200897 | |||
| 1710 | Ga0501035_0269893 | |||
| 1711 | Ga0501035_0425899 | |||
| 1712 | Ga0501044_0053063 | |||
| 1713 | Ga0501044_0061730 | |||
| 1714 | Ga0501044_0188460 | |||
| 1715 | Ga0501044_0211728 | |||
| 1716 | Ga0501044_0290790 | |||
| 1717 | Ga0501044_0330521 | |||
| 1718 | Ga0501044_0678553 | |||
| 1719 | Ga0501044_0879212 | |||
| 1720 | Ga0501044_1130440 | |||
| 1721 | Ga0501045_0262842 | |||
| 1722 | Ga0501212_010338 | |||
| 1723 | nmdc:mga03683_341226_c1 | |||
| 1724 | nmdc:mga03n38_653033_c1 | |||
| 1725 | nmdc:mga0k408_150606_c1 | |||
| 1726 | nmdc:mga0k408_313269_c1 | |||
| 1727 | nmdc:mga06z11_161611_c1 | |||
| 1728 | nmdc:mga07m45_453955_c1 | |||
| 1729 | nmdc:mga05p37_875685_c1 | |||
| 1730 | nmdc:mga09592_163503_c1 | |||
| 1731 | nmdc:mga06r32_69327_c1 | |||
| 1732 | nmdc:mga08y16_457969_c1 | |||
| 1733 | nmdc:mga08y16_703702_c1 | |||
| 1734 | nmdc:mga0n895_81925_c1 | |||
| 1735 | Ga0495601_0005148 | |||
| 1736 | Ga0495601_0145863 | |||
| 1737 | Ga0495601_0160784 | |||
| 1738 | Ga0495612_0001186 | |||
| 1739 | Ga0495612_0176459 | |||
| 1740 | Ga0495595_0006042 | |||
| 1741 | Ga0495595_0088509 | |||
| 1742 | Ga0495619_0263086 | |||
| 1743 | Ga0495619_0644914 | |||
| 1744 | Ga0500643_004537 | |||
| 1745 | Ga0500566_0218248 | |||
| 1746 | Ga0500641_0039459 | |||
| 1747 | Ga0500650_0198727 | |||
| 1748 | Ga0500554_088867 | |||
| 1749 | Ga0500569_092460 | |||
| 1750 | Ga0500595_011638 | |||
| 1751 | Ga0500608_163751 | |||
| 1752 | Ga0500652_000140 | |||
| 1753 | Ga0500559_0028203 | |||
| 1754 | Ga0500568_0032927 | |||
| 1755 | Ga0500577_0046253 | |||
| 1756 | Ga0500616_0067312 | |||
| 1757 | Ga0500622_0018116 | |||
| 1758 | Ga0500636_0018083 | |||
| 1759 | Ga0500636_0278219 | |||
| 1760 | Ga0501084_0188858 | |||
| 1761 | Ga0501084_0582831 | |||
| 1762 | Ga0501084_0911847 | |||
| 1763 | Ga0587084_001885 | |||
| 1764 | Ga0587084_028019 | |||
| 1765 | Ga0587066_014955 | |||
| 1766 | Ga0587073_0078518 | |||
| 1767 | Ga0587077_017795 | |||
| 1768 | Ga0587082_073793 | |||
| 1769 | Ga0587083_0028720 | |||
| 1770 | Ga0587088_095401 | |||
| 1771 | Ga0587089_031603 | |||
| 1772 | Ga0587090_006217 | |||
| 1773 | Ga0587098_048214 | |||
| 1774 | Ga0587098_059081 | |||
| 1775 | Ga0587101_107187 | |||
| 1776 | Ga0587062_016433 | |||
| 1777 | Ga0587062_048532 | |||
| 1778 | Ga0587062_050693 | |||
| 1779 | Ga0587067_034366 | |||
| 1780 | Ga0587067_075086 | |||
| 1781 | Ga0587067_168923 | |||
| 1782 | Ga0587068_009911 | |||
| 1783 | Ga0587068_034293 | |||
| 1784 | Ga0587102_011045 | |||
| 1785 | Ga0587107_051534 | |||
| 1786 | Ga0587119_025095 | |||
| 1787 | Ga0587124_006180 | |||
| 1788 | Ga0587071_005211 | |||
| 1789 | Ga0587071_023287 | |||
| 1790 | Ga0587111_0021274 | |||
| 1791 | Ga0501082_0068490 | |||
| 1792 | Ga0501082_0325904 | |||
| 1793 | Ga0501082_1252064 | |||
| 1794 | Ga0466962_0264109 | |||
| 1795 | Ga0466962_0345417 | |||
| 1796 | Ga0530510_0541695 | |||
| 1797 | 2508735858 | |||
| 1798 | 2509078181 | |||
| 1799 | 2510842510 | |||
| 1800 | 2523466051 | |||
| 1801 | 2545677347 | |||
| 1802 | 2644298330 | |||
| 1803 | 2644656557 | |||
| 1804 | 2644731515 | |||
| 1805 | 2644734893 | |||
| 1806 | 2644744406 | |||
| 1807 | 2671694512 | |||
| 1808 | 2738745711 | |||
| 1809 | 2739347255 | |||
| 1810 | 2739354941 | |||
| 1811 | 2774874179 | |||
| 1812 | 2776259131 | |||
| 1813 | 2819242281 | |||
| 1814 | 2819720916 | |||
| 1815 | 2828310142 | |||
| 1816 | 2829749924 | |||
| 1817 | 2835319206 | |||
| 1818 | 2841761372 | |||
| 1819 | 2841913375 | |||
| 1820 | 2841919122 | |||
| 1821 | 2844104397 | |||
| 1822 | 2851184444 | |||
| 1823 | 2851247385 | |||
| 1824 | 2854685314 | |||
| 1825 | 2861692143 | |||
| 1826 | 2882462593 | |||
| 1827 | 2884300458 | |||
| 1828 | 2891088716 | |||
| 1829 | 2894234006 | |||
| 1830 | 2898797002 | |||
| 1831 | 2917699261 | |||
| 1832 | 2939671397 | |||
| 1833 | 2989778441 | |||
| 1834 | 3003667734 | |||
| 1835 | 641640685 | |||
| 1836 | 643599639 | |||
| 1837 | 8001849270 | |||
| 1838 | 8005248256 | |||
| 1839 | 8005659740 | |||
| 1840 | 8057530445 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8cdv-assembly1.cif.gz_H | rnase r bound to a 30s degradation intermediate (state ii) | 0.9829 | 18 | 127 |
| 7nhn-assembly1.cif.gz_h | vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes | 0.9788 | 12 | 151 |
| 7nhl-assembly1.cif.gz_h | vgaa-lc, an antibiotic resistance abcf, in complex with 70s ribosome from staphylococcus aureus | 0.9753 | 12 | 151 |
| 1hus-assembly1.cif.gz_A | ribosomal protein s7 | 0.9707 | 10 | 148 |
| 7nhn-assembly1.cif.gz_h | vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes | 0.9653 | 12 | 151 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1husA00 | Mainly Alpha;Orthogonal Bundle;Ribosomal Protein S7;Ribosomal protein S7/S5 | 0.9701 | 10 | 148 | 1.10.455.10 |
| 1husA00 | Mainly Alpha;Orthogonal Bundle;Ribosomal Protein S7;Ribosomal protein S7/S5 | 0.9629 | 10 | 148 | 1.10.455.10 |
| af_P48940_2_156_1.10.455.10 | Mainly Alpha;Orthogonal Bundle;Ribosomal Protein S7;Ribosomal protein S7/S5 | 0.9581 | 3 | 156 | 1.10.455.10 |
| 5x8rg00 | Mainly Alpha;Orthogonal Bundle;Ribosomal Protein S7;Ribosomal protein S7/S5 | 0.9558 | 4 | 151 | 1.10.455.10 |
| 5mmjg00 | Mainly Alpha;Orthogonal Bundle;Ribosomal Protein S7;Ribosomal protein S7/S5 | 0.9547 | 2 | 154 | 1.10.455.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3S1UAE0-F1-model_v4 | 30S ribosomal protein S7 | 0.9967 | 34 | 156 |
GO:0000049
GO:0003735 GO:0006412 GO:0015935 GO:0019843 |
| AF-A0A7Y2PLF6-F1-model_v4 | Ribosomal protein S7 | 0.9926 | 12 | 148 |
GO:0003735
GO:0006412 GO:0015935 GO:0019843 |
| AF-A0A3S1UAE0-F1-model_v4 | 30S ribosomal protein S7 | 0.9887 | 34 | 156 |
GO:0000049
GO:0003735 GO:0006412 GO:0015935 GO:0019843 |
| AF-Q02VK9-F1-model_v4 | Small ribosomal subunit protein uS7 (30S ribosomal protein S7) | 0.9829 | 3 | 156 |
GO:0000049
GO:0003735 GO:0006412 GO:0015935 GO:0019843 |
| AF-A0A838VDW6-F1-model_v4 | 30S ribosomal protein S7 | 0.9826 | 51 | 156 |
GO:0000049
GO:0003735 GO:0006412 GO:0015935 GO:0019843 |