F497161

General Info

Members Datasets Scaffolds Average Seq Length
2946 1379 2231 276

Family's Representative Sequence

Representative Sequence 3300041491|Ga0451833_0223154|Ga0451833_0223154_903_1841
Length 312
Sequence MLKNHGDGTHLCYWRFPLYIGIPKTAFRLATRRAAMVAKTDIRAFDTGHPLKVMDPIWDSLREEARLAAERDPVLAAFLYSTVINYHSLEECVIHRICERLDHPDMQANLLRQTFEEMLLDWPDWSSILRVDIQAIYDRDPACLRFMEAVLYFKGFHALQTHRLAHWLLNRGRRDFALYLQSRSSSVFQTDINPAARIGKGIFLDHATGLVVGETAVIGDNVSILHGVTLGGTGKEGADRHPKIGSGVMIGAGAKILGNIEIGYCSRVAAGSVVLKAVPPKKTVAGVPAKVVGEAGCSEPSRNMDQVIGADI

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
3 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
4 2509276019 Ensifer aridi TW10 Isolate Nodule
5 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
6 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
7 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
8 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
9 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
10 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
11 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
12 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
13 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
14 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
15 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
16 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
17 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
18 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
19 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
20 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
21 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
22 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
23 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
24 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
25 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
26 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
27 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
28 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
29 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
30 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
31 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
32 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
33 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
34 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
35 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
36 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
37 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
38 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
39 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
40 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
41 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
42 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
43 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
44 2516143018 Ensifer sp. BR816 Isolate Nodule
45 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
46 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
47 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
48 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
49 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
50 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
51 2519899620 Rhizobium sp. Pop5 Isolate Nodule
52 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
53 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
54 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
55 2534681786 Brucella suis 92/29 Isolate Unclassified
56 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
57 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
58 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
59 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
60 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
61 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
62 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
63 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
64 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
65 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
66 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
67 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
68 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
69 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
70 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
71 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
72 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
73 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
74 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
75 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
76 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
77 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
78 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
79 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
80 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
81 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
82 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
83 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
84 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
85 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
86 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
87 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
88 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
89 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
90 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
91 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
92 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
93 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
94 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
95 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
96 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
97 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
98 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
99 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
100 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
101 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
102 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
103 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
104 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
105 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
106 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
107 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
108 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
109 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
110 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
111 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
112 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
113 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
114 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
115 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
116 2643221557 Ensifer sp. Root558 Isolate Unclassified
117 2643221558 Rhizobium sp. Root149 Isolate Unclassified
118 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
119 2643221568 Rhizobium sp. Root564 Isolate Unclassified
120 2643221582 Rhizobium sp. Root651 Isolate Unclassified
121 2643221599 Rhizobium sp. Root708 Isolate Unclassified
122 2643221607 Rhizobium sp. Root73 Isolate Unclassified
123 2643221610 Ensifer sp. Root74 Isolate Unclassified
124 2643221618 Ensifer sp. Root231 Isolate Unclassified
125 2643221626 Ensifer sp. Root31 Isolate Unclassified
126 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
127 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
128 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
129 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
130 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
131 2643221655 Ensifer sp. Root1252 Isolate Unclassified
132 2643221659 Ensifer sp. Root127 Isolate Unclassified
133 2643221668 Ensifer sp. Root423 Isolate Unclassified
134 2643221675 Ensifer sp. Root1298 Isolate Unclassified
135 2643221680 Ensifer sp. Root1312 Isolate Unclassified
136 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
137 2643221688 Rhizobium sp. Root482 Isolate Unclassified
138 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
139 2643221693 Rhizobium sp. Root491 Isolate Unclassified
140 2643221698 Ensifer sp. Root142 Isolate Unclassified
141 2643221712 Ensifer sp. Root258 Isolate Unclassified
142 2643221718 Rhizobium sp. Root268 Isolate Unclassified
143 2643221719 Rhizobium sp. Root274 Isolate Unclassified
144 2643221723 Ensifer sp. Root278 Isolate Unclassified
145 2643221726 Ensifer sp. Root954 Isolate Unclassified
146 2643221733 Bosea sp. Root381 Isolate Unclassified
147 2643221734 Bosea sp. Root670 Isolate Unclassified
148 2643221736 Bosea sp. Root483D1 Isolate Unclassified
149 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
150 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
151 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
152 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
153 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
154 2718217882 Rhizobium sp. N741 Isolate Nodule
155 2718217927 Rhizobium sp. N324 Isolate Nodule
156 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
157 2718218009 Rhizobium sp. N561 Isolate Nodule
158 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
159 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
160 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
161 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
162 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
163 2718218363 Rhizobium sp. N113 Isolate Nodule
164 2718218365 Rhizobium sp. N731 Isolate Nodule
165 2718218366 Rhizobium sp. N621 Isolate Nodule
166 2718218423 Rhizobium sp. N941 Isolate Nodule
167 2721755514 Rhizobium sp. N6212 Isolate Nodule
168 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
169 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
170 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
171 2721755809 Rhizobium sp. N541 Isolate Nodule
172 2721755810 Rhizobium sp. N871 Isolate Nodule
173 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
174 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
175 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
176 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
177 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
178 2728369365 Rhizobium sp. N1341 Isolate Nodule
179 2728369397 Rhizobium sp. N1314 Isolate Nodule
180 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
181 2738541293 Rhizobium sp. GV031 Isolate Unclassified
182 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
183 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
184 2738543024 Aminobacter sp. AP02 Isolate Unclassified
185 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
186 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
187 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
188 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
189 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
190 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
191 2773857925 Microvirga vignae BR3299 Isolate Unclassified
192 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
193 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
194 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
195 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
196 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
197 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
198 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
199 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
200 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
201 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
202 2791355256 Rhizobium sp. M10 Isolate Nodule
203 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
204 2791355260 Rhizobium sp. L9 Isolate Nodule
205 2791355261 Rhizobium sp. J15 Isolate Nodule
206 2791355262 Rhizobium sp. M1 Isolate Nodule
207 2791355263 Rhizobium chutanense C5 Isolate Nodule
208 2791355264 Rhizobium sp. S9 Isolate Nodule
209 2791355265 Rhizobium sp. H4 Isolate Nodule
210 2791355266 Rhizobium sp. L43 Isolate Nodule
211 2791355267 Rhizobium sp. L18 Isolate Nodule
212 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
213 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
214 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
215 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
216 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
217 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
218 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
219 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
220 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
221 2802429633 Rhizobium anhuiense J3 Isolate Nodule
222 2802429634 Rhizobium anhuiense S10 Isolate Nodule
223 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
224 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
225 2802429637 Rhizobium anhuiense C15 Isolate Nodule
226 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
227 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
228 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
229 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
230 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
231 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
232 2818991467 Bosea vestrisii 3192 Isolate Unclassified
233 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
234 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
235 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
236 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
237 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
238 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
239 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
240 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
241 2838048938 Rhizobium pisi 27/80 Isolate Nodule
242 2838061910 Rhizobium phaseoli L15 Isolate Nodule
243 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
244 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
245 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
246 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
247 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
248 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
249 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
250 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
251 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
252 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
253 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
254 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
255 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
256 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
257 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
258 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
259 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
260 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
261 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
262 2841760612 Bosea sp. Tri-49 Isolate Nodule
263 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
264 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
265 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
266 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
267 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
268 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
269 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
270 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
271 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
272 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
273 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
274 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
275 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
276 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
277 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
278 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
279 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
280 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
281 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
282 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
283 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
284 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
285 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
286 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
287 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
288 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
289 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
290 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
291 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
292 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
293 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
294 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
295 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
296 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
297 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
298 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
299 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
300 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
301 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
302 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
303 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
304 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
305 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
306 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
307 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
308 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
309 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
310 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
311 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
312 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
313 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
314 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
315 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
316 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
317 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
318 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
319 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
320 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
321 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
322 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
323 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
324 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
325 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
326 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
327 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
328 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
329 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
330 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
331 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
332 2844104063 Bosea sp. Tri-39 Isolate Nodule
333 2844163670 Ensifer sp. 1H6 Isolate Unclassified
334 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
335 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
336 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
337 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
338 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
339 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
340 2851182111 Bosea sp. Tri-44 Isolate Nodule
341 2851246043 Bosea sp. Tri-54 Isolate Nodule
342 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
343 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
344 2854911287 Brucella lupini LUP21 Isolate Unclassified
345 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
346 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
347 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
348 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
349 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
350 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
351 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
352 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
353 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
354 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
355 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
356 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
357 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
358 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
359 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
360 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
361 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
362 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
363 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
364 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
365 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
366 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
367 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
368 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
369 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
370 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
371 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
372 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
373 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
374 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
375 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
376 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
377 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
378 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
379 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
380 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
381 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
382 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
383 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
384 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
385 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
386 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
387 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
388 2902330777 Methylobacterium sp. 2A Isolate Unclassified
389 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
390 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
391 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
392 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
393 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
394 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
395 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
396 2909042592 Labrys sp. LIt4 Isolate Nodule
397 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
398 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
399 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
400 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
401 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
402 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
403 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
404 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
405 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
406 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
407 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
408 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
409 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
410 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
411 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
412 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
413 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
414 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
415 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
416 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
417 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
418 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
419 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
420 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
421 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
422 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
423 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
424 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
425 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
426 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
427 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
428 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
429 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
430 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
431 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
432 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
433 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
434 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
435 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
436 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
437 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
438 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
439 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
440 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
441 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
442 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
443 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
444 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
445 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
446 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
447 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
448 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
449 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
450 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
451 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
452 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
453 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
454 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
455 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
456 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
457 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
458 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
459 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
460 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
461 2933599457 Rhizobium phaseoli M3 Isolate Nodule
462 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
463 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
464 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
465 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
466 2936381700 Rhizobium chutanense C16 Isolate Unclassified
467 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
468 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
469 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
470 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
471 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
472 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
473 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
474 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
475 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
476 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
477 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
478 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
479 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
480 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
481 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
482 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
483 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
484 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
485 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
486 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
487 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
488 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
489 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
490 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
491 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
492 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
493 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
494 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
495 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
496 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
497 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
498 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
499 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
500 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
501 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
502 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
503 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
504 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
505 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
506 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
507 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
508 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
509 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
510 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
511 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
512 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
513 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
514 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
515 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
516 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
517 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
518 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
519 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
520 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
521 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
522 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
523 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
524 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
525 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
526 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
527 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
528 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
529 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
530 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
531 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
532 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
533 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
534 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
535 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
536 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
537 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
538 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
539 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
540 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
541 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
542 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
543 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
544 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
545 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
546 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
547 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
548 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
549 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
550 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
551 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
552 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
553 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
554 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
555 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
556 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
557 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
558 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
559 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
560 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
561 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
562 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
563 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
564 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
565 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
566 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
567 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
568 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
569 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
570 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
571 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
572 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
573 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
574 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
575 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
576 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
577 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
578 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
579 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
580 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
581 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
582 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
583 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
584 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
585 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
586 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
587 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
588 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
589 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
590 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
591 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
592 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
593 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
594 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
595 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
596 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
597 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
598 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
599 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
600 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
601 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
602 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
603 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
604 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
605 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
606 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
607 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
608 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
609 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
610 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
611 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
612 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
613 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
614 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
615 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
616 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
617 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
618 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
619 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
620 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
621 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
622 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
623 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
624 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
625 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
626 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
627 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
628 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
629 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
630 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
631 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
632 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
633 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
634 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
635 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
636 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
637 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
638 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
639 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
640 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
641 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
642 2996887358 Rhizobium sp. R711 Isolate Nodule
643 2996893221 Rhizobium sp. R635 Isolate Nodule
644 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
645 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
646 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
647 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
648 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
649 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
650 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
651 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
652 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
653 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
654 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
655 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
656 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
657 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
658 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
659 3300001430 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 Metagenome Rhizosphere
660 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
661 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
662 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
663 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
664 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
665 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
666 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
667 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
668 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
669 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
670 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
671 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
672 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
673 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
674 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
675 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
676 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
677 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
678 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
679 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
680 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
681 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
682 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
683 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
684 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
685 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
686 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
687 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
688 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
689 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
690 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
691 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
692 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
693 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
694 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
695 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
696 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
697 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
698 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
699 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
700 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
701 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
702 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
703 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
704 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
705 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
706 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
707 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
708 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
709 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
710 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
711 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
712 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
713 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
714 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
715 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
716 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
717 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
718 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
719 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
720 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
721 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
722 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
723 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
724 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
725 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
726 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
727 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
728 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
729 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
730 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
731 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
732 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
733 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
734 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
735 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
736 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
737 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
738 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
739 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
740 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
741 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
742 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
743 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
744 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
745 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
746 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
747 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
748 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
749 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
750 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
751 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
752 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
753 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
754 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
755 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
756 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
757 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
758 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
759 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
760 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
761 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
762 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
763 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
764 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
765 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
766 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
767 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
768 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
769 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
770 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
771 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
772 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
773 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
774 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
775 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
776 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
777 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
778 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
779 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
780 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
781 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
782 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
783 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
784 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
785 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
786 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
787 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
788 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
789 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
790 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
791 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
792 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
793 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
794 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
795 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
796 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
797 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
798 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
799 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
800 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
801 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
802 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
803 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
804 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
805 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
806 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
807 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
808 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
809 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
810 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
811 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
812 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
813 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
814 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
815 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
816 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
817 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
818 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
819 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
820 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
821 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
822 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
823 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
824 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
825 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
826 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
827 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
828 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
829 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
830 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
831 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
832 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
833 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
834 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
835 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
836 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
837 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
838 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
839 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
840 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
841 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
842 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
843 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
844 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
845 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
846 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
847 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
848 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
849 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
850 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
851 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
852 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
853 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
854 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
855 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
856 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
857 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
858 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
859 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
860 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
861 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
862 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
863 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
864 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
865 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
866 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
867 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
868 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
869 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
870 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
871 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
872 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
873 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
874 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
875 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
876 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
877 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
878 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
879 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
880 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
881 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
882 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
883 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
884 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
885 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
886 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
887 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
888 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
889 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
890 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
891 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
892 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
893 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
894 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
895 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
896 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
897 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
898 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
899 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
900 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
901 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
902 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
903 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
904 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
905 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
906 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
907 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
908 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
909 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
910 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
911 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
912 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
913 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
914 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
915 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
916 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
917 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
918 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
919 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
920 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
921 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
922 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
923 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
924 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
925 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
926 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
927 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
928 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
929 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
930 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
931 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
932 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
933 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
934 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
935 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
936 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
937 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
938 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
939 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
940 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
941 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
942 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
943 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
944 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
945 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
946 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
947 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
948 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
949 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
950 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
951 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
952 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
953 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
954 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
955 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
956 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
957 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
958 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
959 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
960 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
961 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
962 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
963 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
964 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
965 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
966 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
967 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
968 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
969 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
970 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
971 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
972 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
973 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
974 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
975 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
976 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
977 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
978 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
979 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
980 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
981 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
982 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
983 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
984 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
985 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
986 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
987 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
988 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
989 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
990 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
991 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
992 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
993 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
994 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
995 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
996 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
997 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
998 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
999 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
1000 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
1001 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
1002 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
1003 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
1004 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
1005 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
1006 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
1007 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
1008 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
1009 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
1010 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
1011 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
1012 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
1013 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
1014 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
1015 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
1016 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
1017 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
1018 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
1019 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
1020 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
1021 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
1022 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
1023 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
1024 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
1025 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
1026 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
1027 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
1028 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
1029 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
1030 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
1031 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
1032 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
1033 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
1034 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
1035 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
1036 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
1037 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
1038 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
1039 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
1040 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
1041 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
1042 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
1043 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
1044 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
1045 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
1046 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
1047 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
1048 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
1049 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
1050 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
1051 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
1052 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
1053 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
1054 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
1055 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
1056 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
1057 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
1058 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
1059 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
1060 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
1061 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
1062 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
1063 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
1064 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
1065 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
1066 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
1067 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
1068 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
1069 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
1070 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
1071 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
1072 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
1073 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
1074 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
1075 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
1076 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
1077 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
1078 3300041506 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT Metatranscriptome Unclassified
1079 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
1080 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
1081 3300041510 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT Metatranscriptome Unclassified
1082 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
1083 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
1084 3300041907 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT_extra_run Metatranscriptome Unclassified
1085 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
1086 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
1087 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
1088 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
1089 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
1090 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
1091 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
1092 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
1093 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
1094 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
1095 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
1096 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
1097 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
1098 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
1099 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
1100 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
1101 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
1102 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
1103 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
1104 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
1105 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
1106 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
1107 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
1108 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
1109 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
1110 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
1111 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
1112 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
1113 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
1114 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
1115 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
1116 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
1117 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
1118 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
1119 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
1120 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
1121 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
1122 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
1123 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
1124 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
1125 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
1126 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
1127 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
1128 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
1129 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
1130 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
1131 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
1132 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
1133 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
1134 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
1135 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
1136 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
1137 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
1138 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
1139 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
1140 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
1141 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
1142 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
1143 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
1144 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
1145 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
1146 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
1147 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
1148 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
1149 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
1150 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
1151 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
1152 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
1153 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
1154 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
1155 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
1156 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
1157 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
1158 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
1159 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
1160 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
1161 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
1162 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
1163 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
1164 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
1165 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
1166 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
1167 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
1168 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
1169 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
1170 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
1171 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
1172 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
1173 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
1174 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
1175 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
1176 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
1177 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
1178 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
1179 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
1180 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
1181 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
1182 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
1183 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
1184 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
1185 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
1186 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
1187 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
1188 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
1189 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
1190 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
1191 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
1192 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
1193 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
1194 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
1195 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
1196 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
1197 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
1198 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
1199 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
1200 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
1201 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
1202 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
1203 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
1204 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
1205 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
1206 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
1207 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
1208 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
1209 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
1210 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
1211 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
1212 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
1213 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
1214 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
1215 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1216 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1217 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1218 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
1219 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
1220 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
1221 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
1222 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
1223 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
1224 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
1225 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
1226 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
1227 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
1228 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
1229 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
1230 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
1231 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
1232 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
1233 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
1234 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
1235 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
1236 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
1237 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
1238 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
1239 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
1240 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
1241 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
1242 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
1243 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
1244 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
1245 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
1246 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
1247 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
1248 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
1249 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
1250 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
1251 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
1252 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
1253 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
1254 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
1255 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
1256 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
1257 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
1258 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
1259 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
1260 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
1261 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
1262 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
1263 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
1264 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
1265 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
1266 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
1267 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
1268 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
1269 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
1270 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
1271 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
1272 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
1273 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
1274 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
1275 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
1276 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
1277 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
1278 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
1279 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
1280 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
1281 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
1282 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
1283 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
1284 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
1285 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
1286 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
1287 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
1288 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
1289 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
1290 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
1291 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
1292 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
1293 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
1294 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
1295 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
1296 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
1297 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
1298 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
1299 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
1300 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
1301 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
1302 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
1303 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
1304 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
1305 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
1306 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
1307 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
1308 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1309 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1310 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1311 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1312 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1313 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1314 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1315 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1316 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
1317 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
1318 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
1319 641522639 Methylobacterium sp. 4-46 Isolate Nodule
1320 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
1321 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
1322 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
1323 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
1324 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
1325 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
1326 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
1327 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
1328 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
1329 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
1330 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
1331 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
1332 8005258706 Rhizobium sp. R693 Isolate Nodule
1333 8005275841 Rhizobium sp. N4311 Isolate Nodule
1334 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
1335 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
1336 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
1337 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
1338 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
1339 8005321885 Rhizobium sp. R72 Isolate Nodule
1340 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
1341 8005382845 Rhizobium sp. R634 Isolate Nodule
1342 8005395548 Rhizobium sp. R339 Isolate Nodule
1343 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
1344 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
1345 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
1346 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
1347 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
1348 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
1349 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
1350 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
1351 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
1352 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
1353 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
1354 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
1355 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
1356 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
1357 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
1358 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
1359 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
1360 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
1361 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
1362 8018176218 Rhizobium sp. N122 Isolate Nodule
1363 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
1364 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
1365 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
1366 8024501048 Rhizobium sp. H4 Isolate Nodule
1367 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
1368 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
1369 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
1370 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
1371 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
1372 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
1373 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
1374 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
1375 8056382006 Rhizobium croatiense 13T Isolate Nodule
1376 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
1377 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule
1378 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
1379 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 74.88
Metatranscriptomes 0.85
Isolates 24.27

Biome Distribution

Category Percentage (%)
Aerial Root 0.17
Bulb 0
Endosphere 9.71
Nodule 17.85
Rhizoplane 4.48
Rhizosphere 58.49
Stem 0
Stem Tuber 0
Unclassified 9.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214911870 2209111006 Bacteria 6751
2 ARcpr5oldR_c000058 3300000041 Bacteria 20592
3 ARSoilYngRDRAFT_c00199 3300000042 Bacteria 10042
4 ARcpr5yngRDRAFT_c000188 3300000043 Bacteria 9598
5 ARSoilOldRDRAFT_c000028 3300000044 Bacteria 32672
6 ARCol0oldRDRAFT_c00565 3300000045 Bacteria 3301
7 ARCol0yngRDRAFT_1000057 3300000652 Bacteria 20005
8 JGI24032J14994_100133 3300001430 Bacteria 3489
9 JGI24752J21851_1001260 3300001976 Bacteria 3439
10 JGI24746J21847_1000137 3300001977 Bacteria 9051
11 JGI24747J21853_1000013 3300001978 Bacteria 7120
12 JGI24740J21852_10000001 3300001979 Bacteria 168537
13 JGI24739J22299_10000400 3300001989 Bacteria 15068
14 JGI24737J22298_10000531 3300001990 Bacteria 13359
15 JGI24737J22298_10002432 3300001990 Bacteria 6639
16 JGI24750J21931_1000240 3300002070 Bacteria 9414
17 JGI24745J21846_1000114 3300002073 Bacteria 6121
18 JGI24748J21848_1000264 3300002074 Bacteria 6239
19 JGI24738J21930_10002058 3300002075 Bacteria 5391
20 JGI24749J21850_1003004 3300002076 Bacteria 2355
21 JGI24749J21850_1007729 3300002076 Bacteria 1499
22 JGI24744J21845_10001857 3300002077 Bacteria 4242
23 JGI24744J21845_10006387 3300002077 Bacteria 2446
24 JGI24035J26624_1000224 3300002126 Bacteria 5199
25 JGI24033J26618_1000662 3300002155 Bacteria 3301
26 JGI24034J26672_10001369 3300002239 Bacteria 3226
27 JGI24742J22300_10000135 3300002244 Bacteria 10797
28 JGI24742J22300_10004158 3300002244 Bacteria 2360
29 JGI25155J39150_1000011 3300002704 Bacteria 207685
30 JGI25156J39149_1000027 3300002705 Bacteria 127396
31 JGI25162J39368_1000923 3300002737 Bacteria 18856
32 JGI25162J39368_1001104 3300002737 Bacteria 16375
33 JGI25162J39368_1001271 3300002737 Bacteria 14357
34 JGI25154J39366_1000057 3300002738 Bacteria 110584
35 JGI25154J39366_1000368 3300002738 Bacteria 25167
36 JGI25158J39367_1000203 3300002739 Bacteria 14163
37 JGI25157J39369_1000010 3300002741 Bacteria 207685
38 JGI25152J39213_1001188 3300002773 Bacteria 11978
39 JGI25152J39213_1001618 3300002773 Bacteria 9407
40 JGI25152J39213_1005646 3300002773 Bacteria 3588
41 JGI25152J39213_1006889 3300002773 Bacteria 3007
42 JGI25150J39212_1000010 3300002774 Bacteria 236260
43 JGI25150J39212_1012292 3300002774 Bacteria 1521
44 JGI25159J45721_1000006 3300002987 Bacteria 188201
45 JGI25159J45721_1000375 3300002987 Bacteria 20707
46 JGI25159J45721_1000969 3300002987 Bacteria 12464
47 JGI25151J46595_10000066 3300003187 Bacteria 142963
48 JGI25151J46595_10000653 3300003187 Bacteria 29531
49 JGI25151J46595_10000963 3300003187 Bacteria 21956
50 JGI25151J46595_10013982 3300003187 Bacteria 3593
51 JGI25151J46595_10023001 3300003187 Bacteria 2577
52 JGI25151J46595_10025442 3300003187 Bacteria 2408
53 JGI25406J46586_10000165 3300003203 Bacteria 29331
54 JGI25406J46586_10000169 3300003203 Bacteria 29128
55 JGI25406J46586_10008097 3300003203 Bacteria 4773
56 JGI25406J46586_10019430 3300003203 Bacteria 2769
57 JGI25165J46597_1001156 3300003214 Bacteria 16375
58 JGI25165J46597_1001175 3300003214 Bacteria 16084
59 JGI25165J46597_1002353 3300003214 Bacteria 6349
60 JGI25153J46596_10001697 3300003215 Bacteria 13070
61 JGI25153J46596_10013236 3300003215 Bacteria 3501
62 JGI25153J46596_10013822 3300003215 Bacteria 3390
63 JGI25153J46596_10016477 3300003215 Bacteria 2957
64 rootH2_10091763 3300003320 Bacteria 5125
65 JGI25160J50197_1000004 3300003354 Bacteria 419797
66 JGI25160J50197_1000019 3300003354 Bacteria 233980
67 JGI25160J50197_1004333 3300003354 Bacteria 6151
68 JGI25160J50197_1010089 3300003354 Bacteria 3445
69 JGI25160J50197_1010772 3300003354 Bacteria 3286
70 JGI25161J50226_1000003 3300003374 Bacteria 413345
71 JGI25161J50226_1000053 3300003374 Bacteria 106635
72 JGI25161J50226_1001944 3300003374 Bacteria 5699
73 Ga0006562J51391_1007243 3300003578 Bacteria 4880
74 Ga0006562J51391_1023271 3300003578 Bacteria 1618
75 Ga0055526_1000955 3300003771 Bacteria 21351
76 Ga0055526_1004368 3300003771 Bacteria 8529
77 Ga0055526_1004739 3300003771 Bacteria 8059
78 Ga0055526_1008416 3300003771 Bacteria 5155
79 Ga0055526_1009627 3300003771 Bacteria 4618
80 Ga0055526_1010985 3300003771 Bacteria 4137
81 Ga0055526_1025466 3300003771 Bacteria 1897
82 Ga0055524_1000035 3300003775 Bacteria 174636
83 Ga0055524_1002113 3300003775 Bacteria 10499
84 Ga0055524_1002391 3300003775 Bacteria 9723
85 Ga0055524_1003568 3300003775 Bacteria 7502
86 Ga0055524_1007500 3300003775 Bacteria 4620
87 Ga0055524_1009140 3300003775 Bacteria 4056
88 Ga0055524_1011053 3300003775 Bacteria 3553
89 Ga0055524_1013589 3300003775 Bacteria 3065
90 Ga0055536_1005413 3300003781 Bacteria 6251
91 Ga0055528_1001604 3300003790 Bacteria 13372
92 Ga0055528_1002265 3300003790 Bacteria 10440
93 Ga0055528_1007370 3300003790 Bacteria 4869
94 Ga0055528_1009553 3300003790 Bacteria 4039
95 Ga0055528_1011715 3300003790 Bacteria 3457
96 Ga0055528_1014009 3300003790 Bacteria 2996
97 Ga0055530_10018616 3300003791 Bacteria 2134
98 Ga0055540_1000748 3300003792 Bacteria 22053
99 Ga0055540_1004719 3300003792 Bacteria 6028
100 Ga0055540_1018177 3300003792 Bacteria 1934
101 Ga0055531_10007165 3300003794 Bacteria 6141
102 Ga0055531_10025155 3300003794 Bacteria 2172
103 Ga0058692_1012800 3300003856 Bacteria 1973
104 JGI25405J52794_10002890 3300003911 Bacteria 2989
105 Ga0055543_1000001 3300004625 Bacteria 419949
106 Ga0055543_1000019 3300004625 Bacteria 161035
107 Ga0055543_1000147 3300004625 Bacteria 58621
108 Ga0055543_1000976 3300004625 Bacteria 12941
109 Ga0055543_1012257 3300004625 Bacteria 1731
110 Ga0058859_10007620 3300004798 Bacteria 885
111 Ga0065165_1000049 3300005262 Bacteria 195588
112 Ga0065165_1000180 3300005262 Bacteria 111768
113 Ga0065165_1000714 3300005262 Bacteria 46888
114 Ga0065165_1005412 3300005262 Bacteria 7193
115 Ga0065165_1008068 3300005262 Bacteria 5024
116 Ga0065165_1025717 3300005262 Bacteria 1951
117 Ga0065165_1044964 3300005262 Bacteria 1288
118 Ga0065717_1002161 3300005276 Bacteria 2670
119 Ga0065716_1002870 3300005277 Bacteria 1468
120 Ga0065712_10001072 3300005290 Bacteria 8689
121 Ga0065712_10006568 3300005290 Bacteria 3619
122 Ga0065715_10000559 3300005293 Bacteria 15927
123 Ga0065715_10000988 3300005293 Bacteria 7912
124 Ga0070658_10003419 3300005327 Bacteria 13063
125 Ga0070658_10052232 3300005327 Bacteria 3314
126 Ga0070658_10072315 3300005327 Bacteria 2826
127 Ga0070676_10000174 3300005328 Bacteria 26356
128 Ga0070676_10091025 3300005328 Bacteria 1869
129 Ga0070676_10193627 3300005328 Bacteria 1329
130 Ga0070683_100055976 3300005329 Bacteria 3662
131 Ga0070683_100179465 3300005329 Bacteria 2010
132 Ga0070683_100770555 3300005329 Bacteria 922
133 Ga0070690_100000898 3300005330 Bacteria 15174
134 Ga0070690_100017757 3300005330 Bacteria 4286
135 Ga0070690_100306060 3300005330 Bacteria 1141
136 Ga0070670_100019541 3300005331 Bacteria 5815
137 Ga0070670_100035365 3300005331 Bacteria 4300
138 Ga0070670_100073543 3300005331 Bacteria 2935
139 Ga0070677_10000194 3300005333 Bacteria 20895
140 Ga0070677_10158540 3300005333 Bacteria 1060
141 Ga0068869_100000260 3300005334 Bacteria 27848
142 Ga0068869_100097519 3300005334 Bacteria 2220
143 Ga0068869_100184823 3300005334 Bacteria 1636
144 Ga0068869_100405698 3300005334 Bacteria 1122
145 Ga0070666_10011624 3300005335 Bacteria 5531
146 Ga0070666_10011732 3300005335 Bacteria 5510
147 Ga0070666_10053643 3300005335 Bacteria 2719
148 Ga0070666_10070448 3300005335 Bacteria 2379
149 Ga0070680_100013955 3300005336 Bacteria 6270
150 Ga0070680_100016957 3300005336 Bacteria 5734
151 Ga0070680_100038173 3300005336 Bacteria 3884
152 Ga0070680_100081515 3300005336 Bacteria 2669
153 Ga0070680_100124092 3300005336 Bacteria 2157
154 Ga0070680_100182287 3300005336 Bacteria 1769
155 Ga0070682_100000141 3300005337 Bacteria 57251
156 Ga0070682_100029121 3300005337 Bacteria 3324
157 Ga0070682_100029709 3300005337 Bacteria 3293
158 Ga0068868_100004211 3300005338 Bacteria 10061
159 Ga0068868_100007943 3300005338 Bacteria 7580
160 Ga0068868_100098559 3300005338 Bacteria 2363
161 Ga0070660_100000408 3300005339 Bacteria 28632
162 Ga0070660_100032982 3300005339 Bacteria 3900
163 Ga0070660_100097940 3300005339 Bacteria 2321
164 Ga0070660_100128962 3300005339 Bacteria 2023
165 Ga0070660_100150819 3300005339 Bacteria 1869
166 Ga0070660_100152049 3300005339 Bacteria 1861
167 Ga0070689_100000179 3300005340 Bacteria 38027
168 Ga0070689_100013840 3300005340 Bacteria 5845
169 Ga0070689_100037080 3300005340 Bacteria 3728
170 Ga0070689_100087092 3300005340 Bacteria 2457
171 Ga0070689_100132572 3300005340 Bacteria 1999
172 Ga0070691_10000381 3300005341 Bacteria 16082
173 Ga0070691_10059778 3300005341 Bacteria 1832
174 Ga0070691_10117334 3300005341 Bacteria 1337
175 Ga0070687_100006870 3300005343 Bacteria 4697
176 Ga0070687_100070357 3300005343 Bacteria 1877
177 Ga0070687_100113502 3300005343 Bacteria 1538
178 Ga0070687_100165984 3300005343 Bacteria 1310
179 Ga0070661_100000898 3300005344 Bacteria 21346
180 Ga0070661_100037633 3300005344 Bacteria 3520
181 Ga0070661_100043723 3300005344 Bacteria 3272
182 Ga0070661_100070495 3300005344 Bacteria 2571
183 Ga0070692_10000075 3300005345 Bacteria 20376
184 Ga0070668_100007936 3300005347 Bacteria 7882
185 Ga0070668_100380748 3300005347 Bacteria 1201
186 Ga0070669_100002705 3300005353 Bacteria 12786
187 Ga0070669_100008764 3300005353 Bacteria 7217
188 Ga0070669_100190994 3300005353 Bacteria 1607
189 Ga0070669_100287215 3300005353 Bacteria 1319
190 Ga0070675_100000650 3300005354 Bacteria 24028
191 Ga0070675_100012558 3300005354 Bacteria 6640
192 Ga0070671_100000690 3300005355 Bacteria 24237
193 Ga0070671_100006037 3300005355 Bacteria 9650
194 Ga0070671_100021863 3300005355 Bacteria 5224
195 Ga0070671_100025121 3300005355 Bacteria 4884
196 Ga0070671_100026345 3300005355 Bacteria 4777
197 Ga0070671_100354249 3300005355 Bacteria 1253
198 Ga0070674_100001356 3300005356 Bacteria 12905
199 Ga0070674_100014979 3300005356 Bacteria 4830
200 Ga0070674_100016878 3300005356 Bacteria 4581
201 Ga0070674_100147701 3300005356 Bacteria 1771
202 Ga0070674_100288010 3300005356 Bacteria 1305
203 Ga0070673_100000140 3300005364 Bacteria 34135
204 Ga0070673_100044060 3300005364 Bacteria 3452
205 Ga0070673_100075828 3300005364 Bacteria 2714
206 Ga0070673_100124667 3300005364 Bacteria 2154
207 Ga0070673_100505375 3300005364 Bacteria 1094
208 Ga0070688_100001252 3300005365 Bacteria 12666
209 Ga0070688_100030387 3300005365 Bacteria 3242
210 Ga0070659_100003666 3300005366 Bacteria 10950
211 Ga0070659_100085461 3300005366 Bacteria 2523
212 Ga0070659_100099191 3300005366 Bacteria 2343
213 Ga0070659_100203664 3300005366 Bacteria 1629
214 Ga0070659_100231999 3300005366 Bacteria 1525
215 Ga0070659_100346405 3300005366 Bacteria 1246
216 Ga0070667_100004745 3300005367 Bacteria 11390
217 Ga0070667_100074027 3300005367 Bacteria 2905
218 Ga0070667_100107168 3300005367 Bacteria 2419
219 Ga0070667_100107509 3300005367 Bacteria 2416
220 Ga0070667_100144438 3300005367 Bacteria 2086
221 Ga0070667_100307003 3300005367 Bacteria 1429
222 Ga0070703_10002730 3300005406 Bacteria 5067
223 Ga0070709_10022303 3300005434 Bacteria 3701
224 Ga0070714_100002352 3300005435 Bacteria 13910
225 Ga0070714_100032451 3300005435 Bacteria 4359
226 Ga0070714_100100977 3300005435 Bacteria 2541
227 Ga0070714_100101214 3300005435 Bacteria 2539
228 Ga0070714_100120538 3300005435 Bacteria 2333
229 Ga0070713_100012353 3300005436 Bacteria 6259
230 Ga0070713_100041195 3300005436 Bacteria 3761
231 Ga0070713_100061871 3300005436 Bacteria 3133
232 Ga0070713_100103742 3300005436 Bacteria 2468
233 Ga0070713_100147078 3300005436 Bacteria 2092
234 Ga0070713_100293961 3300005436 Bacteria 1494
235 Ga0070710_10034907 3300005437 Bacteria 2738
236 Ga0070710_10126217 3300005437 Bacteria 1555
237 Ga0070710_10282888 3300005437 Bacteria 1077
238 Ga0070701_10000625 3300005438 Bacteria 12409
239 Ga0070701_10016555 3300005438 Bacteria 3430
240 Ga0070701_10064481 3300005438 Bacteria 1941
241 Ga0070711_100112398 3300005439 Bacteria 2001
242 Ga0070711_100134867 3300005439 Bacteria 1844
243 Ga0070705_100004136 3300005440 Bacteria 7090
244 Ga0070705_100021343 3300005440 Bacteria 3443
245 Ga0070700_100013930 3300005441 Bacteria 4529
246 Ga0070700_100128649 3300005441 Bacteria 1706
247 Ga0070694_100000797 3300005444 Bacteria 17663
248 Ga0070694_100003678 3300005444 Bacteria 9150
249 Ga0070708_100453291 3300005445 Bacteria 1210
250 Ga0070663_100003209 3300005455 Bacteria 9392
251 Ga0070663_100014800 3300005455 Bacteria 5015
252 Ga0070663_100106845 3300005455 Bacteria 2097
253 Ga0070678_100000125 3300005456 Bacteria 30477
254 Ga0070678_100029543 3300005456 Bacteria 3755
255 Ga0070662_100006627 3300005457 Bacteria 7476
256 Ga0070662_100046587 3300005457 Bacteria 3116
257 Ga0070662_100143060 3300005457 Bacteria 1855
258 Ga0070681_10003210 3300005458 Bacteria 15238
259 Ga0070681_10025108 3300005458 Bacteria 5997
260 Ga0070681_10070283 3300005458 Bacteria 3466
261 Ga0070681_10193409 3300005458 Bacteria 1954
262 Ga0070681_10232697 3300005458 Bacteria 1757
263 Ga0068867_100000260 3300005459 Bacteria 34790
264 Ga0068867_100134170 3300005459 Bacteria 1928
265 Ga0070685_10000957 3300005466 Bacteria 15502
266 Ga0070685_10014503 3300005466 Bacteria 4176
267 Ga0070685_10062381 3300005466 Bacteria 2185
268 Ga0070685_10103765 3300005466 Bacteria 1740
269 Ga0070699_100010135 3300005518 Bacteria 8158
270 Ga0070699_100068823 3300005518 Bacteria 3075
271 Ga0070679_100001673 3300005530 Bacteria 19987
272 Ga0070679_100007152 3300005530 Bacteria 10416
273 Ga0070679_100066377 3300005530 Bacteria 3597
274 Ga0070679_100077347 3300005530 Bacteria 3316
275 Ga0070679_100097897 3300005530 Bacteria 2921
276 Ga0070679_100152198 3300005530 Bacteria 2290
277 Ga0070679_100201165 3300005530 Bacteria 1958
278 Ga0070679_100322291 3300005530 Bacteria 1494
279 Ga0070679_100421267 3300005530 Bacteria 1280
280 Ga0070679_100505135 3300005530 Bacteria 1153
281 Ga0070684_100000145 3300005535 Bacteria 47556
282 Ga0070684_100050925 3300005535 Bacteria 3598
283 Ga0070684_100074969 3300005535 Bacteria 2983
284 Ga0070684_100396772 3300005535 Bacteria 1272
285 Ga0070684_100807923 3300005535 Bacteria 877
286 Ga0070697_100007057 3300005536 Bacteria 8733
287 Ga0070697_100132361 3300005536 Bacteria 2092
288 Ga0070697_100430363 3300005536 Bacteria 1147
289 Ga0068853_100002655 3300005539 Bacteria 13488
290 Ga0068853_100030677 3300005539 Bacteria 4542
291 Ga0068853_100044363 3300005539 Bacteria 3806
292 Ga0068853_100638603 3300005539 Bacteria 1013
293 Ga0070672_100000307 3300005543 Bacteria 27667
294 Ga0070672_100002417 3300005543 Bacteria 11834
295 Ga0070672_100071053 3300005543 Bacteria 2768
296 Ga0070672_100301741 3300005543 Bacteria 1358
297 Ga0070686_100001373 3300005544 Bacteria 13757
298 Ga0070686_100018296 3300005544 Bacteria 4109
299 Ga0070686_100027342 3300005544 Bacteria 3452
300 Ga0070686_100077584 3300005544 Bacteria 2191
301 Ga0070686_100332265 3300005544 Bacteria 1137
302 Ga0070695_100004808 3300005545 Bacteria 7948
303 Ga0070695_100005884 3300005545 Bacteria 7236
304 Ga0070695_100007987 3300005545 Bacteria 6269
305 Ga0070695_100154710 3300005545 Bacteria 1603
306 Ga0070696_100016423 3300005546 Bacteria 4985
307 Ga0070696_100242783 3300005546 Bacteria 1359
308 Ga0070693_100004447 3300005547 Bacteria 6627
309 Ga0070693_100010465 3300005547 Bacteria 4649
310 Ga0070693_100014012 3300005547 Bacteria 4096
311 Ga0070693_100063637 3300005547 Bacteria 2150
312 Ga0070665_100029923 3300005548 Bacteria 5481
313 Ga0070665_100058162 3300005548 Bacteria 3876
314 Ga0070665_100105556 3300005548 Bacteria 2819
315 Ga0070665_100134505 3300005548 Bacteria 2474
316 Ga0070665_100266074 3300005548 Bacteria 1716
317 Ga0070665_100363407 3300005548 Bacteria 1453
318 Ga0070704_100000971 3300005549 Bacteria 14560
319 Ga0070704_100003196 3300005549 Bacteria 9366
320 Ga0070704_100021004 3300005549 Bacteria 4224
321 Ga0070704_100127670 3300005549 Bacteria 1965
322 Ga0068855_100010074 3300005563 Bacteria 11393
323 Ga0068855_100032994 3300005563 Bacteria 6181
324 Ga0068855_100045548 3300005563 Bacteria 5189
325 Ga0068855_100168322 3300005563 Bacteria 2483
326 Ga0068855_100232873 3300005563 Bacteria 2061
327 Ga0070664_100001196 3300005564 Bacteria 20672
328 Ga0070664_100017176 3300005564 Bacteria 5940
329 Ga0070664_100035333 3300005564 Bacteria 4195
330 Ga0070664_100058190 3300005564 Bacteria 3287
331 Ga0070664_100184368 3300005564 Bacteria 1857
332 Ga0068857_100007702 3300005577 Bacteria 9280
333 Ga0068857_100298575 3300005577 Bacteria 1485
334 Ga0068854_100019924 3300005578 Bacteria 4529
335 Ga0068854_100087720 3300005578 Bacteria 2309
336 Ga0068854_100148738 3300005578 Bacteria 1804
337 Ga0068856_100001970 3300005614 Bacteria 21399
338 Ga0068856_100126899 3300005614 Bacteria 2555
339 Ga0068856_100164389 3300005614 Bacteria 2230
340 Ga0068856_100539635 3300005614 Bacteria 1187
341 Ga0070702_100000318 3300005615 Bacteria 16680
342 Ga0068852_100014756 3300005616 Bacteria 6031
343 Ga0068852_100026811 3300005616 Bacteria 4689
344 Ga0068852_100029311 3300005616 Bacteria 4520
345 Ga0068852_100034218 3300005616 Bacteria 4226
346 Ga0068852_100043249 3300005616 Bacteria 3819
347 Ga0068852_100214745 3300005616 Bacteria 1827
348 Ga0068859_100008171 3300005617 Bacteria 10616
349 Ga0068859_100029050 3300005617 Bacteria 5547
350 Ga0068859_100172295 3300005617 Bacteria 2245
351 Ga0068859_100434766 3300005617 Bacteria 1409
352 Ga0068864_100005352 3300005618 Bacteria 10515
353 Ga0068864_100005535 3300005618 Bacteria 10355
354 Ga0068864_100025377 3300005618 Bacteria 4990
355 Ga0068864_100075961 3300005618 Bacteria 2934
356 Ga0068864_100300817 3300005618 Bacteria 1502
357 Ga0068866_10002714 3300005718 Bacteria 7303
358 Ga0068866_10031643 3300005718 Bacteria 2550
359 Ga0068861_100007326 3300005719 Bacteria 7559
360 Ga0068861_100011934 3300005719 Bacteria 6050
361 Ga0068861_100253136 3300005719 Bacteria 1504
362 Ga0068851_10030836 3300005834 Bacteria 2661
363 Ga0068851_10053995 3300005834 Bacteria 2046
364 Ga0068870_10000114 3300005840 Bacteria 27448
365 Ga0068870_10001565 3300005840 Bacteria 9301
366 Ga0068863_100029430 3300005841 Bacteria 5242
367 Ga0068863_100051908 3300005841 Bacteria 3886
368 Ga0068863_100052497 3300005841 Bacteria 3863
369 Ga0068863_100367217 3300005841 Bacteria 1404
370 Ga0068858_100002190 3300005842 Bacteria 19792
371 Ga0068858_100025387 3300005842 Bacteria 5513
372 Ga0068858_100081088 3300005842 Bacteria 3015
373 Ga0068860_100000550 3300005843 Bacteria 45703
374 Ga0068860_100004828 3300005843 Bacteria 13727
375 Ga0068860_100051781 3300005843 Bacteria 3905
376 Ga0068860_100122832 3300005843 Bacteria 2488
377 Ga0068860_100126507 3300005843 Bacteria 2449
378 Ga0068860_100542298 3300005843 Bacteria 1165
379 Ga0068862_100007745 3300005844 Bacteria 8883
380 Ga0068862_100028014 3300005844 Bacteria 4744
381 Ga0068862_100068662 3300005844 Bacteria 3058
382 Ga0068862_100213878 3300005844 Bacteria 1743
383 Ga0081455_10000237 3300005937 Bacteria 71335
384 Ga0081455_10001351 3300005937 Bacteria 30344
385 Ga0081455_10003815 3300005937 Bacteria 17198
386 Ga0081455_10004892 3300005937 Bacteria 14844
387 Ga0081455_10010610 3300005937 Bacteria 9322
388 Ga0081455_10044817 3300005937 Bacteria 3853
389 Ga0081455_10109150 3300005937 Bacteria 2202
390 Ga0081455_10317684 3300005937 Bacteria 1111
391 Ga0081538_10002177 3300005981 Bacteria 19445
392 Ga0081538_10102101 3300005981 Bacteria 1440
393 Ga0081540_1006167 3300005983 Bacteria 8793
394 Ga0081540_1057755 3300005983 Bacteria 1874
395 Ga0081539_10000255 3300005985 Bacteria 123054
396 Ga0081539_10000688 3300005985 Bacteria 67723
397 Ga0081539_10001525 3300005985 Bacteria 38837
398 Ga0070717_10003859 3300006028 Bacteria 10778
399 Ga0070717_10060695 3300006028 Bacteria 3131
400 Ga0070717_10230786 3300006028 Bacteria 1629
401 Ga0070717_10365219 3300006028 Bacteria 1293
402 Ga0075365_10001260 3300006038 Bacteria 11231
403 Ga0075365_10027441 3300006038 Bacteria 3624
404 Ga0075365_10102973 3300006038 Bacteria 1956
405 Ga0075368_10001271 3300006042 Bacteria 7995
406 Ga0075368_10022709 3300006042 Bacteria 2389
407 Ga0075363_100044970 3300006048 Bacteria 2341
408 Ga0075363_100152348 3300006048 Bacteria 1305
409 Ga0075363_100186794 3300006048 Bacteria 1181
410 Ga0075364_10015127 3300006051 Bacteria 4778
411 Ga0075364_10049304 3300006051 Bacteria 2745
412 Ga0075364_10091084 3300006051 Bacteria 2023
413 Ga0075364_10145088 3300006051 Bacteria 1598
414 Ga0070715_10021216 3300006163 Bacteria 2516
415 Ga0070715_10037890 3300006163 Bacteria 1998
416 Ga0070716_100045849 3300006173 Bacteria 2457
417 Ga0070712_100071741 3300006175 Bacteria 2479
418 Ga0070712_100095593 3300006175 Bacteria 2186
419 Ga0070712_100113042 3300006175 Bacteria 2030
420 Ga0070712_100445290 3300006175 Bacteria 1077
421 Ga0075362_10000880 3300006177 Bacteria 9098
422 Ga0075362_10109090 3300006177 Bacteria 1301
423 Ga0075362_10169280 3300006177 Bacteria 1055
424 Ga0075362_10173357 3300006177 Bacteria 1043
425 Ga0075367_10007767 3300006178 Bacteria 5516
426 Ga0075367_10010791 3300006178 Bacteria 4812
427 Ga0075367_10023504 3300006178 Bacteria 3469
428 Ga0075367_10047033 3300006178 Bacteria 2537
429 Ga0075367_10180884 3300006178 Bacteria 1315
430 Ga0075367_10321941 3300006178 Bacteria 974
431 Ga0075367_10394420 3300006178 Bacteria 875
432 Ga0075369_10012303 3300006186 Bacteria 3381
433 Ga0075369_10020793 3300006186 Bacteria 2689
434 Ga0075427_10000718 3300006194 Bacteria 3975
435 Ga0075366_10002163 3300006195 Bacteria 10020
436 Ga0075366_10008391 3300006195 Bacteria 5741
437 Ga0075366_10055826 3300006195 Bacteria 2345
438 Ga0075366_10082552 3300006195 Bacteria 1920
439 Ga0075366_10169878 3300006195 Bacteria 1323
440 Ga0097621_100000010 3300006237 Bacteria 112867
441 Ga0097621_100032153 3300006237 Bacteria 4169
442 Ga0097621_100101351 3300006237 Bacteria 2423
443 Ga0075370_10029947 3300006353 Bacteria 3035
444 Ga0075370_10037466 3300006353 Bacteria 2727
445 Ga0075370_10243124 3300006353 Bacteria 1066
446 Ga0075370_10290360 3300006353 Bacteria 972
447 Ga0068871_100000034 3300006358 Bacteria 71462
448 Ga0068871_100025867 3300006358 Bacteria 4573
449 Ga0068871_100027389 3300006358 Bacteria 4457
450 Ga0068871_100081145 3300006358 Bacteria 2687
451 Ga0075428_100011698 3300006844 Bacteria 9768
452 Ga0075428_100031023 3300006844 Bacteria 5910
453 Ga0075428_100076394 3300006844 Bacteria 3656
454 Ga0075428_100091914 3300006844 Bacteria 3309
455 Ga0075428_100143208 3300006844 Bacteria 2599
456 Ga0075428_100191811 3300006844 Bacteria 2210
457 Ga0075428_100372214 3300006844 Bacteria 1532
458 Ga0075428_100487337 3300006844 Bacteria 1319
459 Ga0075428_100697007 3300006844 Bacteria 1082
460 Ga0075430_100005198 3300006846 Bacteria 10968
461 Ga0075430_100040340 3300006846 Bacteria 3952
462 Ga0075430_100061692 3300006846 Bacteria 3150
463 Ga0075430_100387236 3300006846 Bacteria 1154
464 Ga0075431_100000053 3300006847 Bacteria 62977
465 Ga0075431_100014358 3300006847 Bacteria 8010
466 Ga0075431_100024458 3300006847 Bacteria 6190
467 Ga0075431_100041304 3300006847 Bacteria 4754
468 Ga0075431_100270486 3300006847 Bacteria 1722
469 Ga0075433_10010531 3300006852 Bacteria 7429
470 Ga0075434_100000565 3300006871 Bacteria 28492
471 Ga0075434_100016837 3300006871 Bacteria 7032
472 Ga0075434_100059853 3300006871 Bacteria 3787
473 Ga0075434_100081291 3300006871 Bacteria 3237
474 Ga0075434_100123199 3300006871 Bacteria 2608
475 Ga0075434_100162138 3300006871 Bacteria 2256
476 Ga0075434_100377181 3300006871 Bacteria 1439
477 Ga0075434_100481160 3300006871 Bacteria 1262
478 Ga0075429_100004570 3300006880 Bacteria 11894
479 Ga0075429_100006001 3300006880 Bacteria 10504
480 Ga0068865_100000258 3300006881 Bacteria 29404
481 Ga0068865_100012087 3300006881 Bacteria 5426
482 Ga0068865_100034380 3300006881 Bacteria 3400
483 Ga0068865_100099849 3300006881 Bacteria 2123
484 Ga0068865_100156784 3300006881 Bacteria 1732
485 Ga0075436_100002407 3300006914 Bacteria 12902
486 Ga0075436_100068030 3300006914 Bacteria 2461
487 Ga0075436_100125191 3300006914 Bacteria 1800
488 Ga0075436_100138309 3300006914 Bacteria 1711
489 Ga0075436_100227166 3300006914 Bacteria 1325
490 Ga0075436_100336677 3300006914 Bacteria 1086
491 Ga0097620_100008171 3300006931 Bacteria 10616
492 Ga0097620_100029052 3300006931 Bacteria 5547
493 Ga0097620_100172302 3300006931 Bacteria 2245
494 Ga0097620_100434796 3300006931 Bacteria 1409
495 Ga0079104_1000187 3300006946 Bacteria 86957
496 Ga0079104_1003210 3300006946 Bacteria 7879
497 Ga0079104_1008871 3300006946 Bacteria 3459
498 Ga0099826_10000272 3300006948 Bacteria 22976
499 Ga0099826_10056750 3300006948 Bacteria 2581
500 Ga0075435_100021526 3300007076 Bacteria 4960
501 Ga0075435_100029577 3300007076 Bacteria 4300
502 Ga0075435_100052351 3300007076 Bacteria 3291
503 Ga0099794_10047033 3300007265 Bacteria 2068
504 Ga0099794_10135576 3300007265 Bacteria 1245
505 Ga0099795_10017225 3300007788 Bacteria 2300
506 Ga0105251_10029443 3300009011 Bacteria 2766
507 Ga0105250_10036422 3300009092 Bacteria 1975
508 Ga0105240_10000005 3300009093 Bacteria 702630
509 Ga0105240_10139463 3300009093 Bacteria 2900
510 Ga0111539_10000500 3300009094 Bacteria 49951
511 Ga0111539_10001486 3300009094 Bacteria 31308
512 Ga0111539_10003625 3300009094 Bacteria 20338
513 Ga0111539_10018523 3300009094 Bacteria 8625
514 Ga0111539_10058480 3300009094 Bacteria 4574
515 Ga0111539_10079050 3300009094 Bacteria 3869
516 Ga0111539_10149561 3300009094 Bacteria 2733
517 Ga0111539_10592186 3300009094 Bacteria 1291
518 Ga0111539_10699248 3300009094 Bacteria 1180
519 Ga0111539_11058000 3300009094 Bacteria 943
520 Ga0105245_10003131 3300009098 Bacteria 14802
521 Ga0105245_10106909 3300009098 Bacteria 2597
522 Ga0105245_10256166 3300009098 Bacteria 1702
523 Ga0105245_10303236 3300009098 Bacteria 1568
524 Ga0105247_10002505 3300009101 Bacteria 12483
525 Ga0105247_10010561 3300009101 Bacteria 5578
526 Ga0105247_10023791 3300009101 Bacteria 3692
527 Ga0105247_10092970 3300009101 Bacteria 1917
528 Ga0105247_10099429 3300009101 Bacteria 1858
529 Ga0114129_10000237 3300009147 Bacteria 61463
530 Ga0114129_10006403 3300009147 Bacteria 16695
531 Ga0114129_10033328 3300009147 Bacteria 7279
532 Ga0114129_10190167 3300009147 Bacteria 2788
533 Ga0114129_10197471 3300009147 Bacteria 2727
534 Ga0114129_10224348 3300009147 Bacteria 2533
535 Ga0114129_10589498 3300009147 Bacteria 1441
536 Ga0114129_10662038 3300009147 Bacteria 1346
537 Ga0105243_10015073 3300009148 Bacteria 5850
538 Ga0105243_10016989 3300009148 Bacteria 5502
539 Ga0105243_10017278 3300009148 Bacteria 5454
540 Ga0105243_10088180 3300009148 Bacteria 2549
541 Ga0105243_10169275 3300009148 Bacteria 1891
542 Ga0105243_10245424 3300009148 Bacteria 1596
543 Ga0105243_10275470 3300009148 Bacteria 1513
544 Ga0105241_10001911 3300009174 Bacteria 15768
545 Ga0105241_10048051 3300009174 Bacteria 3246
546 Ga0105241_10370202 3300009174 Bacteria 1249
547 Ga0105242_10000037 3300009176 Bacteria 91293
548 Ga0105242_10025069 3300009176 Bacteria 4714
549 Ga0105242_10054092 3300009176 Bacteria 3280
550 Ga0105242_10155344 3300009176 Bacteria 1998
551 Ga0105248_10002195 3300009177 Bacteria 21609
552 Ga0105248_10027024 3300009177 Bacteria 6384
553 Ga0105248_10064732 3300009177 Bacteria 4104
554 Ga0105248_10195584 3300009177 Bacteria 2278
555 Ga0105237_10001912 3300009545 Bacteria 26585
556 Ga0105237_10063301 3300009545 Bacteria 3697
557 Ga0105237_10674016 3300009545 Bacteria 1041
558 Ga0105238_10023052 3300009551 Bacteria 6348
559 Ga0105238_10032764 3300009551 Bacteria 5289
560 Ga0105238_10091427 3300009551 Bacteria 3030
561 Ga0105238_10096421 3300009551 Bacteria 2944
562 Ga0105238_10124656 3300009551 Bacteria 2555
563 Ga0105238_10129451 3300009551 Bacteria 2502
564 Ga0105249_10000209 3300009553 Bacteria 67037
565 Ga0105249_10033836 3300009553 Bacteria 4629
566 Ga0105249_10067118 3300009553 Bacteria 3304
567 Ga0105249_10240650 3300009553 Bacteria 1789
568 Ga0105249_10304666 3300009553 Bacteria 1599
569 Ga0123341_1000001 3300009765 Bacteria 314908
570 Ga0123341_1059495 3300009765 Bacteria 1913
571 Ga0123342_1014422 3300009766 Bacteria 7541
572 Ga0123342_1014579 3300009766 Bacteria 7444
573 Ga0105239_10006977 3300010375 Bacteria 13013
574 Ga0105239_10007427 3300010375 Bacteria 12573
575 Ga0105239_10009869 3300010375 Bacteria 10726
576 Ga0105239_10028131 3300010375 Bacteria 6186
577 Ga0105239_10194863 3300010375 Bacteria 2269
578 Ga0105239_10358720 3300010375 Bacteria 1646
579 Ga0105239_10430800 3300010375 Bacteria 1495
580 Ga0105239_10871621 3300010375 Bacteria 1033
581 Ga0105246_10000614 3300011119 Bacteria 19862
582 Ga0105246_10058128 3300011119 Bacteria 2678
583 Ga0105246_10299844 3300011119 Bacteria 1297
584 Ga0105246_10328221 3300011119 Bacteria 1246
585 Ga0157338_1001045 3300012515 Bacteria 1884
586 Ga0157373_10016809 3300013100 Bacteria 5334
587 Ga0157373_10030942 3300013100 Bacteria 3851
588 Ga0157373_10035992 3300013100 Bacteria 3554
589 Ga0157371_10000015 3300013102 Bacteria 339838
590 Ga0157371_10015657 3300013102 Bacteria 5680
591 Ga0157371_10121499 3300013102 Bacteria 1857
592 Ga0157370_10002129 3300013104 Bacteria 24176
593 Ga0157370_10002232 3300013104 Bacteria 23559
594 Ga0157370_10238146 3300013104 Bacteria 1684
595 Ga0157369_10037588 3300013105 Bacteria 5300
596 Ga0157369_10223031 3300013105 Bacteria 1972
597 Ga0157369_10306067 3300013105 Bacteria 1653
598 Ga0157369_10405496 3300013105 Bacteria 1414
599 Ga0157369_10490627 3300013105 Bacteria 1271
600 Ga0157369_10623480 3300013105 Bacteria 1113
601 Ga0171463_1011 3300013249 Bacteria 230603
602 Ga0157374_10019131 3300013296 Bacteria 6059
603 Ga0157374_10105303 3300013296 Bacteria 2709
604 Ga0157378_10000566 3300013297 Bacteria 35090
605 Ga0157378_10330184 3300013297 Bacteria 1484
606 Ga0163162_10000896 3300013306 Bacteria 27745
607 Ga0163162_10005353 3300013306 Bacteria 12389
608 Ga0163162_10023128 3300013306 Bacteria 6130
609 Ga0163162_10128458 3300013306 Bacteria 2642
610 Ga0163162_10360712 3300013306 Bacteria 1586
611 Ga0157372_10118899 3300013307 Bacteria 3033
612 Ga0157372_10219645 3300013307 Bacteria 2203
613 Ga0157372_10653491 3300013307 Bacteria 1224
614 Ga0157372_10834172 3300013307 Bacteria 1070
615 Ga0157375_10000263 3300013308 Bacteria 47730
616 Ga0157375_10039237 3300013308 Bacteria 4556
617 Ga0157375_10040699 3300013308 Bacteria 4482
618 Ga0163163_10017489 3300014325 Bacteria 6688
619 Ga0163163_10046941 3300014325 Bacteria 4243
620 Ga0163163_10052731 3300014325 Bacteria 4013
621 Ga0163163_10299537 3300014325 Bacteria 1660
622 Ga0163163_10439922 3300014325 Bacteria 1363
623 Ga0163163_10497105 3300014325 Bacteria 1281
624 Ga0163163_10623630 3300014325 Bacteria 1142
625 Ga0157380_10001922 3300014326 Bacteria 13804
626 Ga0157380_10010005 3300014326 Bacteria 6808
627 Ga0157380_10022136 3300014326 Bacteria 4778
628 Ga0157377_10000214 3300014745 Bacteria 31569
629 Ga0157377_10106629 3300014745 Bacteria 1678
630 Ga0157379_10000666 3300014968 Bacteria 27844
631 Ga0157379_10271196 3300014968 Bacteria 1543
632 Ga0157379_10272658 3300014968 Bacteria 1539
633 Ga0157379_10483455 3300014968 Bacteria 1146
634 Ga0157376_10000879 3300014969 Bacteria 19699
635 Ga0157376_10278371 3300014969 Bacteria 1575
636 Ga0182007_10001634 3300015262 Bacteria 11880
637 Ga0182005_1008240 3300015265 Bacteria 3082
638 Ga0183365_10962 3300015684 Bacteria 1014
639 Ga0183363_1279 3300015690 Bacteria 7796
640 Ga0163161_10003116 3300017792 Bacteria 11693
641 Ga0163161_10039168 3300017792 Bacteria 3401
642 Ga0163161_10118372 3300017792 Bacteria 1988
643 Ga0163161_10205959 3300017792 Bacteria 1518
644 Ga0163161_10243817 3300017792 Bacteria 1398
645 Ga0197907_10374128 3300020069 Bacteria 1502
646 Ga0206356_10019253 3300020070 Bacteria 1823
647 Ga0206356_11744201 3300020070 Bacteria 3758
648 Ga0214544_1000024 3300021320 Bacteria 163562
649 Ga0214542_1000015 3300021321 Bacteria 227912
650 Ga0214543_1000011 3300021327 Bacteria 344093
651 Ga0214543_1000032 3300021327 Bacteria 200766
652 Ga0213873_10007595 3300021358 Bacteria 2180
653 Ga0213876_10042285 3300021384 Bacteria 2408
654 Ga0213876_10065419 3300021384 Bacteria 1919
655 Ga0213875_10007177 3300021388 Bacteria 5787
656 Ga0213871_10011341 3300021441 Bacteria 2045
657 Ga0224712_10074973 3300022467 Bacteria 1383
658 Ga0228711_1000012 3300022739 Bacteria 132594
659 Ga0228710_1000006 3300022740 Bacteria 209134
660 Ga0228598_1037468 3300024227 Bacteria 956
661 Ga0209435_100022 3300025206 Bacteria 207766
662 Ga0209436_100155 3300025208 Bacteria 32910
663 Ga0209436_102600 3300025208 Bacteria 5306
664 Ga0209563_107580 3300025230 Bacteria 1770
665 Ga0209437_100153 3300025233 Bacteria 154068
666 Ga0209437_100577 3300025233 Bacteria 23562
667 Ga0207425_1000010 3300025245 Bacteria 572898
668 Ga0207425_1003736 3300025245 Bacteria 4762
669 Ga0207425_1008252 3300025245 Bacteria 2681
670 Ga0209646_1000078 3300025246 Bacteria 207766
671 Ga0209026_1000065 3300025250 Bacteria 207766
672 Ga0209677_100355 3300025253 Bacteria 28569
673 Ga0209148_1011825 3300025254 Bacteria 1612
674 Ga0209759_1000055 3300025256 Bacteria 207766
675 Ga0209759_1010178 3300025256 Bacteria 2776
676 Ga0209129_1000034 3300025258 Bacteria 330950
677 Ga0209129_1000329 3300025258 Bacteria 41319
678 Ga0209129_1003358 3300025258 Bacteria 7041
679 Ga0209129_1004787 3300025258 Bacteria 5112
680 Ga0209129_1004973 3300025258 Bacteria 4921
681 Ga0209129_1011476 3300025258 Bacteria 2111
682 Ga0209233_1000175 3300025261 Bacteria 144221
683 Ga0209233_1000248 3300025261 Bacteria 87812
684 Ga0209233_1000676 3300025261 Bacteria 16375
685 Ga0209233_1017822 3300025261 Bacteria 1925
686 Ga0209565_1023569 3300025263 Bacteria 1263
687 Ga0207666_1000010 3300025271 Bacteria 46973
688 Ga0207666_1000379 3300025271 Bacteria 5888
689 Ga0209673_1000068 3300025273 Bacteria 245891
690 Ga0209673_1000456 3300025273 Bacteria 69267
691 Ga0209673_1001837 3300025273 Bacteria 17367
692 Ga0209673_1002251 3300025273 Bacteria 13913
693 Ga0209673_1002368 3300025273 Bacteria 13243
694 Ga0209673_1003459 3300025273 Bacteria 9294
695 Ga0209673_1018492 3300025273 Bacteria 2532
696 Ga0209130_1000007 3300025284 Bacteria 591584
697 Ga0209130_1000012 3300025284 Bacteria 421329
698 Ga0209130_1000097 3300025284 Bacteria 143750
699 Ga0209130_1000111 3300025284 Bacteria 131855
700 Ga0209130_1028763 3300025284 Bacteria 1164
701 Ga0207673_1000091 3300025290 Bacteria 8127
702 Ga0209675_1000816 3300025291 Bacteria 20520
703 Ga0209676_1002428 3300025292 Bacteria 13266
704 Ga0209676_1003690 3300025292 Bacteria 9152
705 Ga0209676_1013668 3300025292 Bacteria 3106
706 Ga0209025_1000008 3300025294 Bacteria 1130876
707 Ga0209025_1000022 3300025294 Bacteria 574487
708 Ga0209025_1000033 3300025294 Bacteria 414511
709 Ga0209025_1000094 3300025294 Bacteria 241080
710 Ga0209025_1000320 3300025294 Bacteria 106773
711 Ga0209025_1001164 3300025294 Bacteria 37261
712 Ga0209025_1002864 3300025294 Bacteria 17307
713 Ga0209025_1006481 3300025294 Bacteria 9062
714 Ga0209025_1024154 3300025294 Bacteria 3149
715 Ga0209025_1046094 3300025294 Bacteria 1798
716 Ga0209564_1000049 3300025295 Bacteria 362075
717 Ga0209564_1000054 3300025295 Bacteria 350653
718 Ga0209564_1000140 3300025295 Bacteria 179856
719 Ga0209564_1000453 3300025295 Bacteria 69474
720 Ga0209564_1002007 3300025295 Bacteria 17768
721 Ga0209564_1003996 3300025295 Bacteria 9357
722 Ga0209564_1004499 3300025295 Bacteria 8501
723 Ga0209564_1014707 3300025295 Bacteria 3234
724 Ga0209758_1000086 3300025297 Bacteria 254778
725 Ga0209758_1000155 3300025297 Bacteria 160455
726 Ga0209758_1001803 3300025297 Bacteria 23651
727 Ga0209758_1001857 3300025297 Bacteria 23182
728 Ga0209758_1002012 3300025297 Bacteria 21869
729 Ga0209758_1002381 3300025297 Bacteria 19357
730 Ga0209758_1006966 3300025297 Bacteria 7879
731 Ga0209758_1011351 3300025297 Bacteria 5173
732 Ga0209758_1012175 3300025297 Bacteria 4852
733 Ga0209758_1016148 3300025297 Bacteria 3808
734 Ga0209050_1003731 3300025298 Bacteria 10954
735 Ga0209050_1007606 3300025298 Bacteria 6020
736 Ga0209050_1018005 3300025298 Bacteria 2776
737 Ga0209256_1000014 3300025299 Bacteria 687409
738 Ga0209256_1000319 3300025299 Bacteria 82827
739 Ga0209256_1000836 3300025299 Bacteria 38702
740 Ga0209256_1001441 3300025299 Bacteria 24594
741 Ga0209256_1001576 3300025299 Bacteria 22391
742 Ga0209256_1003708 3300025299 Bacteria 10376
743 Ga0209256_1004027 3300025299 Bacteria 9590
744 Ga0209256_1013705 3300025299 Bacteria 2987
745 Ga0209256_1021989 3300025299 Bacteria 1943
746 Ga0207426_1000003 3300025302 Bacteria 1063212
747 Ga0207426_1000010 3300025302 Bacteria 796003
748 Ga0207426_1000094 3300025302 Bacteria 275293
749 Ga0207426_1000111 3300025302 Bacteria 234032
750 Ga0207426_1005192 3300025302 Bacteria 6050
751 Ga0207426_1027328 3300025302 Bacteria 1902
752 Ga0207426_1043572 3300025302 Bacteria 1377
753 Ga0209051_1001055 3300025303 Bacteria 25767
754 Ga0209051_1002245 3300025303 Bacteria 14201
755 Ga0209051_1010194 3300025303 Bacteria 4776
756 Ga0209051_1017610 3300025303 Bacteria 3188
757 Ga0209257_1002064 3300025304 Bacteria 21210
758 Ga0209257_1003261 3300025304 Bacteria 14200
759 Ga0209257_1008688 3300025304 Bacteria 5681
760 Ga0209257_1033156 3300025304 Bacteria 1628
761 Ga0207697_10000424 3300025315 Bacteria 23811
762 Ga0207697_10005789 3300025315 Bacteria 5697
763 Ga0207656_10019037 3300025321 Bacteria 2712
764 Ga0207656_10082012 3300025321 Bacteria 1451
765 Ga0207696_1023741 3300025711 Bacteria 1930
766 Ga0207653_10007266 3300025885 Bacteria 3455
767 Ga0207682_10000035 3300025893 Bacteria 56611
768 Ga0207692_10001776 3300025898 Bacteria 8187
769 Ga0207692_10034699 3300025898 Bacteria 2444
770 Ga0207692_10117796 3300025898 Bacteria 1483
771 Ga0207642_10002311 3300025899 Bacteria 5941
772 Ga0207710_10017802 3300025900 Bacteria 3016
773 Ga0207688_10000881 3300025901 Bacteria 15161
774 Ga0207688_10002888 3300025901 Bacteria 9337
775 Ga0207688_10051209 3300025901 Bacteria 2313
776 Ga0207688_10124428 3300025901 Bacteria 1507
777 Ga0207688_10170247 3300025901 Bacteria 1295
778 Ga0207680_10003962 3300025903 Bacteria 6988
779 Ga0207680_10024905 3300025903 Bacteria 3293
780 Ga0207680_10025139 3300025903 Bacteria 3281
781 Ga0207680_10138629 3300025903 Bacteria 1611
782 Ga0207647_10005370 3300025904 Bacteria 9418
783 Ga0207647_10017164 3300025904 Bacteria 4925
784 Ga0207647_10047610 3300025904 Bacteria 2666
785 Ga0207647_10144788 3300025904 Bacteria 1391
786 Ga0207685_10011259 3300025905 Bacteria 2681
787 Ga0207685_10221766 3300025905 Bacteria 900
788 Ga0207699_10000837 3300025906 Bacteria 14654
789 Ga0207699_10288406 3300025906 Bacteria 1143
790 Ga0207645_10005339 3300025907 Bacteria 9340
791 Ga0207645_10048611 3300025907 Bacteria 2709
792 Ga0207645_10129898 3300025907 Bacteria 1639
793 Ga0207645_10162128 3300025907 Bacteria 1463
794 Ga0207643_10000147 3300025908 Bacteria 48010
795 Ga0207643_10044142 3300025908 Bacteria 2516
796 Ga0207654_10001288 3300025911 Bacteria 13343
797 Ga0207654_10157774 3300025911 Bacteria 1463
798 Ga0207654_10355604 3300025911 Bacteria 1009
799 Ga0207707_10009366 3300025912 Bacteria 8496
800 Ga0207707_10039324 3300025912 Bacteria 4135
801 Ga0207707_10080096 3300025912 Bacteria 2852
802 Ga0207707_10381333 3300025912 Bacteria 1212
803 Ga0207695_10000011 3300025913 Bacteria 910221
804 Ga0207695_10163070 3300025913 Bacteria 2159
805 Ga0207671_10000276 3300025914 Bacteria 76490
806 Ga0207671_10017241 3300025914 Bacteria 5577
807 Ga0207693_10002714 3300025915 Bacteria 15344
808 Ga0207693_10005189 3300025915 Bacteria 10906
809 Ga0207693_10016626 3300025915 Bacteria 5877
810 Ga0207693_10051743 3300025915 Bacteria 3222
811 Ga0207693_10083006 3300025915 Bacteria 2509
812 Ga0207693_10129901 3300025915 Bacteria 1980
813 Ga0207663_10021096 3300025916 Bacteria 3702
814 Ga0207663_10092998 3300025916 Bacteria 2006
815 Ga0207663_10125232 3300025916 Bacteria 1766
816 Ga0207663_10189864 3300025916 Bacteria 1474
817 Ga0207660_10001257 3300025917 Bacteria 16994
818 Ga0207660_10016618 3300025917 Bacteria 4875
819 Ga0207660_10055630 3300025917 Bacteria 2828
820 Ga0207660_10121584 3300025917 Bacteria 1978
821 Ga0207660_10125900 3300025917 Bacteria 1946
822 Ga0207660_10190343 3300025917 Bacteria 1597
823 Ga0207662_10000948 3300025918 Bacteria 13473
824 Ga0207662_10006511 3300025918 Bacteria 6309
825 Ga0207662_10036523 3300025918 Bacteria 2872
826 Ga0207662_10081795 3300025918 Bacteria 1972
827 Ga0207657_10007742 3300025919 Bacteria 10971
828 Ga0207657_10032905 3300025919 Bacteria 4678
829 Ga0207657_10043825 3300025919 Bacteria 3938
830 Ga0207657_10067846 3300025919 Bacteria 3031
831 Ga0207657_10089414 3300025919 Bacteria 2573
832 Ga0207657_10189412 3300025919 Bacteria 1660
833 Ga0207649_10000585 3300025920 Bacteria 24862
834 Ga0207649_10036183 3300025920 Bacteria 2972
835 Ga0207649_10349266 3300025920 Bacteria 1094
836 Ga0207652_10006627 3300025921 Bacteria 9330
837 Ga0207652_10047555 3300025921 Bacteria 3665
838 Ga0207652_10085671 3300025921 Bacteria 2761
839 Ga0207652_10145164 3300025921 Bacteria 2123
840 Ga0207652_10168657 3300025921 Bacteria 1964
841 Ga0207652_10205860 3300025921 Bacteria 1771
842 Ga0207652_10298565 3300025921 Bacteria 1454
843 Ga0207652_10409805 3300025921 Bacteria 1223
844 Ga0207652_10545141 3300025921 Bacteria 1043
845 Ga0207681_10002111 3300025923 Bacteria 12735
846 Ga0207681_10130434 3300025923 Bacteria 1858
847 Ga0207681_10183774 3300025923 Bacteria 1594
848 Ga0207681_10475094 3300025923 Bacteria 1020
849 Ga0207694_10015318 3300025924 Bacteria 5785
850 Ga0207694_10074045 3300025924 Bacteria 2665
851 Ga0207694_10101058 3300025924 Bacteria 2285
852 Ga0207694_10136436 3300025924 Bacteria 1971
853 Ga0207694_10196832 3300025924 Bacteria 1639
854 Ga0207650_10012089 3300025925 Bacteria 5952
855 Ga0207650_10167415 3300025925 Bacteria 1745
856 Ga0207650_10352665 3300025925 Bacteria 1211
857 Ga0207650_10360305 3300025925 Bacteria 1198
858 Ga0207650_10427307 3300025925 Bacteria 1100
859 Ga0207659_10002165 3300025926 Bacteria 11667
860 Ga0207659_10076698 3300025926 Bacteria 2458
861 Ga0207659_10109562 3300025926 Bacteria 2096
862 Ga0207687_10000373 3300025927 Bacteria 29973
863 Ga0207687_10005010 3300025927 Bacteria 8770
864 Ga0207687_10008125 3300025927 Bacteria 6869
865 Ga0207687_10344062 3300025927 Bacteria 1213
866 Ga0207687_10477608 3300025927 Bacteria 1037
867 Ga0207700_10000775 3300025928 Bacteria 18424
868 Ga0207700_10026723 3300025928 Bacteria 4029
869 Ga0207700_10109700 3300025928 Bacteria 2218
870 Ga0207700_10184038 3300025928 Bacteria 1751
871 Ga0207664_10003741 3300025929 Bacteria 10217
872 Ga0207664_10206437 3300025929 Bacteria 1698
873 Ga0207664_10209220 3300025929 Bacteria 1687
874 Ga0207664_10306496 3300025929 Bacteria 1398
875 Ga0207644_10009611 3300025931 Bacteria 6351
876 Ga0207644_10055330 3300025931 Bacteria 2859
877 Ga0207644_10209932 3300025931 Bacteria 1539
878 Ga0207644_10217076 3300025931 Bacteria 1514
879 Ga0207690_10021242 3300025932 Bacteria 4023
880 Ga0207690_10038897 3300025932 Bacteria 3099
881 Ga0207690_10070123 3300025932 Bacteria 2413
882 Ga0207706_10008770 3300025933 Bacteria 9306
883 Ga0207706_10016119 3300025933 Bacteria 6751
884 Ga0207706_10020035 3300025933 Bacteria 6010
885 Ga0207706_10026140 3300025933 Bacteria 5225
886 Ga0207706_10047431 3300025933 Bacteria 3800
887 Ga0207706_10167736 3300025933 Bacteria 1929
888 Ga0207686_10009442 3300025934 Bacteria 5293
889 Ga0207686_10035794 3300025934 Bacteria 2983
890 Ga0207686_10076834 3300025934 Bacteria 2166
891 Ga0207686_10168759 3300025934 Bacteria 1541
892 Ga0207709_10000374 3300025935 Bacteria 45115
893 Ga0207709_10017540 3300025935 Bacteria 3996
894 Ga0207709_10021587 3300025935 Bacteria 3646
895 Ga0207709_10125408 3300025935 Bacteria 1741
896 Ga0207709_10173341 3300025935 Bacteria 1516
897 Ga0207709_10181873 3300025935 Bacteria 1485
898 Ga0207670_10007805 3300025936 Bacteria 6004
899 Ga0207670_10102406 3300025936 Bacteria 2047
900 Ga0207670_10128852 3300025936 Bacteria 1850
901 Ga0207670_10148665 3300025936 Bacteria 1735
902 Ga0207670_10149307 3300025936 Bacteria 1732
903 Ga0207669_10000587 3300025937 Bacteria 15820
904 Ga0207669_10017820 3300025937 Bacteria 3653
905 Ga0207669_10045017 3300025937 Bacteria 2597
906 Ga0207669_10163585 3300025937 Bacteria 1575
907 Ga0207669_10525931 3300025937 Bacteria 950
908 Ga0207704_10000119 3300025938 Bacteria 43208
909 Ga0207704_10048507 3300025938 Bacteria 2546
910 Ga0207704_10114392 3300025938 Bacteria 1832
911 Ga0207665_10000654 3300025939 Bacteria 23305
912 Ga0207665_10034498 3300025939 Bacteria 3357
913 Ga0207665_10441157 3300025939 Bacteria 997
914 Ga0207691_10002396 3300025940 Bacteria 18341
915 Ga0207691_10009502 3300025940 Bacteria 9337
916 Ga0207691_10025977 3300025940 Bacteria 5496
917 Ga0207691_10047431 3300025940 Bacteria 3942
918 Ga0207711_10004053 3300025941 Bacteria 12576
919 Ga0207711_10004447 3300025941 Bacteria 11946
920 Ga0207711_10006173 3300025941 Bacteria 10125
921 Ga0207711_10088037 3300025941 Bacteria 2726
922 Ga0207711_10240675 3300025941 Bacteria 1659
923 Ga0207711_10289889 3300025941 Bacteria 1508
924 Ga0207711_10292550 3300025941 Bacteria 1501
925 Ga0207689_10002861 3300025942 Bacteria 15909
926 Ga0207689_10002971 3300025942 Bacteria 15641
927 Ga0207689_10026454 3300025942 Bacteria 4858
928 Ga0207689_10094496 3300025942 Bacteria 2456
929 Ga0207661_10001255 3300025944 Bacteria 16972
930 Ga0207661_10153493 3300025944 Bacteria 1992
931 Ga0207661_10709749 3300025944 Bacteria 925
932 Ga0207679_10000224 3300025945 Bacteria 44681
933 Ga0207679_10012758 3300025945 Bacteria 5489
934 Ga0207679_10125973 3300025945 Bacteria 2047
935 Ga0207679_10334582 3300025945 Bacteria 1315
936 Ga0207667_10053003 3300025949 Bacteria 4269
937 Ga0207667_10075762 3300025949 Bacteria 3493
938 Ga0207667_10132526 3300025949 Bacteria 2567
939 Ga0207667_10393999 3300025949 Bacteria 1410
940 Ga0207651_10000400 3300025960 Bacteria 18316
941 Ga0207651_10032914 3300025960 Bacteria 3336
942 Ga0207651_10065661 3300025960 Bacteria 2546
943 Ga0207712_10002420 3300025961 Bacteria 12064
944 Ga0207712_10011143 3300025961 Bacteria 5724
945 Ga0207712_10072600 3300025961 Bacteria 2479
946 Ga0207712_10102636 3300025961 Bacteria 2129
947 Ga0207712_10126556 3300025961 Bacteria 1941
948 Ga0207712_10151793 3300025961 Bacteria 1790
949 Ga0207712_10188288 3300025961 Bacteria 1627
950 Ga0207712_10346845 3300025961 Bacteria 1233
951 Ga0207668_10000698 3300025972 Bacteria 20584
952 Ga0207668_10034833 3300025972 Bacteria 3347
953 Ga0207668_10081745 3300025972 Bacteria 2345
954 Ga0207668_10085169 3300025972 Bacteria 2305
955 Ga0207668_10092027 3300025972 Bacteria 2231
956 Ga0207668_10254092 3300025972 Bacteria 1429
957 Ga0207640_10002531 3300025981 Bacteria 9796
958 Ga0207640_10068098 3300025981 Bacteria 2384
959 Ga0207640_10124525 3300025981 Bacteria 1853
960 Ga0207658_10010812 3300025986 Bacteria 6209
961 Ga0207658_10077886 3300025986 Bacteria 2531
962 Ga0207658_10406356 3300025986 Bacteria 1198
963 Ga0207677_10001410 3300026023 Bacteria 12805
964 Ga0207677_10015387 3300026023 Bacteria 4499
965 Ga0207703_10001072 3300026035 Bacteria 26068
966 Ga0207703_10007803 3300026035 Bacteria 8471
967 Ga0207703_10011414 3300026035 Bacteria 6908
968 Ga0207703_10126880 3300026035 Bacteria 2198
969 Ga0207703_10369561 3300026035 Bacteria 1324
970 Ga0207639_10000756 3300026041 Bacteria 22035
971 Ga0207639_10132081 3300026041 Bacteria 2068
972 Ga0207639_10210546 3300026041 Bacteria 1673
973 Ga0207639_10265413 3300026041 Bacteria 1503
974 Ga0207678_10002752 3300026067 Bacteria 15926
975 Ga0207678_10019314 3300026067 Bacteria 5986
976 Ga0207678_10032254 3300026067 Bacteria 4565
977 Ga0207678_10033690 3300026067 Bacteria 4462
978 Ga0207678_10054803 3300026067 Bacteria 3434
979 Ga0207708_10004096 3300026075 Bacteria 10726
980 Ga0207708_10009115 3300026075 Bacteria 7343
981 Ga0207708_10021777 3300026075 Bacteria 4837
982 Ga0207702_10065778 3300026078 Bacteria 3106
983 Ga0207641_10002800 3300026088 Bacteria 15876
984 Ga0207641_10116629 3300026088 Bacteria 2376
985 Ga0207641_10213424 3300026088 Bacteria 1786
986 Ga0207641_10272044 3300026088 Bacteria 1590
987 Ga0207641_10466644 3300026088 Bacteria 1222
988 Ga0207648_10005710 3300026089 Bacteria 12470
989 Ga0207648_10009523 3300026089 Bacteria 9295
990 Ga0207676_10000347 3300026095 Bacteria 39680
991 Ga0207676_10002836 3300026095 Bacteria 12332
992 Ga0207676_10045167 3300026095 Bacteria 3402
993 Ga0207676_10246476 3300026095 Bacteria 1606
994 Ga0207676_10603834 3300026095 Bacteria 1054
995 Ga0207676_10717307 3300026095 Bacteria 970
996 Ga0207674_10000608 3300026116 Bacteria 46971
997 Ga0207674_10203368 3300026116 Bacteria 1930
998 Ga0207674_10277790 3300026116 Bacteria 1622
999 Ga0207674_10315933 3300026116 Bacteria 1511
1000 Ga0207675_100003249 3300026118 Bacteria 15927
1001 Ga0207675_100004191 3300026118 Bacteria 13954
1002 Ga0207675_100027599 3300026118 Bacteria 5288
1003 Ga0207675_100307900 3300026118 Bacteria 1544
1004 Ga0207683_10000082 3300026121 Bacteria 74842
1005 Ga0207683_10001639 3300026121 Bacteria 20049
1006 Ga0207683_10005386 3300026121 Bacteria 10966
1007 Ga0207683_10008081 3300026121 Bacteria 8999
1008 Ga0207683_10287967 3300026121 Bacteria 1502
1009 Ga0207698_10004048 3300026142 Bacteria 8902
1010 Ga0207698_10030646 3300026142 Bacteria 3872
1011 Ga0207698_10149564 3300026142 Bacteria 2024
1012 Ga0207698_10206254 3300026142 Bacteria 1764
1013 Ga0207698_10318487 3300026142 Bacteria 1455
1014 Ga0209281_1000268 3300027111 Bacteria 100508
1015 Ga0209281_1000310 3300027111 Bacteria 87212
1016 Ga0209281_1001674 3300027111 Bacteria 11676
1017 Ga0209371_1000021 3300027312 Bacteria 555864
1018 Ga0209371_1000698 3300027312 Bacteria 28446
1019 Ga0209371_1011725 3300027312 Bacteria 2582
1020 Ga0209179_1001507 3300027512 Bacteria 2876
1021 Ga0210002_1001110 3300027617 Bacteria 3743
1022 Ga0209983_1002766 3300027665 Bacteria 3804
1023 Ga0209282_1000026 3300027666 Bacteria 166272
1024 Ga0209282_1000300 3300027666 Bacteria 24486
1025 Ga0209282_1045429 3300027666 Bacteria 2570
1026 Ga0209971_1013067 3300027682 Bacteria 1967
1027 Ga0209966_1004480 3300027695 Bacteria 2368
1028 Ga0209998_10001378 3300027717 Bacteria 5895
1029 Ga0209998_10002981 3300027717 Bacteria 3770
1030 Ga0209813_10008474 3300027866 Bacteria 2600
1031 Ga0209813_10012073 3300027866 Bacteria 2273
1032 Ga0209974_10001218 3300027876 Bacteria 9206
1033 Ga0207428_10000256 3300027907 Bacteria 72918
1034 Ga0207428_10000338 3300027907 Bacteria 60937
1035 Ga0207428_10000804 3300027907 Bacteria 35481
1036 Ga0207428_10017874 3300027907 Bacteria 6078
1037 Ga0207428_10049144 3300027907 Bacteria 3381
1038 Ga0207428_10355749 3300027907 Bacteria 1077
1039 Ga0265357_1001835 3300028023 Bacteria 1638
1040 Ga0268266_10021269 3300028379 Bacteria 5527
1041 Ga0268266_10061600 3300028379 Bacteria 3236
1042 Ga0268266_10542742 3300028379 Bacteria 1113
1043 Ga0268266_10680030 3300028379 Bacteria 991
1044 Ga0268265_10003525 3300028380 Bacteria 11193
1045 Ga0268265_10123681 3300028380 Bacteria 2136
1046 Ga0268265_10145857 3300028380 Bacteria 1989
1047 Ga0268265_10191916 3300028380 Bacteria 1765
1048 Ga0268265_10302611 3300028380 Bacteria 1440
1049 Ga0268264_10000762 3300028381 Bacteria 35963
1050 Ga0268264_10019150 3300028381 Bacteria 5595
1051 Ga0268264_10054648 3300028381 Bacteria 3335
1052 Ga0268264_10057752 3300028381 Bacteria 3246
1053 Ga0268264_10102557 3300028381 Bacteria 2490
1054 Ga0265337_1003113 3300028556 Bacteria 7315
1055 Ga0265336_10039639 3300028666 Bacteria 1444
1056 Ga0307515_10000274 3300028794 Bacteria 126011
1057 Ga0307515_10040282 3300028794 Bacteria 7392
1058 Ga0307515_10067674 3300028794 Bacteria 4921
1059 Ga0307515_10138433 3300028794 Bacteria 2628
1060 Ga0265338_10022745 3300028800 Bacteria 6473
1061 Ga0265338_10122398 3300028800 Bacteria 2070
1062 Ga0265324_10001149 3300029957 Bacteria 15817
1063 Ga0265324_10035124 3300029957 Bacteria 1746
1064 Ga0268256_1000020 3300030500 Bacteria 557873
1065 Ga0268256_1005121 3300030500 Bacteria 5221
1066 Ga0268256_1015115 3300030500 Bacteria 2266
1067 Ga0265762_1017489 3300030760 Bacteria 1305
1068 Ga0265763_1001123 3300030763 Bacteria 1839
1069 Ga0265760_10044076 3300031090 Bacteria 1334
1070 Ga0265330_10007596 3300031235 Bacteria 5272
1071 Ga0265330_10028620 3300031235 Bacteria 2510
1072 Ga0265330_10036189 3300031235 Bacteria 2201
1073 Ga0265330_10058925 3300031235 Bacteria 1673
1074 Ga0265330_10122354 3300031235 Bacteria 1108
1075 Ga0265332_10000910 3300031238 Bacteria 17749
1076 Ga0265332_10014182 3300031238 Bacteria 3526
1077 Ga0265332_10028016 3300031238 Bacteria 2467
1078 Ga0265328_10117374 3300031239 Bacteria 991
1079 Ga0265320_10004204 3300031240 Bacteria 9461
1080 Ga0265325_10000105 3300031241 Bacteria 59642
1081 Ga0265325_10000230 3300031241 Bacteria 39802
1082 Ga0265325_10000697 3300031241 Bacteria 24447
1083 Ga0265325_10018514 3300031241 Bacteria 3863
1084 Ga0265325_10021929 3300031241 Bacteria 3502
1085 Ga0265325_10031272 3300031241 Bacteria 2850
1086 Ga0265325_10067784 3300031241 Bacteria 1797
1087 Ga0265325_10084512 3300031241 Bacteria 1573
1088 Ga0265329_10009039 3300031242 Bacteria 3741
1089 Ga0265340_10002029 3300031247 Bacteria 11597
1090 Ga0265340_10021000 3300031247 Bacteria 3349
1091 Ga0265340_10030315 3300031247 Bacteria 2711
1092 Ga0265340_10084741 3300031247 Bacteria 1488
1093 Ga0265340_10112303 3300031247 Bacteria 1259
1094 Ga0265339_10000075 3300031249 Bacteria 85133
1095 Ga0265339_10008490 3300031249 Bacteria 6534
1096 Ga0265339_10012275 3300031249 Bacteria 5236
1097 Ga0265339_10017015 3300031249 Bacteria 4314
1098 Ga0265339_10038245 3300031249 Bacteria 2678
1099 Ga0265339_10041543 3300031249 Bacteria 2551
1100 Ga0265339_10106439 3300031249 Bacteria 1455
1101 Ga0265339_10160008 3300031249 Bacteria 1133
1102 Ga0265331_10039368 3300031250 Bacteria 2306
1103 Ga0265331_10164281 3300031250 Bacteria 1006
1104 Ga0265316_10009784 3300031344 Bacteria 8805
1105 Ga0265316_10037266 3300031344 Bacteria 3927
1106 Ga0265316_10114860 3300031344 Bacteria 2036
1107 Ga0265316_10114960 3300031344 Bacteria 2035
1108 Ga0265316_10116095 3300031344 Bacteria 2023
1109 Ga0265316_10116690 3300031344 Bacteria 2018
1110 Ga0265316_10130520 3300031344 Bacteria 1893
1111 Ga0307513_10040399 3300031456 Bacteria 5159
1112 Ga0307513_10166031 3300031456 Bacteria 2092
1113 Ga0307509_10306767 3300031507 Bacteria 1332
1114 Ga0307408_100037549 3300031548 Bacteria 3413
1115 Ga0265313_10000031 3300031595 Bacteria 128981
1116 Ga0265313_10000041 3300031595 Bacteria 119119
1117 Ga0265313_10000540 3300031595 Bacteria 39475
1118 Ga0265313_10000632 3300031595 Bacteria 36281
1119 Ga0265313_10040269 3300031595 Bacteria 2311
1120 Ga0265313_10072741 3300031595 Bacteria 1579
1121 Ga0265313_10105050 3300031595 Bacteria 1248
1122 Ga0316575_10030297 3300031665 Bacteria 2115
1123 Ga0265314_10020944 3300031711 Bacteria 5040
1124 Ga0265314_10036923 3300031711 Bacteria 3545
1125 Ga0265314_10081817 3300031711 Bacteria 2126
1126 Ga0265314_10239823 3300031711 Bacteria 1047
1127 Ga0265342_10000146 3300031712 Bacteria 80151
1128 Ga0265342_10002975 3300031712 Bacteria 14226
1129 Ga0265342_10010066 3300031712 Bacteria 6594
1130 Ga0265342_10012876 3300031712 Bacteria 5644
1131 Ga0265342_10059087 3300031712 Bacteria 2265
1132 Ga0265342_10068900 3300031712 Bacteria 2067
1133 Ga0265342_10271621 3300031712 Bacteria 900
1134 Ga0316578_10137444 3300031728 Bacteria 1471
1135 Ga0307410_10480022 3300031852 Bacteria 1019
1136 Ga0307406_10012890 3300031901 Bacteria 4775
1137 Ga0307406_10129869 3300031901 Bacteria 1767
1138 Ga0307412_10024199 3300031911 Bacteria 3747
1139 Ga0307412_10298148 3300031911 Bacteria 1273
1140 Ga0315914_1000008 3300031967 Bacteria 209133
1141 Ga0307409_100013850 3300031995 Bacteria 5214
1142 Ga0307416_100551217 3300032002 Bacteria 1226
1143 Ga0307414_10189521 3300032004 Bacteria 1662
1144 Ga0307411_10049782 3300032005 Bacteria 2725
1145 Ga0316585_10040220 3300032137 Bacteria 1488
1146 Ga0307510_10068963 3300033180 Bacteria 3545
1147 Ga0315913_1000093 3300033430 Bacteria 51180
1148 Ga0315915_1000014 3300033464 Bacteria 171068
1149 Ga0373930_0000013 3300034816 Bacteria 17272
1150 Ga0373948_0000118 3300034817 Bacteria 8262
1151 Ga0373948_0000496 3300034817 Bacteria 4915
1152 Ga0373948_0009819 3300034817 Bacteria 1659
1153 Ga0373950_0000691 3300034818 Bacteria 4166
1154 Ga0373958_0000188 3300034819 Bacteria 7177
1155 Ga0373959_0035136 3300034820 Bacteria 1029
1156 Ga0373938_0000083 3300034957 Bacteria 12786
1157 Ga0373938_0002057 3300034957 Bacteria 3230
1158 Ga0373928_0003067 3300035084 Bacteria 3209
1159 Ga0373928_0047100 3300035084 Bacteria 1008
1160 Ga0373929_0000068 3300035085 Bacteria 17576
1161 Ga0373929_0013157 3300035085 Bacteria 1582
1162 Ga0373934_0001326 3300035086 Bacteria 9034
1163 Ga0373934_0043029 3300035086 Bacteria 1785
1164 Ga0373944_0011106 3300035089 Bacteria 2463
1165 Ga0373944_0012539 3300035089 Bacteria 2338
1166 Ga0373944_0049692 3300035089 Bacteria 1319
1167 Ga0373944_0104831 3300035089 Bacteria 959
1168 Ga0373949_0000934 3300035090 Bacteria 9111
1169 Ga0373949_0002952 3300035090 Bacteria 4186
1170 Ga0373949_0010566 3300035090 Bacteria 2024
1171 Ga0373949_0062024 3300035090 Bacteria 964
1172 Ga0373951_0001301 3300035091 Bacteria 6589
1173 Ga0373951_0001345 3300035091 Bacteria 6466
1174 Ga0373952_0000414 3300035092 Bacteria 7370
1175 Ga0373952_0001711 3300035092 Bacteria 3990
1176 Ga0373923_0009654 3300035111 Bacteria 3489
1177 Ga0373923_0146548 3300035111 Bacteria 1070
1178 Ga0373932_0001138 3300035112 Bacteria 7655
1179 Ga0373932_0003121 3300035112 Bacteria 4032
1180 Ga0373936_0000315 3300035113 Bacteria 16336
1181 Ga0373936_0001160 3300035113 Bacteria 9476
1182 Ga0373936_0021334 3300035113 Bacteria 2519
1183 Ga0373936_0067954 3300035113 Bacteria 1465
1184 Ga0373939_0002139 3300035114 Bacteria 4699
1185 Ga0373939_0009952 3300035114 Bacteria 2366
1186 Ga0373939_0010074 3300035114 Bacteria 2355
1187 Ga0373939_0027034 3300035114 Bacteria 1622
1188 Ga0373939_0045484 3300035114 Bacteria 1340
1189 Ga0373939_0059491 3300035114 Bacteria 1212
1190 Ga0373941_0000938 3300035115 Bacteria 6009
1191 Ga0373941_0003446 3300035115 Bacteria 3582
1192 Ga0373941_0020523 3300035115 Bacteria 1853
1193 Ga0373945_0001093 3300035116 Bacteria 8162
1194 Ga0373945_0005613 3300035116 Bacteria 4023
1195 Ga0373945_0021656 3300035116 Bacteria 2210
1196 Ga0373953_0020595 3300035117 Bacteria 2465
1197 Ga0373954_0006830 3300035118 Bacteria 4979
1198 Ga0373954_0043269 3300035118 Bacteria 2100
1199 Ga0373954_0087135 3300035118 Bacteria 1496
1200 Ga0373956_0007620 3300035119 Bacteria 4362
1201 Ga0373956_0018744 3300035119 Bacteria 2933
1202 Ga0373957_0069156 3300035120 Bacteria 1378
1203 Ga0373960_0002307 3300035121 Bacteria 4292
1204 Ga0373960_0003157 3300035121 Bacteria 3725
1205 Ga0373960_0008174 3300035121 Bacteria 2500
1206 Ga0373960_0021877 3300035121 Bacteria 1706
1207 Ga0373943_0000209 3300035170 Bacteria 24029
1208 Ga0373943_0000945 3300035170 Bacteria 12841
1209 Ga0373943_0007527 3300035170 Bacteria 4891
1210 Ga0373943_0012663 3300035170 Bacteria 3802
1211 Ga0373943_0108447 3300035170 Bacteria 1461
1212 Ga0373946_0000216 3300035171 Bacteria 17908
1213 Ga0373946_0001244 3300035171 Bacteria 8814
1214 Ga0373946_0005866 3300035171 Bacteria 4448
1215 Ga0373955_0006553 3300035172 Bacteria 5310
1216 Ga0373955_0017381 3300035172 Bacteria 3559
1217 Ga0373955_0041393 3300035172 Bacteria 2469
1218 Ga0373955_0042929 3300035172 Bacteria 2430
1219 Ga0373942_0000520 3300035207 Bacteria 10751
1220 Ga0373942_0002511 3300035207 Bacteria 4446
1221 Ga0373961_0001414 3300035241 Bacteria 7150
1222 Ga0373961_0011252 3300035241 Bacteria 2218
1223 Ga0373962_0000558 3300035242 Bacteria 8384
1224 Ga0373962_0003426 3300035242 Bacteria 3810
1225 Ga0373962_0041721 3300035242 Bacteria 1295
1226 Ga0373962_0100762 3300035242 Bacteria 901
1227 Ga0316574_0000583 3300035398 Bacteria 15122
1228 Ga0373924_0000349 3300035410 Bacteria 14213
1229 Ga0373924_0025289 3300035410 Bacteria 2347
1230 Ga0373924_0042730 3300035410 Bacteria 1860
1231 Ga0373924_0044770 3300035410 Bacteria 1819
1232 Ga0373924_0060228 3300035410 Bacteria 1587
1233 Ga0373931_0007905 3300035691 Bacteria 5030
1234 Ga0373931_0008996 3300035691 Bacteria 4760
1235 Ga0373931_0015638 3300035691 Bacteria 3724
1236 Ga0373931_0046184 3300035691 Bacteria 2301
1237 Ga0373931_0050128 3300035691 Bacteria 2220
1238 Ga0373931_0230123 3300035691 Bacteria 1120
1239 Ga0373931_0271151 3300035691 Bacteria 1039
1240 Ga0373935_0000292 3300035692 Bacteria 24777
1241 Ga0373935_0019413 3300035692 Bacteria 4145
1242 Ga0373935_0037058 3300035692 Bacteria 3051
1243 Ga0373935_0042240 3300035692 Bacteria 2866
1244 Ga0373935_0185649 3300035692 Bacteria 1429
1245 Ga0373927_0002703 3300035695 Bacteria 12925
1246 Ga0373927_0003567 3300035695 Bacteria 11110
1247 Ga0373927_0011896 3300035695 Bacteria 5793
1248 Ga0373927_0020628 3300035695 Bacteria 4320
1249 Ga0373927_0060108 3300035695 Bacteria 2458
1250 Ga0373927_0105441 3300035695 Bacteria 1835
1251 Ga0373927_0160967 3300035695 Bacteria 1470
1252 Ga0373933_0000518 3300035724 Bacteria 24100
1253 Ga0373933_0004901 3300035724 Bacteria 7305
1254 Ga0373933_0030508 3300035724 Bacteria 3122
1255 Ga0373947_0000365 3300035725 Bacteria 25566
1256 Ga0373947_0000379 3300035725 Bacteria 25163
1257 Ga0373947_0001671 3300035725 Bacteria 13579
1258 Ga0373947_0023554 3300035725 Bacteria 3583
1259 Ga0373947_0045411 3300035725 Bacteria 2629
1260 Ga0373947_0082367 3300035725 Bacteria 1994
1261 Ga0373937_0001710 3300036401 Bacteria 18446
1262 Ga0373937_0005614 3300036401 Bacteria 10769
1263 Ga0373937_0008148 3300036401 Bacteria 9098
1264 Ga0373937_0034353 3300036401 Bacteria 4612
1265 Ga0373937_0068299 3300036401 Bacteria 3277
1266 Ga0373937_0155498 3300036401 Bacteria 2143
1267 Ga0373937_0175585 3300036401 Bacteria 2011
1268 Ga0373937_0555311 3300036401 Bacteria 1091
1269 Ga0373937_0627728 3300036401 Bacteria 1020
1270 Ga0373937_0744621 3300036401 Bacteria 927
1271 Ga0316582_0034396 3300036647 Bacteria 3121
1272 Ga0316584_0021319 3300036712 Bacteria 4708
1273 Ga0373925_0000018 3300037068 Bacteria 174213
1274 Ga0373925_0001344 3300037068 Bacteria 21480
1275 Ga0373925_0001465 3300037068 Bacteria 20320
1276 Ga0373925_0015007 3300037068 Bacteria 5600
1277 Ga0373925_0041952 3300037068 Bacteria 3394
1278 Ga0373925_0115236 3300037068 Bacteria 2081
1279 Ga0373925_0142520 3300037068 Bacteria 1877
1280 Ga0373925_0210883 3300037068 Bacteria 1547
1281 Ga0395899_0008003 3300037312 Bacteria 8142
1282 Ga0395899_0132245 3300037312 Bacteria 1781
1283 Ga0395900_0002888 3300037418 Bacteria 18709
1284 Ga0395900_0012043 3300037418 Bacteria 8841
1285 Ga0395900_0146307 3300037418 Bacteria 2416
1286 Ga0395900_0490698 3300037418 Bacteria 1180
1287 Ga0395898_0007773 3300037466 Bacteria 11384
1288 Ga0395898_0046567 3300037466 Bacteria 4260
1289 Ga0395898_0079433 3300037466 Bacteria 3165
1290 Ga0395905_0000658 3300037471 Bacteria 45924
1291 Ga0395905_0005373 3300037471 Bacteria 13092
1292 Ga0395905_0015770 3300037471 Bacteria 7178
1293 Ga0395905_0084201 3300037471 Bacteria 2979
1294 Ga0436364_0161603 3300037853 Bacteria 2070
1295 Ga0436364_0410618 3300037853 Bacteria 84995
1296 Ga0436364_0681691 3300037853 Bacteria 1572
1297 Ga0436364_0773514 3300037853 Bacteria 3091
1298 Ga0436364_0774545 3300037853 Bacteria 3389
1299 Ga0436364_1053682 3300037853 Bacteria 2868
1300 Ga0395901_0021727 3300038443 Bacteria 6575
1301 Ga0395901_0120912 3300038443 Bacteria 2752
1302 Ga0395901_0181108 3300038443 Bacteria 2210
1303 Ga0395901_0276015 3300038443 Bacteria 1747
1304 Ga0436365_0000552 3300039437 Bacteria 1542
1305 Ga0436365_0219019 3300039437 Bacteria 1215
1306 Ga0436365_0780547 3300039437 Bacteria 4510
1307 Ga0436365_0934594 3300039437 Bacteria 2372
1308 Ga0436365_1689635 3300039437 Bacteria 1084
1309 Ga0436360_1030738 3300039438 Bacteria 1177
1310 Ga0436361_0447916 3300039447 Bacteria 3739
1311 Ga0436361_0583883 3300039447 Bacteria 1757
1312 Ga0436361_1191526 3300039447 Bacteria 2024
1313 Ga0436363_0551050 3300039450 Bacteria 963
1314 Ga0436363_0575052 3300039450 Bacteria 1702
1315 Ga0436363_0634809 3300039450 Bacteria 5257
1316 Ga0436362_0292983 3300039453 Bacteria 3480
1317 Ga0436362_0772071 3300039453 Bacteria 1616
1318 Ga0436362_0838148 3300039453 Bacteria 856
1319 Ga0439436_0008690 3300041404 Bacteria 3122
1320 Ga0439436_0046246 3300041404 Bacteria 1237
1321 Ga0439439_0005910 3300041406 Bacteria 2818
1322 Ga0439439_0032432 3300041406 Bacteria 1334
1323 Ga0439447_027226 3300041407 Bacteria 1460
1324 Ga0439453_0003170 3300041408 Bacteria 2341
1325 Ga0439465_0001450 3300041413 Bacteria 7677
1326 Ga0439465_0004393 3300041413 Bacteria 4561
1327 Ga0439465_0027863 3300041413 Bacteria 1790
1328 Ga0451833_0223154 3300041491 Bacteria 8683
1329 Ga0451837_0499150 3300041494 Bacteria 1118
1330 Ga0451837_1523969 3300041494 Bacteria 1074
1331 Ga0451845_0654372 3300041501 Bacteria 2233
1332 Ga0451846_70228 3300041502 Bacteria 1805
1333 Ga0451847_0083388 3300041503 Bacteria 2144
1334 Ga0451849_0489010 3300041505 Bacteria 994
1335 Ga0451850_35806 3300041506 Bacteria 986
1336 Ga0451851_0987432 3300041507 Bacteria 1473
1337 Ga0451843_0065450 3300041509 Bacteria 4230
1338 Ga0451854_37387 3300041510 Bacteria 1426
1339 Ga0451855_1098170 3300041511 Bacteria 2084
1340 Ga0451853_2558696 3300041512 Bacteria 6758
1341 Ga0452268_15340 3300041907 Bacteria 2145
1342 Ga0439443_017300 3300042003 Bacteria 1108
1343 Ga0439449_0000949 3300042007 Bacteria 11352
1344 Ga0439449_0008506 3300042007 Bacteria 3899
1345 Ga0439449_0022500 3300042007 Bacteria 2361
1346 Ga0439450_014888 3300042008 Bacteria 1584
1347 Ga0439455_0022392 3300042012 Bacteria 1514
1348 Ga0439462_0032319 3300042015 Bacteria 1387
1349 Ga0439462_0066949 3300042015 Bacteria 974
1350 Ga0450923_006239 3300042125 Bacteria 1966
1351 Ga0450906_006925 3300042145 Bacteria 2262
1352 Ga0439435_0001488 3300042436 Bacteria 4353
1353 Ga0439435_0026765 3300042436 Bacteria 1538
1354 Ga0439464_0007232 3300042439 Bacteria 2902
1355 Ga0439460_0068028 3300042461 Bacteria 1098
1356 Ga0466972_0109823 3300044658 Bacteria 1303
1357 Ga0466972_0167256 3300044658 Bacteria 1032
1358 Ga0466963_0153839 3300044694 Bacteria 1598
1359 Ga0453684_0026923 3300044712 Bacteria 8281
1360 Ga0453684_0134128 3300044712 Bacteria 2967
1361 Ga0466971_0059506 3300044719 Bacteria 1726
1362 Ga0466971_0154350 3300044719 Bacteria 1073
1363 Ga0466971_0231736 3300044719 Bacteria 877
1364 Ga0466970_0014361 3300044765 Bacteria 4066
1365 Ga0466970_0187936 3300044765 Bacteria 1147
1366 Ga0466957_0024191 3300044842 Bacteria 3593
1367 Ga0466960_0054234 3300044901 Bacteria 1946
1368 Ga0466960_0092051 3300044901 Bacteria 1547
1369 Ga0466960_0183827 3300044901 Bacteria 1134
1370 Ga0466960_0284038 3300044901 Bacteria 928
1371 Ga0451576_0105599 3300045051 Bacteria 2930
1372 Ga0466958_0012605 3300045836 Bacteria 4791
1373 Ga0466967_0159662 3300045976 Bacteria 2115
1374 Ga0466967_0368081 3300045976 Bacteria 1394
1375 Ga0495592_0000001 3300046454 Bacteria 305819
1376 Ga0495592_0002225 3300046454 Bacteria 13688
1377 Ga0495592_0082329 3300046454 Bacteria 2326
1378 Ga0495592_0117157 3300046454 Bacteria 1878
1379 Ga0495592_0139526 3300046454 Bacteria 1687
1380 Ga0495592_0296730 3300046454 Bacteria 1052
1381 Ga0495603_0026838 3300046455 Bacteria 3478
1382 Ga0495603_0030937 3300046455 Bacteria 3223
1383 Ga0495629_0000440 3300046459 Bacteria 34677
1384 Ga0495629_0023211 3300046459 Bacteria 4420
1385 Ga0495629_0024988 3300046459 Bacteria 4249
1386 Ga0495629_0038204 3300046459 Bacteria 3383
1387 Ga0495629_0054577 3300046459 Bacteria 2794
1388 Ga0495638_0001347 3300046460 Bacteria 22537
1389 Ga0495638_0014704 3300046460 Bacteria 5279
1390 Ga0495641_0043238 3300046461 Bacteria 2084
1391 Ga0495641_0138510 3300046461 Bacteria 1087
1392 Ga0495651_0002430 3300046462 Bacteria 14380
1393 Ga0495651_0004059 3300046462 Bacteria 11187
1394 Ga0495651_0011906 3300046462 Bacteria 6692
1395 Ga0495651_0013966 3300046462 Bacteria 6211
1396 Ga0495651_0113334 3300046462 Bacteria 2002
1397 Ga0495653_0000092 3300046463 Bacteria 74868
1398 Ga0495653_0006947 3300046463 Bacteria 9293
1399 Ga0495653_0008183 3300046463 Bacteria 8563
1400 Ga0495653_0048455 3300046463 Bacteria 3280
1401 Ga0495653_0173739 3300046463 Bacteria 1485
1402 Ga0495580_0002900 3300046472 Bacteria 14738
1403 Ga0495580_0037929 3300046472 Bacteria 3455
1404 Ga0495580_0311624 3300046472 Bacteria 1070
1405 Ga0495582_0000914 3300046473 Bacteria 16434
1406 Ga0495582_0025155 3300046473 Bacteria 3261
1407 Ga0495582_0087153 3300046473 Bacteria 1738
1408 Ga0495605_0003366 3300046474 Bacteria 9555
1409 Ga0495605_0055337 3300046474 Bacteria 1917
1410 Ga0495605_0121668 3300046474 Bacteria 1183
1411 Ga0495639_0006388 3300046475 Bacteria 5068
1412 Ga0495639_0050853 3300046475 Bacteria 1883
1413 Ga0495639_0069438 3300046475 Bacteria 1625
1414 Ga0495662_0014931 3300046476 Bacteria 3772
1415 Ga0495662_0016685 3300046476 Bacteria 3558
1416 Ga0495662_0026739 3300046476 Bacteria 2786
1417 Ga0495662_0028884 3300046476 Bacteria 2677
1418 Ga0495662_0136709 3300046476 Bacteria 1205
1419 Ga0495662_0169166 3300046476 Bacteria 1077
1420 Ga0495664_0000001 3300046477 Bacteria 757730
1421 Ga0495664_0000814 3300046477 Bacteria 15977
1422 Ga0495664_0004525 3300046477 Bacteria 7604
1423 Ga0495664_0031813 3300046477 Bacteria 3093
1424 Ga0495664_0265202 3300046477 Bacteria 1038
1425 Ga0495584_0022280 3300046491 Bacteria 3215
1426 Ga0495584_0126197 3300046491 Bacteria 1297
1427 Ga0495585_0008712 3300046492 Bacteria 6133
1428 Ga0495585_0017056 3300046492 Bacteria 4202
1429 Ga0495585_0017347 3300046492 Bacteria 4159
1430 Ga0495594_0022816 3300046499 Bacteria 3350
1431 Ga0495594_0138575 3300046499 Bacteria 1379
1432 Ga0495607_0006526 3300046501 Bacteria 8201
1433 Ga0495607_0019982 3300046501 Bacteria 4242
1434 Ga0495583_0002986 3300046506 Bacteria 13562
1435 Ga0495583_0036678 3300046506 Bacteria 2330
1436 Ga0495606_0000519 3300046507 Bacteria 62313
1437 Ga0495606_0002491 3300046507 Bacteria 21290
1438 Ga0495606_0010164 3300046507 Bacteria 7850
1439 Ga0495606_0210997 3300046507 Bacteria 1100
1440 Ga0495608_0000109 3300046511 Bacteria 59207
1441 Ga0495608_0010975 3300046511 Bacteria 6313
1442 Ga0495608_0031649 3300046511 Bacteria 3576
1443 Ga0495608_0061907 3300046511 Bacteria 2460
1444 Ga0495608_0069457 3300046511 Bacteria 2301
1445 Ga0495610_0007132 3300046512 Bacteria 7531
1446 Ga0495610_0052713 3300046512 Bacteria 1973
1447 Ga0495610_0158020 3300046512 Bacteria 961
1448 Ga0495616_0038046 3300046513 Bacteria 2472
1449 Ga0495618_0000064 3300046514 Bacteria 77194
1450 Ga0495618_0000996 3300046514 Bacteria 19404
1451 Ga0495618_0005449 3300046514 Bacteria 7754
1452 Ga0495618_0014942 3300046514 Bacteria 4735
1453 Ga0495618_0339685 3300046514 Bacteria 927
1454 Ga0495620_0009503 3300046515 Bacteria 5167
1455 Ga0495620_0038067 3300046515 Bacteria 2137
1456 Ga0495628_0000003 3300046516 Bacteria 470339
1457 Ga0495628_0027928 3300046516 Bacteria 4588
1458 Ga0495628_0155210 3300046516 Bacteria 1742
1459 Ga0495630_0000850 3300046517 Bacteria 21530
1460 Ga0495630_0003083 3300046517 Bacteria 11559
1461 Ga0495630_0018564 3300046517 Bacteria 5111
1462 Ga0495630_0042458 3300046517 Bacteria 3396
1463 Ga0495630_0085916 3300046517 Bacteria 2375
1464 Ga0495630_0100353 3300046517 Bacteria 2190
1465 Ga0495630_0121039 3300046517 Bacteria 1985
1466 Ga0495630_0196499 3300046517 Bacteria 1539
1467 Ga0495631_0002151 3300046518 Bacteria 11384
1468 Ga0495631_0090472 3300046518 Bacteria 1318
1469 Ga0495637_0069554 3300046520 Bacteria 1424
1470 Ga0495637_0075845 3300046520 Bacteria 1348
1471 Ga0495643_0016698 3300046522 Bacteria 4310
1472 Ga0495643_0038505 3300046522 Bacteria 2618
1473 Ga0495643_0045214 3300046522 Bacteria 2391
1474 Ga0495644_0010408 3300046523 Bacteria 3584
1475 Ga0495644_0074383 3300046523 Bacteria 1278
1476 Ga0495648_0070121 3300046524 Bacteria 2038
1477 Ga0495648_0131491 3300046524 Bacteria 1330
1478 Ga0495648_0188306 3300046524 Bacteria 1043
1479 Ga0495666_0000884 3300046526 Bacteria 14016
1480 Ga0495666_0059754 3300046526 Bacteria 1823
1481 Ga0495666_0156427 3300046526 Bacteria 1058
1482 Ga0495652_0000001 3300046529 Bacteria 1045081
1483 Ga0495652_0019698 3300046529 Bacteria 6005
1484 Ga0495652_0022381 3300046529 Bacteria 5607
1485 Ga0495652_0073360 3300046529 Bacteria 2850
1486 Ga0495652_0126898 3300046529 Bacteria 2025
1487 Ga0495652_0147745 3300046529 Bacteria 1840
1488 Ga0495654_0002779 3300046530 Bacteria 11033
1489 Ga0495654_0128846 3300046530 Bacteria 1138
1490 Ga0495665_0001249 3300046531 Bacteria 13536
1491 Ga0495665_0003072 3300046531 Bacteria 9031
1492 Ga0495665_0054702 3300046531 Bacteria 2108
1493 Ga0495665_0058547 3300046531 Bacteria 2034
1494 Ga0495640_0000012 3300046533 Bacteria 194692
1495 Ga0495640_0007360 3300046533 Bacteria 8664
1496 Ga0495640_0012226 3300046533 Bacteria 6569
1497 Ga0495640_0021850 3300046533 Bacteria 4687
1498 Ga0495640_0032197 3300046533 Bacteria 3736
1499 Ga0495640_0072546 3300046533 Bacteria 2307
1500 Ga0495640_0176938 3300046533 Bacteria 1361
1501 Ga0495586_0020580 3300046535 Bacteria 3513
1502 Ga0495587_0000028 3300046536 Bacteria 138663
1503 Ga0495587_0013126 3300046536 Bacteria 5209
1504 Ga0495587_0026760 3300046536 Bacteria 3513
1505 Ga0495598_0015426 3300046537 Bacteria 1929
1506 Ga0495609_0046643 3300046538 Bacteria 1940
1507 Ga0495609_0058060 3300046538 Bacteria 1712
1508 Ga0495609_0120709 3300046538 Bacteria 1127
1509 Ga0495621_0043196 3300046539 Bacteria 1590
1510 Ga0495597_0003588 3300046542 Bacteria 8943
1511 Ga0495645_0000004 3300046543 Bacteria 532661
1512 Ga0495645_0011912 3300046543 Bacteria 6126
1513 Ga0495645_0027733 3300046543 Bacteria 4114
1514 Ga0495645_0030621 3300046543 Bacteria 3920
1515 Ga0495645_0157794 3300046543 Bacteria 1571
1516 Ga0495645_0206217 3300046543 Bacteria 1330
1517 Ga0495622_0003618 3300046557 Bacteria 7255
1518 Ga0495633_0014580 3300046558 Bacteria 4103
1519 Ga0495633_0022000 3300046558 Bacteria 3180
1520 Ga0495633_0074244 3300046558 Bacteria 1585
1521 Ga0495633_0127155 3300046558 Bacteria 1179
1522 Ga0495667_0000001 3300046559 Bacteria 834831
1523 Ga0495667_0003492 3300046559 Bacteria 10534
1524 Ga0495667_0007691 3300046559 Bacteria 7305
1525 Ga0495667_0021620 3300046559 Bacteria 4341
1526 Ga0495667_0088532 3300046559 Bacteria 2007
1527 Ga0495667_0158711 3300046559 Bacteria 1455
1528 Ga0495656_0003231 3300046615 Bacteria 5498
1529 Ga0495656_0012678 3300046615 Bacteria 3117
1530 Ga0495656_0095466 3300046615 Bacteria 1367
1531 Ga0495668_0009435 3300046616 Bacteria 5995
1532 Ga0495668_0177477 3300046616 Bacteria 1167
1533 Ga0495634_0000075 3300046642 Bacteria 77824
1534 Ga0495634_0005439 3300046642 Bacteria 9804
1535 Ga0495634_0006407 3300046642 Bacteria 8945
1536 Ga0495634_0036161 3300046642 Bacteria 3378
1537 Ga0495634_0049953 3300046642 Bacteria 2811
1538 Ga0495634_0059655 3300046642 Bacteria 2541
1539 Ga0495611_0028203 3300046648 Bacteria 2457
1540 Ga0495611_0046289 3300046648 Bacteria 1950
1541 Ga0495611_0091944 3300046648 Bacteria 1403
1542 Ga0495625_0001123 3300046660 Bacteria 34651
1543 Ga0495635_0000015 3300046663 Bacteria 215468
1544 Ga0495635_0001695 3300046663 Bacteria 14847
1545 Ga0495635_0008986 3300046663 Bacteria 6970
1546 Ga0495635_0010473 3300046663 Bacteria 6485
1547 Ga0495635_0044745 3300046663 Bacteria 3053
1548 Ga0495635_0145957 3300046663 Bacteria 1611
1549 Ga0495635_0157681 3300046663 Bacteria 1544
1550 Ga0495635_0248499 3300046663 Bacteria 1199
1551 Ga0495659_0000755 3300046664 Bacteria 11615
1552 Ga0495588_0003191 3300046674 Bacteria 7096
1553 Ga0495588_0009671 3300046674 Bacteria 4466
1554 Ga0495588_0048326 3300046674 Bacteria 2185
1555 Ga0495588_0092886 3300046674 Bacteria 1581
1556 Ga0495588_0173762 3300046674 Bacteria 1139
1557 Ga0495657_0000155 3300046675 Bacteria 62116
1558 Ga0495657_0015245 3300046675 Bacteria 5626
1559 Ga0495599_0000029 3300046678 Bacteria 113803
1560 Ga0495599_0044357 3300046678 Bacteria 2788
1561 Ga0495599_0103005 3300046678 Bacteria 1778
1562 Ga0495623_0000012 3300046679 Bacteria 120267
1563 Ga0495623_0063995 3300046679 Bacteria 2302
1564 Ga0495646_0000006 3300046680 Bacteria 258496
1565 Ga0495646_0007172 3300046680 Bacteria 7079
1566 Ga0495646_0115273 3300046680 Bacteria 1526
1567 Ga0495647_0003008 3300046681 Bacteria 5363
1568 Ga0495647_0146994 3300046681 Bacteria 1008
1569 Ga0495658_0000200 3300046683 Bacteria 34796
1570 Ga0495658_0023078 3300046683 Bacteria 3299
1571 Ga0495658_0037694 3300046683 Bacteria 2673
1572 Ga0495658_0051619 3300046683 Bacteria 2330
1573 Ga0495658_0054538 3300046683 Bacteria 2274
1574 Ga0495658_0329953 3300046683 Bacteria 968
1575 Ga0495669_0039593 3300046684 Bacteria 2087
1576 Ga0495669_0044918 3300046684 Bacteria 1969
1577 Ga0495669_0057334 3300046684 Bacteria 1757
1578 Ga0495613_0012563 3300046689 Bacteria 6294
1579 Ga0495613_0037492 3300046689 Bacteria 3594
1580 Ga0495613_0042847 3300046689 Bacteria 3348
1581 Ga0495613_0105367 3300046689 Bacteria 2035
1582 Ga0495613_0180831 3300046689 Bacteria 1493
1583 Ga0495624_0004405 3300046690 Bacteria 10305
1584 Ga0495624_0025399 3300046690 Bacteria 3889
1585 Ga0495624_0135007 3300046690 Bacteria 1512
1586 Ga0495670_0003961 3300046691 Bacteria 7270
1587 Ga0495670_0056140 3300046691 Bacteria 1975
1588 Ga0495671_0067481 3300046692 Bacteria 1759
1589 Ga0495671_0158040 3300046692 Bacteria 1103
1590 Ga0495671_0161207 3300046692 Bacteria 1091
1591 Ga0495589_0071238 3300046794 Bacteria 1699
1592 Ga0495600_0000286 3300046809 Bacteria 27213
1593 Ga0495600_0000769 3300046809 Bacteria 16893
1594 Ga0495600_0081137 3300046809 Bacteria 2117
1595 Ga0495600_0081880 3300046809 Bacteria 2106
1596 Ga0495581_0007762 3300047315 Bacteria 6210
1597 Ga0495581_0011638 3300047315 Bacteria 5092
1598 Ga0495581_0019388 3300047315 Bacteria 3948
1599 Ga0495581_0019773 3300047315 Bacteria 3910
1600 Ga0495581_0022637 3300047315 Bacteria 3640
1601 Ga0495581_0060666 3300047315 Bacteria 2186
1602 Ga0495604_0000091 3300047317 Bacteria 77216
1603 Ga0495604_0000625 3300047317 Bacteria 30418
1604 Ga0495604_0003181 3300047317 Bacteria 13120
1605 Ga0495604_0079809 3300047317 Bacteria 2453
1606 Ga0495604_0091311 3300047317 Bacteria 2259
1607 Ga0495604_0164754 3300047317 Bacteria 1564
1608 Ga0495674_0000001 3300047319 Bacteria 778665
1609 Ga0495674_0000267 3300047319 Bacteria 44377
1610 Ga0495674_0019582 3300047319 Bacteria 6278
1611 Ga0495674_0149677 3300047319 Bacteria 1958
1612 Ga0495674_0156336 3300047319 Bacteria 1910
1613 Ga0495674_0167520 3300047319 Bacteria 1835
1614 Ga0495674_0219464 3300047319 Bacteria 1572
1615 Ga0495672_0132500 3300047320 Bacteria 1310
1616 Ga0495672_0178828 3300047320 Bacteria 1076
1617 Ga0495676_0046479 3300047321 Bacteria 3522
1618 Ga0495676_0053351 3300047321 Bacteria 3222
1619 Ga0495676_0062782 3300047321 Bacteria 2898
1620 Ga0495676_0091423 3300047321 Bacteria 2275
1621 Ga0495680_0000489 3300047322 Bacteria 44631
1622 Ga0495680_0003110 3300047322 Bacteria 16521
1623 Ga0495680_0004500 3300047322 Bacteria 13332
1624 Ga0495680_0006435 3300047322 Bacteria 10914
1625 Ga0495680_0019890 3300047322 Bacteria 5658
1626 Ga0495680_0027736 3300047322 Bacteria 4647
1627 Ga0495680_0246100 3300047322 Bacteria 1268
1628 Ga0495687_113581 3300047443 Bacteria 990
1629 Ga0495675_0000113 3300047444 Bacteria 58250
1630 Ga0495675_0142951 3300047444 Bacteria 1482
1631 Ga0495675_0174034 3300047444 Bacteria 1321
1632 Ga0495679_062000 3300047446 Bacteria 1095
1633 Ga0495681_0006372 3300047470 Bacteria 7765
1634 Ga0495684_0000055 3300047471 Bacteria 79796
1635 Ga0495684_0002895 3300047471 Bacteria 13512
1636 Ga0495684_0005380 3300047471 Bacteria 9968
1637 Ga0495684_0097564 3300047471 Bacteria 2223
1638 Ga0495684_0097659 3300047471 Bacteria 2222
1639 Ga0495684_0251304 3300047471 Bacteria 1286
1640 Ga0495684_0253360 3300047471 Bacteria 1280
1641 Ga0495684_0256987 3300047471 Bacteria 1269
1642 Ga0495686_0004635 3300047472 Bacteria 11180
1643 Ga0495686_0025709 3300047472 Bacteria 3857
1644 Ga0495686_0032707 3300047472 Bacteria 3364
1645 Ga0495593_0003290 3300047673 Bacteria 9694
1646 Ga0495593_0006737 3300047673 Bacteria 6725
1647 Ga0495593_0012654 3300047673 Bacteria 4820
1648 Ga0495593_0018562 3300047673 Bacteria 3906
1649 Ga0495593_0103443 3300047673 Bacteria 1459
1650 Ga0495602_0000002 3300048088 Bacteria 422216
1651 Ga0495602_0003565 3300048088 Bacteria 16106
1652 Ga0495602_0070734 3300048088 Bacteria 2984
1653 Ga0495602_0074406 3300048088 Bacteria 2887
1654 Ga0495602_0119203 3300048088 Bacteria 2127
1655 Ga0495614_0028398 3300048089 Bacteria 2410
1656 Ga0495614_0042245 3300048089 Bacteria 1955
1657 Ga0496100_0000380 3300048903 Bacteria 21636
1658 Ga0496100_0006540 3300048903 Bacteria 6360
1659 Ga0496101_0001315 3300048904 Bacteria 14856
1660 Ga0496101_0022384 3300048904 Bacteria 4350
1661 Ga0496101_0023194 3300048904 Bacteria 4283
1662 Ga0496101_0082737 3300048904 Bacteria 2375
1663 Ga0496101_0171593 3300048904 Bacteria 1667
1664 Ga0496102_0010977 3300048905 Bacteria 7806
1665 Ga0496102_0047316 3300048905 Bacteria 3908
1666 Ga0496102_0058141 3300048905 Bacteria 3532
1667 Ga0496102_0058840 3300048905 Bacteria 3512
1668 Ga0496102_0062013 3300048905 Bacteria 3423
1669 Ga0496102_0103547 3300048905 Bacteria 2647
1670 Ga0496102_0205453 3300048905 Bacteria 1857
1671 Ga0496102_0247947 3300048905 Bacteria 1679
1672 Ga0496103_0002582 3300048906 Bacteria 11343
1673 Ga0496103_0016337 3300048906 Bacteria 4429
1674 Ga0496103_0028308 3300048906 Bacteria 3399
1675 Ga0496103_0051744 3300048906 Bacteria 2542
1676 Ga0496103_0103633 3300048906 Bacteria 1802
1677 Ga0496103_0110200 3300048906 Bacteria 1748
1678 Ga0496104_0000069 3300048907 Bacteria 107511
1679 Ga0496104_0001998 3300048907 Bacteria 17696
1680 Ga0496104_0002038 3300048907 Bacteria 17538
1681 Ga0496104_0009701 3300048907 Bacteria 8579
1682 Ga0496104_0012321 3300048907 Bacteria 7685
1683 Ga0496104_0032924 3300048907 Bacteria 4825
1684 Ga0496104_0051175 3300048907 Bacteria 3898
1685 Ga0496104_0108687 3300048907 Bacteria 2658
1686 Ga0496104_0109318 3300048907 Bacteria 2650
1687 Ga0496104_0125209 3300048907 Bacteria 2467
1688 Ga0496104_0221311 3300048907 Bacteria 1805
1689 Ga0496104_0257990 3300048907 Bacteria 1656
1690 Ga0496105_0000273 3300048908 Bacteria 34154
1691 Ga0496105_0003200 3300048908 Bacteria 12054
1692 Ga0496105_0012407 3300048908 Bacteria 6745
1693 Ga0496105_0027217 3300048908 Bacteria 4669
1694 Ga0496105_0035427 3300048908 Bacteria 4106
1695 Ga0496105_0127865 3300048908 Bacteria 2095
1696 Ga0496105_0162780 3300048908 Bacteria 1831
1697 Ga0496105_0195128 3300048908 Bacteria 1654
1698 Ga0496106_0004905 3300048909 Bacteria 9902
1699 Ga0496106_0005034 3300048909 Bacteria 9780
1700 Ga0496106_0006158 3300048909 Bacteria 8868
1701 Ga0496106_0011013 3300048909 Bacteria 6685
1702 Ga0496106_0017277 3300048909 Bacteria 5340
1703 Ga0496106_0221426 3300048909 Bacteria 1509
1704 Ga0496107_0000537 3300048910 Bacteria 21180
1705 Ga0496107_0006365 3300048910 Bacteria 8115
1706 Ga0496107_0013024 3300048910 Bacteria 5810
1707 Ga0496107_0063558 3300048910 Bacteria 2675
1708 Ga0496107_0067169 3300048910 Bacteria 2601
1709 Ga0496107_0091491 3300048910 Bacteria 2223
1710 Ga0496107_0215224 3300048910 Bacteria 1429
1711 Ga0496108_0018111 3300048911 Bacteria 5762
1712 Ga0496108_0025662 3300048911 Bacteria 4858
1713 Ga0496108_0065272 3300048911 Bacteria 3068
1714 Ga0496108_0115557 3300048911 Bacteria 2298
1715 Ga0496108_0129129 3300048911 Bacteria 2172
1716 Ga0496108_0201138 3300048911 Bacteria 1729
1717 Ga0496108_0273172 3300048911 Bacteria 1471
1718 Ga0496108_0555650 3300048911 Bacteria 1001
1719 Ga0496109_0000211 3300048912 Bacteria 57066
1720 Ga0496109_0004878 3300048912 Bacteria 11204
1721 Ga0496109_0007320 3300048912 Bacteria 9332
1722 Ga0496109_0010746 3300048912 Bacteria 7837
1723 Ga0496109_0055426 3300048912 Bacteria 3616
1724 Ga0496109_0094753 3300048912 Bacteria 2763
1725 Ga0496110_0005109 3300048913 Bacteria 10251
1726 Ga0496110_0025892 3300048913 Bacteria 5016
1727 Ga0496110_0042808 3300048913 Bacteria 3953
1728 Ga0496110_0047098 3300048913 Bacteria 3774
1729 Ga0496110_0047695 3300048913 Bacteria 3752
1730 Ga0496110_0054506 3300048913 Bacteria 3517
1731 Ga0496110_0057725 3300048913 Bacteria 3417
1732 Ga0496110_0068717 3300048913 Bacteria 3136
1733 Ga0496110_0088234 3300048913 Bacteria 2770
1734 Ga0496110_0387450 3300048913 Bacteria 1274
1735 Ga0496110_0502226 3300048913 Bacteria 1104
1736 Ga0496111_0000797 3300048914 Bacteria 16881
1737 Ga0496111_0014125 3300048914 Bacteria 5448
1738 Ga0496111_0031739 3300048914 Bacteria 3763
1739 Ga0496111_0141877 3300048914 Bacteria 1780
1740 Ga0496111_0154797 3300048914 Bacteria 1701
1741 Ga0496112_0000016 3300048915 Bacteria 194634
1742 Ga0496112_0003979 3300048915 Bacteria 12379
1743 Ga0496112_0005033 3300048915 Bacteria 11346
1744 Ga0496112_0010105 3300048915 Bacteria 8545
1745 Ga0496112_0035820 3300048915 Bacteria 4836
1746 Ga0496112_0056278 3300048915 Bacteria 3870
1747 Ga0496112_0090590 3300048915 Bacteria 3027
1748 Ga0496112_0273024 3300048915 Bacteria 1639
1749 Ga0496113_0000104 3300048916 Bacteria 35682
1750 Ga0496113_0004791 3300048916 Bacteria 8362
1751 Ga0496113_0013067 3300048916 Bacteria 5605
1752 Ga0496113_0016231 3300048916 Bacteria 5141
1753 Ga0496113_0025017 3300048916 Bacteria 4251
1754 Ga0496113_0080700 3300048916 Bacteria 2492
1755 Ga0496113_0126942 3300048916 Bacteria 1998
1756 Ga0496113_0374952 3300048916 Bacteria 1142
1757 Ga0496114_0003482 3300048917 Bacteria 12085
1758 Ga0496114_0009535 3300048917 Bacteria 7703
1759 Ga0496114_0057063 3300048917 Bacteria 3259
1760 Ga0496114_0123135 3300048917 Bacteria 2232
1761 Ga0496114_0186865 3300048917 Bacteria 1811
1762 Ga0496114_0197612 3300048917 Bacteria 1760
1763 Ga0496114_0238901 3300048917 Bacteria 1597
1764 Ga0496114_0270501 3300048917 Bacteria 1497
1765 Ga0496114_0279228 3300048917 Bacteria 1472
1766 Ga0496115_0008441 3300048918 Bacteria 7622
1767 Ga0496115_0011629 3300048918 Bacteria 6603
1768 Ga0496115_0014721 3300048918 Bacteria 5926
1769 Ga0496115_0037604 3300048918 Bacteria 3836
1770 Ga0496115_0047177 3300048918 Bacteria 3444
1771 Ga0496115_0047227 3300048918 Bacteria 3442
1772 Ga0496115_0055149 3300048918 Bacteria 3192
1773 Ga0496115_0075559 3300048918 Bacteria 2737
1774 Ga0496115_0082979 3300048918 Bacteria 2612
1775 Ga0496115_0278816 3300048918 Bacteria 1372
1776 Ga0496115_0342901 3300048918 Bacteria 1219
1777 Ga0496115_0377426 3300048918 Bacteria 1153
1778 Ga0496116_0000043 3300048919 Bacteria 328085
1779 Ga0496116_0010081 3300048919 Bacteria 7968
1780 Ga0496116_0020796 3300048919 Bacteria 4971
1781 Ga0496116_0068414 3300048919 Bacteria 2262
1782 Ga0496116_0086799 3300048919 Bacteria 1917
1783 Ga0496117_0000002 3300048920 Bacteria 2483758
1784 Ga0496117_0002626 3300048920 Bacteria 22299
1785 Ga0496117_0034760 3300048920 Bacteria 3793
1786 Ga0496117_0174387 3300048920 Bacteria 1244
1787 Ga0496118_0000355 3300048921 Bacteria 77500
1788 Ga0496118_0002908 3300048921 Bacteria 22263
1789 Ga0496118_0016639 3300048921 Bacteria 6738
1790 Ga0496118_0030122 3300048921 Bacteria 4537
1791 Ga0496118_0049303 3300048921 Bacteria 3244
1792 Ga0496118_0049811 3300048921 Bacteria 3221
1793 Ga0496118_0083290 3300048921 Bacteria 2237
1794 Ga0496118_0148090 3300048921 Bacteria 1474
1795 Ga0496118_0291683 3300048921 Bacteria 901
1796 Ga0496119_0001049 3300048922 Bacteria 35355
1797 Ga0496119_0019289 3300048922 Bacteria 5030
1798 Ga0496119_0022816 3300048922 Bacteria 4462
1799 Ga0496119_0023480 3300048922 Bacteria 4370
1800 Ga0496119_0023830 3300048922 Bacteria 4326
1801 Ga0496119_0060646 3300048922 Bacteria 2263
1802 Ga0496119_0075211 3300048922 Bacteria 1964
1803 Ga0496119_0152504 3300048922 Bacteria 1236
1804 Ga0496119_0154007 3300048922 Bacteria 1229
1805 Ga0496119_0161280 3300048922 Bacteria 1192
1806 Ga0496120_0001026 3300048923 Bacteria 37324
1807 Ga0496120_0041615 3300048923 Bacteria 2689
1808 Ga0496121_0000001 3300048924 Bacteria 1830318
1809 Ga0496121_0002834 3300048924 Bacteria 25612
1810 Ga0496121_0007292 3300048924 Bacteria 13377
1811 Ga0496121_0008324 3300048924 Bacteria 12253
1812 Ga0496121_0022576 3300048924 Bacteria 6098
1813 Ga0496121_0037196 3300048924 Bacteria 4326
1814 Ga0496121_0039941 3300048924 Bacteria 4126
1815 Ga0496121_0064770 3300048924 Bacteria 2978
1816 Ga0496121_0128354 3300048924 Bacteria 1903
1817 Ga0496121_0180096 3300048924 Bacteria 1526
1818 Ga0496121_0235180 3300048924 Bacteria 1280
1819 Ga0496121_0322992 3300048924 Bacteria 1038
1820 Ga0496122_0000001 3300048925 Bacteria 1827766
1821 Ga0496122_0000025 3300048925 Bacteria 362915
1822 Ga0496122_0007050 3300048925 Bacteria 12635
1823 Ga0496122_0013982 3300048925 Bacteria 7799
1824 Ga0496122_0020485 3300048925 Bacteria 5973
1825 Ga0496122_0026337 3300048925 Bacteria 5016
1826 Ga0496122_0027134 3300048925 Bacteria 4906
1827 Ga0496122_0037582 3300048925 Bacteria 3894
1828 Ga0496122_0072488 3300048925 Bacteria 2448
1829 Ga0496122_0086527 3300048925 Bacteria 2156
1830 Ga0496122_0104427 3300048925 Bacteria 1882
1831 Ga0496123_0000001 3300048926 Bacteria 1831497
1832 Ga0496123_0000032 3300048926 Bacteria 285282
1833 Ga0496123_0000043 3300048926 Bacteria 253752
1834 Ga0496123_0010783 3300048926 Bacteria 8020
1835 Ga0496123_0010935 3300048926 Bacteria 7938
1836 Ga0496123_0013675 3300048926 Bacteria 6789
1837 Ga0496123_0029237 3300048926 Bacteria 4063
1838 Ga0496123_0041064 3300048926 Bacteria 3212
1839 Ga0496123_0046657 3300048926 Bacteria 2936
1840 Ga0496123_0139205 3300048926 Bacteria 1330
1841 Ga0496124_0000112 3300048927 Bacteria 166282
1842 Ga0496124_0003528 3300048927 Bacteria 19047
1843 Ga0496124_0008106 3300048927 Bacteria 11034
1844 Ga0496124_0018233 3300048927 Bacteria 6581
1845 Ga0496124_0019709 3300048927 Bacteria 6266
1846 Ga0496124_0023074 3300048927 Bacteria 5692
1847 Ga0496124_0038848 3300048927 Bacteria 4130
1848 Ga0496124_0046692 3300048927 Bacteria 3707
1849 Ga0496124_0055085 3300048927 Bacteria 3363
1850 Ga0496124_0106758 3300048927 Bacteria 2260
1851 Ga0496124_0126394 3300048927 Bacteria 2036
1852 Ga0496124_0128101 3300048927 Bacteria 2020
1853 Ga0496124_0145251 3300048927 Bacteria 1867
1854 Ga0496124_0205767 3300048927 Bacteria 1493
1855 Ga0496125_0000001 3300048928 Bacteria 1766138
1856 Ga0496125_0000092 3300048928 Bacteria 211050
1857 Ga0496125_0001341 3300048928 Bacteria 36276
1858 Ga0496125_0001770 3300048928 Bacteria 29917
1859 Ga0496125_0010044 3300048928 Bacteria 9610
1860 Ga0496125_0029434 3300048928 Bacteria 4935
1861 Ga0496125_0054611 3300048928 Bacteria 3262
1862 Ga0496126_0000369 3300048929 Bacteria 92814
1863 Ga0496126_0005296 3300048929 Bacteria 14808
1864 Ga0496126_0025621 3300048929 Bacteria 5670
1865 Ga0496126_0027521 3300048929 Bacteria 5429
1866 Ga0495678_008204 3300049459 Bacteria 5299
1867 Ga0501317_017280 3300049533 Bacteria 944
1868 Ga0501321_009974 3300049537 Bacteria 1035
1869 Ga0501325_002693 3300049541 Bacteria 1237
1870 Ga0501031_0023684 3300049568 Bacteria 4002
1871 Ga0501031_0095847 3300049568 Bacteria 1936
1872 Ga0501031_0110215 3300049568 Bacteria 1797
1873 Ga0501032_0031972 3300049569 Bacteria 3607
1874 Ga0501032_0038066 3300049569 Bacteria 3277
1875 Ga0501032_0079969 3300049569 Bacteria 2175
1876 Ga0501032_0142313 3300049569 Bacteria 1579
1877 Ga0501032_0159647 3300049569 Bacteria 1480
1878 Ga0501032_0227329 3300049569 Bacteria 1213
1879 Ga0501033_0006664 3300049570 Bacteria 9026
1880 Ga0501033_0020232 3300049570 Bacteria 5031
1881 Ga0501033_0030642 3300049570 Bacteria 4041
1882 Ga0501033_0062652 3300049570 Bacteria 2738
1883 Ga0501033_0073315 3300049570 Bacteria 2513
1884 Ga0501033_0074314 3300049570 Bacteria 2495
1885 Ga0501033_0274779 3300049570 Bacteria 1190
1886 Ga0501033_0385188 3300049570 Bacteria 979
1887 Ga0501034_0005514 3300049571 Bacteria 13808
1888 Ga0501034_0008639 3300049571 Bacteria 10742
1889 Ga0501034_0033130 3300049571 Bacteria 5244
1890 Ga0501034_0062839 3300049571 Bacteria 3728
1891 Ga0501034_0082818 3300049571 Bacteria 3210
1892 Ga0501034_0105586 3300049571 Bacteria 2809
1893 Ga0501034_0136543 3300049571 Bacteria 2433
1894 Ga0501034_0187086 3300049571 Bacteria 2034
1895 Ga0501034_0196037 3300049571 Bacteria 1979
1896 Ga0501034_0211117 3300049571 Bacteria 1896
1897 Ga0501034_0578866 3300049571 Bacteria 1030
1898 Ga0501036_0003373 3300049572 Bacteria 12758
1899 Ga0501036_0017490 3300049572 Bacteria 5994
1900 Ga0501036_0026291 3300049572 Bacteria 4911
1901 Ga0501036_0032301 3300049572 Bacteria 4423
1902 Ga0501036_0051586 3300049572 Bacteria 3483
1903 Ga0501036_0073064 3300049572 Bacteria 2900
1904 Ga0501036_0087633 3300049572 Bacteria 2631
1905 Ga0501036_0282371 3300049572 Bacteria 1389
1906 Ga0501037_0011514 3300049573 Bacteria 6511
1907 Ga0501037_0016929 3300049573 Bacteria 5364
1908 Ga0501037_0017813 3300049573 Bacteria 5229
1909 Ga0501037_0048981 3300049573 Bacteria 3094
1910 Ga0501037_0061852 3300049573 Bacteria 2730
1911 Ga0501037_0071527 3300049573 Bacteria 2523
1912 Ga0501037_0100601 3300049573 Bacteria 2087
1913 Ga0501037_0119962 3300049573 Bacteria 1891
1914 Ga0501038_0009517 3300049574 Bacteria 8918
1915 Ga0501038_0012909 3300049574 Bacteria 7620
1916 Ga0501038_0026739 3300049574 Bacteria 5137
1917 Ga0501038_0031324 3300049574 Bacteria 4700
1918 Ga0501038_0036530 3300049574 Bacteria 4311
1919 Ga0501038_0075778 3300049574 Bacteria 2843
1920 Ga0501038_0108493 3300049574 Bacteria 2301
1921 Ga0501038_0260926 3300049574 Bacteria 1369
1922 Ga0501038_0287591 3300049574 Bacteria 1293
1923 Ga0501038_0437177 3300049574 Bacteria 1008
1924 Ga0501039_0036175 3300049575 Bacteria 3809
1925 Ga0501039_0082559 3300049575 Bacteria 2502
1926 Ga0501039_0366127 3300049575 Bacteria 1132
1927 Ga0501040_0096153 3300049576 Bacteria 2062
1928 Ga0501040_0120120 3300049576 Bacteria 1844
1929 Ga0501041_0279550 3300049577 Bacteria 1050
1930 Ga0501043_0009122 3300049579 Bacteria 7803
1931 Ga0501043_0034750 3300049579 Bacteria 3964
1932 Ga0501043_0045712 3300049579 Bacteria 3443
1933 Ga0501043_0107704 3300049579 Bacteria 2189
1934 Ga0501043_0220985 3300049579 Bacteria 1465
1935 Ga0501043_0364252 3300049579 Bacteria 1097
1936 Ga0501046_0003405 3300049580 Bacteria 14597
1937 Ga0501046_0010978 3300049580 Bacteria 7767
1938 Ga0501046_0073455 3300049580 Bacteria 2654
1939 Ga0501046_0377812 3300049580 Bacteria 1026
1940 Ga0501047_0000228 3300049581 Bacteria 66588
1941 Ga0501047_0005864 3300049581 Bacteria 11561
1942 Ga0501047_0009086 3300049581 Bacteria 9386
1943 Ga0501047_0014702 3300049581 Bacteria 7448
1944 Ga0501047_0025685 3300049581 Bacteria 5664
1945 Ga0501047_0068784 3300049581 Bacteria 3411
1946 Ga0501047_0130434 3300049581 Bacteria 2394
1947 Ga0501048_0000331 3300049582 Bacteria 32529
1948 Ga0501048_0001758 3300049582 Bacteria 16487
1949 Ga0501067_0002567 3300049583 Bacteria 10034
1950 Ga0501068_0003377 3300049584 Bacteria 8581
1951 Ga0501068_0003420 3300049584 Bacteria 8541
1952 Ga0501068_0014151 3300049584 Bacteria 4556
1953 Ga0501068_0035476 3300049584 Bacteria 2978
1954 Ga0501068_0278424 3300049584 Bacteria 1069
1955 Ga0501069_0003872 3300049585 Bacteria 7708
1956 Ga0501069_0180713 3300049585 Bacteria 1219
1957 Ga0501070_0007225 3300049586 Bacteria 9430
1958 Ga0501070_0012830 3300049586 Bacteria 7062
1959 Ga0501070_0014246 3300049586 Bacteria 6692
1960 Ga0501070_0014944 3300049586 Bacteria 6531
1961 Ga0501070_0019565 3300049586 Bacteria 5677
1962 Ga0501070_0071103 3300049586 Bacteria 2881
1963 Ga0501070_0074251 3300049586 Bacteria 2815
1964 Ga0501070_0104200 3300049586 Bacteria 2346
1965 Ga0501070_0131097 3300049586 Bacteria 2070
1966 Ga0501070_0229724 3300049586 Bacteria 1520
1967 Ga0501070_0287393 3300049586 Bacteria 1341
1968 Ga0501070_0549747 3300049586 Bacteria 924
1969 Ga0501071_0053053 3300049587 Bacteria 2924
1970 Ga0501071_0098601 3300049587 Bacteria 2153
1971 Ga0501071_0141871 3300049587 Bacteria 1789
1972 Ga0501072_0001711 3300049588 Bacteria 16332
1973 Ga0501072_0055644 3300049588 Bacteria 3118
1974 Ga0501072_0074478 3300049588 Bacteria 2685
1975 Ga0501072_0095850 3300049588 Bacteria 2358
1976 Ga0501072_0226065 3300049588 Bacteria 1491
1977 Ga0501073_0009199 3300049589 Bacteria 7287
1978 Ga0501073_0018457 3300049589 Bacteria 5042
1979 Ga0501073_0030347 3300049589 Bacteria 3860
1980 Ga0501073_0061579 3300049589 Bacteria 2618
1981 Ga0501073_0382526 3300049589 Bacteria 972
1982 Ga0501074_0102810 3300049590 Bacteria 2045
1983 Ga0501074_0154458 3300049590 Bacteria 1640
1984 Ga0501075_0171507 3300049591 Bacteria 1656
1985 Ga0501076_0046862 3300049592 Bacteria 3416
1986 Ga0501076_0095437 3300049592 Bacteria 2395
1987 Ga0501076_0342683 3300049592 Bacteria 1227
1988 Ga0501077_0003071 3300049593 Bacteria 10027
1989 Ga0501077_0023941 3300049593 Bacteria 3873
1990 Ga0501077_0033066 3300049593 Bacteria 3293
1991 Ga0501077_0235801 3300049593 Unclassified 1163
1992 Ga0501252_004934 3300049682 Bacteria 1436
1993 Ga0501079_0052582 3300049741 Bacteria 3143
1994 Ga0501079_0084729 3300049741 Bacteria 2452
1995 Ga0501079_0216653 3300049741 Bacteria 1495
1996 Ga0501079_0310709 3300049741 Bacteria 1233
1997 Ga0501079_0383821 3300049741 Bacteria 1101
1998 Ga0501079_0516014 3300049741 Bacteria 940
1999 Ga0501079_0531435 3300049741 Bacteria 925
2000 Ga0501080_0001137 3300049742 Bacteria 21908
2001 Ga0501080_0015938 3300049742 Bacteria 6932
2002 Ga0501080_0072959 3300049742 Bacteria 3193
2003 Ga0501080_0083608 3300049742 Bacteria 2965
2004 Ga0501080_0122374 3300049742 Bacteria 2410
2005 Ga0501080_0149652 3300049742 Bacteria 2158
2006 Ga0501080_0202934 3300049742 Bacteria 1820
2007 Ga0501080_0267177 3300049742 Bacteria 1557
2008 Ga0501080_0377481 3300049742 Bacteria 1278
2009 Ga0501081_0027275 3300049743 Bacteria 3853
2010 Ga0501081_0045755 3300049743 Bacteria 3005
2011 Ga0501081_0048305 3300049743 Bacteria 2929
2012 Ga0501081_0224396 3300049743 Bacteria 1367
2013 Ga0501083_0025094 3300049744 Bacteria 4128
2014 Ga0501083_0035347 3300049744 Bacteria 3414
2015 Ga0501083_0043017 3300049744 Bacteria 3061
2016 Ga0501083_0055575 3300049744 Bacteria 2653
2017 Ga0501083_0079080 3300049744 Bacteria 2181
2018 Ga0501083_0101911 3300049744 Bacteria 1892
2019 Ga0501280_001053 3300049776 Bacteria 5620
2020 Ga0501035_0022065 3300049822 Bacteria 5848
2021 Ga0501035_0034511 3300049822 Bacteria 4596
2022 Ga0501035_0063571 3300049822 Bacteria 3282
2023 Ga0501035_0089644 3300049822 Bacteria 2708
2024 Ga0501035_0121641 3300049822 Bacteria 2281
2025 Ga0501044_0002904 3300049823 Bacteria 19514
2026 Ga0501044_0006495 3300049823 Bacteria 12918
2027 Ga0501044_0010842 3300049823 Bacteria 9888
2028 Ga0501044_0094692 3300049823 Bacteria 3010
2029 Ga0501044_0152045 3300049823 Bacteria 2296
2030 Ga0501044_0174070 3300049823 Bacteria 2122
2031 Ga0501044_0179096 3300049823 Bacteria 2087
2032 Ga0501044_0180971 3300049823 Bacteria 2075
2033 Ga0501044_0352644 3300049823 Bacteria 1390
2034 Ga0501044_0450393 3300049823 Bacteria 1194
2035 Ga0501044_0556774 3300049823 Bacteria 1043
2036 Ga0501044_0590499 3300049823 Bacteria 1004
2037 Ga0501044_0606439 3300049823 Bacteria 987
2038 Ga0501045_0019735 3300049824 Bacteria 4809
2039 Ga0501045_0067502 3300049824 Bacteria 2627
2040 nmdc:mga03683_1313_c1 3300050489 Bacteria 7347
2041 nmdc:mga03683_17711_c1 3300050489 Bacteria 2700
2042 nmdc:mga00v17_22699_c1 3300050491 Bacteria 3623
2043 nmdc:mga00v17_287268_c1 3300050491 Bacteria 1068
2044 nmdc:mga00v17_6_c1 3300050491 Bacteria 179509
2045 nmdc:mga00v17_74_c2 3300050491 Bacteria 26063
2046 nmdc:mga00v17_95613_c1 3300050491 Bacteria 1870
2047 nmdc:mga0yw44_10927_c1 3300050492 Bacteria 4656
2048 nmdc:mga0yw44_15015_c1 3300050492 Bacteria 4134
2049 nmdc:mga0yw44_208030_c1 3300050492 Bacteria 1294
2050 nmdc:mga0yw44_382836_c1 3300050492 Bacteria 950
2051 nmdc:mga0yw44_86857_c1 3300050492 Bacteria 1971
2052 nmdc:mga0yw44_9825_c1 3300050492 Bacteria 4859
2053 nmdc:mga0k408_115448_c1 3300050493 Bacteria 1588
2054 nmdc:mga0k408_13060_c1 3300050493 Bacteria 4547
2055 nmdc:mga0k408_165436_c1 3300050493 Bacteria 1318
2056 nmdc:mga0k408_189006_c1 3300050493 Bacteria 1229
2057 nmdc:mga0k408_38530_c2 3300050493 Bacteria 2040
2058 nmdc:mga0k408_83973_c1 3300050493 Bacteria 1868
2059 nmdc:mga06z11_158174_c1 3300050494 Bacteria 1293
2060 nmdc:mga06z11_17428_c1 3300050494 Bacteria 3259
2061 nmdc:mga06z11_186672_c1 3300050494 Bacteria 1198
2062 nmdc:mga06z11_23090_c1 3300050494 Bacteria 2916
2063 nmdc:mga06z11_52530_c1 3300050494 Bacteria 2092
2064 nmdc:mga06z11_78913_c1 3300050494 Bacteria 1761
2065 nmdc:mga06z11_85042_c1 3300050494 Bacteria 1706
2066 nmdc:mga04h51_26632_c1 3300050495 Bacteria 1790
2067 nmdc:mga07m45_101116_c1 3300050496 Bacteria 1655
2068 nmdc:mga07m45_125816_c1 3300050496 Bacteria 1482
2069 nmdc:mga07m45_256283_c1 3300050496 Bacteria 1018
2070 nmdc:mga05p37_131667_c1 3300050507 Bacteria 3069
2071 nmdc:mga05p37_183765_c1 3300050507 Bacteria 2542
2072 nmdc:mga05p37_24117_c1 3300050507 Bacteria 7390
2073 nmdc:mga05p37_4180_c1 3300050507 Bacteria 16868
2074 nmdc:mga05p37_635_c1 3300050507 Bacteria 38849
2075 nmdc:mga05p37_9055_c1 3300050507 Bacteria 11768
2076 nmdc:mga09592_135018_c1 3300050508 Bacteria 2125
2077 nmdc:mga09592_1455_c1 3300050508 Bacteria 19027
2078 nmdc:mga09592_4975_c1 3300050508 Bacteria 10770
2079 nmdc:mga09592_542116_c1 3300050508 Bacteria 999
2080 nmdc:mga0qj67_4711_c1 3300050509 Bacteria 9909
2081 nmdc:mga0qj67_57496_c1 3300050509 Bacteria 3083
2082 nmdc:mga0qj67_5882_c1 3300050509 Bacteria 8985
2083 nmdc:mga06r32_232775_c1 3300050510 Bacteria 1830
2084 nmdc:mga06r32_234900_c1 3300050510 Bacteria 1821
2085 nmdc:mga06r32_249043_c1 3300050510 Bacteria 1764
2086 nmdc:mga06r32_27182_c1 3300050510 Bacteria 5342
2087 nmdc:mga06r32_566_c1 3300050510 Bacteria 32215
2088 nmdc:mga08y16_11723_c1 3300050511 Bacteria 9209
2089 nmdc:mga08y16_1227_c1 3300050511 Bacteria 25379
2090 nmdc:mga08y16_134_c1 3300050511 Bacteria 64270
2091 nmdc:mga08y16_17037_c1 3300050511 Bacteria 7651
2092 nmdc:mga08y16_199269_c1 3300050511 Bacteria 2075
2093 nmdc:mga08y16_445280_c1 3300050511 Bacteria 1321
2094 nmdc:mga08y16_6892_c1 3300050511 Bacteria 11914
2095 nmdc:mga0n895_109586_c1 3300050512 Bacteria 2776
2096 nmdc:mga0n895_146006_c1 3300050512 Bacteria 2395
2097 nmdc:mga0n895_171_c1 3300050512 Bacteria 40104
2098 nmdc:mga0n895_21574_c1 3300050512 Bacteria 6027
2099 nmdc:mga0n895_24501_c1 3300050512 Bacteria 5688
2100 nmdc:mga0n895_76894_c1 3300050512 Bacteria 3319
2101 nmdc:mga0n895_86278_c1 3300050512 Bacteria 3135
2102 nmdc:mga0rr50_12842_c1 3300050513 Bacteria 5429
2103 nmdc:mga0rr50_13993_c1 3300050513 Bacteria 5245
2104 nmdc:mga0rr50_193567_c1 3300050513 Bacteria 1668
2105 nmdc:mga0rr50_21706_c1 3300050513 Bacteria 4389
2106 nmdc:mga0rr50_515938_c1 3300050513 Bacteria 1017
2107 nmdc:mga08x19_140706_c1 3300050514 Bacteria 1630
2108 nmdc:mga08x19_23_c1 3300050514 Bacteria 288286
2109 nmdc:mga08x19_270120_c1 3300050514 Bacteria 1177
2110 nmdc:mga08x19_66052_c1 3300050514 Bacteria 2350
2111 nmdc:mga08x19_88581_c1 3300050514 Bacteria 2040
2112 nmdc:mga0a205_15686_c1 3300050515 Bacteria 7079
2113 nmdc:mga0a205_2563_c1 3300050515 Bacteria 16021
2114 nmdc:mga0a205_3394_c1 3300050515 Bacteria 14195
2115 nmdc:mga0sz30_1690_c1 3300050516 Bacteria 7841
2116 nmdc:mga0sz30_17676_c1 3300050516 Bacteria 2846
2117 nmdc:mga0sz30_21874_c1 3300050516 Bacteria 2592
2118 nmdc:mga0sz30_44938_c1 3300050516 Bacteria 1862
2119 Ga0495601_0000006 3300053077 Bacteria 373770
2120 Ga0495601_0000379 3300053077 Bacteria 23511
2121 Ga0495601_0001291 3300053077 Bacteria 13761
2122 Ga0495601_0005176 3300053077 Bacteria 7579
2123 Ga0495601_0006296 3300053077 Bacteria 6933
2124 Ga0495601_0022891 3300053077 Bacteria 3839
2125 Ga0495601_0075700 3300053077 Bacteria 2154
2126 Ga0495601_0110667 3300053077 Bacteria 1779
2127 Ga0495601_0127997 3300053077 Bacteria 1653
2128 Ga0495601_0167917 3300053077 Bacteria 1434
2129 Ga0495601_0181384 3300053077 Bacteria 1376
2130 Ga0495612_0000007 3300053078 Bacteria 253300
2131 Ga0495612_0000306 3300053078 Bacteria 19924
2132 Ga0495612_0001697 3300053078 Bacteria 9058
2133 Ga0495612_0005818 3300053078 Bacteria 5091
2134 Ga0495612_0007362 3300053078 Bacteria 4498
2135 Ga0495612_0042536 3300053078 Bacteria 1854
2136 Ga0495612_0161214 3300053078 Bacteria 979
2137 Ga0495612_0189253 3300053078 Bacteria 905
2138 Ga0500610_0104204 3300053079 Bacteria 1465
2139 Ga0500635_0006227 3300053080 Bacteria 3176
2140 Ga0495655_0016429 3300053083 Bacteria 1594
2141 Ga0495595_0000051 3300053084 Bacteria 60041
2142 Ga0495595_0001512 3300053084 Bacteria 9085
2143 Ga0495595_0003018 3300053084 Bacteria 6655
2144 Ga0495595_0003071 3300053084 Bacteria 6606
2145 Ga0495595_0033968 3300053084 Bacteria 2305
2146 Ga0495595_0110988 3300053084 Bacteria 1330
2147 Ga0495595_0161242 3300053084 Bacteria 1106
2148 Ga0495619_0000027 3300053085 Bacteria 165001
2149 Ga0495619_0000105 3300053085 Bacteria 62599
2150 Ga0495619_0004472 3300053085 Bacteria 8925
2151 Ga0495619_0005762 3300053085 Bacteria 7849
2152 Ga0495619_0021807 3300053085 Bacteria 4092
2153 Ga0495619_0024578 3300053085 Bacteria 3865
2154 Ga0495619_0041815 3300053085 Bacteria 2999
2155 Ga0495619_0049686 3300053085 Bacteria 2766
2156 Ga0495619_0051507 3300053085 Bacteria 2720
2157 Ga0495619_0056407 3300053085 Bacteria 2604
2158 Ga0495619_0062165 3300053085 Bacteria 2485
2159 Ga0495619_0106556 3300053085 Bacteria 1911
2160 Ga0495619_0114935 3300053085 Bacteria 1841
2161 Ga0495619_0291563 3300053085 Bacteria 1130
2162 Ga0500646_0067705 3300053090 Bacteria 1065
2163 Ga0500651_0012851 3300053093 Bacteria 5084
2164 Ga0500641_0015533 3300053096 Bacteria 2829
2165 Ga0500654_085932 3300053099 Bacteria 1434
2166 Ga0500554_012124 3300053102 Bacteria 2158
2167 Ga0500556_0007667 3300053104 Bacteria 3090
2168 Ga0500556_0048019 3300053104 Bacteria 1534
2169 Ga0500560_015739 3300053107 Bacteria 2048
2170 Ga0500562_025006 3300053108 Bacteria 1562
2171 Ga0500592_014781 3300053116 Bacteria 1251
2172 Ga0500594_0009623 3300053118 Bacteria 2230
2173 Ga0500595_016023 3300053119 Bacteria 2799
2174 Ga0500595_022555 3300053119 Bacteria 2226
2175 Ga0500607_124219 3300053121 Bacteria 1243
2176 Ga0500608_010666 3300053122 Bacteria 3953
2177 Ga0500618_000192 3300053125 Bacteria 50229
2178 Ga0500618_000361 3300053125 Bacteria 31600
2179 Ga0500618_007452 3300053125 Bacteria 3122
2180 Ga0500618_009031 3300053125 Bacteria 2743
2181 Ga0500642_0019592 3300053130 Bacteria 2642
2182 Ga0500658_0043364 3300053134 Bacteria 1812
2183 Ga0500559_0009585 3300053136 Bacteria 4182
2184 Ga0500561_0008364 3300053137 Bacteria 2058
2185 Ga0500568_0000506 3300053139 Bacteria 28722
2186 Ga0500568_0017135 3300053139 Bacteria 3204
2187 Ga0500573_0001363 3300053140 Bacteria 11624
2188 Ga0500573_0004799 3300053140 Bacteria 7157
2189 Ga0500577_0000183 3300053142 Bacteria 16294
2190 Ga0500603_000278 3300053150 Bacteria 13480
2191 Ga0500604_0006742 3300053151 Bacteria 3039
2192 Ga0500604_0023089 3300053151 Bacteria 1772
2193 Ga0500616_0000006 3300053153 Bacteria 944738
2194 Ga0500616_0001455 3300053153 Bacteria 22611
2195 Ga0500616_0001481 3300053153 Bacteria 22313
2196 Ga0500616_0023325 3300053153 Bacteria 3447
2197 Ga0500616_0143148 3300053153 Bacteria 1115
2198 Ga0500622_0001030 3300053156 Bacteria 23359
2199 Ga0500622_0037417 3300053156 Bacteria 2535
2200 Ga0500622_0067344 3300053156 Bacteria 1817
2201 Ga0500627_0024215 3300053158 Bacteria 2481
2202 Ga0500627_0126281 3300053158 Bacteria 1155
2203 Ga0500627_0127910 3300053158 Bacteria 1147
2204 Ga0500633_0006714 3300053160 Bacteria 2842
2205 Ga0500633_0085919 3300053160 Bacteria 1144
2206 Ga0500636_0000019 3300053177 Bacteria 105042
2207 Ga0500637_0067505 3300053178 Bacteria 2054
2208 Ga0500611_006236 3300053727 Bacteria 1726
2209 Ga0500645_002247 3300053730 Bacteria 8787
2210 Ga0501084_0010849 3300054114 Bacteria 7546
2211 Ga0501084_0021997 3300054114 Bacteria 5320
2212 Ga0501084_0265941 3300054114 Bacteria 1448
2213 Ga0501084_0403331 3300054114 Bacteria 1155
2214 Ga0587066_010363 3300059490 Bacteria 1342
2215 Ga0587070_016503 3300059491 Bacteria 1183
2216 Ga0587082_022111 3300059504 Bacteria 1044
2217 Ga0587088_016173 3300059508 Bacteria 1185
2218 Ga0587101_012922 3300059623 Bacteria 1093
2219 Ga0587128_015306 3300059630 Bacteria 1110
2220 Ga0587072_015368 3300059643 Bacteria 1300
2221 Ga0587111_0018765 3300060346 Bacteria 1305
2222 Ga0501082_0000008 3300060353 Bacteria 125977
2223 Ga0501082_0008268 3300060353 Bacteria 8973
2224 Ga0501082_0043601 3300060353 Bacteria 3868
2225 Ga0501082_0155204 3300060353 Bacteria 1989
2226 Ga0501082_0183376 3300060353 Bacteria 1821
2227 Ga0501082_0190013 3300060353 Bacteria 1787
2228 Ga0501082_0194035 3300060353 Bacteria 1766
2229 Ga0501082_0332185 3300060353 Bacteria 1324
2230 Ga0501082_0526761 3300060353 Bacteria 1033
2231 Ga0530510_0214609 3300061734 Bacteria 1430

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044712 Ga0453684_0134128 Ga0453684_0134128_1738_2598 246
2 3300039447 Ga0436361_1191526 Ga0436361_1191526_1064_1891 247
3 3300039450 Ga0436363_0551050 Ga0436363_0551050_21_836 247
4 3300029957 Ga0265324_10001149 Ga0265324_100011494 249
5 3300048922 Ga0496119_0154007 Ga0496119_0154007_442_1215 250
6 3300009093 Ga0105240_10000005 Ga0105240_10000005286 251
7 3300009545 Ga0105237_10001912 Ga0105237_100019125 251
8 3300010375 Ga0105239_10007427 Ga0105239_100074274 251
9 3300013104 Ga0157370_10002129 Ga0157370_100021295 251
10 3300015262 Ga0182007_10001634 Ga0182007_100016344 251
11 3300048905 Ga0496102_0062013 Ga0496102_0062013_1146_1934 251
12 3300048906 Ga0496103_0016337 Ga0496103_0016337_2002_2790 251
13 3300048916 Ga0496113_0080700 Ga0496113_0080700_236_1024 251
14 3300048919 Ga0496116_0020796 Ga0496116_0020796_1640_2428 251
15 3300048920 Ga0496117_0002626 Ga0496117_0002626_19759_20547 251
16 3300048921 Ga0496118_0002908 Ga0496118_0002908_1717_2505 251
17 3300048922 Ga0496119_0019289 Ga0496119_0019289_1699_2487 251
18 3300048923 Ga0496120_0041615 Ga0496120_0041615_1673_2461 251
19 3300048924 Ga0496121_0007292 Ga0496121_0007292_10858_11646 251
20 3300048925 Ga0496122_0013982 Ga0496122_0013982_5498_6286 251
21 3300048926 Ga0496123_0010935 Ga0496123_0010935_5481_6269 251
22 3300048927 Ga0496124_0038848 Ga0496124_0038848_1612_2400 251
23 3300003578 Ga0006562J51391_1007243 Ga0006562J51391_10072434 252
24 3300031239 Ga0265328_10117374 Ga0265328_101173741 252
25 3300037853 Ga0436364_0681691 Ga0436364_0681691_101_928 252
26 3300039450 Ga0436363_0634809 Ga0436363_0634809_35_862 252
27 3300049570 Ga0501033_0073315 Ga0501033_0073315_1312_2142 252
28 3300049571 Ga0501034_0105586 Ga0501034_0105586_372_1202 252
29 3300049579 Ga0501043_0045712 Ga0501043_0045712_890_1720 252
30 3300049581 Ga0501047_0005864 Ga0501047_0005864_10536_11366 252
31 3300049822 Ga0501035_0121641 Ga0501035_0121641_865_1695 252
32 3300048907 Ga0496104_0000069 Ga0496104_0000069_98148_98978 254
33 3300048907 Ga0496104_0009701 Ga0496104_0009701_4131_4961 254
34 3300048908 Ga0496105_0035427 Ga0496105_0035427_144_974 254
35 3300048913 Ga0496110_0068717 Ga0496110_0068717_1717_2547 254
36 3300048914 Ga0496111_0014125 Ga0496111_0014125_2604_3434 254
37 3300048916 Ga0496113_0013067 Ga0496113_0013067_3601_4431 254
38 3300025904 Ga0207647_10144788 Ga0207647_101447882 255
39 3300031235 Ga0265330_10058925 Ga0265330_100589251 255
40 3300031241 Ga0265325_10084512 Ga0265325_100845121 255
41 3300031247 Ga0265340_10002029 Ga0265340_1000202912 255
42 3300031595 Ga0265313_10000031 Ga0265313_1000003125 255
43 3300031711 Ga0265314_10239823 Ga0265314_102398231 255
44 3300031712 Ga0265342_10010066 Ga0265342_100100666 255
45 3300048907 Ga0496104_0108687 Ga0496104_0108687_494_1360 255
46 3300048917 Ga0496114_0057063 Ga0496114_0057063_1537_2403 255
47 3300048918 Ga0496115_0047227 Ga0496115_0047227_1203_2069 255
48 3300048918 Ga0496115_0055149 Ga0496115_0055149_181_1047 255
49 3300048922 Ga0496119_0001049 Ga0496119_0001049_16183_17049 255
50 3300041404 Ga0439436_0046246 Ga0439436_0046246_25_804 257
51 3300041505 Ga0451849_0489010 Ga0451849_0489010_22_801 257
52 3300042015 Ga0439462_0066949 Ga0439462_0066949_156_938 257
53 3300047443 Ga0495687_113581 Ga0495687_113581_11_790 257
54 3300048910 Ga0496107_0215224 Ga0496107_0215224_631_1404 257
55 3300048929 Ga0496126_0025621 Ga0496126_0025621_2289_3122 257
56 3300025294 Ga0209025_1000320 Ga0209025_100032099 258
57 3300031344 Ga0265316_10037266 Ga0265316_100372663 258
58 3300031852 Ga0307410_10480022 Ga0307410_104800222 258
59 3300031995 Ga0307409_100013850 Ga0307409_1000138502 258
60 3300032005 Ga0307411_10049782 Ga0307411_100497824 258
61 3300048925 Ga0496122_0007050 Ga0496122_0007050_2630_3463 258
62 3300048926 Ga0496123_0000043 Ga0496123_0000043_76994_77827 258
63 3300048927 Ga0496124_0008106 Ga0496124_0008106_9136_9990 258
64 3300048928 Ga0496125_0001770 Ga0496125_0001770_18212_19045 258
65 3300048929 Ga0496126_0005296 Ga0496126_0005296_10695_11549 258
66 3300049533 Ga0501317_017280 Ga0501317_017280_80_916 258
67 3300049537 Ga0501321_009974 Ga0501321_009974_64_900 258
68 3300049541 Ga0501325_002693 Ga0501325_002693_17_853 258
69 3300049568 Ga0501031_0023684 Ga0501031_0023684_2582_3412 258
70 3300049569 Ga0501032_0227329 Ga0501032_0227329_68_898 258
71 3300049573 Ga0501037_0061852 Ga0501037_0061852_816_1646 258
72 3300049574 Ga0501038_0036530 Ga0501038_0036530_1357_2187 258
73 3300049575 Ga0501039_0082559 Ga0501039_0082559_1434_2264 258
74 3300049586 Ga0501070_0104200 Ga0501070_0104200_869_1699 258
75 3300013100 Ga0157373_10035992 Ga0157373_100359922 259
76 3300013105 Ga0157369_10037588 Ga0157369_100375884 259
77 3300048917 Ga0496114_0123135 Ga0496114_0123135_31_819 259
78 3300042125 Ga0450923_006239 Ga0450923_006239_1165_1947 260
79 3300053104 Ga0500556_0048019 Ga0500556_0048019_20_802 260
80 3300053121 Ga0500607_124219 Ga0500607_124219_30_827 260
81 3300003792 Ga0055540_1000748 Ga0055540_100074829 261
82 3300009765 Ga0123341_1000001 Ga0123341_100000178 261
83 3300009766 Ga0123342_1014579 Ga0123342_10145795 261
84 3300025273 Ga0209673_1001837 Ga0209673_10018374 261
85 3300025298 Ga0209050_1018005 Ga0209050_10180054 261
86 3300025303 Ga0209051_1001055 Ga0209051_10010554 261
87 3300025304 Ga0209257_1002064 Ga0209257_100206425 261
88 3300031249 Ga0265339_10017015 Ga0265339_100170155 261
89 3300046690 Ga0495624_0135007 Ga0495624_0135007_536_1321 261
90 3300048922 Ga0496119_0023830 Ga0496119_0023830_1165_1989 261
91 3300037312 Ga0395899_0132245 Ga0395899_0132245_361_1179 262
92 3300037471 Ga0395905_0084201 Ga0395905_0084201_1991_2809 262
93 3300044658 Ga0466972_0167256 Ga0466972_0167256_28_846 262
94 3300044901 Ga0466960_0092051 Ga0466960_0092051_27_845 262
95 3300048919 Ga0496116_0086799 Ga0496116_0086799_1064_1888 263
96 3300048924 Ga0496121_0000001 Ga0496121_0000001_1248838_1249662 263
97 3300048925 Ga0496122_0086527 Ga0496122_0086527_46_870 263
98 3300048927 Ga0496124_0106758 Ga0496124_0106758_1033_1857 263
99 3300048928 Ga0496125_0000001 Ga0496125_0000001_1407918_1408742 263
100 3300048929 Ga0496126_0027521 Ga0496126_0027521_3651_4475 263
101 iso_pu_bacteria 2970149975 2970155244 263
102 3300017792 Ga0163161_10243817 Ga0163161_102438171 264
103 iso_pu_bacteria 2842775625 2842777693 264
104 iso_pu_bacteria 3003665799 3003670649 264
105 iso_pu_bacteria 2595698237 2596377478 265
106 iso_pu_bacteria 2773857925 2774869867 265
107 iso_pu_bacteria 2775506901 2776259081 265
108 iso_pu_bacteria 2835312727 2835315053 265
109 iso_pu_bacteria 2837678835 2837680925 265
110 iso_pu_bacteria 2838074704 2838079344 265
111 iso_pu_bacteria 2876377896 2876378520 265
112 iso_pu_bacteria 2882456835 2882461889 265
113 iso_pu_bacteria 2884298095 2884300505 265
114 iso_pu_bacteria 2889306138 2889308690 265
115 iso_pu_bacteria 2889790730 2889794659 265
116 iso_pu_bacteria 2889914905 2889917873 265
117 iso_pu_bacteria 2894232714 2894239879 265
118 iso_pu_bacteria 2902330777 2902331245 265
119 iso_pu_bacteria 2902405164 2902407308 265
120 iso_pu_bacteria 2928125067 2928127441 265
121 iso_pu_bacteria 2558860983 2561466266 266
122 iso_pu_bacteria 2643221550 2643770471 266
123 iso_pu_bacteria 2643221564 2643840577 266
124 iso_pu_bacteria 2757320392 2757569941 266
125 iso_pu_bacteria 2791355253 2793279488 266
126 iso_pu_bacteria 2894817345 2894819905 266
127 iso_pu_bacteria 8005658619 8005659327 266
128 3300013297 Ga0157378_10330184 Ga0157378_103301841 267
129 iso_pu_bacteria 2510461069 2510841049 267
130 iso_pu_bacteria 2510917026 2511170810 267
131 iso_pu_bacteria 2511231027 2511389413 267
132 iso_pu_bacteria 2545555834 2545677849 267
133 iso_pu_bacteria 2585427633 2585995615 267
134 iso_pu_bacteria 2585427634 2586000188 267
135 iso_pu_bacteria 2643221558 2643811800 267
136 iso_pu_bacteria 2643221653 2644300326 267
137 iso_pu_bacteria 2643221719 2644658550 267
138 iso_pu_bacteria 2738541281 2738747374 267
139 iso_pu_bacteria 2738541317 2738945406 267
140 iso_pu_bacteria 2738543032 2739356603 267
141 iso_pu_bacteria 2765235802 2765466050 267
142 iso_pu_bacteria 2767802442 2770197662 267
143 iso_pu_bacteria 2775506902 2776271688 267
144 iso_pu_bacteria 2775506904 2776279799 267
145 iso_pu_bacteria 2775507049 2776913245 267
146 iso_pu_bacteria 2818991272 2819242056 267
147 iso_pu_bacteria 2839993093 2839995232 267
148 iso_pu_bacteria 2840764183 2840769991 267
149 iso_pu_bacteria 2842871566 2842872775 267
150 iso_pu_bacteria 2891048133 2891051928 267
151 iso_pu_bacteria 2894652903 2894654600 267
152 iso_pu_bacteria 2904578770 2904583322 267
153 iso_pu_bacteria 2913308742 2913310112 267
154 iso_pu_bacteria 2919119836 2919121058 267
155 iso_pu_bacteria 2919171160 2919175379 267
156 iso_pu_bacteria 2928521798 2928523215 267
157 iso_pu_bacteria 2939669807 2939671454 267
158 iso_pu_bacteria 2954011201 2954015485 267
159 iso_pu_bacteria 2958172287 2958172409 267
160 iso_pu_bacteria 2989776772 2989778668 267
161 iso_pu_bacteria 2995392953 2995395014 267
162 iso_pu_bacteria 3002141150 3002144044 267
163 iso_pu_bacteria 641522639 641642625 267
164 iso_pu_bacteria 643348564 643600519 267
165 iso_pu_bacteria 8005246636 8005250759 267
166 iso_pu_bacteria 8024486573 8024492517 267
167 iso_pu_bacteria 8045864390 8045865560 267
168 3300005981 Ga0081538_10002177 Ga0081538_100021776 268
169 3300005983 Ga0081540_1006167 Ga0081540_10061676 268
170 3300006844 Ga0075428_100143208 Ga0075428_1001432084 268
171 3300044901 Ga0466960_0183827 Ga0466960_0183827_117_947 268
172 3300046530 Ga0495654_0002779 Ga0495654_0002779_8330_9142 268
173 3300046692 Ga0495671_0161207 Ga0495671_0161207_135_959 268
174 3300049571 Ga0501034_0062839 Ga0501034_0062839_1548_2429 268
175 3300053125 Ga0500618_000361 Ga0500618_000361_28678_29490 268
176 iso_pu_bacteria 2508501122 2509107842 268
177 iso_pu_bacteria 2508501127 2509144679 268
178 iso_pu_bacteria 2509276019 2509376239 268
179 iso_pu_bacteria 2509276021 2509387102 268
180 iso_pu_bacteria 2509276033 2509442593 268
181 iso_pu_bacteria 2510065019 2510132858 268
182 iso_pu_bacteria 2510065057 2510307525 268
183 iso_pu_bacteria 2510461076 2510894232 268
184 iso_pu_bacteria 2510461076 2510899257 268
185 iso_pu_bacteria 2510917028 2511182723 268
186 iso_pu_bacteria 2510917030 2511200572 268
187 iso_pu_bacteria 2511231052 2511501396 268
188 iso_pu_bacteria 2512047086 2512532810 268
189 iso_pu_bacteria 2512875026 2512971859 268
190 iso_pu_bacteria 2513237084 2513570053 268
191 iso_pu_bacteria 2513237085 2513575303 268
192 iso_pu_bacteria 2513237086 2513583151 268
193 iso_pu_bacteria 2513237087 2513593893 268
194 iso_pu_bacteria 2513237088 2513599274 268
195 iso_pu_bacteria 2513237089 2513607515 268
196 iso_pu_bacteria 2513237090 2513610077 268
197 iso_pu_bacteria 2513237091 2513617774 268
198 iso_pu_bacteria 2513237093 2513633008 268
199 iso_pu_bacteria 2513237103 2513710271 268
200 iso_pu_bacteria 2513237138 2513870578 268
201 iso_pu_bacteria 2513237140 2513886274 268
202 iso_pu_bacteria 2513237143 2513906329 268
203 iso_pu_bacteria 2513237144 2513909745 268
204 iso_pu_bacteria 2513237146 2513926515 268
205 iso_pu_bacteria 2513237156 2513988399 268
206 iso_pu_bacteria 2513237159 2514000307 268
207 iso_pu_bacteria 2513237160 2514005410 268
208 iso_pu_bacteria 2513237162 2514019855 268
209 iso_pu_bacteria 2515075009 2515111810 268
210 iso_pu_bacteria 2515154107 2515611467 268
211 iso_pu_bacteria 2515154113 2515639411 268
212 iso_pu_bacteria 2515154114 2515642142 268
213 iso_pu_bacteria 2515154116 2515656195 268
214 iso_pu_bacteria 2515154134 2515739001 268
215 iso_pu_bacteria 2516143018 2516209265 268
216 iso_pu_bacteria 2516653046 2516892675 268
217 iso_pu_bacteria 2516653077 2517035534 268
218 iso_pu_bacteria 2516653085 2517075994 268
219 iso_pu_bacteria 2517093000 2517094733 268
220 iso_pu_bacteria 2517287029 2517406358 268
221 iso_pu_bacteria 2517487022 2517569483 268
222 iso_pu_bacteria 2519899620 2520379485 268
223 iso_pu_bacteria 2524023207 2524452896 268
224 iso_pu_bacteria 2529292951 2530645117 268
225 iso_pu_bacteria 2534681786 2535484975 268
226 iso_pu_bacteria 2534681796 2535516134 268
227 iso_pu_bacteria 2537561587 2537877635 268
228 iso_pu_bacteria 2551306084 2551674144 268
229 iso_pu_bacteria 2551306084 2551676295 268
230 iso_pu_bacteria 2551306085 2551689591 268
231 iso_pu_bacteria 2551306086 2551695726 268
232 iso_pu_bacteria 2551306087 2551698579 268
233 iso_pu_bacteria 2551306089 2551710488 268
234 iso_pu_bacteria 2551306090 2551718688 268
235 iso_pu_bacteria 2551306092 2551737771 268
236 iso_pu_bacteria 2551306093 2551739998 268
237 iso_pu_bacteria 2554235003 2554247654 268
238 iso_pu_bacteria 2558860100 2558863107 268
239 iso_pu_bacteria 2558860242 2559294787 268
240 iso_pu_bacteria 2582581283 2585168323 268
241 iso_pu_bacteria 2582581294 2585199852 268
242 iso_pu_bacteria 2582581298 2585225925 268
243 iso_pu_bacteria 2582581299 2585230072 268
244 iso_pu_bacteria 2582581304 2585254336 268
245 iso_pu_bacteria 2582581306 2585268950 268
246 iso_pu_bacteria 2582581865 2585389475 268
247 iso_pu_bacteria 2582581866 2585393911 268
248 iso_pu_bacteria 2582581867 2585400689 268
249 iso_pu_bacteria 2585427526 2585528136 268
250 iso_pu_bacteria 2585427528 2585540344 268
251 iso_pu_bacteria 2585427529 2585546885 268
252 iso_pu_bacteria 2585427590 2585819751 268
253 iso_pu_bacteria 2585427593 2585838543 268
254 iso_pu_bacteria 2597489875 2597814632 268
255 iso_pu_bacteria 2599185170 2599418054 268
256 iso_pu_bacteria 2599185210 2599604051 268
257 iso_pu_bacteria 2599185236 2599721994 268
258 iso_pu_bacteria 2599185352 2600192352 268
259 iso_pu_bacteria 2600254933 2600375622 268
260 iso_pu_bacteria 2600255279 2601608216 268
261 iso_pu_bacteria 2600255308 2601744990 268
262 iso_pu_bacteria 2615840624 2616292838 268
263 iso_pu_bacteria 2643221551 2643775086 268
264 iso_pu_bacteria 2643221555 2643793531 268
265 iso_pu_bacteria 2643221557 2643808434 268
266 iso_pu_bacteria 2643221568 2643855680 268
267 iso_pu_bacteria 2643221582 2643919275 268
268 iso_pu_bacteria 2643221599 2644005908 268
269 iso_pu_bacteria 2643221607 2644049539 268
270 iso_pu_bacteria 2643221610 2644066473 268
271 iso_pu_bacteria 2643221618 2644109505 268
272 iso_pu_bacteria 2643221626 2644145189 268
273 iso_pu_bacteria 2643221634 2644193133 268
274 iso_pu_bacteria 2643221636 2644204053 268
275 iso_pu_bacteria 2643221637 2644210958 268
276 iso_pu_bacteria 2643221643 2644239225 268
277 iso_pu_bacteria 2643221655 2644307770 268
278 iso_pu_bacteria 2643221659 2644332545 268
279 iso_pu_bacteria 2643221668 2644378061 268
280 iso_pu_bacteria 2643221675 2644415314 268
281 iso_pu_bacteria 2643221680 2644450285 268
282 iso_pu_bacteria 2643221686 2644482573 268
283 iso_pu_bacteria 2643221688 2644494697 268
284 iso_pu_bacteria 2643221689 2644499075 268
285 iso_pu_bacteria 2643221693 2644522180 268
286 iso_pu_bacteria 2643221698 2644544292 268
287 iso_pu_bacteria 2643221712 2644613859 268
288 iso_pu_bacteria 2643221718 2644654613 268
289 iso_pu_bacteria 2643221723 2644677928 268
290 iso_pu_bacteria 2643221726 2644687837 268
291 iso_pu_bacteria 2643221733 2644731991 268
292 iso_pu_bacteria 2643221734 2644735259 268
293 iso_pu_bacteria 2643221736 2644745552 268
294 iso_pu_bacteria 2657244999 2657683686 268
295 iso_pu_bacteria 2690316117 2692316411 268
296 iso_pu_bacteria 2693429783 2694630544 268
297 iso_pu_bacteria 2693429784 2694638953 268
298 iso_pu_bacteria 2718217882 2719180752 268
299 iso_pu_bacteria 2718217927 2719385388 268
300 iso_pu_bacteria 2718217997 2719665217 268
301 iso_pu_bacteria 2718218009 2719731501 268
302 iso_pu_bacteria 2718218199 2720491637 268
303 iso_pu_bacteria 2718218232 2720612890 268
304 iso_pu_bacteria 2718218233 2720619751 268
305 iso_pu_bacteria 2718218235 2720631182 268
306 iso_pu_bacteria 2718218269 2720774909 268
307 iso_pu_bacteria 2718218363 2721146846 268
308 iso_pu_bacteria 2718218365 2721158373 268
309 iso_pu_bacteria 2718218366 2721163725 268
310 iso_pu_bacteria 2718218423 2721399137 268
311 iso_pu_bacteria 2721755514 2722839895 268
312 iso_pu_bacteria 2721755556 2723026546 268
313 iso_pu_bacteria 2721755684 2723560150 268
314 iso_pu_bacteria 2721755685 2723566708 268
315 iso_pu_bacteria 2721755809 2724037950 268
316 iso_pu_bacteria 2721755810 2724044257 268
317 iso_pu_bacteria 2721755819 2724089516 268
318 iso_pu_bacteria 2721755822 2724103973 268
319 iso_pu_bacteria 2721755823 2724109810 268
320 iso_pu_bacteria 2724679232 2725950417 268
321 iso_pu_bacteria 2728369352 2730107482 268
322 iso_pu_bacteria 2728369365 2730163989 268
323 iso_pu_bacteria 2728369397 2730298005 268
324 iso_pu_bacteria 2738541333 2739038269 268
325 iso_pu_bacteria 2738543024 2739309281 268
326 iso_pu_bacteria 2765235942 2766067941 268
327 iso_pu_bacteria 2791355082 2792581178 268
328 iso_pu_bacteria 2791355091 2792623185 268
329 iso_pu_bacteria 2791355092 2792626949 268
330 iso_pu_bacteria 2791355094 2792642622 268
331 iso_pu_bacteria 2791355256 2793297129 268
332 iso_pu_bacteria 2791355259 2793313891 268
333 iso_pu_bacteria 2791355260 2793321266 268
334 iso_pu_bacteria 2791355261 2793331193 268
335 iso_pu_bacteria 2791355262 2793337321 268
336 iso_pu_bacteria 2791355263 2793343078 268
337 iso_pu_bacteria 2791355264 2793347786 268
338 iso_pu_bacteria 2791355265 2793352231 268
339 iso_pu_bacteria 2791355266 2793360408 268
340 iso_pu_bacteria 2791355267 2793366388 268
341 iso_pu_bacteria 2802428858 2802718855 268
342 iso_pu_bacteria 2802428859 2802726466 268
343 iso_pu_bacteria 2802428860 2802733009 268
344 iso_pu_bacteria 2802428861 2802738364 268
345 iso_pu_bacteria 2802428862 2802744696 268
346 iso_pu_bacteria 2802428863 2802751098 268
347 iso_pu_bacteria 2802429268 2804751877 268
348 iso_pu_bacteria 2802429605 2805927560 268
349 iso_pu_bacteria 2802429606 2805936034 268
350 iso_pu_bacteria 2802429633 2806045556 268
351 iso_pu_bacteria 2802429634 2806051640 268
352 iso_pu_bacteria 2802429635 2806061684 268
353 iso_pu_bacteria 2802429636 2806067865 268
354 iso_pu_bacteria 2802429637 2806072782 268
355 iso_pu_bacteria 2808606387 2808985444 268
356 iso_pu_bacteria 2818991439 2819559879 268
357 iso_pu_bacteria 2818991461 2819687455 268
358 iso_pu_bacteria 2818991467 2819720806 268
359 iso_pu_bacteria 2821123053 2821127667 268
360 iso_pu_bacteria 2838016132 2838018745 268
361 iso_pu_bacteria 2838022645 2838025546 268
362 iso_pu_bacteria 2838035591 2838040992 268
363 iso_pu_bacteria 2838042994 2838043052 268
364 iso_pu_bacteria 2838048938 2838052183 268
365 iso_pu_bacteria 2838061910 2838067900 268
366 iso_pu_bacteria 2838068647 2838071312 268
367 iso_pu_bacteria 2838661181 2838666163 268
368 iso_pu_bacteria 2838668709 2838670001 268
369 iso_pu_bacteria 2838675328 2838676292 268
370 iso_pu_bacteria 2838680041 2838682637 268
371 iso_pu_bacteria 2838686498 2838689066 268
372 iso_pu_bacteria 2838694306 2838697216 268
373 iso_pu_bacteria 2838701080 2838702373 268
374 iso_pu_bacteria 2838707686 2838709551 268
375 iso_pu_bacteria 2838714209 2838715175 268
376 iso_pu_bacteria 2838719591 2838721025 268
377 iso_pu_bacteria 2838724970 2838725933 268
378 iso_pu_bacteria 2838729681 2838730401 268
379 iso_pu_bacteria 2838736955 2838738090 268
380 iso_pu_bacteria 2838742623 2838743342 268
381 iso_pu_bacteria 2841734538 2841740558 268
382 iso_pu_bacteria 2841760612 2841761349 268
383 iso_pu_bacteria 2841840854 2841841541 268
384 iso_pu_bacteria 2841846520 2841847984 268
385 iso_pu_bacteria 2841851746 2841854971 268
386 iso_pu_bacteria 2841859092 2841859465 268
387 iso_pu_bacteria 2841864319 2841864973 268
388 iso_pu_bacteria 2841911363 2841913305 268
389 iso_pu_bacteria 2841917233 2841919052 268
390 iso_pu_bacteria 2842077413 2842077717 268
391 iso_pu_bacteria 2842110456 2842110950 268
392 iso_pu_bacteria 2842118031 2842119774 268
393 iso_pu_bacteria 2842124991 2842125986 268
394 iso_pu_bacteria 2842130223 2842131186 268
395 iso_pu_bacteria 2842140634 2842141319 268
396 iso_pu_bacteria 2842146304 2842147082 268
397 iso_pu_bacteria 2842152218 2842153644 268
398 iso_pu_bacteria 2842156927 2842157833 268
399 iso_pu_bacteria 2842163707 2842165048 268
400 iso_pu_bacteria 2842170452 2842171418 268
401 iso_pu_bacteria 2842175837 2842177264 268
402 iso_pu_bacteria 2842180545 2842180583 268
403 iso_pu_bacteria 2842187318 2842188283 268
404 iso_pu_bacteria 2842192696 2842197079 268
405 iso_pu_bacteria 2842198810 2842201115 268
406 iso_pu_bacteria 2842205361 2842206479 268
407 iso_pu_bacteria 2842211629 2842212594 268
408 iso_pu_bacteria 2842217011 2842220559 268
409 iso_pu_bacteria 2842224351 2842225787 268
410 iso_pu_bacteria 2842229732 2842236268 268
411 iso_pu_bacteria 2842237096 2842238964 268
412 iso_pu_bacteria 2842243621 2842244520 268
413 iso_pu_bacteria 2842250916 2842252147 268
414 iso_pu_bacteria 2842257432 2842258333 268
415 iso_pu_bacteria 2842264693 2842267582 268
416 iso_pu_bacteria 2842271015 2842273086 268
417 iso_pu_bacteria 2842278818 2842279936 268
418 iso_pu_bacteria 2842285085 2842287565 268
419 iso_pu_bacteria 2842291075 2842291379 268
420 iso_pu_bacteria 2842304105 2842309433 268
421 iso_pu_bacteria 2842311132 2842315369 268
422 iso_pu_bacteria 2842317721 2842318328 268
423 iso_pu_bacteria 2842341865 2842346965 268
424 iso_pu_bacteria 2842363717 2842366798 268
425 iso_pu_bacteria 2842370503 2842373212 268
426 iso_pu_bacteria 2842377471 2842377775 268
427 iso_pu_bacteria 2842384541 2842386284 268
428 iso_pu_bacteria 2842395702 2842399549 268
429 iso_pu_bacteria 2842402390 2842404906 268
430 iso_pu_bacteria 2842409023 2842411488 268
431 iso_pu_bacteria 2842415677 2842418061 268
432 iso_pu_bacteria 2842422224 2842425031 268
433 iso_pu_bacteria 2842428310 2842431840 268
434 iso_pu_bacteria 2842434925 2842437953 268
435 iso_pu_bacteria 2842441272 2842444767 268
436 iso_pu_bacteria 2842447887 2842451683 268
437 iso_pu_bacteria 2842462802 2842465856 268
438 iso_pu_bacteria 2842469257 2842472570 268
439 iso_pu_bacteria 2842489311 2842492691 268
440 iso_pu_bacteria 2842495871 2842500698 268
441 iso_pu_bacteria 2842515876 2842516249 268
442 iso_pu_bacteria 2842521101 2842525976 268
443 iso_pu_bacteria 2844104063 2844104374 268
444 iso_pu_bacteria 2844163670 2844170381 268
445 iso_pu_bacteria 2844454524 2844459580 268
446 iso_pu_bacteria 2847417321 2847418520 268
447 iso_pu_bacteria 2847670302 2847676158 268
448 iso_pu_bacteria 2847686936 2847692798 268
449 iso_pu_bacteria 2848992105 2848993498 268
450 iso_pu_bacteria 2850079185 2850080821 268
451 iso_pu_bacteria 2851182111 2851184422 268
452 iso_pu_bacteria 2851246043 2851247362 268
453 iso_pu_bacteria 2854896431 2854902015 268
454 iso_pu_bacteria 2854911287 2854912198 268
455 iso_pu_bacteria 2854916844 2854916923 268
456 iso_pu_bacteria 2855825444 2855825486 268
457 iso_pu_bacteria 2855839649 2855840864 268
458 iso_pu_bacteria 2855872281 2855873317 268
459 iso_pu_bacteria 2856314179 2856315944 268
460 iso_pu_bacteria 2856342000 2856347680 268
461 iso_pu_bacteria 2857349434 2857350450 268
462 iso_pu_bacteria 2857516855 2857522932 268
463 iso_pu_bacteria 2857531043 2857534671 268
464 iso_pu_bacteria 2858800743 2858801407 268
465 iso_pu_bacteria 2871444079 2871446038 268
466 iso_pu_bacteria 2871474448 2871478173 268
467 iso_pu_bacteria 2871495908 2871503153 268
468 iso_pu_bacteria 2874102143 2874107397 268
469 iso_pu_bacteria 2874123672 2874127958 268
470 iso_pu_bacteria 2876369609 2876376087 268
471 iso_pu_bacteria 2876392853 2876394814 268
472 iso_pu_bacteria 2878035449 2878040212 268
473 iso_pu_bacteria 2878760144 2878767042 268
474 iso_pu_bacteria 2878767105 2878774240 268
475 iso_pu_bacteria 2878788777 2878796938 268
476 iso_pu_bacteria 2881147464 2881152159 268
477 iso_pu_bacteria 2881161766 2881168141 268
478 iso_pu_bacteria 2885312484 2885316921 268
479 iso_pu_bacteria 2888343758 2888348020 268
480 iso_pu_bacteria 2888350351 2888356380 268
481 iso_pu_bacteria 2889010040 2889011295 268
482 iso_pu_bacteria 2889016732 2889016977 268
483 iso_pu_bacteria 2891373044 2891377410 268
484 iso_pu_bacteria 2896384573 2896387011 268
485 iso_pu_bacteria 2899792073 2899796262 268
486 iso_pu_bacteria 2899845264 2899847381 268
487 iso_pu_bacteria 2903540706 2903548342 268
488 iso_pu_bacteria 2904659560 2904661445 268
489 iso_pu_bacteria 2906328253 2906328956 268
490 iso_pu_bacteria 2906354277 2906361851 268
491 iso_pu_bacteria 2906414383 2906416081 268
492 iso_pu_bacteria 2909042592 2909043785 268
493 iso_pu_bacteria 2913295892 2913300465 268
494 iso_pu_bacteria 2915980308 2915985224 268
495 iso_pu_bacteria 2915986958 2915987468 268
496 iso_pu_bacteria 2915993759 2915999377 268
497 iso_pu_bacteria 2916000859 2916003939 268
498 iso_pu_bacteria 2916007675 2916012934 268
499 iso_pu_bacteria 2916014648 2916015171 268
500 iso_pu_bacteria 2916021584 2916027883 268
501 iso_pu_bacteria 2916028427 2916033479 268
502 iso_pu_bacteria 2916035215 2916041786 268
503 iso_pu_bacteria 2916041962 2916046818 268
504 iso_pu_bacteria 2916048683 2916053965 268
505 iso_pu_bacteria 2916055098 2916060170 268
506 iso_pu_bacteria 2916061851 2916068093 268
507 iso_pu_bacteria 2916068649 2916075100 268
508 iso_pu_bacteria 2916076590 2916078654 268
509 iso_pu_bacteria 2917699015 2917699135 268
510 iso_pu_bacteria 2919100787 2919107745 268
511 iso_pu_bacteria 2919114240 2919115266 268
512 iso_pu_bacteria 2919166419 2919167556 268
513 iso_pu_bacteria 2920760137 2920765596 268
514 iso_pu_bacteria 2920822456 2920824239 268
515 iso_pu_bacteria 2921201388 2921207723 268
516 iso_pu_bacteria 2921208531 2921209188 268
517 iso_pu_bacteria 2921237296 2921243351 268
518 iso_pu_bacteria 2921244191 2921246802 268
519 iso_pu_bacteria 2921250672 2921253019 268
520 iso_pu_bacteria 2921257292 2921260491 268
521 iso_pu_bacteria 2921263974 2921269076 268
522 iso_pu_bacteria 2921282425 2921283102 268
523 iso_pu_bacteria 2921289301 2921294487 268
524 iso_pu_bacteria 2921296804 2921297220 268
525 iso_pu_bacteria 2922130491 2922137199 268
526 iso_pu_bacteria 2922158528 2922158932 268
527 iso_pu_bacteria 2922185730 2922192201 268
528 iso_pu_bacteria 2923556063 2923558191 268
529 iso_pu_bacteria 2924144063 2924146439 268
530 iso_pu_bacteria 2924150972 2924156092 268
531 iso_pu_bacteria 2924158325 2924158942 268
532 iso_pu_bacteria 2924165586 2924170268 268
533 iso_pu_bacteria 2924172951 2924178273 268
534 iso_pu_bacteria 2924179722 2924183039 268
535 iso_pu_bacteria 2924186466 2924189384 268
536 iso_pu_bacteria 2924193448 2924198626 268
537 iso_pu_bacteria 2924200457 2924202732 268
538 iso_pu_bacteria 2924207177 2924213917 268
539 iso_pu_bacteria 2924221636 2924227875 268
540 iso_pu_bacteria 2924228884 2924234720 268
541 iso_pu_bacteria 2924726620 2924731581 268
542 iso_pu_bacteria 2924754689 2924762525 268
543 iso_pu_bacteria 2926754445 2926756313 268
544 iso_pu_bacteria 2926760298 2926760535 268
545 iso_pu_bacteria 2929138655 2929139867 268
546 iso_pu_bacteria 2933006813 2933008287 268
547 iso_pu_bacteria 2933011516 2933013108 268
548 iso_pu_bacteria 2933570622 2933575793 268
549 iso_pu_bacteria 2933586486 2933586975 268
550 iso_pu_bacteria 2933594066 2933597798 268
551 iso_pu_bacteria 2933599457 2933602111 268
552 iso_pu_bacteria 2935894831 2935898927 268
553 iso_pu_bacteria 2935901341 2935904883 268
554 iso_pu_bacteria 2936367885 2936373183 268
555 iso_pu_bacteria 2936375103 2936381328 268
556 iso_pu_bacteria 2936381700 2936384597 268
557 iso_pu_bacteria 2936996657 2936997751 268
558 iso_pu_bacteria 2937002841 2937004685 268
559 iso_pu_bacteria 2937009748 2937012538 268
560 iso_pu_bacteria 2937016420 2937016990 268
561 iso_pu_bacteria 2937023124 2937029232 268
562 iso_pu_bacteria 2937029754 2937031199 268
563 iso_pu_bacteria 2937036028 2937040855 268
564 iso_pu_bacteria 2937042894 2937049592 268
565 iso_pu_bacteria 2937049772 2937052214 268
566 iso_pu_bacteria 2937056579 2937059620 268
567 iso_pu_bacteria 2937063883 2937065009 268
568 iso_pu_bacteria 2937071275 2937075678 268
569 iso_pu_bacteria 2937078374 2937079993 268
570 iso_pu_bacteria 2937084907 2937085521 268
571 iso_pu_bacteria 2937091812 2937097618 268
572 iso_pu_bacteria 2937098957 2937106014 268
573 iso_pu_bacteria 2937106411 2937112901 268
574 iso_pu_bacteria 2937113482 2937117835 268
575 iso_pu_bacteria 2937119839 2937123141 268
576 iso_pu_bacteria 2937126314 2937127994 268
577 iso_pu_bacteria 2937836603 2937839889 268
578 iso_pu_bacteria 2937891427 2937896838 268
579 iso_pu_bacteria 2937994558 2938002166 268
580 iso_pu_bacteria 2938014810 2938018979 268
581 iso_pu_bacteria 2941499720 2941499804 268
582 iso_pu_bacteria 2957375807 2957378591 268
583 iso_pu_bacteria 2957382221 2957384497 268
584 iso_pu_bacteria 2957388812 2957389720 268
585 iso_pu_bacteria 2957395598 2957399310 268
586 iso_pu_bacteria 2957402308 2957405917 268
587 iso_pu_bacteria 2957408893 2957411224 268
588 iso_pu_bacteria 2957415311 2957417639 268
589 iso_pu_bacteria 2957422303 2957428300 268
590 iso_pu_bacteria 2957430029 2957433522 268
591 iso_pu_bacteria 2957437181 2957437674 268
592 iso_pu_bacteria 2957443900 2957448678 268
593 iso_pu_bacteria 2957450854 2957456339 268
594 iso_pu_bacteria 2957457609 2957462486 268
595 iso_pu_bacteria 2957464669 2957467930 268
596 iso_pu_bacteria 2957471148 2957476174 268
597 iso_pu_bacteria 2957478035 2957482976 268
598 iso_pu_bacteria 2957484790 2957485054 268
599 iso_pu_bacteria 2957491536 2957495648 268
600 iso_pu_bacteria 2957498199 2957504473 268
601 iso_pu_bacteria 2957505466 2957511798 268
602 iso_pu_bacteria 2958071322 2958075161 268
603 iso_pu_bacteria 2958100919 2958107592 268
604 iso_pu_bacteria 2958115193 2958122107 268
605 iso_pu_bacteria 2958165035 2958172220 268
606 iso_pu_bacteria 2960584000 2960586414 268
607 iso_pu_bacteria 2960591022 2960596159 268
608 iso_pu_bacteria 2960597568 2960603257 268
609 iso_pu_bacteria 2960603979 2960607220 268
610 iso_pu_bacteria 2960610863 2960616297 268
611 iso_pu_bacteria 2960617483 2960623135 268
612 iso_pu_bacteria 2960624210 2960625155 268
613 iso_pu_bacteria 2960631154 2960637261 268
614 iso_pu_bacteria 2960637947 2960643641 268
615 iso_pu_bacteria 2960645483 2960650788 268
616 iso_pu_bacteria 2960652885 2960658694 268
617 iso_pu_bacteria 2960660292 2960666688 268
618 iso_pu_bacteria 2960667422 2960671991 268
619 iso_pu_bacteria 2960674078 2960678552 268
620 iso_pu_bacteria 2960680706 2960686855 268
621 iso_pu_bacteria 2960687367 2960692257 268
622 iso_pu_bacteria 2960693952 2960695967 268
623 iso_pu_bacteria 2961114664 2961116597 268
624 iso_pu_bacteria 2961163497 2961170668 268
625 iso_pu_bacteria 2964607997 2964611163 268
626 iso_pu_bacteria 2964615318 2964617485 268
627 iso_pu_bacteria 2964621998 2964628262 268
628 iso_pu_bacteria 2964628898 2964633897 268
629 iso_pu_bacteria 2964636051 2964640611 268
630 iso_pu_bacteria 2964643177 2964646003 268
631 iso_pu_bacteria 2964649959 2964655774 268
632 iso_pu_bacteria 2964656573 2964657538 268
633 iso_pu_bacteria 2964663802 2964664982 268
634 iso_pu_bacteria 2964670856 2964675818 268
635 iso_pu_bacteria 2964678106 2964682178 268
636 iso_pu_bacteria 2964685014 2964691268 268
637 iso_pu_bacteria 2964691889 2964693728 268
638 iso_pu_bacteria 2964698721 2964702056 268
639 iso_pu_bacteria 2964705432 2964709211 268
640 iso_pu_bacteria 2964712639 2964716838 268
641 iso_pu_bacteria 2964719344 2964724503 268
642 iso_pu_bacteria 2965018300 2965025415 268
643 iso_pu_bacteria 2965062239 2965069347 268
644 iso_pu_bacteria 2965119406 2965121166 268
645 iso_pu_bacteria 2967664464 2967668099 268
646 iso_pu_bacteria 2967671571 2967674583 268
647 iso_pu_bacteria 2967678726 2967683786 268
648 iso_pu_bacteria 2967686174 2967687345 268
649 iso_pu_bacteria 2967693043 2967693623 268
650 iso_pu_bacteria 2967699805 2967700857 268
651 iso_pu_bacteria 2967706974 2967711997 268
652 iso_pu_bacteria 2967714385 2967720335 268
653 iso_pu_bacteria 2967721400 2967728192 268
654 iso_pu_bacteria 2967728569 2967734296 268
655 iso_pu_bacteria 2967735183 2967741212 268
656 iso_pu_bacteria 2967742019 2967746288 268
657 iso_pu_bacteria 2967748971 2967750075 268
658 iso_pu_bacteria 2967755722 2967758028 268
659 iso_pu_bacteria 2967762386 2967763487 268
660 iso_pu_bacteria 2967769361 2967771591 268
661 iso_pu_bacteria 2967775926 2967777555 268
662 iso_pu_bacteria 2968091066 2968095916 268
663 iso_pu_bacteria 2968097103 2968100392 268
664 iso_pu_bacteria 2968110612 2968112504 268
665 iso_pu_bacteria 2968117919 2968121279 268
666 iso_pu_bacteria 2968128360 2968132255 268
667 iso_pu_bacteria 2968171901 2968179054 268
668 iso_pu_bacteria 2970019648 2970020079 268
669 iso_pu_bacteria 2970026789 2970030960 268
670 iso_pu_bacteria 2970033650 2970038202 268
671 iso_pu_bacteria 2970040964 2970047184 268
672 iso_pu_bacteria 2970047711 2970053906 268
673 iso_pu_bacteria 2970054988 2970061412 268
674 iso_pu_bacteria 2970061556 2970067556 268
675 iso_pu_bacteria 2970068827 2970072282 268
676 iso_pu_bacteria 2970076120 2970077440 268
677 iso_pu_bacteria 2970082768 2970084789 268
678 iso_pu_bacteria 2970088815 2970095277 268
679 iso_pu_bacteria 2970095765 2970099421 268
680 iso_pu_bacteria 2970102677 2970103684 268
681 iso_pu_bacteria 2970109326 2970114373 268
682 iso_pu_bacteria 2970116247 2970122601 268
683 iso_pu_bacteria 2970122695 2970124710 268
684 iso_pu_bacteria 2970129317 2970130322 268
685 iso_pu_bacteria 2970136068 2970141075 268
686 iso_pu_bacteria 2970143518 2970145523 268
687 iso_pu_bacteria 2970156795 2970162768 268
688 iso_pu_bacteria 2970164137 2970170556 268
689 iso_pu_bacteria 2970170962 2970177117 268
690 iso_pu_bacteria 2970177841 2970181187 268
691 iso_pu_bacteria 2970184632 2970190391 268
692 iso_pu_bacteria 2970191845 2970196943 268
693 iso_pu_bacteria 2970524798 2970531921 268
694 iso_pu_bacteria 2970540015 2970546409 268
695 iso_pu_bacteria 2970554993 2970561898 268
696 iso_pu_bacteria 2977516862 2977518003 268
697 iso_pu_bacteria 2977523885 2977528744 268
698 iso_pu_bacteria 2977530762 2977533856 268
699 iso_pu_bacteria 2977537788 2977540259 268
700 iso_pu_bacteria 2977544691 2977547616 268
701 iso_pu_bacteria 2977551784 2977554861 268
702 iso_pu_bacteria 2977558990 2977564580 268
703 iso_pu_bacteria 2977565890 2977568345 268
704 iso_pu_bacteria 2977572785 2977575531 268
705 iso_pu_bacteria 2977579622 2977585236 268
706 iso_pu_bacteria 2977858184 2977861343 268
707 iso_pu_bacteria 2977942078 2977948161 268
708 iso_pu_bacteria 2977971508 2977979912 268
709 iso_pu_bacteria 2978969890 2978974003 268
710 iso_pu_bacteria 2979089926 2979094185 268
711 iso_pu_bacteria 2979095461 2979098434 268
712 iso_pu_bacteria 2979100975 2979106188 268
713 iso_pu_bacteria 2979710463 2979716863 268
714 iso_pu_bacteria 2979779861 2979779917 268
715 iso_pu_bacteria 2984509177 2984512016 268
716 iso_pu_bacteria 2984518228 2984521623 268
717 iso_pu_bacteria 2984537506 2984540917 268
718 iso_pu_bacteria 2984587000 2984589332 268
719 iso_pu_bacteria 2984601300 2984603179 268
720 iso_pu_bacteria 2987636660 2987637636 268
721 iso_pu_bacteria 2987652177 2987655508 268
722 iso_pu_bacteria 2987659509 2987666907 268
723 iso_pu_bacteria 2989349275 2989353012 268
724 iso_pu_bacteria 2989771324 2989773811 268
725 iso_pu_bacteria 2996341866 2996343919 268
726 iso_pu_bacteria 2996887358 2996892389 268
727 iso_pu_bacteria 2996893221 2996893806 268
728 iso_pu_bacteria 3003930520 3003933527 268
729 iso_pu_bacteria 3004188549 3004195911 268
730 iso_pu_bacteria 3004203850 3004206042 268
731 iso_pu_bacteria 3005409236 3005409694 268
732 iso_pu_bacteria 3005445848 3005447201 268
733 iso_pu_bacteria 3005452660 3005453910 268
734 iso_pu_bacteria 639633055 639648093 268
735 iso_pu_bacteria 643692032 643825526 268
736 iso_pu_bacteria 648276728 648740160 268
737 iso_pu_bacteria 650716007 650740039 268
738 iso_pu_bacteria 8003570095 8003571038 268
739 iso_pu_bacteria 8003992118 8003993361 268
740 iso_pu_bacteria 8003999396 8004000612 268
741 iso_pu_bacteria 8004395343 8004403888 268
742 iso_pu_bacteria 8004445564 8004450169 268
743 iso_pu_bacteria 8004633249 8004639839 268
744 iso_pu_bacteria 8004703790 8004713541 268
745 iso_pu_bacteria 8005258706 8005259671 268
746 iso_pu_bacteria 8005275841 8005280156 268
747 iso_pu_bacteria 8005282627 8005288228 268
748 iso_pu_bacteria 8005289223 8005294741 268
749 iso_pu_bacteria 8005301065 8005307083 268
750 iso_pu_bacteria 8005307578 8005314601 268
751 iso_pu_bacteria 8005321885 8005326916 268
752 iso_pu_bacteria 8005376324 8005378736 268
753 iso_pu_bacteria 8005382845 8005384994 268
754 iso_pu_bacteria 8005395548 8005397081 268
755 iso_pu_bacteria 8005430974 8005436156 268
756 iso_pu_bacteria 8005460587 8005462468 268
757 iso_pu_bacteria 8005497431 8005499849 268
758 iso_pu_bacteria 8005542996 8005544829 268
759 iso_pu_bacteria 8005556819 8005558159 268
760 iso_pu_bacteria 8005563573 8005569337 268
761 iso_pu_bacteria 8005570704 8005575389 268
762 iso_pu_bacteria 8005619151 8005621218 268
763 iso_pu_bacteria 8005626139 8005631482 268
764 iso_pu_bacteria 8005668836 8005671267 268
765 iso_pu_bacteria 8005688590 8005694997 268
766 iso_pu_bacteria 8005695170 8005696222 268
767 iso_pu_bacteria 8018127388 8018129515 268
768 iso_pu_bacteria 8018150411 8018155657 268
769 iso_pu_bacteria 8018163183 8018168052 268
770 iso_pu_bacteria 8018176218 8018180295 268
771 iso_pu_bacteria 8023680758 8023680930 268
772 iso_pu_bacteria 8024479707 8024485701 268
773 iso_pu_bacteria 8024501048 8024505155 268
774 iso_pu_bacteria 8049293176 8049294411 268
775 iso_pu_bacteria 8054460903 8054462770 268
776 iso_pu_bacteria 8054558443 8054562842 268
777 iso_pu_bacteria 8055431914 8055434382 268
778 iso_pu_bacteria 8055617313 8055622136 268
779 iso_pu_bacteria 8056375014 8056380099 268
780 iso_pu_bacteria 8056382006 8056387612 268
781 iso_pu_bacteria 8056875544 8056877448 268
782 iso_pu_bacteria 8057529695 8057530468 268
783 iso_pu_bacteria 8057874678 8057875540 268
784 3300005937 Ga0081455_10109150 Ga0081455_101091502 269
785 3300006048 Ga0075363_100186794 Ga0075363_1001867942 269
786 3300006178 Ga0075367_10321941 Ga0075367_103219411 269
787 3300014326 Ga0157380_10010005 Ga0157380_100100058 269
788 3300015684 Ga0183365_10962 Ga0183365_109621 269
789 3300025961 Ga0207712_10346845 Ga0207712_103468451 269
790 3300025972 Ga0207668_10254092 Ga0207668_102540922 269
791 3300031595 Ga0265313_10000632 Ga0265313_1000063239 269
792 3300037471 Ga0395905_0000658 Ga0395905_0000658_33337_34158 269
793 3300044712 Ga0453684_0026923 Ga0453684_0026923_7132_8001 269
794 3300044901 Ga0466960_0054234 Ga0466960_0054234_955_1791 269
795 3300044901 Ga0466960_0284038 Ga0466960_0284038_29_880 269
796 3300045976 Ga0466967_0368081 Ga0466967_0368081_353_1204 269
797 3300049570 Ga0501033_0006664 Ga0501033_0006664_1122_1973 269
798 3300049682 Ga0501252_004934 Ga0501252_004934_65_901 269
799 3300049822 Ga0501035_0022065 Ga0501035_0022065_3864_4715 269
800 3300050493 nmdc:mga0k408_189006_c1 nmdc:mga0k408_189006_c1_324_1133 269
801 3300050493 nmdc:mga0k408_83973_c1 nmdc:mga0k408_83973_c1_477_1286 269
802 3300050494 nmdc:mga06z11_186672_c1 nmdc:mga06z11_186672_c1_22_831 269
803 3300050494 nmdc:mga06z11_52530_c1 nmdc:mga06z11_52530_c1_755_1564 269
804 3300053096 Ga0500641_0015533 Ga0500641_0015533_287_1096 269
805 3300053134 Ga0500658_0043364 Ga0500658_0043364_957_1766 269
806 iso_pu_bacteria 2510917022 2511133670 269
807 iso_pu_bacteria 2524023209 2524462639 269
808 iso_pu_bacteria 2582581307 2585270560 269
809 iso_pu_bacteria 2582581308 2585276900 269
810 iso_pu_bacteria 2582581315 2585324096 269
811 iso_pu_bacteria 2582581316 2585333508 269
812 iso_pu_bacteria 2585427527 2585534794 269
813 iso_pu_bacteria 2585427530 2585551760 269
814 iso_pu_bacteria 2585427531 2585558264 269
815 iso_pu_bacteria 2585427594 2585845752 269
816 iso_pu_bacteria 2585427608 2585897657 269
817 iso_pu_bacteria 2585427609 2585904747 269
818 iso_pu_bacteria 2585428125 2587980137 269
819 iso_pu_bacteria 2599185156 2599331528 269
820 iso_pu_bacteria 2615840626 2616308273 269
821 iso_pu_bacteria 2615840698 2616556666 269
822 iso_pu_bacteria 2617270742 2617381627 269
823 iso_pu_bacteria 2667528174 2671115675 269
824 iso_pu_bacteria 2738541293 2738799287 269
825 iso_pu_bacteria 2758568016 2758641865 269
826 iso_pu_bacteria 2775507266 2778176414 269
827 iso_pu_bacteria 2818991448 2819610468 269
828 iso_pu_bacteria 2818991453 2819638212 269
829 iso_pu_bacteria 2838029111 2838032190 269
830 iso_pu_bacteria 2842298080 2842301902 269
831 iso_pu_bacteria 2842357229 2842362300 269
832 iso_pu_bacteria 2842475841 2842479181 269
833 iso_pu_bacteria 2842482326 2842487196 269
834 iso_pu_bacteria 2842502639 2842506099 269
835 iso_pu_bacteria 2842509118 2842510145 269
836 iso_pu_bacteria 2842922631 2842923926 269
837 iso_pu_bacteria 2852387548 2852389553 269
838 iso_pu_bacteria 2899803654 2899807532 269
839 iso_pu_bacteria 2919408235 2919409727 269
840 iso_pu_bacteria 3005416602 3005420411 269
841 iso_pu_bacteria 8005314921 8005317362 269
842 iso_pu_bacteria 8005484373 8005486572 269
843 iso_pu_bacteria 8005645114 8005646280 269
844 iso_pu_bacteria 8005682033 8005686419 269
845 iso_pu_bacteria 8046767195 8046770281 269
846 iso_pu_bacteria 8057575449 8057578209 269
847 3300003578 Ga0006562J51391_1023271 Ga0006562J51391_10232711 270
848 3300003781 Ga0055536_1005413 Ga0055536_10054135 270
849 3300003792 Ga0055540_1004719 Ga0055540_10047194 270
850 3300003794 Ga0055531_10007165 Ga0055531_100071656 270
851 3300005435 Ga0070714_100101214 Ga0070714_1001012143 270
852 3300005436 Ga0070713_100103742 Ga0070713_1001037424 270
853 3300006028 Ga0070717_10230786 Ga0070717_102307862 270
854 3300006028 Ga0070717_10365219 Ga0070717_103652192 270
855 3300006051 Ga0075364_10015127 Ga0075364_100151274 270
856 3300006353 Ga0075370_10290360 Ga0075370_102903601 270
857 3300006914 Ga0075436_100125191 Ga0075436_1001251913 270
858 3300024227 Ga0228598_1037468 Ga0228598_10374681 270
859 3300025230 Ga0209563_107580 Ga0209563_1075801 270
860 3300025292 Ga0209676_1002428 Ga0209676_100242813 270
861 3300025297 Ga0209758_1000155 Ga0209758_1000155133 270
862 3300025298 Ga0209050_1007606 Ga0209050_10076064 270
863 3300025303 Ga0209051_1002245 Ga0209051_100224510 270
864 3300025304 Ga0209257_1003261 Ga0209257_100326110 270
865 3300025915 Ga0207693_10083006 Ga0207693_100830062 270
866 3300025928 Ga0207700_10026723 Ga0207700_100267233 270
867 3300025928 Ga0207700_10109700 Ga0207700_101097003 270
868 3300025929 Ga0207664_10206437 Ga0207664_102064372 270
869 3300028023 Ga0265357_1001835 Ga0265357_10018352 270
870 3300028800 Ga0265338_10122398 Ga0265338_101223983 270
871 3300029957 Ga0265324_10035124 Ga0265324_100351242 270
872 3300030760 Ga0265762_1017489 Ga0265762_10174891 270
873 3300030763 Ga0265763_1001123 Ga0265763_10011231 270
874 3300031090 Ga0265760_10044076 Ga0265760_100440763 270
875 3300031249 Ga0265339_10000075 Ga0265339_1000007558 270
876 3300031456 Ga0307513_10166031 Ga0307513_101660313 270
877 3300031595 Ga0265313_10000540 Ga0265313_100005407 270
878 3300031728 Ga0316578_10137444 Ga0316578_101374442 270
879 3300032137 Ga0316585_10040220 Ga0316585_100402202 270
880 3300035398 Ga0316574_0000583 Ga0316574_0000583_9386_10207 270
881 3300035695 Ga0373927_0002703 Ga0373927_0002703_11024_11848 270
882 3300036401 Ga0373937_0555311 Ga0373937_0555311_72_890 270
883 3300036647 Ga0316582_0034396 Ga0316582_0034396_1831_2652 270
884 3300036712 Ga0316584_0021319 Ga0316584_0021319_2922_3743 270
885 3300037068 Ga0373925_0001344 Ga0373925_0001344_11041_11865 270
886 3300037471 Ga0395905_0005373 Ga0395905_0005373_7812_8636 270
887 3300037471 Ga0395905_0015770 Ga0395905_0015770_4084_4908 270
888 3300041406 Ga0439439_0032432 Ga0439439_0032432_157_987 270
889 3300042007 Ga0439449_0022500 Ga0439449_0022500_946_1776 270
890 3300044694 Ga0466963_0153839 Ga0466963_0153839_315_1130 270
891 3300044842 Ga0466957_0024191 Ga0466957_0024191_1740_2555 270
892 3300046454 Ga0495592_0082329 Ga0495592_0082329_265_1098 270
893 3300046459 Ga0495629_0038204 Ga0495629_0038204_100_933 270
894 3300046462 Ga0495651_0113334 Ga0495651_0113334_1032_1865 270
895 3300046476 Ga0495662_0136709 Ga0495662_0136709_93_926 270
896 3300046524 Ga0495648_0070121 Ga0495648_0070121_46_879 270
897 3300046642 Ga0495634_0049953 Ga0495634_0049953_1452_2285 270
898 3300046683 Ga0495658_0051619 Ga0495658_0051619_1357_2190 270
899 3300048922 Ga0496119_0161280 Ga0496119_0161280_230_1171 270
900 3300048924 Ga0496121_0008324 Ga0496121_0008324_10165_10989 270
901 3300048924 Ga0496121_0322992 Ga0496121_0322992_103_999 270
902 3300048927 Ga0496124_0205767 Ga0496124_0205767_441_1301 270
903 3300049592 Ga0501076_0342683 Ga0501076_0342683_110_940 270
904 3300049776 Ga0501280_001053 Ga0501280_001053_2226_3050 270
905 3300050491 nmdc:mga00v17_74_c2 nmdc:mga00v17_74_c2_22942_23766 270
906 3300050514 nmdc:mga08x19_66052_c1 nmdc:mga08x19_66052_c1_1168_1983 270
907 3300053077 Ga0495601_0127997 Ga0495601_0127997_338_1156 270
908 3300053085 Ga0495619_0024578 Ga0495619_0024578_1907_2740 270
909 3300053104 Ga0500556_0007667 Ga0500556_0007667_433_1257 270
910 3300053122 Ga0500608_010666 Ga0500608_010666_365_1192 270
911 3300053136 Ga0500559_0009585 Ga0500559_0009585_2272_3096 270
912 3300053153 Ga0500616_0001455 Ga0500616_0001455_2699_3541 270
913 3300053153 Ga0500616_0143148 Ga0500616_0143148_46_870 270
914 3300053158 Ga0500627_0127910 Ga0500627_0127910_186_1028 270
915 3300061734 Ga0530510_0214609 Ga0530510_0214609_224_1054 270
916 3300002739 JGI25158J39367_1000203 JGI25158J39367_10002035 271
917 3300002773 JGI25152J39213_1001188 JGI25152J39213_10011886 271
918 3300002773 JGI25152J39213_1005646 JGI25152J39213_10056463 271
919 3300002773 JGI25152J39213_1006889 JGI25152J39213_10068893 271
920 3300002774 JGI25150J39212_1012292 JGI25150J39212_10122921 271
921 3300002987 JGI25159J45721_1000006 JGI25159J45721_1000006113 271
922 3300002987 JGI25159J45721_1000969 JGI25159J45721_10009695 271
923 3300003187 JGI25151J46595_10000653 JGI25151J46595_1000065317 271
924 3300003187 JGI25151J46595_10013982 JGI25151J46595_100139822 271
925 3300003187 JGI25151J46595_10023001 JGI25151J46595_100230012 271
926 3300003187 JGI25151J46595_10025442 JGI25151J46595_100254424 271
927 3300003203 JGI25406J46586_10008097 JGI25406J46586_100080975 271
928 3300003215 JGI25153J46596_10013236 JGI25153J46596_100132362 271
929 3300003215 JGI25153J46596_10013822 JGI25153J46596_100138224 271
930 3300003215 JGI25153J46596_10016477 JGI25153J46596_100164772 271
931 3300003354 JGI25160J50197_1000019 JGI25160J50197_1000019118 271
932 3300003354 JGI25160J50197_1004333 JGI25160J50197_10043335 271
933 3300003354 JGI25160J50197_1010089 JGI25160J50197_10100891 271
934 3300003354 JGI25160J50197_1010772 JGI25160J50197_10107723 271
935 3300003374 JGI25161J50226_1000053 JGI25161J50226_100005379 271
936 3300003374 JGI25161J50226_1001944 JGI25161J50226_10019447 271
937 3300003771 Ga0055526_1004368 Ga0055526_10043687 271
938 3300003771 Ga0055526_1004739 Ga0055526_10047398 271
939 3300003771 Ga0055526_1008416 Ga0055526_10084164 271
940 3300003771 Ga0055526_1009627 Ga0055526_10096274 271
941 3300003771 Ga0055526_1010985 Ga0055526_10109854 271
942 3300003771 Ga0055526_1025466 Ga0055526_10254662 271
943 3300003775 Ga0055524_1002113 Ga0055524_100211311 271
944 3300003775 Ga0055524_1002391 Ga0055524_10023915 271
945 3300003775 Ga0055524_1003568 Ga0055524_10035683 271
946 3300003775 Ga0055524_1007500 Ga0055524_10075004 271
947 3300003775 Ga0055524_1009140 Ga0055524_10091402 271
948 3300003775 Ga0055524_1011053 Ga0055524_10110534 271
949 3300003775 Ga0055524_1013589 Ga0055524_10135892 271
950 3300003790 Ga0055528_1001604 Ga0055528_100160412 271
951 3300003790 Ga0055528_1002265 Ga0055528_10022654 271
952 3300003790 Ga0055528_1007370 Ga0055528_10073704 271
953 3300003790 Ga0055528_1009553 Ga0055528_10095531 271
954 3300003790 Ga0055528_1011715 Ga0055528_10117152 271
955 3300003790 Ga0055528_1014009 Ga0055528_10140093 271
956 3300003791 Ga0055530_10018616 Ga0055530_100186161 271
957 3300003792 Ga0055540_1018177 Ga0055540_10181773 271
958 3300003794 Ga0055531_10025155 Ga0055531_100251552 271
959 3300003856 Ga0058692_1012800 Ga0058692_10128001 271
960 3300004625 Ga0055543_1000019 Ga0055543_100001979 271
961 3300004625 Ga0055543_1000147 Ga0055543_100014714 271
962 3300004625 Ga0055543_1000976 Ga0055543_100097611 271
963 3300004798 Ga0058859_10007620 Ga0058859_100076201 271
964 3300005262 Ga0065165_1000180 Ga0065165_1000180119 271
965 3300005262 Ga0065165_1005412 Ga0065165_10054125 271
966 3300005262 Ga0065165_1008068 Ga0065165_10080686 271
967 3300005262 Ga0065165_1025717 Ga0065165_10257172 271
968 3300005262 Ga0065165_1044964 Ga0065165_10449641 271
969 3300005328 Ga0070676_10193627 Ga0070676_101936272 271
970 3300005330 Ga0070690_100306060 Ga0070690_1003060602 271
971 3300005333 Ga0070677_10158540 Ga0070677_101585401 271
972 3300005334 Ga0068869_100097519 Ga0068869_1000975192 271
973 3300005336 Ga0070680_100038173 Ga0070680_1000381732 271
974 3300005339 Ga0070660_100097940 Ga0070660_1000979402 271
975 3300005340 Ga0070689_100132572 Ga0070689_1001325722 271
976 3300005343 Ga0070687_100165984 Ga0070687_1001659841 271
977 3300005355 Ga0070671_100026345 Ga0070671_1000263456 271
978 3300005355 Ga0070671_100354249 Ga0070671_1003542492 271
979 3300005356 Ga0070674_100014979 Ga0070674_1000149798 271
980 3300005364 Ga0070673_100124667 Ga0070673_1001246673 271
981 3300005364 Ga0070673_100505375 Ga0070673_1005053751 271
982 3300005440 Ga0070705_100021343 Ga0070705_1000213433 271
983 3300005458 Ga0070681_10025108 Ga0070681_100251087 271
984 3300005458 Ga0070681_10193409 Ga0070681_101934091 271
985 3300005466 Ga0070685_10103765 Ga0070685_101037654 271
986 3300005530 Ga0070679_100007152 Ga0070679_10000715213 271
987 3300005536 Ga0070697_100007057 Ga0070697_1000070576 271
988 3300005539 Ga0068853_100044363 Ga0068853_1000443633 271
989 3300005543 Ga0070672_100301741 Ga0070672_1003017412 271
990 3300005545 Ga0070695_100005884 Ga0070695_10000588411 271
991 3300005547 Ga0070693_100014012 Ga0070693_1000140124 271
992 3300005548 Ga0070665_100029923 Ga0070665_1000299236 271
993 3300005841 Ga0068863_100051908 Ga0068863_1000519085 271
994 3300005843 Ga0068860_100542298 Ga0068860_1005422982 271
995 3300005985 Ga0081539_10000688 Ga0081539_1000068851 271
996 3300006038 Ga0075365_10001260 Ga0075365_1000126010 271
997 3300006038 Ga0075365_10102973 Ga0075365_101029732 271
998 3300006042 Ga0075368_10001271 Ga0075368_100012713 271
999 3300006042 Ga0075368_10022709 Ga0075368_100227092 271
1000 3300006048 Ga0075363_100152348 Ga0075363_1001523481 271
1001 3300006177 Ga0075362_10000880 Ga0075362_100008809 271
1002 3300006177 Ga0075362_10109090 Ga0075362_101090901 271
1003 3300006177 Ga0075362_10169280 Ga0075362_101692801 271
1004 3300006177 Ga0075362_10173357 Ga0075362_101733571 271
1005 3300006178 Ga0075367_10010791 Ga0075367_100107911 271
1006 3300006178 Ga0075367_10023504 Ga0075367_100235043 271
1007 3300006178 Ga0075367_10394420 Ga0075367_103944201 271
1008 3300006186 Ga0075369_10020793 Ga0075369_100207934 271
1009 3300006195 Ga0075366_10002163 Ga0075366_100021636 271
1010 3300006195 Ga0075366_10008391 Ga0075366_100083915 271
1011 3300006195 Ga0075366_10055826 Ga0075366_100558263 271
1012 3300006195 Ga0075366_10082552 Ga0075366_100825523 271
1013 3300006195 Ga0075366_10169878 Ga0075366_101698781 271
1014 3300006237 Ga0097621_100101351 Ga0097621_1001013512 271
1015 3300006353 Ga0075370_10037466 Ga0075370_100374662 271
1016 3300006353 Ga0075370_10243124 Ga0075370_102431241 271
1017 3300006881 Ga0068865_100099849 Ga0068865_1000998491 271
1018 3300006914 Ga0075436_100002407 Ga0075436_10000240713 271
1019 3300006946 Ga0079104_1000187 Ga0079104_100018784 271
1020 3300006946 Ga0079104_1003210 Ga0079104_10032106 271
1021 3300006946 Ga0079104_1008871 Ga0079104_10088714 271
1022 3300006948 Ga0099826_10000272 Ga0099826_1000027216 271
1023 3300006948 Ga0099826_10056750 Ga0099826_100567503 271
1024 3300007076 Ga0075435_100021526 Ga0075435_1000215264 271
1025 3300009094 Ga0111539_10592186 Ga0111539_105921862 271
1026 3300009101 Ga0105247_10092970 Ga0105247_100929702 271
1027 3300009147 Ga0114129_10589498 Ga0114129_105894982 271
1028 3300009148 Ga0105243_10017278 Ga0105243_100172785 271
1029 3300009176 Ga0105242_10054092 Ga0105242_100540923 271
1030 3300009177 Ga0105248_10064732 Ga0105248_100647325 271
1031 3300009177 Ga0105248_10195584 Ga0105248_101955842 271
1032 3300009545 Ga0105237_10674016 Ga0105237_106740161 271
1033 3300009551 Ga0105238_10032764 Ga0105238_100327645 271
1034 3300009765 Ga0123341_1059495 Ga0123341_10594952 271
1035 3300009766 Ga0123342_1014422 Ga0123342_10144221 271
1036 3300010375 Ga0105239_10871621 Ga0105239_108716211 271
1037 3300013100 Ga0157373_10016809 Ga0157373_100168094 271
1038 3300013102 Ga0157371_10000015 Ga0157371_1000001591 271
1039 3300013104 Ga0157370_10002232 Ga0157370_100022328 271
1040 3300013105 Ga0157369_10490627 Ga0157369_104906271 271
1041 3300013249 Ga0171463_1011 Ga0171463_1011171 271
1042 3300014325 Ga0163163_10623630 Ga0163163_106236302 271
1043 3300015690 Ga0183363_1279 Ga0183363_12799 271
1044 3300021320 Ga0214544_1000024 Ga0214544_1000024155 271
1045 3300021321 Ga0214542_1000015 Ga0214542_1000015140 271
1046 3300021327 Ga0214543_1000011 Ga0214543_1000011264 271
1047 3300021327 Ga0214543_1000032 Ga0214543_100003230 271
1048 3300022739 Ga0228711_1000012 Ga0228711_100001293 271
1049 3300022740 Ga0228710_1000006 Ga0228710_100000693 271
1050 3300025208 Ga0209436_100155 Ga0209436_10015537 271
1051 3300025208 Ga0209436_102600 Ga0209436_1026004 271
1052 3300025245 Ga0207425_1003736 Ga0207425_10037364 271
1053 3300025245 Ga0207425_1008252 Ga0207425_10082524 271
1054 3300025258 Ga0209129_1000329 Ga0209129_100032941 271
1055 3300025258 Ga0209129_1003358 Ga0209129_10033587 271
1056 3300025258 Ga0209129_1004787 Ga0209129_10047875 271
1057 3300025258 Ga0209129_1004973 Ga0209129_10049732 271
1058 3300025258 Ga0209129_1011476 Ga0209129_10114763 271
1059 3300025263 Ga0209565_1023569 Ga0209565_10235691 271
1060 3300025273 Ga0209673_1000068 Ga0209673_1000068139 271
1061 3300025273 Ga0209673_1000456 Ga0209673_100045618 271
1062 3300025273 Ga0209673_1002251 Ga0209673_100225110 271
1063 3300025273 Ga0209673_1002368 Ga0209673_10023686 271
1064 3300025273 Ga0209673_1003459 Ga0209673_10034599 271
1065 3300025273 Ga0209673_1018492 Ga0209673_10184922 271
1066 3300025284 Ga0209130_1000007 Ga0209130_1000007471 271
1067 3300025284 Ga0209130_1000097 Ga0209130_10000979 271
1068 3300025284 Ga0209130_1028763 Ga0209130_10287632 271
1069 3300025292 Ga0209676_1003690 Ga0209676_10036909 271
1070 3300025292 Ga0209676_1013668 Ga0209676_10136684 271
1071 3300025294 Ga0209025_1000033 Ga0209025_1000033387 271
1072 3300025294 Ga0209025_1000094 Ga0209025_100009495 271
1073 3300025294 Ga0209025_1001164 Ga0209025_100116441 271
1074 3300025294 Ga0209025_1002864 Ga0209025_100286418 271
1075 3300025294 Ga0209025_1006481 Ga0209025_10064815 271
1076 3300025294 Ga0209025_1024154 Ga0209025_10241544 271
1077 3300025294 Ga0209025_1046094 Ga0209025_10460943 271
1078 3300025295 Ga0209564_1000140 Ga0209564_100014026 271
1079 3300025295 Ga0209564_1000453 Ga0209564_100045367 271
1080 3300025295 Ga0209564_1002007 Ga0209564_10020074 271
1081 3300025295 Ga0209564_1003996 Ga0209564_10039965 271
1082 3300025295 Ga0209564_1004499 Ga0209564_10044994 271
1083 3300025295 Ga0209564_1014707 Ga0209564_10147074 271
1084 3300025297 Ga0209758_1001803 Ga0209758_100180318 271
1085 3300025297 Ga0209758_1001857 Ga0209758_100185713 271
1086 3300025297 Ga0209758_1002381 Ga0209758_100238117 271
1087 3300025297 Ga0209758_1006966 Ga0209758_10069668 271
1088 3300025297 Ga0209758_1011351 Ga0209758_10113516 271
1089 3300025297 Ga0209758_1012175 Ga0209758_10121754 271
1090 3300025297 Ga0209758_1016148 Ga0209758_10161483 271
1091 3300025298 Ga0209050_1003731 Ga0209050_10037314 271
1092 3300025299 Ga0209256_1000319 Ga0209256_100031912 271
1093 3300025299 Ga0209256_1000836 Ga0209256_100083631 271
1094 3300025299 Ga0209256_1001441 Ga0209256_100144128 271
1095 3300025299 Ga0209256_1001576 Ga0209256_100157615 271
1096 3300025299 Ga0209256_1003708 Ga0209256_10037085 271
1097 3300025299 Ga0209256_1004027 Ga0209256_10040276 271
1098 3300025299 Ga0209256_1013705 Ga0209256_10137052 271
1099 3300025299 Ga0209256_1021989 Ga0209256_10219892 271
1100 3300025302 Ga0207426_1000003 Ga0207426_1000003856 271
1101 3300025302 Ga0207426_1000094 Ga0207426_100009443 271
1102 3300025302 Ga0207426_1000111 Ga0207426_1000111112 271
1103 3300025302 Ga0207426_1005192 Ga0207426_10051926 271
1104 3300025302 Ga0207426_1043572 Ga0207426_10435722 271
1105 3300025303 Ga0209051_1010194 Ga0209051_10101945 271
1106 3300025303 Ga0209051_1017610 Ga0209051_10176102 271
1107 3300025304 Ga0209257_1008688 Ga0209257_10086885 271
1108 3300025304 Ga0209257_1033156 Ga0209257_10331562 271
1109 3300025907 Ga0207645_10129898 Ga0207645_101298982 271
1110 3300025912 Ga0207707_10381333 Ga0207707_103813332 271
1111 3300025917 Ga0207660_10016618 Ga0207660_100166182 271
1112 3300025919 Ga0207657_10189412 Ga0207657_101894122 271
1113 3300025921 Ga0207652_10205860 Ga0207652_102058603 271
1114 3300025921 Ga0207652_10298565 Ga0207652_102985652 271
1115 3300025923 Ga0207681_10130434 Ga0207681_101304341 271
1116 3300025926 Ga0207659_10076698 Ga0207659_100766983 271
1117 3300025931 Ga0207644_10209932 Ga0207644_102099322 271
1118 3300025934 Ga0207686_10035794 Ga0207686_100357943 271
1119 3300025936 Ga0207670_10149307 Ga0207670_101493072 271
1120 3300025937 Ga0207669_10525931 Ga0207669_105259311 271
1121 3300025939 Ga0207665_10034498 Ga0207665_100344984 271
1122 3300025939 Ga0207665_10441157 Ga0207665_104411571 271
1123 3300025941 Ga0207711_10088037 Ga0207711_100880373 271
1124 3300025986 Ga0207658_10406356 Ga0207658_104063561 271
1125 3300026095 Ga0207676_10603834 Ga0207676_106038341 271
1126 3300026118 Ga0207675_100307900 Ga0207675_1003079002 271
1127 3300026121 Ga0207683_10287967 Ga0207683_102879672 271
1128 3300027111 Ga0209281_1000268 Ga0209281_10002686 271
1129 3300027111 Ga0209281_1000310 Ga0209281_100031084 271
1130 3300027111 Ga0209281_1001674 Ga0209281_10016747 271
1131 3300027312 Ga0209371_1000021 Ga0209371_100002161 271
1132 3300027312 Ga0209371_1000698 Ga0209371_100069823 271
1133 3300027666 Ga0209282_1000026 Ga0209282_1000026181 271
1134 3300027666 Ga0209282_1000300 Ga0209282_100030010 271
1135 3300027666 Ga0209282_1045429 Ga0209282_10454293 271
1136 3300027866 Ga0209813_10008474 Ga0209813_100084742 271
1137 3300027866 Ga0209813_10012073 Ga0209813_100120733 271
1138 3300028379 Ga0268266_10021269 Ga0268266_100212691 271
1139 3300028381 Ga0268264_10102557 Ga0268264_101025573 271
1140 3300028794 Ga0307515_10000274 Ga0307515_1000027426 271
1141 3300028794 Ga0307515_10040282 Ga0307515_100402827 271
1142 3300028794 Ga0307515_10067674 Ga0307515_100676745 271
1143 3300030500 Ga0268256_1000020 Ga0268256_100002067 271
1144 3300030500 Ga0268256_1005121 Ga0268256_10051215 271
1145 3300031235 Ga0265330_10028620 Ga0265330_100286202 271
1146 3300031235 Ga0265330_10122354 Ga0265330_101223541 271
1147 3300031241 Ga0265325_10000230 Ga0265325_1000023035 271
1148 3300031241 Ga0265325_10031272 Ga0265325_100312724 271
1149 3300031247 Ga0265340_10021000 Ga0265340_100210003 271
1150 3300031249 Ga0265339_10008490 Ga0265339_100084905 271
1151 3300031250 Ga0265331_10039368 Ga0265331_100393683 271
1152 3300031344 Ga0265316_10114860 Ga0265316_101148603 271
1153 3300031344 Ga0265316_10130520 Ga0265316_101305202 271
1154 3300031456 Ga0307513_10040399 Ga0307513_100403993 271
1155 3300031548 Ga0307408_100037549 Ga0307408_1000375495 271
1156 3300031712 Ga0265342_10271621 Ga0265342_102716211 271
1157 3300031911 Ga0307412_10024199 Ga0307412_100241993 271
1158 3300031911 Ga0307412_10298148 Ga0307412_102981481 271
1159 3300031967 Ga0315914_1000008 Ga0315914_100000892 271
1160 3300032002 Ga0307416_100551217 Ga0307416_1005512171 271
1161 3300032004 Ga0307414_10189521 Ga0307414_101895212 271
1162 3300033430 Ga0315913_1000093 Ga0315913_10000939 271
1163 3300033464 Ga0315915_1000014 Ga0315915_100001484 271
1164 3300035089 Ga0373944_0049692 Ga0373944_0049692_104_919 271
1165 3300035090 Ga0373949_0062024 Ga0373949_0062024_87_908 271
1166 3300035111 Ga0373923_0146548 Ga0373923_0146548_133_948 271
1167 3300035114 Ga0373939_0010074 Ga0373939_0010074_48_869 271
1168 3300035241 Ga0373961_0011252 Ga0373961_0011252_277_1092 271
1169 3300035691 Ga0373931_0015638 Ga0373931_0015638_1958_2779 271
1170 3300035691 Ga0373931_0046184 Ga0373931_0046184_986_1801 271
1171 3300036401 Ga0373937_0068299 Ga0373937_0068299_494_1309 271
1172 3300036401 Ga0373937_0744621 Ga0373937_0744621_37_852 271
1173 3300037068 Ga0373925_0115236 Ga0373925_0115236_632_1447 271
1174 3300037068 Ga0373925_0210883 Ga0373925_0210883_105_929 271
1175 3300037466 Ga0395898_0079433 Ga0395898_0079433_2044_2889 271
1176 3300037853 Ga0436364_1053682 Ga0436364_1053682_1049_1879 271
1177 3300038443 Ga0395901_0276015 Ga0395901_0276015_637_1482 271
1178 3300039438 Ga0436360_1030738 Ga0436360_1030738_267_1097 271
1179 3300039447 Ga0436361_0447916 Ga0436361_0447916_899_1729 271
1180 3300039447 Ga0436361_0583883 Ga0436361_0583883_325_1155 271
1181 3300039453 Ga0436362_0772071 Ga0436362_0772071_30_860 271
1182 3300041404 Ga0439436_0008690 Ga0439436_0008690_360_1187 271
1183 3300041406 Ga0439439_0005910 Ga0439439_0005910_1844_2671 271
1184 3300041407 Ga0439447_027226 Ga0439447_027226_229_1056 271
1185 3300041413 Ga0439465_0001450 Ga0439465_0001450_6823_7656 271
1186 3300041413 Ga0439465_0004393 Ga0439465_0004393_1107_1934 271
1187 3300041413 Ga0439465_0027863 Ga0439465_0027863_723_1556 271
1188 3300041491 Ga0451833_0223154 Ga0451833_0223154_903_1841 271
1189 3300041494 Ga0451837_0499150 Ga0451837_0499150_92_925 271
1190 3300041494 Ga0451837_1523969 Ga0451837_1523969_194_1027 271
1191 3300041501 Ga0451845_0654372 Ga0451845_0654372_74_907 271
1192 3300041502 Ga0451846_70228 Ga0451846_70228_440_1378 271
1193 3300041503 Ga0451847_0083388 Ga0451847_0083388_1013_1951 271
1194 3300041506 Ga0451850_35806 Ga0451850_35806_32_865 271
1195 3300041507 Ga0451851_0987432 Ga0451851_0987432_342_1280 271
1196 3300041509 Ga0451843_0065450 Ga0451843_0065450_2254_3192 271
1197 3300041510 Ga0451854_37387 Ga0451854_37387_448_1281 271
1198 3300041511 Ga0451855_1098170 Ga0451855_1098170_1095_2033 271
1199 3300041512 Ga0451853_2558696 Ga0451853_2558696_520_1458 271
1200 3300041907 Ga0452268_15340 Ga0452268_15340_1247_2080 271
1201 3300042007 Ga0439449_0000949 Ga0439449_0000949_2824_3651 271
1202 3300042007 Ga0439449_0008506 Ga0439449_0008506_1356_2183 271
1203 3300042015 Ga0439462_0032319 Ga0439462_0032319_384_1211 271
1204 3300042145 Ga0450906_006925 Ga0450906_006925_1254_2081 271
1205 3300042436 Ga0439435_0026765 Ga0439435_0026765_284_1099 271
1206 3300044658 Ga0466972_0109823 Ga0466972_0109823_20_868 271
1207 3300044719 Ga0466971_0059506 Ga0466971_0059506_577_1407 271
1208 3300044765 Ga0466970_0187936 Ga0466970_0187936_123_947 271
1209 3300046460 Ga0495638_0001347 Ga0495638_0001347_2241_3074 271
1210 3300046474 Ga0495605_0003366 Ga0495605_0003366_6445_7278 271
1211 3300046474 Ga0495605_0055337 Ga0495605_0055337_100_933 271
1212 3300046477 Ga0495664_0265202 Ga0495664_0265202_153_968 271
1213 3300046492 Ga0495585_0008712 Ga0495585_0008712_1555_2388 271
1214 3300046492 Ga0495585_0017056 Ga0495585_0017056_1222_2055 271
1215 3300046501 Ga0495607_0019982 Ga0495607_0019982_211_1149 271
1216 3300046506 Ga0495583_0002986 Ga0495583_0002986_2245_3078 271
1217 3300046506 Ga0495583_0036678 Ga0495583_0036678_1294_2127 271
1218 3300046507 Ga0495606_0000519 Ga0495606_0000519_59790_60638 271
1219 3300046507 Ga0495606_0010164 Ga0495606_0010164_2481_3419 271
1220 3300046507 Ga0495606_0210997 Ga0495606_0210997_97_930 271
1221 3300046512 Ga0495610_0007132 Ga0495610_0007132_2137_3000 271
1222 3300046512 Ga0495610_0052713 Ga0495610_0052713_122_1060 271
1223 3300046512 Ga0495610_0158020 Ga0495610_0158020_50_883 271
1224 3300046515 Ga0495620_0009503 Ga0495620_0009503_1964_2902 271
1225 3300046515 Ga0495620_0038067 Ga0495620_0038067_235_1098 271
1226 3300046518 Ga0495631_0002151 Ga0495631_0002151_8415_9248 271
1227 3300046522 Ga0495643_0016698 Ga0495643_0016698_1350_2183 271
1228 3300046522 Ga0495643_0038505 Ga0495643_0038505_1750_2583 271
1229 3300046524 Ga0495648_0131491 Ga0495648_0131491_348_1181 271
1230 3300046524 Ga0495648_0188306 Ga0495648_0188306_86_919 271
1231 3300046530 Ga0495654_0128846 Ga0495654_0128846_32_865 271
1232 3300046533 Ga0495640_0072546 Ga0495640_0072546_716_1531 271
1233 3300046538 Ga0495609_0046643 Ga0495609_0046643_742_1575 271
1234 3300046538 Ga0495609_0120709 Ga0495609_0120709_152_1090 271
1235 3300046542 Ga0495597_0003588 Ga0495597_0003588_880_1818 271
1236 3300046558 Ga0495633_0022000 Ga0495633_0022000_1593_2426 271
1237 3300046558 Ga0495633_0074244 Ga0495633_0074244_475_1308 271
1238 3300046558 Ga0495633_0127155 Ga0495633_0127155_130_954 271
1239 3300046615 Ga0495656_0012678 Ga0495656_0012678_891_1724 271
1240 3300046615 Ga0495656_0095466 Ga0495656_0095466_19_834 271
1241 3300046616 Ga0495668_0009435 Ga0495668_0009435_1998_2831 271
1242 3300046616 Ga0495668_0177477 Ga0495668_0177477_96_935 271
1243 3300046648 Ga0495611_0028203 Ga0495611_0028203_112_945 271
1244 3300046660 Ga0495625_0001123 Ga0495625_0001123_31574_32407 271
1245 3300046674 Ga0495588_0003191 Ga0495588_0003191_5456_6280 271
1246 3300046674 Ga0495588_0048326 Ga0495588_0048326_1087_1920 271
1247 3300046674 Ga0495588_0173762 Ga0495588_0173762_46_870 271
1248 3300046691 Ga0495670_0056140 Ga0495670_0056140_939_1772 271
1249 3300047319 Ga0495674_0156336 Ga0495674_0156336_24_839 271
1250 3300047444 Ga0495675_0174034 Ga0495675_0174034_335_1150 271
1251 3300047446 Ga0495679_062000 Ga0495679_062000_227_1060 271
1252 3300047470 Ga0495681_0006372 Ga0495681_0006372_1352_2176 271
1253 3300047472 Ga0495686_0004635 Ga0495686_0004635_1580_2428 271
1254 3300047472 Ga0495686_0025709 Ga0495686_0025709_948_1886 271
1255 3300047472 Ga0495686_0032707 Ga0495686_0032707_360_1223 271
1256 3300048088 Ga0495602_0119203 Ga0495602_0119203_267_1082 271
1257 3300048904 Ga0496101_0171593 Ga0496101_0171593_698_1588 271
1258 3300048905 Ga0496102_0103547 Ga0496102_0103547_537_1352 271
1259 3300048905 Ga0496102_0205453 Ga0496102_0205453_962_1783 271
1260 3300048905 Ga0496102_0247947 Ga0496102_0247947_233_1081 271
1261 3300048907 Ga0496104_0221311 Ga0496104_0221311_63_890 271
1262 3300048907 Ga0496104_0257990 Ga0496104_0257990_558_1448 271
1263 3300048908 Ga0496105_0127865 Ga0496105_0127865_1129_1944 271
1264 3300048908 Ga0496105_0195128 Ga0496105_0195128_456_1346 271
1265 3300048909 Ga0496106_0004905 Ga0496106_0004905_7645_8478 271
1266 3300048909 Ga0496106_0221426 Ga0496106_0221426_76_891 271
1267 3300048910 Ga0496107_0067169 Ga0496107_0067169_1566_2381 271
1268 3300048911 Ga0496108_0115557 Ga0496108_0115557_38_853 271
1269 3300048911 Ga0496108_0201138 Ga0496108_0201138_99_929 271
1270 3300048912 Ga0496109_0094753 Ga0496109_0094753_1060_1875 271
1271 3300048913 Ga0496110_0054506 Ga0496110_0054506_1885_2700 271
1272 3300048913 Ga0496110_0502226 Ga0496110_0502226_75_890 271
1273 3300048914 Ga0496111_0031739 Ga0496111_0031739_1171_1995 271
1274 3300048914 Ga0496111_0154797 Ga0496111_0154797_637_1452 271
1275 3300048915 Ga0496112_0056278 Ga0496112_0056278_692_1507 271
1276 3300048915 Ga0496112_0090590 Ga0496112_0090590_2067_2882 271
1277 3300048915 Ga0496112_0273024 Ga0496112_0273024_36_851 271
1278 3300048916 Ga0496113_0016231 Ga0496113_0016231_608_1432 271
1279 3300048916 Ga0496113_0374952 Ga0496113_0374952_241_1056 271
1280 3300048917 Ga0496114_0186865 Ga0496114_0186865_741_1631 271
1281 3300048917 Ga0496114_0197612 Ga0496114_0197612_825_1640 271
1282 3300048917 Ga0496114_0270501 Ga0496114_0270501_198_1031 271
1283 3300048918 Ga0496115_0014721 Ga0496115_0014721_853_1668 271
1284 3300048918 Ga0496115_0037604 Ga0496115_0037604_2400_3215 271
1285 3300048918 Ga0496115_0047177 Ga0496115_0047177_1599_2420 271
1286 3300048918 Ga0496115_0075559 Ga0496115_0075559_1651_2541 271
1287 3300048919 Ga0496116_0000043 Ga0496116_0000043_84216_85040 271
1288 3300048920 Ga0496117_0000002 Ga0496117_0000002_1033638_1034462 271
1289 3300048920 Ga0496117_0034760 Ga0496117_0034760_1952_2785 271
1290 3300048921 Ga0496118_0000355 Ga0496118_0000355_47779_48603 271
1291 3300048921 Ga0496118_0016639 Ga0496118_0016639_1495_2433 271
1292 3300048921 Ga0496118_0030122 Ga0496118_0030122_2075_2908 271
1293 3300048921 Ga0496118_0083290 Ga0496118_0083290_1344_2168 271
1294 3300048921 Ga0496118_0291683 Ga0496118_0291683_17_841 271
1295 3300048922 Ga0496119_0022816 Ga0496119_0022816_3496_4320 271
1296 3300048922 Ga0496119_0023480 Ga0496119_0023480_1039_1887 271
1297 3300048922 Ga0496119_0152504 Ga0496119_0152504_227_1060 271
1298 3300048923 Ga0496120_0001026 Ga0496120_0001026_13098_13922 271
1299 3300048924 Ga0496121_0022576 Ga0496121_0022576_721_1584 271
1300 3300048924 Ga0496121_0037196 Ga0496121_0037196_736_1569 271
1301 3300048924 Ga0496121_0039941 Ga0496121_0039941_1642_2490 271
1302 3300048924 Ga0496121_0128354 Ga0496121_0128354_1049_1882 271
1303 3300048924 Ga0496121_0180096 Ga0496121_0180096_641_1474 271
1304 3300048925 Ga0496122_0000001 Ga0496122_0000001_340092_340916 271
1305 3300048925 Ga0496122_0000025 Ga0496122_0000025_350799_351623 271
1306 3300048925 Ga0496122_0020485 Ga0496122_0020485_3194_4018 271
1307 3300048925 Ga0496122_0027134 Ga0496122_0027134_2683_3516 271
1308 3300048925 Ga0496122_0072488 Ga0496122_0072488_1361_2185 271
1309 3300048926 Ga0496123_0000001 Ga0496123_0000001_343823_344647 271
1310 3300048926 Ga0496123_0000032 Ga0496123_0000032_12590_13414 271
1311 3300048926 Ga0496123_0013675 Ga0496123_0013675_4474_5307 271
1312 3300048926 Ga0496123_0139205 Ga0496123_0139205_148_972 271
1313 3300048927 Ga0496124_0000112 Ga0496124_0000112_14358_15182 271
1314 3300048927 Ga0496124_0019709 Ga0496124_0019709_2587_3411 271
1315 3300048927 Ga0496124_0023074 Ga0496124_0023074_1653_2477 271
1316 3300048927 Ga0496124_0046692 Ga0496124_0046692_1960_2793 271
1317 3300048927 Ga0496124_0055085 Ga0496124_0055085_2197_3060 271
1318 3300048927 Ga0496124_0128101 Ga0496124_0128101_512_1345 271
1319 3300048927 Ga0496124_0145251 Ga0496124_0145251_273_1106 271
1320 3300048928 Ga0496125_0010044 Ga0496125_0010044_1497_2330 271
1321 3300048929 Ga0496126_0000369 Ga0496126_0000369_42229_43053 271
1322 3300049459 Ga0495678_008204 Ga0495678_008204_2151_2984 271
1323 3300049568 Ga0501031_0095847 Ga0501031_0095847_1072_1908 271
1324 3300049568 Ga0501031_0110215 Ga0501031_0110215_541_1374 271
1325 3300049569 Ga0501032_0038066 Ga0501032_0038066_549_1382 271
1326 3300049569 Ga0501032_0079969 Ga0501032_0079969_984_1799 271
1327 3300049570 Ga0501033_0074314 Ga0501033_0074314_535_1350 271
1328 3300049570 Ga0501033_0385188 Ga0501033_0385188_46_879 271
1329 3300049571 Ga0501034_0033130 Ga0501034_0033130_3099_3938 271
1330 3300049571 Ga0501034_0578866 Ga0501034_0578866_30_863 271
1331 3300049572 Ga0501036_0026291 Ga0501036_0026291_984_1799 271
1332 3300049572 Ga0501036_0073064 Ga0501036_0073064_1338_2171 271
1333 3300049572 Ga0501036_0282371 Ga0501036_0282371_209_1042 271
1334 3300049573 Ga0501037_0011514 Ga0501037_0011514_407_1222 271
1335 3300049573 Ga0501037_0017813 Ga0501037_0017813_834_1667 271
1336 3300049573 Ga0501037_0071527 Ga0501037_0071527_1349_2182 271
1337 3300049574 Ga0501038_0031324 Ga0501038_0031324_3729_4544 271
1338 3300049574 Ga0501038_0075778 Ga0501038_0075778_344_1177 271
1339 3300049574 Ga0501038_0287591 Ga0501038_0287591_216_1049 271
1340 3300049575 Ga0501039_0036175 Ga0501039_0036175_2222_3037 271
1341 3300049577 Ga0501041_0279550 Ga0501041_0279550_174_1010 271
1342 3300049579 Ga0501043_0034750 Ga0501043_0034750_1622_2437 271
1343 3300049579 Ga0501043_0220985 Ga0501043_0220985_128_961 271
1344 3300049580 Ga0501046_0003405 Ga0501046_0003405_5290_6105 271
1345 3300049581 Ga0501047_0068784 Ga0501047_0068784_2297_3130 271
1346 3300049582 Ga0501048_0001758 Ga0501048_0001758_5882_6697 271
1347 3300049583 Ga0501067_0002567 Ga0501067_0002567_3275_4090 271
1348 3300049584 Ga0501068_0014151 Ga0501068_0014151_3224_4039 271
1349 3300049584 Ga0501068_0035476 Ga0501068_0035476_1484_2317 271
1350 3300049584 Ga0501068_0278424 Ga0501068_0278424_85_900 271
1351 3300049585 Ga0501069_0003872 Ga0501069_0003872_397_1212 271
1352 3300049585 Ga0501069_0180713 Ga0501069_0180713_367_1206 271
1353 3300049586 Ga0501070_0007225 Ga0501070_0007225_3198_4013 271
1354 3300049587 Ga0501071_0141871 Ga0501071_0141871_578_1393 271
1355 3300049588 Ga0501072_0055644 Ga0501072_0055644_653_1483 271
1356 3300049588 Ga0501072_0095850 Ga0501072_0095850_1522_2337 271
1357 3300049589 Ga0501073_0009199 Ga0501073_0009199_6119_6934 271
1358 3300049589 Ga0501073_0030347 Ga0501073_0030347_1516_2349 271
1359 3300049589 Ga0501073_0061579 Ga0501073_0061579_1121_1951 271
1360 3300049590 Ga0501074_0154458 Ga0501074_0154458_525_1355 271
1361 3300049592 Ga0501076_0095437 Ga0501076_0095437_1162_1977 271
1362 3300049741 Ga0501079_0216653 Ga0501079_0216653_314_1129 271
1363 3300049741 Ga0501079_0516014 Ga0501079_0516014_51_887 271
1364 3300049742 Ga0501080_0072959 Ga0501080_0072959_1195_2028 271
1365 3300049742 Ga0501080_0083608 Ga0501080_0083608_1234_2049 271
1366 3300049742 Ga0501080_0122374 Ga0501080_0122374_1312_2142 271
1367 3300049742 Ga0501080_0149652 Ga0501080_0149652_363_1202 271
1368 3300049742 Ga0501080_0377481 Ga0501080_0377481_121_936 271
1369 3300049743 Ga0501081_0027275 Ga0501081_0027275_329_1165 271
1370 3300049744 Ga0501083_0035347 Ga0501083_0035347_100_915 271
1371 3300049744 Ga0501083_0043017 Ga0501083_0043017_1169_2002 271
1372 3300049744 Ga0501083_0055575 Ga0501083_0055575_163_996 271
1373 3300049744 Ga0501083_0079080 Ga0501083_0079080_491_1306 271
1374 3300049822 Ga0501035_0089644 Ga0501035_0089644_366_1181 271
1375 3300049823 Ga0501044_0002904 Ga0501044_0002904_12836_13669 271
1376 3300049823 Ga0501044_0179096 Ga0501044_0179096_953_1786 271
1377 3300049823 Ga0501044_0352644 Ga0501044_0352644_419_1234 271
1378 3300049823 Ga0501044_0556774 Ga0501044_0556774_208_1023 271
1379 3300049824 Ga0501045_0019735 Ga0501045_0019735_3381_4196 271
1380 3300050489 nmdc:mga03683_1313_c1 nmdc:mga03683_1313_c1_167_1000 271
1381 3300050491 nmdc:mga00v17_287268_c1 nmdc:mga00v17_287268_c1_184_1008 271
1382 3300050491 nmdc:mga00v17_6_c1 nmdc:mga00v17_6_c1_114787_115611 271
1383 3300050492 nmdc:mga0yw44_208030_c1 nmdc:mga0yw44_208030_c1_166_1104 271
1384 3300050492 nmdc:mga0yw44_382836_c1 nmdc:mga0yw44_382836_c1_42_899 271
1385 3300050492 nmdc:mga0yw44_9825_c1 nmdc:mga0yw44_9825_c1_2167_2991 271
1386 3300050493 nmdc:mga0k408_13060_c1 nmdc:mga0k408_13060_c1_1969_2802 271
1387 3300050493 nmdc:mga0k408_38530_c2 nmdc:mga0k408_38530_c2_493_1308 271
1388 3300050494 nmdc:mga06z11_158174_c1 nmdc:mga06z11_158174_c1_44_859 271
1389 3300050494 nmdc:mga06z11_17428_c1 nmdc:mga06z11_17428_c1_324_1148 271
1390 3300050494 nmdc:mga06z11_78913_c1 nmdc:mga06z11_78913_c1_869_1702 271
1391 3300050495 nmdc:mga04h51_26632_c1 nmdc:mga04h51_26632_c1_398_1222 271
1392 3300050496 nmdc:mga07m45_256283_c1 nmdc:mga07m45_256283_c1_134_958 271
1393 3300050511 nmdc:mga08y16_445280_c1 nmdc:mga08y16_445280_c1_347_1162 271
1394 3300050513 nmdc:mga0rr50_13993_c1 nmdc:mga0rr50_13993_c1_1195_2034 271
1395 3300050514 nmdc:mga08x19_23_c1 nmdc:mga08x19_23_c1_180669_181508 271
1396 3300050516 nmdc:mga0sz30_1690_c1 nmdc:mga0sz30_1690_c1_2003_2827 271
1397 3300050516 nmdc:mga0sz30_17676_c1 nmdc:mga0sz30_17676_c1_1839_2672 271
1398 3300050516 nmdc:mga0sz30_21874_c1 nmdc:mga0sz30_21874_c1_1620_2444 271
1399 3300053077 Ga0495601_0022891 Ga0495601_0022891_2484_3374 271
1400 3300053077 Ga0495601_0075700 Ga0495601_0075700_723_1538 271
1401 3300053078 Ga0495612_0161214 Ga0495612_0161214_61_951 271
1402 3300053078 Ga0495612_0189253 Ga0495612_0189253_15_830 271
1403 3300053084 Ga0495595_0161242 Ga0495595_0161242_113_928 271
1404 3300053085 Ga0495619_0041815 Ga0495619_0041815_60_875 271
1405 3300053085 Ga0495619_0114935 Ga0495619_0114935_586_1476 271
1406 3300053085 Ga0495619_0291563 Ga0495619_0291563_127_1044 271
1407 3300053099 Ga0500654_085932 Ga0500654_085932_208_1035 271
1408 3300053107 Ga0500560_015739 Ga0500560_015739_291_1115 271
1409 3300053108 Ga0500562_025006 Ga0500562_025006_61_894 271
1410 3300053118 Ga0500594_0009623 Ga0500594_0009623_917_1750 271
1411 3300053125 Ga0500618_000192 Ga0500618_000192_2424_3248 271
1412 3300053125 Ga0500618_009031 Ga0500618_009031_955_1779 271
1413 3300053137 Ga0500561_0008364 Ga0500561_0008364_80_904 271
1414 3300053139 Ga0500568_0000506 Ga0500568_0000506_2193_3026 271
1415 3300053139 Ga0500568_0017135 Ga0500568_0017135_1135_1968 271
1416 3300053151 Ga0500604_0006742 Ga0500604_0006742_1088_1921 271
1417 3300053151 Ga0500604_0023089 Ga0500604_0023089_484_1311 271
1418 3300053153 Ga0500616_0001481 Ga0500616_0001481_2254_3087 271
1419 3300053153 Ga0500616_0023325 Ga0500616_0023325_1761_2699 271
1420 3300053156 Ga0500622_0001030 Ga0500622_0001030_20894_21727 271
1421 3300053156 Ga0500622_0067344 Ga0500622_0067344_366_1199 271
1422 3300053158 Ga0500627_0024215 Ga0500627_0024215_702_1535 271
1423 3300053160 Ga0500633_0006714 Ga0500633_0006714_85_918 271
1424 3300053177 Ga0500636_0000019 Ga0500636_0000019_44278_45102 271
1425 3300053727 Ga0500611_006236 Ga0500611_006236_846_1685 271
1426 3300054114 Ga0501084_0010849 Ga0501084_0010849_6177_6992 271
1427 3300054114 Ga0501084_0265941 Ga0501084_0265941_130_966 271
1428 3300059490 Ga0587066_010363 Ga0587066_010363_135_998 271
1429 3300059491 Ga0587070_016503 Ga0587070_016503_13_876 271
1430 3300059504 Ga0587082_022111 Ga0587082_022111_115_939 271
1431 3300059508 Ga0587088_016173 Ga0587088_016173_342_1175 271
1432 3300059623 Ga0587101_012922 Ga0587101_012922_218_1081 271
1433 3300059630 Ga0587128_015306 Ga0587128_015306_172_996 271
1434 3300059643 Ga0587072_015368 Ga0587072_015368_234_1058 271
1435 3300060346 Ga0587111_0018765 Ga0587111_0018765_155_979 271
1436 3300060353 Ga0501082_0043601 Ga0501082_0043601_505_1320 271
1437 3300060353 Ga0501082_0183376 Ga0501082_0183376_162_995 271
1438 3300060353 Ga0501082_0194035 Ga0501082_0194035_867_1703 271
1439 iso_pu_bacteria 2643221547 2643755606 271
1440 3300001979 JGI24740J21852_10000001 JGI24740J21852_10000001103 272
1441 3300002704 JGI25155J39150_1000011 JGI25155J39150_100001176 272
1442 3300002705 JGI25156J39149_1000027 JGI25156J39149_100002776 272
1443 3300002737 JGI25162J39368_1000923 JGI25162J39368_10009234 272
1444 3300002737 JGI25162J39368_1001104 JGI25162J39368_10011044 272
1445 3300002737 JGI25162J39368_1001271 JGI25162J39368_100127117 272
1446 3300002738 JGI25154J39366_1000057 JGI25154J39366_10000573 272
1447 3300002738 JGI25154J39366_1000368 JGI25154J39366_10003684 272
1448 3300002741 JGI25157J39369_1000010 JGI25157J39369_1000010135 272
1449 3300002773 JGI25152J39213_1001618 JGI25152J39213_10016187 272
1450 3300002774 JGI25150J39212_1000010 JGI25150J39212_10000107 272
1451 3300002987 JGI25159J45721_1000375 JGI25159J45721_10003753 272
1452 3300003187 JGI25151J46595_10000066 JGI25151J46595_1000006670 272
1453 3300003187 JGI25151J46595_10000963 JGI25151J46595_1000096311 272
1454 3300003214 JGI25165J46597_1001156 JGI25165J46597_10011564 272
1455 3300003214 JGI25165J46597_1001175 JGI25165J46597_100117520 272
1456 3300003214 JGI25165J46597_1002353 JGI25165J46597_10023534 272
1457 3300003215 JGI25153J46596_10001697 JGI25153J46596_1000169711 272
1458 3300003320 rootH2_10091763 rootH2_100917633 272
1459 3300003354 JGI25160J50197_1000004 JGI25160J50197_1000004139 272
1460 3300003374 JGI25161J50226_1000003 JGI25161J50226_1000003289 272
1461 3300003771 Ga0055526_1000955 Ga0055526_100095516 272
1462 3300003775 Ga0055524_1000035 Ga0055524_1000035130 272
1463 3300004625 Ga0055543_1000001 Ga0055543_1000001295 272
1464 3300004625 Ga0055543_1012257 Ga0055543_10122572 272
1465 3300005262 Ga0065165_1000049 Ga0065165_1000049116 272
1466 3300005262 Ga0065165_1000714 Ga0065165_10007147 272
1467 3300005367 Ga0070667_100074027 Ga0070667_1000740272 272
1468 3300005548 Ga0070665_100058162 Ga0070665_1000581621 272
1469 3300005548 Ga0070665_100363407 Ga0070665_1003634072 272
1470 3300005563 Ga0068855_100032994 Ga0068855_1000329945 272
1471 3300005616 Ga0068852_100029311 Ga0068852_1000293114 272
1472 3300006048 Ga0075363_100044970 Ga0075363_1000449702 272
1473 3300006051 Ga0075364_10145088 Ga0075364_101450882 272
1474 3300006178 Ga0075367_10047033 Ga0075367_100470332 272
1475 3300006186 Ga0075369_10012303 Ga0075369_100123033 272
1476 3300006353 Ga0075370_10029947 Ga0075370_100299472 272
1477 3300009148 Ga0105243_10275470 Ga0105243_102754701 272
1478 3300015265 Ga0182005_1008240 Ga0182005_10082404 272
1479 3300021358 Ga0213873_10007595 Ga0213873_100075952 272
1480 3300021384 Ga0213876_10065419 Ga0213876_100654192 272
1481 3300021388 Ga0213875_10007177 Ga0213875_100071773 272
1482 3300021441 Ga0213871_10011341 Ga0213871_100113411 272
1483 3300025206 Ga0209435_100022 Ga0209435_100022135 272
1484 3300025233 Ga0209437_100153 Ga0209437_10015316 272
1485 3300025233 Ga0209437_100577 Ga0209437_10057721 272
1486 3300025245 Ga0207425_1000010 Ga0207425_1000010336 272
1487 3300025246 Ga0209646_1000078 Ga0209646_1000078135 272
1488 3300025250 Ga0209026_1000065 Ga0209026_1000065135 272
1489 3300025253 Ga0209677_100355 Ga0209677_1003557 272
1490 3300025254 Ga0209148_1011825 Ga0209148_10118252 272
1491 3300025256 Ga0209759_1000055 Ga0209759_1000055135 272
1492 3300025256 Ga0209759_1010178 Ga0209759_10101782 272
1493 3300025258 Ga0209129_1000034 Ga0209129_10000345 272
1494 3300025261 Ga0209233_1000175 Ga0209233_10001755 272
1495 3300025261 Ga0209233_1000248 Ga0209233_100024893 272
1496 3300025261 Ga0209233_1000676 Ga0209233_100067622 272
1497 3300025284 Ga0209130_1000012 Ga0209130_1000012139 272
1498 3300025284 Ga0209130_1000111 Ga0209130_1000111122 272
1499 3300025291 Ga0209675_1000816 Ga0209675_100081615 272
1500 3300025294 Ga0209025_1000008 Ga0209025_10000081042 272
1501 3300025294 Ga0209025_1000022 Ga0209025_1000022246 272
1502 3300025295 Ga0209564_1000049 Ga0209564_100004974 272
1503 3300025295 Ga0209564_1000054 Ga0209564_1000054178 272
1504 3300025297 Ga0209758_1000086 Ga0209758_100008612 272
1505 3300025299 Ga0209256_1000014 Ga0209256_1000014565 272
1506 3300025302 Ga0207426_1000010 Ga0207426_1000010498 272
1507 3300025302 Ga0207426_1027328 Ga0207426_10273282 272
1508 3300025901 Ga0207688_10051209 Ga0207688_100512093 272
1509 3300025913 Ga0207695_10000011 Ga0207695_10000011628 272
1510 3300025914 Ga0207671_10000276 Ga0207671_1000027674 272
1511 3300025935 Ga0207709_10181873 Ga0207709_101818731 272
1512 3300025961 Ga0207712_10011143 Ga0207712_100111437 272
1513 3300027312 Ga0209371_1011725 Ga0209371_10117253 272
1514 3300028794 Ga0307515_10138433 Ga0307515_101384332 272
1515 3300030500 Ga0268256_1015115 Ga0268256_10151153 272
1516 3300031247 Ga0265340_10112303 Ga0265340_101123032 272
1517 3300031250 Ga0265331_10164281 Ga0265331_101642811 272
1518 3300031344 Ga0265316_10009784 Ga0265316_100097842 272
1519 3300031344 Ga0265316_10116095 Ga0265316_101160952 272
1520 3300031901 Ga0307406_10012890 Ga0307406_100128904 272
1521 3300031901 Ga0307406_10129869 Ga0307406_101298692 272
1522 3300035410 Ga0373924_0060228 Ga0373924_0060228_24_848 272
1523 3300035692 Ga0373935_0019413 Ga0373935_0019413_841_1665 272
1524 3300035695 Ga0373927_0160967 Ga0373927_0160967_300_1124 272
1525 3300035725 Ga0373947_0082367 Ga0373947_0082367_37_861 272
1526 3300037853 Ga0436364_0161603 Ga0436364_0161603_897_1721 272
1527 3300037853 Ga0436364_0773514 Ga0436364_0773514_345_1211 272
1528 3300037853 Ga0436364_0774545 Ga0436364_0774545_370_1194 272
1529 3300038443 Ga0395901_0181108 Ga0395901_0181108_131_955 272
1530 3300039437 Ga0436365_0219019 Ga0436365_0219019_305_1171 272
1531 3300039437 Ga0436365_0934594 Ga0436365_0934594_405_1229 272
1532 3300039453 Ga0436362_0292983 Ga0436362_0292983_1926_2903 272
1533 3300044765 Ga0466970_0014361 Ga0466970_0014361_1887_2750 272
1534 3300046476 Ga0495662_0016685 Ga0495662_0016685_1006_1866 272
1535 3300046517 Ga0495630_0196499 Ga0495630_0196499_175_999 272
1536 3300046518 Ga0495631_0090472 Ga0495631_0090472_434_1279 272
1537 3300046522 Ga0495643_0045214 Ga0495643_0045214_249_1103 272
1538 3300046533 Ga0495640_0021850 Ga0495640_0021850_2966_3790 272
1539 3300046642 Ga0495634_0059655 Ga0495634_0059655_851_1675 272
1540 3300047319 Ga0495674_0219464 Ga0495674_0219464_307_1131 272
1541 3300047471 Ga0495684_0256987 Ga0495684_0256987_220_1044 272
1542 3300048907 Ga0496104_0051175 Ga0496104_0051175_794_1618 272
1543 3300048908 Ga0496105_0027217 Ga0496105_0027217_806_1630 272
1544 3300048911 Ga0496108_0555650 Ga0496108_0555650_98_922 272
1545 3300048913 Ga0496110_0047098 Ga0496110_0047098_852_1676 272
1546 3300048918 Ga0496115_0082979 Ga0496115_0082979_68_892 272
1547 3300048919 Ga0496116_0010081 Ga0496116_0010081_3495_4376 272
1548 3300048919 Ga0496116_0068414 Ga0496116_0068414_218_1144 272
1549 3300048921 Ga0496118_0049811 Ga0496118_0049811_1056_1904 272
1550 3300048922 Ga0496119_0060646 Ga0496119_0060646_483_1346 272
1551 3300048924 Ga0496121_0064770 Ga0496121_0064770_794_1657 272
1552 3300048924 Ga0496121_0235180 Ga0496121_0235180_42_923 272
1553 3300048925 Ga0496122_0026337 Ga0496122_0026337_2605_3453 272
1554 3300048925 Ga0496122_0037582 Ga0496122_0037582_1994_2857 272
1555 3300048925 Ga0496122_0104427 Ga0496122_0104427_436_1317 272
1556 3300048926 Ga0496123_0010783 Ga0496123_0010783_679_1527 272
1557 3300048926 Ga0496123_0029237 Ga0496123_0029237_1656_2537 272
1558 3300048926 Ga0496123_0041064 Ga0496123_0041064_1853_2701 272
1559 3300048926 Ga0496123_0046657 Ga0496123_0046657_1496_2359 272
1560 3300048927 Ga0496124_0003528 Ga0496124_0003528_7393_8241 272
1561 3300048927 Ga0496124_0018233 Ga0496124_0018233_3532_4413 272
1562 3300048927 Ga0496124_0126394 Ga0496124_0126394_990_1853 272
1563 3300048928 Ga0496125_0029434 Ga0496125_0029434_2271_3125 272
1564 3300048928 Ga0496125_0054611 Ga0496125_0054611_1326_2207 272
1565 3300049575 Ga0501039_0366127 Ga0501039_0366127_265_1083 272
1566 3300049587 Ga0501071_0053053 Ga0501071_0053053_223_1062 272
1567 3300049588 Ga0501072_0226065 Ga0501072_0226065_635_1480 272
1568 3300049592 Ga0501076_0046862 Ga0501076_0046862_1389_2234 272
1569 3300049593 Ga0501077_0023941 Ga0501077_0023941_1881_2726 272
1570 3300049741 Ga0501079_0052582 Ga0501079_0052582_1254_2099 272
1571 3300049742 Ga0501080_0202934 Ga0501080_0202934_75_920 272
1572 3300049743 Ga0501081_0045755 Ga0501081_0045755_1305_2150 272
1573 3300049743 Ga0501081_0048305 Ga0501081_0048305_38_877 272
1574 3300049743 Ga0501081_0224396 Ga0501081_0224396_392_1231 272
1575 3300049824 Ga0501045_0067502 Ga0501045_0067502_771_1589 272
1576 3300050493 nmdc:mga0k408_165436_c1 nmdc:mga0k408_165436_c1_75_896 272
1577 3300050494 nmdc:mga06z11_85042_c1 nmdc:mga06z11_85042_c1_18_839 272
1578 3300050496 nmdc:mga07m45_125816_c1 nmdc:mga07m45_125816_c1_451_1272 272
1579 3300050516 nmdc:mga0sz30_44938_c1 nmdc:mga0sz30_44938_c1_666_1520 272
1580 3300053077 Ga0495601_0110667 Ga0495601_0110667_863_1687 272
1581 3300053125 Ga0500618_007452 Ga0500618_007452_1051_1899 272
1582 3300053130 Ga0500642_0019592 Ga0500642_0019592_1513_2334 272
1583 3300053156 Ga0500622_0037417 Ga0500622_0037417_402_1256 272
1584 3300053160 Ga0500633_0085919 Ga0500633_0085919_51_905 272
1585 3300054114 Ga0501084_0021997 Ga0501084_0021997_1572_2417 272
1586 3300060353 Ga0501082_0008268 Ga0501082_0008268_5322_6167 272
1587 3300060353 Ga0501082_0190013 Ga0501082_0190013_205_1044 272
1588 3300002077 JGI24744J21845_10001857 JGI24744J21845_100018573 273
1589 3300002244 JGI24742J22300_10004158 JGI24742J22300_100041582 273
1590 3300003203 JGI25406J46586_10019430 JGI25406J46586_100194302 273
1591 3300005331 Ga0070670_100019541 Ga0070670_1000195416 273
1592 3300005334 Ga0068869_100184823 Ga0068869_1001848231 273
1593 3300005334 Ga0068869_100405698 Ga0068869_1004056981 273
1594 3300005335 Ga0070666_10070448 Ga0070666_100704482 273
1595 3300005337 Ga0070682_100029709 Ga0070682_1000297093 273
1596 3300005338 Ga0068868_100007943 Ga0068868_1000079436 273
1597 3300005339 Ga0070660_100128962 Ga0070660_1001289622 273
1598 3300005340 Ga0070689_100013840 Ga0070689_1000138403 273
1599 3300005343 Ga0070687_100070357 Ga0070687_1000703571 273
1600 3300005344 Ga0070661_100070495 Ga0070661_1000704953 273
1601 3300005353 Ga0070669_100008764 Ga0070669_1000087647 273
1602 3300005353 Ga0070669_100190994 Ga0070669_1001909942 273
1603 3300005354 Ga0070675_100012558 Ga0070675_1000125589 273
1604 3300005355 Ga0070671_100021863 Ga0070671_1000218636 273
1605 3300005356 Ga0070674_100016878 Ga0070674_1000168783 273
1606 3300005364 Ga0070673_100075828 Ga0070673_1000758283 273
1607 3300005366 Ga0070659_100085461 Ga0070659_1000854612 273
1608 3300005367 Ga0070667_100107168 Ga0070667_1001071682 273
1609 3300005436 Ga0070713_100041195 Ga0070713_1000411952 273
1610 3300005436 Ga0070713_100147078 Ga0070713_1001470782 273
1611 3300005437 Ga0070710_10282888 Ga0070710_102828881 273
1612 3300005438 Ga0070701_10016555 Ga0070701_100165555 273
1613 3300005439 Ga0070711_100134867 Ga0070711_1001348672 273
1614 3300005455 Ga0070663_100106845 Ga0070663_1001068451 273
1615 3300005456 Ga0070678_100029543 Ga0070678_1000295433 273
1616 3300005466 Ga0070685_10014503 Ga0070685_100145035 273
1617 3300005518 Ga0070699_100010135 Ga0070699_1000101356 273
1618 3300005518 Ga0070699_100068823 Ga0070699_1000688232 273
1619 3300005535 Ga0070684_100050925 Ga0070684_1000509251 273
1620 3300005535 Ga0070684_100396772 Ga0070684_1003967721 273
1621 3300005536 Ga0070697_100132361 Ga0070697_1001323612 273
1622 3300005539 Ga0068853_100030677 Ga0068853_1000306774 273
1623 3300005543 Ga0070672_100002417 Ga0070672_1000024177 273
1624 3300005544 Ga0070686_100027342 Ga0070686_1000273422 273
1625 3300005548 Ga0070665_100134505 Ga0070665_1001345051 273
1626 3300005563 Ga0068855_100168322 Ga0068855_1001683222 273
1627 3300005564 Ga0070664_100017176 Ga0070664_1000171763 273
1628 3300005578 Ga0068854_100087720 Ga0068854_1000877203 273
1629 3300005616 Ga0068852_100026811 Ga0068852_1000268115 273
1630 3300005617 Ga0068859_100434766 Ga0068859_1004347663 273
1631 3300005618 Ga0068864_100005352 Ga0068864_10000535210 273
1632 3300005618 Ga0068864_100300817 Ga0068864_1003008173 273
1633 3300005718 Ga0068866_10031643 Ga0068866_100316432 273
1634 3300005719 Ga0068861_100011934 Ga0068861_1000119343 273
1635 3300005840 Ga0068870_10001565 Ga0068870_100015657 273
1636 3300005841 Ga0068863_100029430 Ga0068863_1000294307 273
1637 3300005842 Ga0068858_100025387 Ga0068858_1000253877 273
1638 3300005843 Ga0068860_100004828 Ga0068860_10000482813 273
1639 3300005844 Ga0068862_100028014 Ga0068862_1000280142 273
1640 3300005937 Ga0081455_10003815 Ga0081455_1000381515 273
1641 3300005937 Ga0081455_10010610 Ga0081455_100106108 273
1642 3300005981 Ga0081538_10102101 Ga0081538_101021012 273
1643 3300005985 Ga0081539_10001525 Ga0081539_1000152527 273
1644 3300006028 Ga0070717_10060695 Ga0070717_100606952 273
1645 3300006038 Ga0075365_10027441 Ga0075365_100274415 273
1646 3300006051 Ga0075364_10049304 Ga0075364_100493042 273
1647 3300006173 Ga0070716_100045849 Ga0070716_1000458492 273
1648 3300006175 Ga0070712_100445290 Ga0070712_1004452902 273
1649 3300006178 Ga0075367_10180884 Ga0075367_101808842 273
1650 3300006237 Ga0097621_100032153 Ga0097621_1000321532 273
1651 3300006358 Ga0068871_100081145 Ga0068871_1000811453 273
1652 3300006844 Ga0075428_100031023 Ga0075428_1000310233 273
1653 3300006844 Ga0075428_100076394 Ga0075428_1000763942 273
1654 3300006844 Ga0075428_100091914 Ga0075428_1000919143 273
1655 3300006844 Ga0075428_100191811 Ga0075428_1001918112 273
1656 3300006847 Ga0075431_100041304 Ga0075431_1000413043 273
1657 3300006871 Ga0075434_100377181 Ga0075434_1003771811 273
1658 3300006871 Ga0075434_100481160 Ga0075434_1004811602 273
1659 3300006881 Ga0068865_100034380 Ga0068865_1000343803 273
1660 3300006931 Ga0097620_100434796 Ga0097620_1004347961 273
1661 3300007265 Ga0099794_10047033 Ga0099794_100470333 273
1662 3300009094 Ga0111539_10079050 Ga0111539_100790501 273
1663 3300009094 Ga0111539_10149561 Ga0111539_101495614 273
1664 3300009094 Ga0111539_10699248 Ga0111539_106992482 273
1665 3300009098 Ga0105245_10106909 Ga0105245_101069093 273
1666 3300009098 Ga0105245_10303236 Ga0105245_103032362 273
1667 3300009101 Ga0105247_10023791 Ga0105247_100237913 273
1668 3300009147 Ga0114129_10006403 Ga0114129_1000640311 273
1669 3300009147 Ga0114129_10190167 Ga0114129_101901672 273
1670 3300009147 Ga0114129_10224348 Ga0114129_102243482 273
1671 3300009148 Ga0105243_10015073 Ga0105243_100150736 273
1672 3300009174 Ga0105241_10048051 Ga0105241_100480513 273
1673 3300009176 Ga0105242_10025069 Ga0105242_100250695 273
1674 3300009177 Ga0105248_10027024 Ga0105248_100270243 273
1675 3300009551 Ga0105238_10091427 Ga0105238_100914273 273
1676 3300009553 Ga0105249_10067118 Ga0105249_100671183 273
1677 3300011119 Ga0105246_10299844 Ga0105246_102998442 273
1678 3300013296 Ga0157374_10105303 Ga0157374_101053032 273
1679 3300013306 Ga0163162_10128458 Ga0163162_101284583 273
1680 3300013308 Ga0157375_10039237 Ga0157375_100392374 273
1681 3300014325 Ga0163163_10017489 Ga0163163_100174896 273
1682 3300014325 Ga0163163_10046941 Ga0163163_100469413 273
1683 3300014326 Ga0157380_10022136 Ga0157380_100221366 273
1684 3300014968 Ga0157379_10272658 Ga0157379_102726581 273
1685 3300014968 Ga0157379_10483455 Ga0157379_104834552 273
1686 3300014969 Ga0157376_10278371 Ga0157376_102783712 273
1687 3300017792 Ga0163161_10039168 Ga0163161_100391685 273
1688 3300021384 Ga0213876_10042285 Ga0213876_100422853 273
1689 3300025321 Ga0207656_10019037 Ga0207656_100190371 273
1690 3300025900 Ga0207710_10017802 Ga0207710_100178024 273
1691 3300025901 Ga0207688_10000881 Ga0207688_1000088115 273
1692 3300025901 Ga0207688_10170247 Ga0207688_101702472 273
1693 3300025903 Ga0207680_10003962 Ga0207680_100039625 273
1694 3300025904 Ga0207647_10047610 Ga0207647_100476103 273
1695 3300025908 Ga0207643_10044142 Ga0207643_100441421 273
1696 3300025911 Ga0207654_10157774 Ga0207654_101577742 273
1697 3300025915 Ga0207693_10051743 Ga0207693_100517434 273
1698 3300025916 Ga0207663_10125232 Ga0207663_101252322 273
1699 3300025918 Ga0207662_10000948 Ga0207662_1000094813 273
1700 3300025918 Ga0207662_10081795 Ga0207662_100817951 273
1701 3300025919 Ga0207657_10067846 Ga0207657_100678463 273
1702 3300025919 Ga0207657_10089414 Ga0207657_100894143 273
1703 3300025920 Ga0207649_10036183 Ga0207649_100361832 273
1704 3300025923 Ga0207681_10183774 Ga0207681_101837742 273
1705 3300025923 Ga0207681_10475094 Ga0207681_104750941 273
1706 3300025924 Ga0207694_10136436 Ga0207694_101364363 273
1707 3300025925 Ga0207650_10167415 Ga0207650_101674153 273
1708 3300025925 Ga0207650_10352665 Ga0207650_103526652 273
1709 3300025926 Ga0207659_10109562 Ga0207659_101095621 273
1710 3300025927 Ga0207687_10008125 Ga0207687_100081251 273
1711 3300025927 Ga0207687_10477608 Ga0207687_104776082 273
1712 3300025928 Ga0207700_10184038 Ga0207700_101840381 273
1713 3300025932 Ga0207690_10070123 Ga0207690_100701233 273
1714 3300025933 Ga0207706_10016119 Ga0207706_100161196 273
1715 3300025934 Ga0207686_10076834 Ga0207686_100768341 273
1716 3300025935 Ga0207709_10017540 Ga0207709_100175402 273
1717 3300025936 Ga0207670_10102406 Ga0207670_101024062 273
1718 3300025936 Ga0207670_10148665 Ga0207670_101486651 273
1719 3300025937 Ga0207669_10045017 Ga0207669_100450172 273
1720 3300025938 Ga0207704_10048507 Ga0207704_100485071 273
1721 3300025940 Ga0207691_10002396 Ga0207691_100023967 273
1722 3300025941 Ga0207711_10004447 Ga0207711_100044473 273
1723 3300025942 Ga0207689_10002971 Ga0207689_1000297115 273
1724 3300025945 Ga0207679_10012758 Ga0207679_100127583 273
1725 3300025960 Ga0207651_10032914 Ga0207651_100329145 273
1726 3300025961 Ga0207712_10126556 Ga0207712_101265562 273
1727 3300025972 Ga0207668_10092027 Ga0207668_100920272 273
1728 3300025981 Ga0207640_10124525 Ga0207640_101245252 273
1729 3300026023 Ga0207677_10015387 Ga0207677_100153871 273
1730 3300026035 Ga0207703_10007803 Ga0207703_100078034 273
1731 3300026035 Ga0207703_10369561 Ga0207703_103695612 273
1732 3300026041 Ga0207639_10210546 Ga0207639_102105463 273
1733 3300026067 Ga0207678_10032254 Ga0207678_100322545 273
1734 3300026075 Ga0207708_10021777 Ga0207708_100217773 273
1735 3300026088 Ga0207641_10116629 Ga0207641_101166292 273
1736 3300026089 Ga0207648_10005710 Ga0207648_100057107 273
1737 3300026095 Ga0207676_10002836 Ga0207676_100028368 273
1738 3300026095 Ga0207676_10246476 Ga0207676_102464762 273
1739 3300026118 Ga0207675_100004191 Ga0207675_1000041914 273
1740 3300026142 Ga0207698_10206254 Ga0207698_102062541 273
1741 3300027907 Ga0207428_10355749 Ga0207428_103557491 273
1742 3300028379 Ga0268266_10061600 Ga0268266_100616003 273
1743 3300028379 Ga0268266_10542742 Ga0268266_105427422 273
1744 3300028380 Ga0268265_10302611 Ga0268265_103026112 273
1745 3300028381 Ga0268264_10019150 Ga0268264_100191502 273
1746 3300031238 Ga0265332_10000910 Ga0265332_1000091016 273
1747 3300031249 Ga0265339_10012275 Ga0265339_100122754 273
1748 3300031711 Ga0265314_10036923 Ga0265314_100369233 273
1749 3300031712 Ga0265342_10000146 Ga0265342_1000014667 273
1750 3300035084 Ga0373928_0047100 Ga0373928_0047100_133_960 273
1751 3300035089 Ga0373944_0011106 Ga0373944_0011106_1084_1914 273
1752 3300035113 Ga0373936_0021334 Ga0373936_0021334_1051_1881 273
1753 3300035116 Ga0373945_0005613 Ga0373945_0005613_528_1358 273
1754 3300035170 Ga0373943_0000209 Ga0373943_0000209_16660_17490 273
1755 3300035171 Ga0373946_0000216 Ga0373946_0000216_13677_14507 273
1756 3300035242 Ga0373962_0100762 Ga0373962_0100762_11_838 273
1757 3300035691 Ga0373931_0271151 Ga0373931_0271151_181_1002 273
1758 3300035692 Ga0373935_0037058 Ga0373935_0037058_1502_2332 273
1759 3300035692 Ga0373935_0042240 Ga0373935_0042240_404_1234 273
1760 3300035695 Ga0373927_0003567 Ga0373927_0003567_7045_7875 273
1761 3300035695 Ga0373927_0011896 Ga0373927_0011896_3461_4291 273
1762 3300035725 Ga0373947_0000365 Ga0373947_0000365_15016_15846 273
1763 3300035725 Ga0373947_0023554 Ga0373947_0023554_1681_2511 273
1764 3300035725 Ga0373947_0045411 Ga0373947_0045411_390_1217 273
1765 3300037068 Ga0373925_0001465 Ga0373925_0001465_13723_14553 273
1766 3300037068 Ga0373925_0142520 Ga0373925_0142520_1011_1838 273
1767 3300037418 Ga0395900_0146307 Ga0395900_0146307_936_1757 273
1768 3300038443 Ga0395901_0120912 Ga0395901_0120912_1194_2015 273
1769 3300039437 Ga0436365_1689635 Ga0436365_1689635_234_1055 273
1770 3300046454 Ga0495592_0296730 Ga0495592_0296730_31_873 273
1771 3300046460 Ga0495638_0014704 Ga0495638_0014704_37_858 273
1772 3300046472 Ga0495580_0002900 Ga0495580_0002900_2204_3034 273
1773 3300046473 Ga0495582_0087153 Ga0495582_0087153_207_1028 273
1774 3300046474 Ga0495605_0121668 Ga0495605_0121668_328_1170 273
1775 3300046475 Ga0495639_0069438 Ga0495639_0069438_585_1415 273
1776 3300046476 Ga0495662_0028884 Ga0495662_0028884_862_1692 273
1777 3300046476 Ga0495662_0169166 Ga0495662_0169166_160_987 273
1778 3300046477 Ga0495664_0000814 Ga0495664_0000814_6301_7131 273
1779 3300046514 Ga0495618_0000996 Ga0495618_0000996_17341_18171 273
1780 3300046514 Ga0495618_0339685 Ga0495618_0339685_44_874 273
1781 3300046516 Ga0495628_0155210 Ga0495628_0155210_176_1006 273
1782 3300046517 Ga0495630_0003083 Ga0495630_0003083_8164_8994 273
1783 3300046517 Ga0495630_0042458 Ga0495630_0042458_1252_2082 273
1784 3300046517 Ga0495630_0100353 Ga0495630_0100353_376_1197 273
1785 3300046520 Ga0495637_0069554 Ga0495637_0069554_514_1356 273
1786 3300046526 Ga0495666_0156427 Ga0495666_0156427_28_858 273
1787 3300046529 Ga0495652_0019698 Ga0495652_0019698_910_1740 273
1788 3300046531 Ga0495665_0003072 Ga0495665_0003072_1715_2545 273
1789 3300046531 Ga0495665_0054702 Ga0495665_0054702_522_1352 273
1790 3300046531 Ga0495665_0058547 Ga0495665_0058547_1101_1931 273
1791 3300046533 Ga0495640_0007360 Ga0495640_0007360_5502_6332 273
1792 3300046533 Ga0495640_0032197 Ga0495640_0032197_2879_3709 273
1793 3300046535 Ga0495586_0020580 Ga0495586_0020580_989_1819 273
1794 3300046539 Ga0495621_0043196 Ga0495621_0043196_519_1361 273
1795 3300046543 Ga0495645_0027733 Ga0495645_0027733_2348_3178 273
1796 3300046559 Ga0495667_0088532 Ga0495667_0088532_862_1689 273
1797 3300046642 Ga0495634_0005439 Ga0495634_0005439_6971_7801 273
1798 3300046642 Ga0495634_0006407 Ga0495634_0006407_5365_6195 273
1799 3300046648 Ga0495611_0091944 Ga0495611_0091944_490_1332 273
1800 3300046663 Ga0495635_0008986 Ga0495635_0008986_1513_2343 273
1801 3300046663 Ga0495635_0145957 Ga0495635_0145957_164_991 273
1802 3300046683 Ga0495658_0329953 Ga0495658_0329953_52_882 273
1803 3300046684 Ga0495669_0044918 Ga0495669_0044918_563_1405 273
1804 3300046689 Ga0495613_0037492 Ga0495613_0037492_1376_2203 273
1805 3300046689 Ga0495613_0042847 Ga0495613_0042847_1025_1855 273
1806 3300046690 Ga0495624_0004405 Ga0495624_0004405_4610_5440 273
1807 3300047315 Ga0495581_0007762 Ga0495581_0007762_1438_2268 273
1808 3300047315 Ga0495581_0022637 Ga0495581_0022637_2639_3469 273
1809 3300047315 Ga0495581_0060666 Ga0495581_0060666_1308_2129 273
1810 3300047317 Ga0495604_0164754 Ga0495604_0164754_461_1291 273
1811 3300047319 Ga0495674_0000267 Ga0495674_0000267_4049_4879 273
1812 3300047319 Ga0495674_0149677 Ga0495674_0149677_922_1749 273
1813 3300047320 Ga0495672_0132500 Ga0495672_0132500_146_967 273
1814 3300047321 Ga0495676_0091423 Ga0495676_0091423_1085_1915 273
1815 3300047471 Ga0495684_0005380 Ga0495684_0005380_7424_8254 273
1816 3300047471 Ga0495684_0097564 Ga0495684_0097564_212_1042 273
1817 3300047673 Ga0495593_0006737 Ga0495593_0006737_4447_5277 273
1818 3300048903 Ga0496100_0006540 Ga0496100_0006540_2221_3105 273
1819 3300048904 Ga0496101_0001315 Ga0496101_0001315_2903_3787 273
1820 3300048905 Ga0496102_0058141 Ga0496102_0058141_2525_3409 273
1821 3300048905 Ga0496102_0058840 Ga0496102_0058840_129_956 273
1822 3300048906 Ga0496103_0002582 Ga0496103_0002582_3580_4464 273
1823 3300048906 Ga0496103_0051744 Ga0496103_0051744_1034_1855 273
1824 3300048907 Ga0496104_0002038 Ga0496104_0002038_13835_14662 273
1825 3300048907 Ga0496104_0032924 Ga0496104_0032924_3130_4014 273
1826 3300048908 Ga0496105_0003200 Ga0496105_0003200_8041_8925 273
1827 3300048908 Ga0496105_0012407 Ga0496105_0012407_5720_6547 273
1828 3300048909 Ga0496106_0006158 Ga0496106_0006158_6019_6903 273
1829 3300048910 Ga0496107_0000537 Ga0496107_0000537_8098_8982 273
1830 3300048910 Ga0496107_0091491 Ga0496107_0091491_135_956 273
1831 3300048911 Ga0496108_0018111 Ga0496108_0018111_4631_5515 273
1832 3300048911 Ga0496108_0025662 Ga0496108_0025662_2533_3360 273
1833 3300048912 Ga0496109_0007320 Ga0496109_0007320_7191_8075 273
1834 3300048912 Ga0496109_0055426 Ga0496109_0055426_178_1005 273
1835 3300048913 Ga0496110_0005109 Ga0496110_0005109_948_1784 273
1836 3300048913 Ga0496110_0047695 Ga0496110_0047695_2620_3504 273
1837 3300048913 Ga0496110_0387450 Ga0496110_0387450_103_924 273
1838 3300048914 Ga0496111_0000797 Ga0496111_0000797_1372_2256 273
1839 3300048915 Ga0496112_0005033 Ga0496112_0005033_11_838 273
1840 3300048915 Ga0496112_0010105 Ga0496112_0010105_5265_6149 273
1841 3300048916 Ga0496113_0000104 Ga0496113_0000104_33236_34063 273
1842 3300048916 Ga0496113_0004791 Ga0496113_0004791_891_1775 273
1843 3300048917 Ga0496114_0238901 Ga0496114_0238901_186_1013 273
1844 3300048917 Ga0496114_0279228 Ga0496114_0279228_361_1203 273
1845 3300048918 Ga0496115_0011629 Ga0496115_0011629_4957_5841 273
1846 3300048918 Ga0496115_0377426 Ga0496115_0377426_284_1111 273
1847 3300049569 Ga0501032_0031972 Ga0501032_0031972_732_1553 273
1848 3300049569 Ga0501032_0159647 Ga0501032_0159647_639_1460 273
1849 3300049570 Ga0501033_0020232 Ga0501033_0020232_343_1167 273
1850 3300049570 Ga0501033_0062652 Ga0501033_0062652_270_1091 273
1851 3300049570 Ga0501033_0274779 Ga0501033_0274779_74_895 273
1852 3300049571 Ga0501034_0008639 Ga0501034_0008639_7488_8312 273
1853 3300049571 Ga0501034_0136543 Ga0501034_0136543_98_922 273
1854 3300049571 Ga0501034_0187086 Ga0501034_0187086_1060_1881 273
1855 3300049571 Ga0501034_0196037 Ga0501034_0196037_662_1483 273
1856 3300049571 Ga0501034_0211117 Ga0501034_0211117_191_1012 273
1857 3300049572 Ga0501036_0003373 Ga0501036_0003373_8112_8936 273
1858 3300049572 Ga0501036_0017490 Ga0501036_0017490_4455_5276 273
1859 3300049572 Ga0501036_0087633 Ga0501036_0087633_157_981 273
1860 3300049573 Ga0501037_0048981 Ga0501037_0048981_1744_2565 273
1861 3300049573 Ga0501037_0100601 Ga0501037_0100601_122_946 273
1862 3300049573 Ga0501037_0119962 Ga0501037_0119962_917_1738 273
1863 3300049574 Ga0501038_0012909 Ga0501038_0012909_6739_7560 273
1864 3300049574 Ga0501038_0026739 Ga0501038_0026739_1456_2277 273
1865 3300049574 Ga0501038_0108493 Ga0501038_0108493_314_1135 273
1866 3300049574 Ga0501038_0260926 Ga0501038_0260926_13_837 273
1867 3300049574 Ga0501038_0437177 Ga0501038_0437177_83_904 273
1868 3300049576 Ga0501040_0096153 Ga0501040_0096153_783_1604 273
1869 3300049576 Ga0501040_0120120 Ga0501040_0120120_309_1130 273
1870 3300049579 Ga0501043_0009122 Ga0501043_0009122_5128_5949 273
1871 3300049580 Ga0501046_0010978 Ga0501046_0010978_2016_2837 273
1872 3300049580 Ga0501046_0073455 Ga0501046_0073455_438_1259 273
1873 3300049581 Ga0501047_0000228 Ga0501047_0000228_45899_46723 273
1874 3300049581 Ga0501047_0025685 Ga0501047_0025685_2749_3573 273
1875 3300049582 Ga0501048_0000331 Ga0501048_0000331_13925_14749 273
1876 3300049584 Ga0501068_0003377 Ga0501068_0003377_1936_2757 273
1877 3300049584 Ga0501068_0003420 Ga0501068_0003420_907_1728 273
1878 3300049586 Ga0501070_0012830 Ga0501070_0012830_3458_4282 273
1879 3300049586 Ga0501070_0014246 Ga0501070_0014246_3143_3967 273
1880 3300049586 Ga0501070_0071103 Ga0501070_0071103_398_1219 273
1881 3300049586 Ga0501070_0131097 Ga0501070_0131097_41_862 273
1882 3300049586 Ga0501070_0549747 Ga0501070_0549747_83_907 273
1883 3300049587 Ga0501071_0098601 Ga0501071_0098601_400_1245 273
1884 3300049588 Ga0501072_0074478 Ga0501072_0074478_1779_2600 273
1885 3300049589 Ga0501073_0018457 Ga0501073_0018457_3796_4617 273
1886 3300049590 Ga0501074_0102810 Ga0501074_0102810_1071_1892 273
1887 3300049591 Ga0501075_0171507 Ga0501075_0171507_16_837 273
1888 3300049593 Ga0501077_0033066 Ga0501077_0033066_1076_1897 273
1889 3300049741 Ga0501079_0084729 Ga0501079_0084729_502_1323 273
1890 3300049741 Ga0501079_0310709 Ga0501079_0310709_342_1163 273
1891 3300049741 Ga0501079_0383821 Ga0501079_0383821_48_869 273
1892 3300049742 Ga0501080_0001137 Ga0501080_0001137_3431_4255 273
1893 3300049742 Ga0501080_0015938 Ga0501080_0015938_885_1706 273
1894 3300049742 Ga0501080_0267177 Ga0501080_0267177_203_1024 273
1895 3300049744 Ga0501083_0025094 Ga0501083_0025094_119_943 273
1896 3300049822 Ga0501035_0034511 Ga0501035_0034511_1564_2385 273
1897 3300049823 Ga0501044_0006495 Ga0501044_0006495_8741_9565 273
1898 3300049823 Ga0501044_0010842 Ga0501044_0010842_6177_7001 273
1899 3300049823 Ga0501044_0606439 Ga0501044_0606439_60_884 273
1900 3300050489 nmdc:mga03683_17711_c1 nmdc:mga03683_17711_c1_144_965 273
1901 3300050491 nmdc:mga00v17_22699_c1 nmdc:mga00v17_22699_c1_2231_3052 273
1902 3300050491 nmdc:mga00v17_95613_c1 nmdc:mga00v17_95613_c1_819_1661 273
1903 3300050492 nmdc:mga0yw44_10927_c1 nmdc:mga0yw44_10927_c1_2883_3704 273
1904 3300050492 nmdc:mga0yw44_15015_c1 nmdc:mga0yw44_15015_c1_2602_3444 273
1905 3300050492 nmdc:mga0yw44_86857_c1 nmdc:mga0yw44_86857_c1_896_1738 273
1906 3300050496 nmdc:mga07m45_101116_c1 nmdc:mga07m45_101116_c1_315_1136 273
1907 3300050507 nmdc:mga05p37_131667_c1 nmdc:mga05p37_131667_c1_1051_1872 273
1908 3300050507 nmdc:mga05p37_183765_c1 nmdc:mga05p37_183765_c1_1542_2363 273
1909 3300050507 nmdc:mga05p37_4180_c1 nmdc:mga05p37_4180_c1_7993_8820 273
1910 3300050510 nmdc:mga06r32_232775_c1 nmdc:mga06r32_232775_c1_438_1265 273
1911 3300050510 nmdc:mga06r32_234900_c1 nmdc:mga06r32_234900_c1_366_1187 273
1912 3300050512 nmdc:mga0n895_76894_c1 nmdc:mga0n895_76894_c1_233_1060 273
1913 3300050513 nmdc:mga0rr50_193567_c1 nmdc:mga0rr50_193567_c1_501_1337 273
1914 3300053077 Ga0495601_0005176 Ga0495601_0005176_5652_6482 273
1915 3300053078 Ga0495612_0000306 Ga0495612_0000306_18741_19571 273
1916 3300053079 Ga0500610_0104204 Ga0500610_0104204_520_1341 273
1917 3300053084 Ga0495595_0033968 Ga0495595_0033968_404_1231 273
1918 3300053084 Ga0495595_0110988 Ga0495595_0110988_478_1308 273
1919 3300053085 Ga0495619_0049686 Ga0495619_0049686_609_1436 273
1920 3300053085 Ga0495619_0056407 Ga0495619_0056407_664_1494 273
1921 3300053085 Ga0495619_0062165 Ga0495619_0062165_1144_1974 273
1922 3300053085 Ga0495619_0106556 Ga0495619_0106556_291_1121 273
1923 3300060353 Ga0501082_0155204 Ga0501082_0155204_195_1016 273
1924 3300060353 Ga0501082_0332185 Ga0501082_0332185_159_980 273
1925 3300060353 Ga0501082_0526761 Ga0501082_0526761_96_917 273
1926 3300003203 JGI25406J46586_10000165 JGI25406J46586_1000016511 274
1927 3300003203 JGI25406J46586_10000169 JGI25406J46586_100001698 274
1928 3300005340 Ga0070689_100087092 Ga0070689_1000870922 274
1929 3300005353 Ga0070669_100287215 Ga0070669_1002872151 274
1930 3300005356 Ga0070674_100147701 Ga0070674_1001477012 274
1931 3300005367 Ga0070667_100307003 Ga0070667_1003070032 274
1932 3300005435 Ga0070714_100032451 Ga0070714_1000324518 274
1933 3300005437 Ga0070710_10126217 Ga0070710_101262172 274
1934 3300005466 Ga0070685_10062381 Ga0070685_100623812 274
1935 3300005530 Ga0070679_100097897 Ga0070679_1000978973 274
1936 3300005544 Ga0070686_100332265 Ga0070686_1003322651 274
1937 3300005549 Ga0070704_100021004 Ga0070704_1000210044 274
1938 3300005618 Ga0068864_100075961 Ga0068864_1000759611 274
1939 3300005844 Ga0068862_100213878 Ga0068862_1002138782 274
1940 3300005937 Ga0081455_10004892 Ga0081455_1000489214 274
1941 3300005937 Ga0081455_10317684 Ga0081455_103176841 274
1942 3300005985 Ga0081539_10000255 Ga0081539_1000025555 274
1943 3300006051 Ga0075364_10091084 Ga0075364_100910842 274
1944 3300006163 Ga0070715_10021216 Ga0070715_100212163 274
1945 3300006175 Ga0070712_100113042 Ga0070712_1001130422 274
1946 3300006844 Ga0075428_100011698 Ga0075428_10001169812 274
1947 3300006844 Ga0075428_100487337 Ga0075428_1004873371 274
1948 3300006844 Ga0075428_100697007 Ga0075428_1006970071 274
1949 3300006846 Ga0075430_100040340 Ga0075430_1000403403 274
1950 3300006846 Ga0075430_100061692 Ga0075430_1000616923 274
1951 3300006846 Ga0075430_100387236 Ga0075430_1003872362 274
1952 3300006847 Ga0075431_100000053 Ga0075431_10000005353 274
1953 3300006847 Ga0075431_100014358 Ga0075431_1000143586 274
1954 3300006847 Ga0075431_100270486 Ga0075431_1002704862 274
1955 3300006871 Ga0075434_100081291 Ga0075434_1000812913 274
1956 3300006880 Ga0075429_100006001 Ga0075429_10000600113 274
1957 3300006914 Ga0075436_100138309 Ga0075436_1001383091 274
1958 3300007076 Ga0075435_100052351 Ga0075435_1000523513 274
1959 3300007265 Ga0099794_10135576 Ga0099794_101355762 274
1960 3300007788 Ga0099795_10017225 Ga0099795_100172253 274
1961 3300009094 Ga0111539_10018523 Ga0111539_1001852310 274
1962 3300009094 Ga0111539_10058480 Ga0111539_100584802 274
1963 3300009094 Ga0111539_11058000 Ga0111539_110580001 274
1964 3300009147 Ga0114129_10000237 Ga0114129_100002374 274
1965 3300009147 Ga0114129_10197471 Ga0114129_101974713 274
1966 3300009147 Ga0114129_10662038 Ga0114129_106620382 274
1967 3300009148 Ga0105243_10245424 Ga0105243_102454242 274
1968 3300011119 Ga0105246_10058128 Ga0105246_100581281 274
1969 3300013105 Ga0157369_10223031 Ga0157369_102230312 274
1970 3300013306 Ga0163162_10360712 Ga0163162_103607122 274
1971 3300014325 Ga0163163_10439922 Ga0163163_104399222 274
1972 3300025297 Ga0209758_1002012 Ga0209758_100201213 274
1973 3300025911 Ga0207654_10355604 Ga0207654_103556041 274
1974 3300025927 Ga0207687_10344062 Ga0207687_103440621 274
1975 3300025933 Ga0207706_10167736 Ga0207706_101677362 274
1976 3300025935 Ga0207709_10173341 Ga0207709_101733412 274
1977 3300025937 Ga0207669_10017820 Ga0207669_100178203 274
1978 3300025937 Ga0207669_10163585 Ga0207669_101635852 274
1979 3300025940 Ga0207691_10025977 Ga0207691_100259776 274
1980 3300025941 Ga0207711_10289889 Ga0207711_102898891 274
1981 3300025961 Ga0207712_10151793 Ga0207712_101517932 274
1982 3300025961 Ga0207712_10188288 Ga0207712_101882882 274
1983 3300026041 Ga0207639_10265413 Ga0207639_102654132 274
1984 3300026088 Ga0207641_10466644 Ga0207641_104666442 274
1985 3300026121 Ga0207683_10005386 Ga0207683_100053862 274
1986 3300027512 Ga0209179_1001507 Ga0209179_10015073 274
1987 3300027907 Ga0207428_10017874 Ga0207428_100178747 274
1988 3300027907 Ga0207428_10049144 Ga0207428_100491442 274
1989 3300028380 Ga0268265_10191916 Ga0268265_101919162 274
1990 3300031238 Ga0265332_10014182 Ga0265332_100141823 274
1991 3300031238 Ga0265332_10028016 Ga0265332_100280163 274
1992 3300031240 Ga0265320_10004204 Ga0265320_1000420414 274
1993 3300031241 Ga0265325_10000697 Ga0265325_100006978 274
1994 3300031241 Ga0265325_10067784 Ga0265325_100677841 274
1995 3300031242 Ga0265329_10009039 Ga0265329_100090395 274
1996 3300031249 Ga0265339_10038245 Ga0265339_100382453 274
1997 3300031507 Ga0307509_10306767 Ga0307509_103067671 274
1998 3300031595 Ga0265313_10000041 Ga0265313_10000041103 274
1999 3300031595 Ga0265313_10072741 Ga0265313_100727412 274
2000 3300031595 Ga0265313_10105050 Ga0265313_101050502 274
2001 3300031712 Ga0265342_10059087 Ga0265342_100590872 274
2002 3300031712 Ga0265342_10068900 Ga0265342_100689002 274
2003 3300033180 Ga0307510_10068963 Ga0307510_100689634 274
2004 3300035113 Ga0373936_0000315 Ga0373936_0000315_14060_14899 274
2005 3300035118 Ga0373954_0043269 Ga0373954_0043269_933_1772 274
2006 3300035119 Ga0373956_0018744 Ga0373956_0018744_204_1043 274
2007 3300035170 Ga0373943_0007527 Ga0373943_0007527_2856_3695 274
2008 3300035171 Ga0373946_0001244 Ga0373946_0001244_5325_6164 274
2009 3300035172 Ga0373955_0042929 Ga0373955_0042929_1438_2277 274
2010 3300035410 Ga0373924_0000349 Ga0373924_0000349_66_905 274
2011 3300035691 Ga0373931_0230123 Ga0373931_0230123_14_838 274
2012 3300035692 Ga0373935_0000292 Ga0373935_0000292_4543_5382 274
2013 3300035695 Ga0373927_0020628 Ga0373927_0020628_1239_2078 274
2014 3300035695 Ga0373927_0105441 Ga0373927_0105441_501_1328 274
2015 3300035724 Ga0373933_0000518 Ga0373933_0000518_5032_5871 274
2016 3300035725 Ga0373947_0000379 Ga0373947_0000379_10402_11241 274
2017 3300036401 Ga0373937_0001710 Ga0373937_0001710_8526_9365 274
2018 3300036401 Ga0373937_0627728 Ga0373937_0627728_26_862 274
2019 3300037068 Ga0373925_0000018 Ga0373925_0000018_171267_172106 274
2020 3300037068 Ga0373925_0041952 Ga0373925_0041952_1998_2825 274
2021 3300039437 Ga0436365_0000552 Ga0436365_0000552_440_1264 274
2022 3300039437 Ga0436365_0780547 Ga0436365_0780547_655_1479 274
2023 3300039450 Ga0436363_0575052 Ga0436363_0575052_645_1469 274
2024 3300039453 Ga0436362_0838148 Ga0436362_0838148_15_839 274
2025 3300041408 Ga0439453_0003170 Ga0439453_0003170_426_1250 274
2026 3300042003 Ga0439443_017300 Ga0439443_017300_170_994 274
2027 3300042436 Ga0439435_0001488 Ga0439435_0001488_924_1748 274
2028 3300046454 Ga0495592_0000001 Ga0495592_0000001_36292_37131 274
2029 3300046455 Ga0495603_0030937 Ga0495603_0030937_275_1102 274
2030 3300046459 Ga0495629_0024988 Ga0495629_0024988_2662_3501 274
2031 3300046462 Ga0495651_0002430 Ga0495651_0002430_10255_11094 274
2032 3300046463 Ga0495653_0000092 Ga0495653_0000092_51291_52130 274
2033 3300046473 Ga0495582_0025155 Ga0495582_0025155_1977_2816 274
2034 3300046476 Ga0495662_0014931 Ga0495662_0014931_1027_1866 274
2035 3300046477 Ga0495664_0000001 Ga0495664_0000001_279230_280069 274
2036 3300046491 Ga0495584_0126197 Ga0495584_0126197_348_1172 274
2037 3300046507 Ga0495606_0002491 Ga0495606_0002491_7405_8232 274
2038 3300046511 Ga0495608_0000109 Ga0495608_0000109_4654_5493 274
2039 3300046514 Ga0495618_0000064 Ga0495618_0000064_22652_23491 274
2040 3300046516 Ga0495628_0000003 Ga0495628_0000003_110287_111126 274
2041 3300046517 Ga0495630_0000850 Ga0495630_0000850_13473_14312 274
2042 3300046523 Ga0495644_0074383 Ga0495644_0074383_145_969 274
2043 3300046529 Ga0495652_0000001 Ga0495652_0000001_547096_547935 274
2044 3300046533 Ga0495640_0000012 Ga0495640_0000012_189388_190227 274
2045 3300046536 Ga0495587_0000028 Ga0495587_0000028_53709_54548 274
2046 3300046543 Ga0495645_0000004 Ga0495645_0000004_172736_173575 274
2047 3300046559 Ga0495667_0000001 Ga0495667_0000001_387088_387927 274
2048 3300046642 Ga0495634_0000075 Ga0495634_0000075_66470_67309 274
2049 3300046663 Ga0495635_0000015 Ga0495635_0000015_189580_190419 274
2050 3300046675 Ga0495657_0000155 Ga0495657_0000155_38576_39415 274
2051 3300046678 Ga0495599_0000029 Ga0495599_0000029_22681_23520 274
2052 3300046679 Ga0495623_0000012 Ga0495623_0000012_4466_5305 274
2053 3300046680 Ga0495646_0000006 Ga0495646_0000006_234982_235821 274
2054 3300046683 Ga0495658_0054538 Ga0495658_0054538_1328_2155 274
2055 3300046689 Ga0495613_0180831 Ga0495613_0180831_424_1263 274
2056 3300046809 Ga0495600_0000286 Ga0495600_0000286_1167_2006 274
2057 3300047317 Ga0495604_0000091 Ga0495604_0000091_22748_23587 274
2058 3300047319 Ga0495674_0000001 Ga0495674_0000001_479167_480006 274
2059 3300047320 Ga0495672_0178828 Ga0495672_0178828_88_924 274
2060 3300047322 Ga0495680_0000489 Ga0495680_0000489_26507_27346 274
2061 3300047444 Ga0495675_0000113 Ga0495675_0000113_3827_4666 274
2062 3300047471 Ga0495684_0000055 Ga0495684_0000055_53774_54613 274
2063 3300047673 Ga0495593_0003290 Ga0495593_0003290_4608_5447 274
2064 3300048088 Ga0495602_0000002 Ga0495602_0000002_22710_23549 274
2065 3300048915 Ga0496112_0000016 Ga0496112_0000016_144572_145399 274
2066 3300048920 Ga0496117_0174387 Ga0496117_0174387_317_1144 274
2067 3300048921 Ga0496118_0049303 Ga0496118_0049303_98_925 274
2068 3300048921 Ga0496118_0148090 Ga0496118_0148090_133_960 274
2069 3300048922 Ga0496119_0075211 Ga0496119_0075211_476_1303 274
2070 3300048924 Ga0496121_0002834 Ga0496121_0002834_20779_21606 274
2071 3300048928 Ga0496125_0000092 Ga0496125_0000092_119373_120200 274
2072 3300048928 Ga0496125_0001341 Ga0496125_0001341_32713_33540 274
2073 3300049569 Ga0501032_0142313 Ga0501032_0142313_678_1502 274
2074 3300049570 Ga0501033_0030642 Ga0501033_0030642_1381_2205 274
2075 3300049571 Ga0501034_0082818 Ga0501034_0082818_728_1552 274
2076 3300049572 Ga0501036_0051586 Ga0501036_0051586_867_1691 274
2077 3300049573 Ga0501037_0016929 Ga0501037_0016929_3823_4647 274
2078 3300049574 Ga0501038_0009517 Ga0501038_0009517_4011_4835 274
2079 3300049581 Ga0501047_0009086 Ga0501047_0009086_3724_4548 274
2080 3300049586 Ga0501070_0019565 Ga0501070_0019565_2254_3078 274
2081 3300049586 Ga0501070_0229724 Ga0501070_0229724_415_1239 274
2082 3300049588 Ga0501072_0001711 Ga0501072_0001711_11335_12159 274
2083 3300049741 Ga0501079_0531435 Ga0501079_0531435_72_896 274
2084 3300049744 Ga0501083_0101911 Ga0501083_0101911_17_841 274
2085 3300049823 Ga0501044_0094692 Ga0501044_0094692_528_1352 274
2086 3300049823 Ga0501044_0180971 Ga0501044_0180971_696_1520 274
2087 3300049823 Ga0501044_0590499 Ga0501044_0590499_82_906 274
2088 3300050493 nmdc:mga0k408_115448_c1 nmdc:mga0k408_115448_c1_325_1149 274
2089 3300050507 nmdc:mga05p37_635_c1 nmdc:mga05p37_635_c1_17114_17938 274
2090 3300050508 nmdc:mga09592_135018_c1 nmdc:mga09592_135018_c1_1147_1971 274
2091 3300050508 nmdc:mga09592_4975_c1 nmdc:mga09592_4975_c1_9903_10727 274
2092 3300050508 nmdc:mga09592_542116_c1 nmdc:mga09592_542116_c1_96_920 274
2093 3300050509 nmdc:mga0qj67_4711_c1 nmdc:mga0qj67_4711_c1_8735_9559 274
2094 3300050509 nmdc:mga0qj67_57496_c1 nmdc:mga0qj67_57496_c1_1301_2125 274
2095 3300050510 nmdc:mga06r32_249043_c1 nmdc:mga06r32_249043_c1_413_1240 274
2096 3300050510 nmdc:mga06r32_566_c1 nmdc:mga06r32_566_c1_5959_6783 274
2097 3300050511 nmdc:mga08y16_134_c1 nmdc:mga08y16_134_c1_54044_54868 274
2098 3300050511 nmdc:mga08y16_17037_c1 nmdc:mga08y16_17037_c1_5892_6716 274
2099 3300050511 nmdc:mga08y16_199269_c1 nmdc:mga08y16_199269_c1_755_1582 274
2100 3300050512 nmdc:mga0n895_109586_c1 nmdc:mga0n895_109586_c1_31_858 274
2101 3300050512 nmdc:mga0n895_86278_c1 nmdc:mga0n895_86278_c1_1144_1971 274
2102 3300050513 nmdc:mga0rr50_21706_c1 nmdc:mga0rr50_21706_c1_2907_3734 274
2103 3300050513 nmdc:mga0rr50_515938_c1 nmdc:mga0rr50_515938_c1_50_874 274
2104 3300050515 nmdc:mga0a205_15686_c1 nmdc:mga0a205_15686_c1_2487_3314 274
2105 3300053077 Ga0495601_0000006 Ga0495601_0000006_319217_320056 274
2106 3300053078 Ga0495612_0000007 Ga0495612_0000007_4628_5467 274
2107 3300053080 Ga0500635_0006227 Ga0500635_0006227_474_1301 274
2108 3300053084 Ga0495595_0000051 Ga0495595_0000051_17275_18114 274
2109 3300053085 Ga0495619_0000027 Ga0495619_0000027_110475_111314 274
2110 3300053102 Ga0500554_012124 Ga0500554_012124_62_889 274
2111 3300053116 Ga0500592_014781 Ga0500592_014781_62_889 274
2112 3300053119 Ga0500595_016023 Ga0500595_016023_73_900 274
2113 3300053119 Ga0500595_022555 Ga0500595_022555_618_1445 274
2114 3300053140 Ga0500573_0001363 Ga0500573_0001363_1898_2734 274
2115 3300053140 Ga0500573_0004799 Ga0500573_0004799_1221_2072 274
2116 3300053142 Ga0500577_0000183 Ga0500577_0000183_10703_11530 274
2117 3300053150 Ga0500603_000278 Ga0500603_000278_841_1668 274
2118 3300053158 Ga0500627_0126281 Ga0500627_0126281_193_1020 274
2119 3300053178 Ga0500637_0067505 Ga0500637_0067505_56_883 274
2120 3300054114 Ga0501084_0403331 Ga0501084_0403331_61_885 274
2121 3300060353 Ga0501082_0000008 Ga0501082_0000008_37718_38542 274
2122 3300025261 Ga0209233_1017822 Ga0209233_10178223 275
2123 3300037853 Ga0436364_0410618 Ga0436364_0410618_14268_15107 275
2124 3300048913 Ga0496110_0042808 Ga0496110_0042808_459_1310 275
2125 3300049572 Ga0501036_0032301 Ga0501036_0032301_1008_1850 275
2126 3300049579 Ga0501043_0107704 Ga0501043_0107704_370_1212 275
2127 3300049579 Ga0501043_0364252 Ga0501043_0364252_221_1048 275
2128 3300049581 Ga0501047_0130434 Ga0501047_0130434_511_1353 275
2129 3300049586 Ga0501070_0074251 Ga0501070_0074251_1425_2267 275
2130 3300049586 Ga0501070_0287393 Ga0501070_0287393_443_1285 275
2131 3300049589 Ga0501073_0382526 Ga0501073_0382526_43_885 275
2132 3300049822 Ga0501035_0063571 Ga0501035_0063571_348_1190 275
2133 3300049823 Ga0501044_0152045 Ga0501044_0152045_290_1132 275
2134 3300049823 Ga0501044_0450393 Ga0501044_0450393_264_1091 275
2135 2209111006 2214911870 2213970504 276
2136 3300000041 ARcpr5oldR_c000058 ARcpr5oldR_00005813 276
2137 3300000042 ARSoilYngRDRAFT_c00199 ARSoilYngRDRAFT_001993 276
2138 3300000043 ARcpr5yngRDRAFT_c000188 ARcpr5yngRDRAFT_0001883 276
2139 3300000044 ARSoilOldRDRAFT_c000028 ARSoilOldRDRAFT_00002824 276
2140 3300000045 ARCol0oldRDRAFT_c00565 ARCol0oldRDRAFT_005653 276
2141 3300000652 ARCol0yngRDRAFT_1000057 ARCol0yngRDRAFT_100005712 276
2142 3300001430 JGI24032J14994_100133 JGI24032J14994_1001333 276
2143 3300001976 JGI24752J21851_1001260 JGI24752J21851_10012603 276
2144 3300001977 JGI24746J21847_1000137 JGI24746J21847_10001378 276
2145 3300001978 JGI24747J21853_1000013 JGI24747J21853_10000133 276
2146 3300001989 JGI24739J22299_10000400 JGI24739J22299_1000040011 276
2147 3300001990 JGI24737J22298_10000531 JGI24737J22298_100005318 276
2148 3300001990 JGI24737J22298_10002432 JGI24737J22298_100024325 276
2149 3300002070 JGI24750J21931_1000240 JGI24750J21931_10002409 276
2150 3300002073 JGI24745J21846_1000114 JGI24745J21846_10001147 276
2151 3300002074 JGI24748J21848_1000264 JGI24748J21848_10002644 276
2152 3300002075 JGI24738J21930_10002058 JGI24738J21930_100020582 276
2153 3300002076 JGI24749J21850_1003004 JGI24749J21850_10030042 276
2154 3300002076 JGI24749J21850_1007729 JGI24749J21850_10077291 276
2155 3300002077 JGI24744J21845_10006387 JGI24744J21845_100063872 276
2156 3300002126 JGI24035J26624_1000224 JGI24035J26624_10002244 276
2157 3300002155 JGI24033J26618_1000662 JGI24033J26618_10006623 276
2158 3300002239 JGI24034J26672_10001369 JGI24034J26672_100013693 276
2159 3300002244 JGI24742J22300_10000135 JGI24742J22300_100001358 276
2160 3300003911 JGI25405J52794_10002890 JGI25405J52794_100028903 276
2161 3300005276 Ga0065717_1002161 Ga0065717_10021611 276
2162 3300005277 Ga0065716_1002870 Ga0065716_10028702 276
2163 3300005290 Ga0065712_10001072 Ga0065712_100010727 276
2164 3300005290 Ga0065712_10006568 Ga0065712_100065683 276
2165 3300005293 Ga0065715_10000559 Ga0065715_1000055911 276
2166 3300005293 Ga0065715_10000988 Ga0065715_100009886 276
2167 3300005327 Ga0070658_10003419 Ga0070658_1000341913 276
2168 3300005327 Ga0070658_10052232 Ga0070658_100522323 276
2169 3300005327 Ga0070658_10072315 Ga0070658_100723155 276
2170 3300005328 Ga0070676_10000174 Ga0070676_1000017421 276
2171 3300005328 Ga0070676_10091025 Ga0070676_100910252 276
2172 3300005329 Ga0070683_100055976 Ga0070683_1000559763 276
2173 3300005329 Ga0070683_100179465 Ga0070683_1001794652 276
2174 3300005329 Ga0070683_100770555 Ga0070683_1007705551 276
2175 3300005330 Ga0070690_100000898 Ga0070690_10000089813 276
2176 3300005330 Ga0070690_100017757 Ga0070690_1000177571 276
2177 3300005331 Ga0070670_100035365 Ga0070670_1000353651 276
2178 3300005331 Ga0070670_100073543 Ga0070670_1000735433 276
2179 3300005333 Ga0070677_10000194 Ga0070677_100001947 276
2180 3300005334 Ga0068869_100000260 Ga0068869_10000026022 276
2181 3300005335 Ga0070666_10011624 Ga0070666_100116247 276
2182 3300005335 Ga0070666_10011732 Ga0070666_100117324 276
2183 3300005335 Ga0070666_10053643 Ga0070666_100536433 276
2184 3300005336 Ga0070680_100013955 Ga0070680_1000139558 276
2185 3300005336 Ga0070680_100016957 Ga0070680_1000169573 276
2186 3300005336 Ga0070680_100081515 Ga0070680_1000815152 276
2187 3300005336 Ga0070680_100124092 Ga0070680_1001240922 276
2188 3300005336 Ga0070680_100182287 Ga0070680_1001822872 276
2189 3300005337 Ga0070682_100000141 Ga0070682_10000014151 276
2190 3300005337 Ga0070682_100029121 Ga0070682_1000291213 276
2191 3300005338 Ga0068868_100004211 Ga0068868_1000042117 276
2192 3300005338 Ga0068868_100098559 Ga0068868_1000985593 276
2193 3300005339 Ga0070660_100000408 Ga0070660_10000040831 276
2194 3300005339 Ga0070660_100032982 Ga0070660_1000329825 276
2195 3300005339 Ga0070660_100150819 Ga0070660_1001508192 276
2196 3300005339 Ga0070660_100152049 Ga0070660_1001520492 276
2197 3300005340 Ga0070689_100000179 Ga0070689_10000017935 276
2198 3300005340 Ga0070689_100037080 Ga0070689_1000370802 276
2199 3300005341 Ga0070691_10000381 Ga0070691_1000038112 276
2200 3300005341 Ga0070691_10059778 Ga0070691_100597783 276
2201 3300005341 Ga0070691_10117334 Ga0070691_101173342 276
2202 3300005343 Ga0070687_100006870 Ga0070687_1000068704 276
2203 3300005343 Ga0070687_100113502 Ga0070687_1001135021 276
2204 3300005344 Ga0070661_100000898 Ga0070661_1000008986 276
2205 3300005344 Ga0070661_100037633 Ga0070661_1000376335 276
2206 3300005344 Ga0070661_100043723 Ga0070661_1000437233 276
2207 3300005345 Ga0070692_10000075 Ga0070692_1000007515 276
2208 3300005347 Ga0070668_100007936 Ga0070668_1000079365 276
2209 3300005347 Ga0070668_100380748 Ga0070668_1003807482 276
2210 3300005353 Ga0070669_100002705 Ga0070669_1000027057 276
2211 3300005354 Ga0070675_100000650 Ga0070675_10000065011 276
2212 3300005355 Ga0070671_100000690 Ga0070671_1000006906 276
2213 3300005355 Ga0070671_100006037 Ga0070671_10000603711 276
2214 3300005355 Ga0070671_100025121 Ga0070671_1000251212 276
2215 3300005356 Ga0070674_100001356 Ga0070674_10000135612 276
2216 3300005356 Ga0070674_100288010 Ga0070674_1002880102 276
2217 3300005364 Ga0070673_100000140 Ga0070673_10000014018 276
2218 3300005364 Ga0070673_100044060 Ga0070673_1000440602 276
2219 3300005365 Ga0070688_100001252 Ga0070688_10000125212 276
2220 3300005365 Ga0070688_100030387 Ga0070688_1000303872 276
2221 3300005366 Ga0070659_100003666 Ga0070659_1000036664 276
2222 3300005366 Ga0070659_100099191 Ga0070659_1000991912 276
2223 3300005366 Ga0070659_100203664 Ga0070659_1002036642 276
2224 3300005366 Ga0070659_100231999 Ga0070659_1002319992 276
2225 3300005366 Ga0070659_100346405 Ga0070659_1003464052 276
2226 3300005367 Ga0070667_100004745 Ga0070667_1000047454 276
2227 3300005367 Ga0070667_100107509 Ga0070667_1001075092 276
2228 3300005367 Ga0070667_100144438 Ga0070667_1001444382 276
2229 3300005406 Ga0070703_10002730 Ga0070703_100027303 276
2230 3300005434 Ga0070709_10022303 Ga0070709_100223032 276
2231 3300005435 Ga0070714_100002352 Ga0070714_1000023525 276
2232 3300005435 Ga0070714_100100977 Ga0070714_1001009771 276
2233 3300005435 Ga0070714_100120538 Ga0070714_1001205383 276
2234 3300005436 Ga0070713_100012353 Ga0070713_1000123532 276
2235 3300005436 Ga0070713_100061871 Ga0070713_1000618713 276
2236 3300005436 Ga0070713_100293961 Ga0070713_1002939611 276
2237 3300005437 Ga0070710_10034907 Ga0070710_100349073 276
2238 3300005438 Ga0070701_10000625 Ga0070701_100006254 276
2239 3300005438 Ga0070701_10064481 Ga0070701_100644811 276
2240 3300005439 Ga0070711_100112398 Ga0070711_1001123981 276
2241 3300005440 Ga0070705_100004136 Ga0070705_1000041367 276
2242 3300005441 Ga0070700_100013930 Ga0070700_1000139301 276
2243 3300005441 Ga0070700_100128649 Ga0070700_1001286492 276
2244 3300005444 Ga0070694_100000797 Ga0070694_10000079714 276
2245 3300005444 Ga0070694_100003678 Ga0070694_1000036786 276
2246 3300005445 Ga0070708_100453291 Ga0070708_1004532911 276
2247 3300005455 Ga0070663_100003209 Ga0070663_1000032097 276
2248 3300005455 Ga0070663_100014800 Ga0070663_1000148005 276
2249 3300005456 Ga0070678_100000125 Ga0070678_10000012512 276
2250 3300005457 Ga0070662_100006627 Ga0070662_1000066273 276
2251 3300005457 Ga0070662_100046587 Ga0070662_1000465873 276
2252 3300005457 Ga0070662_100143060 Ga0070662_1001430601 276
2253 3300005458 Ga0070681_10003210 Ga0070681_1000321011 276
2254 3300005458 Ga0070681_10070283 Ga0070681_100702833 276
2255 3300005458 Ga0070681_10232697 Ga0070681_102326972 276
2256 3300005459 Ga0068867_100000260 Ga0068867_10000026025 276
2257 3300005459 Ga0068867_100134170 Ga0068867_1001341702 276
2258 3300005466 Ga0070685_10000957 Ga0070685_1000095720 276
2259 3300005530 Ga0070679_100001673 Ga0070679_1000016733 276
2260 3300005530 Ga0070679_100066377 Ga0070679_1000663774 276
2261 3300005530 Ga0070679_100077347 Ga0070679_1000773474 276
2262 3300005530 Ga0070679_100152198 Ga0070679_1001521983 276
2263 3300005530 Ga0070679_100201165 Ga0070679_1002011653 276
2264 3300005530 Ga0070679_100322291 Ga0070679_1003222911 276
2265 3300005530 Ga0070679_100421267 Ga0070679_1004212672 276
2266 3300005530 Ga0070679_100505135 Ga0070679_1005051351 276
2267 3300005535 Ga0070684_100000145 Ga0070684_10000014534 276
2268 3300005535 Ga0070684_100074969 Ga0070684_1000749693 276
2269 3300005535 Ga0070684_100807923 Ga0070684_1008079231 276
2270 3300005536 Ga0070697_100430363 Ga0070697_1004303631 276
2271 3300005539 Ga0068853_100002655 Ga0068853_10000265514 276
2272 3300005539 Ga0068853_100638603 Ga0068853_1006386031 276
2273 3300005543 Ga0070672_100000307 Ga0070672_10000030713 276
2274 3300005543 Ga0070672_100071053 Ga0070672_1000710532 276
2275 3300005544 Ga0070686_100001373 Ga0070686_10000137311 276
2276 3300005544 Ga0070686_100018296 Ga0070686_1000182966 276
2277 3300005544 Ga0070686_100077584 Ga0070686_1000775842 276
2278 3300005545 Ga0070695_100004808 Ga0070695_1000048085 276
2279 3300005545 Ga0070695_100007987 Ga0070695_1000079874 276
2280 3300005545 Ga0070695_100154710 Ga0070695_1001547102 276
2281 3300005546 Ga0070696_100016423 Ga0070696_1000164234 276
2282 3300005546 Ga0070696_100242783 Ga0070696_1002427832 276
2283 3300005547 Ga0070693_100004447 Ga0070693_1000044476 276
2284 3300005547 Ga0070693_100010465 Ga0070693_1000104655 276
2285 3300005547 Ga0070693_100063637 Ga0070693_1000636372 276
2286 3300005548 Ga0070665_100105556 Ga0070665_1001055564 276
2287 3300005548 Ga0070665_100266074 Ga0070665_1002660742 276
2288 3300005549 Ga0070704_100000971 Ga0070704_10000097114 276
2289 3300005549 Ga0070704_100003196 Ga0070704_1000031967 276
2290 3300005549 Ga0070704_100127670 Ga0070704_1001276702 276
2291 3300005563 Ga0068855_100010074 Ga0068855_1000100748 276
2292 3300005563 Ga0068855_100045548 Ga0068855_1000455484 276
2293 3300005563 Ga0068855_100232873 Ga0068855_1002328733 276
2294 3300005564 Ga0070664_100001196 Ga0070664_10000119618 276
2295 3300005564 Ga0070664_100035333 Ga0070664_1000353335 276
2296 3300005564 Ga0070664_100058190 Ga0070664_1000581902 276
2297 3300005564 Ga0070664_100184368 Ga0070664_1001843682 276
2298 3300005577 Ga0068857_100007702 Ga0068857_10000770212 276
2299 3300005577 Ga0068857_100298575 Ga0068857_1002985752 276
2300 3300005578 Ga0068854_100019924 Ga0068854_1000199245 276
2301 3300005578 Ga0068854_100148738 Ga0068854_1001487381 276
2302 3300005614 Ga0068856_100001970 Ga0068856_10000197020 276
2303 3300005614 Ga0068856_100126899 Ga0068856_1001268992 276
2304 3300005614 Ga0068856_100164389 Ga0068856_1001643892 276
2305 3300005614 Ga0068856_100539635 Ga0068856_1005396351 276
2306 3300005615 Ga0070702_100000318 Ga0070702_10000031814 276
2307 3300005616 Ga0068852_100014756 Ga0068852_1000147567 276
2308 3300005616 Ga0068852_100034218 Ga0068852_1000342182 276
2309 3300005616 Ga0068852_100043249 Ga0068852_1000432492 276
2310 3300005616 Ga0068852_100214745 Ga0068852_1002147452 276
2311 3300005617 Ga0068859_100008171 Ga0068859_1000081715 276
2312 3300005617 Ga0068859_100029050 Ga0068859_1000290503 276
2313 3300005617 Ga0068859_100172295 Ga0068859_1001722953 276
2314 3300005618 Ga0068864_100005535 Ga0068864_1000055353 276
2315 3300005618 Ga0068864_100025377 Ga0068864_1000253777 276
2316 3300005718 Ga0068866_10002714 Ga0068866_100027144 276
2317 3300005719 Ga0068861_100007326 Ga0068861_1000073262 276
2318 3300005719 Ga0068861_100253136 Ga0068861_1002531363 276
2319 3300005834 Ga0068851_10030836 Ga0068851_100308364 276
2320 3300005834 Ga0068851_10053995 Ga0068851_100539952 276
2321 3300005840 Ga0068870_10000114 Ga0068870_1000011421 276
2322 3300005841 Ga0068863_100052497 Ga0068863_1000524976 276
2323 3300005841 Ga0068863_100367217 Ga0068863_1003672172 276
2324 3300005842 Ga0068858_100002190 Ga0068858_1000021905 276
2325 3300005842 Ga0068858_100081088 Ga0068858_1000810883 276
2326 3300005843 Ga0068860_100000550 Ga0068860_10000055023 276
2327 3300005843 Ga0068860_100051781 Ga0068860_1000517812 276
2328 3300005843 Ga0068860_100122832 Ga0068860_1001228323 276
2329 3300005843 Ga0068860_100126507 Ga0068860_1001265072 276
2330 3300005844 Ga0068862_100007745 Ga0068862_1000077456 276
2331 3300005844 Ga0068862_100068662 Ga0068862_1000686624 276
2332 3300005937 Ga0081455_10000237 Ga0081455_1000023730 276
2333 3300005937 Ga0081455_10001351 Ga0081455_100013516 276
2334 3300005937 Ga0081455_10044817 Ga0081455_100448173 276
2335 3300005983 Ga0081540_1057755 Ga0081540_10577552 276
2336 3300006028 Ga0070717_10003859 Ga0070717_100038598 276
2337 3300006163 Ga0070715_10037890 Ga0070715_100378903 276
2338 3300006175 Ga0070712_100071741 Ga0070712_1000717412 276
2339 3300006175 Ga0070712_100095593 Ga0070712_1000955933 276
2340 3300006178 Ga0075367_10007767 Ga0075367_100077677 276
2341 3300006194 Ga0075427_10000718 Ga0075427_100007184 276
2342 3300006237 Ga0097621_100000010 Ga0097621_1000000103 276
2343 3300006358 Ga0068871_100000034 Ga0068871_10000003468 276
2344 3300006358 Ga0068871_100025867 Ga0068871_1000258676 276
2345 3300006358 Ga0068871_100027389 Ga0068871_1000273895 276
2346 3300006844 Ga0075428_100372214 Ga0075428_1003722143 276
2347 3300006846 Ga0075430_100005198 Ga0075430_1000051989 276
2348 3300006847 Ga0075431_100024458 Ga0075431_1000244584 276
2349 3300006852 Ga0075433_10010531 Ga0075433_100105317 276
2350 3300006871 Ga0075434_100000565 Ga0075434_10000056532 276
2351 3300006871 Ga0075434_100016837 Ga0075434_1000168376 276
2352 3300006871 Ga0075434_100059853 Ga0075434_1000598536 276
2353 3300006871 Ga0075434_100123199 Ga0075434_1001231994 276
2354 3300006871 Ga0075434_100162138 Ga0075434_1001621381 276
2355 3300006880 Ga0075429_100004570 Ga0075429_10000457010 276
2356 3300006881 Ga0068865_100000258 Ga0068865_1000002584 276
2357 3300006881 Ga0068865_100012087 Ga0068865_1000120878 276
2358 3300006881 Ga0068865_100156784 Ga0068865_1001567842 276
2359 3300006914 Ga0075436_100068030 Ga0075436_1000680303 276
2360 3300006914 Ga0075436_100227166 Ga0075436_1002271661 276
2361 3300006914 Ga0075436_100336677 Ga0075436_1003366772 276
2362 3300006931 Ga0097620_100008171 Ga0097620_10000817111 276
2363 3300006931 Ga0097620_100029052 Ga0097620_1000290523 276
2364 3300006931 Ga0097620_100172302 Ga0097620_1001723023 276
2365 3300007076 Ga0075435_100029577 Ga0075435_1000295777 276
2366 3300009011 Ga0105251_10029443 Ga0105251_100294433 276
2367 3300009092 Ga0105250_10036422 Ga0105250_100364222 276
2368 3300009093 Ga0105240_10139463 Ga0105240_101394633 276
2369 3300009094 Ga0111539_10000500 Ga0111539_100005004 276
2370 3300009094 Ga0111539_10001486 Ga0111539_1000148613 276
2371 3300009094 Ga0111539_10003625 Ga0111539_1000362518 276
2372 3300009098 Ga0105245_10003131 Ga0105245_1000313110 276
2373 3300009098 Ga0105245_10256166 Ga0105245_102561661 276
2374 3300009101 Ga0105247_10002505 Ga0105247_100025051 276
2375 3300009101 Ga0105247_10010561 Ga0105247_100105615 276
2376 3300009101 Ga0105247_10099429 Ga0105247_100994292 276
2377 3300009147 Ga0114129_10033328 Ga0114129_100333286 276
2378 3300009148 Ga0105243_10016989 Ga0105243_100169894 276
2379 3300009148 Ga0105243_10088180 Ga0105243_100881803 276
2380 3300009148 Ga0105243_10169275 Ga0105243_101692752 276
2381 3300009174 Ga0105241_10001911 Ga0105241_100019118 276
2382 3300009174 Ga0105241_10370202 Ga0105241_103702021 276
2383 3300009176 Ga0105242_10000037 Ga0105242_1000003721 276
2384 3300009176 Ga0105242_10155344 Ga0105242_101553442 276
2385 3300009177 Ga0105248_10002195 Ga0105248_1000219512 276
2386 3300009545 Ga0105237_10063301 Ga0105237_100633012 276
2387 3300009551 Ga0105238_10023052 Ga0105238_100230528 276
2388 3300009551 Ga0105238_10096421 Ga0105238_100964213 276
2389 3300009551 Ga0105238_10124656 Ga0105238_101246563 276
2390 3300009551 Ga0105238_10129451 Ga0105238_101294513 276
2391 3300009553 Ga0105249_10000209 Ga0105249_1000020912 276
2392 3300009553 Ga0105249_10033836 Ga0105249_100338366 276
2393 3300009553 Ga0105249_10240650 Ga0105249_102406503 276
2394 3300009553 Ga0105249_10304666 Ga0105249_103046662 276
2395 3300010375 Ga0105239_10006977 Ga0105239_1000697710 276
2396 3300010375 Ga0105239_10009869 Ga0105239_100098699 276
2397 3300010375 Ga0105239_10028131 Ga0105239_100281315 276
2398 3300010375 Ga0105239_10194863 Ga0105239_101948632 276
2399 3300010375 Ga0105239_10358720 Ga0105239_103587202 276
2400 3300010375 Ga0105239_10430800 Ga0105239_104308001 276
2401 3300011119 Ga0105246_10000614 Ga0105246_1000061416 276
2402 3300011119 Ga0105246_10328221 Ga0105246_103282211 276
2403 3300012515 Ga0157338_1001045 Ga0157338_10010452 276
2404 3300013100 Ga0157373_10030942 Ga0157373_100309424 276
2405 3300013102 Ga0157371_10015657 Ga0157371_100156575 276
2406 3300013102 Ga0157371_10121499 Ga0157371_101214993 276
2407 3300013104 Ga0157370_10238146 Ga0157370_102381461 276
2408 3300013105 Ga0157369_10306067 Ga0157369_103060672 276
2409 3300013105 Ga0157369_10405496 Ga0157369_104054962 276
2410 3300013105 Ga0157369_10623480 Ga0157369_106234801 276
2411 3300013296 Ga0157374_10019131 Ga0157374_100191316 276
2412 3300013297 Ga0157378_10000566 Ga0157378_1000056625 276
2413 3300013306 Ga0163162_10000896 Ga0163162_1000089612 276
2414 3300013306 Ga0163162_10005353 Ga0163162_100053539 276
2415 3300013306 Ga0163162_10023128 Ga0163162_100231283 276
2416 3300013307 Ga0157372_10118899 Ga0157372_101188993 276
2417 3300013307 Ga0157372_10219645 Ga0157372_102196452 276
2418 3300013307 Ga0157372_10653491 Ga0157372_106534912 276
2419 3300013307 Ga0157372_10834172 Ga0157372_108341721 276
2420 3300013308 Ga0157375_10000263 Ga0157375_1000026316 276
2421 3300013308 Ga0157375_10040699 Ga0157375_100406995 276
2422 3300014325 Ga0163163_10052731 Ga0163163_100527311 276
2423 3300014325 Ga0163163_10299537 Ga0163163_102995372 276
2424 3300014325 Ga0163163_10497105 Ga0163163_104971052 276
2425 3300014326 Ga0157380_10001922 Ga0157380_1000192210 276
2426 3300014745 Ga0157377_10000214 Ga0157377_1000021429 276
2427 3300014745 Ga0157377_10106629 Ga0157377_101066292 276
2428 3300014968 Ga0157379_10000666 Ga0157379_1000066625 276
2429 3300014968 Ga0157379_10271196 Ga0157379_102711961 276
2430 3300014969 Ga0157376_10000879 Ga0157376_100008798 276
2431 3300017792 Ga0163161_10003116 Ga0163161_100031166 276
2432 3300017792 Ga0163161_10118372 Ga0163161_101183723 276
2433 3300017792 Ga0163161_10205959 Ga0163161_102059592 276
2434 3300020069 Ga0197907_10374128 Ga0197907_103741281 276
2435 3300020070 Ga0206356_10019253 Ga0206356_100192532 276
2436 3300020070 Ga0206356_11744201 Ga0206356_117442012 276
2437 3300022467 Ga0224712_10074973 Ga0224712_100749732 276
2438 3300025271 Ga0207666_1000010 Ga0207666_100001046 276
2439 3300025271 Ga0207666_1000379 Ga0207666_10003793 276
2440 3300025290 Ga0207673_1000091 Ga0207673_10000919 276
2441 3300025315 Ga0207697_10000424 Ga0207697_1000042410 276
2442 3300025315 Ga0207697_10005789 Ga0207697_100057896 276
2443 3300025321 Ga0207656_10082012 Ga0207656_100820122 276
2444 3300025711 Ga0207696_1023741 Ga0207696_10237413 276
2445 3300025885 Ga0207653_10007266 Ga0207653_100072663 276
2446 3300025893 Ga0207682_10000035 Ga0207682_1000003525 276
2447 3300025898 Ga0207692_10001776 Ga0207692_100017763 276
2448 3300025898 Ga0207692_10034699 Ga0207692_100346991 276
2449 3300025898 Ga0207692_10117796 Ga0207692_101177961 276
2450 3300025899 Ga0207642_10002311 Ga0207642_100023113 276
2451 3300025901 Ga0207688_10002888 Ga0207688_100028884 276
2452 3300025901 Ga0207688_10124428 Ga0207688_101244282 276
2453 3300025903 Ga0207680_10024905 Ga0207680_100249053 276
2454 3300025903 Ga0207680_10025139 Ga0207680_100251393 276
2455 3300025903 Ga0207680_10138629 Ga0207680_101386293 276
2456 3300025904 Ga0207647_10005370 Ga0207647_100053704 276
2457 3300025904 Ga0207647_10017164 Ga0207647_100171643 276
2458 3300025905 Ga0207685_10011259 Ga0207685_100112593 276
2459 3300025905 Ga0207685_10221766 Ga0207685_102217661 276
2460 3300025906 Ga0207699_10000837 Ga0207699_1000083716 276
2461 3300025906 Ga0207699_10288406 Ga0207699_102884061 276
2462 3300025907 Ga0207645_10005339 Ga0207645_1000533910 276
2463 3300025907 Ga0207645_10048611 Ga0207645_100486112 276
2464 3300025907 Ga0207645_10162128 Ga0207645_101621281 276
2465 3300025908 Ga0207643_10000147 Ga0207643_1000014721 276
2466 3300025911 Ga0207654_10001288 Ga0207654_1000128811 276
2467 3300025912 Ga0207707_10009366 Ga0207707_100093666 276
2468 3300025912 Ga0207707_10039324 Ga0207707_100393243 276
2469 3300025912 Ga0207707_10080096 Ga0207707_100800962 276
2470 3300025913 Ga0207695_10163070 Ga0207695_101630703 276
2471 3300025914 Ga0207671_10017241 Ga0207671_100172416 276
2472 3300025915 Ga0207693_10002714 Ga0207693_1000271418 276
2473 3300025915 Ga0207693_10005189 Ga0207693_1000518910 276
2474 3300025915 Ga0207693_10016626 Ga0207693_100166262 276
2475 3300025915 Ga0207693_10129901 Ga0207693_101299013 276
2476 3300025916 Ga0207663_10021096 Ga0207663_100210962 276
2477 3300025916 Ga0207663_10092998 Ga0207663_100929983 276
2478 3300025916 Ga0207663_10189864 Ga0207663_101898642 276
2479 3300025917 Ga0207660_10001257 Ga0207660_1000125710 276
2480 3300025917 Ga0207660_10055630 Ga0207660_100556302 276
2481 3300025917 Ga0207660_10121584 Ga0207660_101215842 276
2482 3300025917 Ga0207660_10125900 Ga0207660_101259002 276
2483 3300025917 Ga0207660_10190343 Ga0207660_101903432 276
2484 3300025918 Ga0207662_10006511 Ga0207662_100065114 276
2485 3300025918 Ga0207662_10036523 Ga0207662_100365232 276
2486 3300025919 Ga0207657_10007742 Ga0207657_1000774211 276
2487 3300025919 Ga0207657_10032905 Ga0207657_100329052 276
2488 3300025919 Ga0207657_10043825 Ga0207657_100438255 276
2489 3300025920 Ga0207649_10000585 Ga0207649_1000058520 276
2490 3300025920 Ga0207649_10349266 Ga0207649_103492662 276
2491 3300025921 Ga0207652_10006627 Ga0207652_100066272 276
2492 3300025921 Ga0207652_10047555 Ga0207652_100475552 276
2493 3300025921 Ga0207652_10085671 Ga0207652_100856714 276
2494 3300025921 Ga0207652_10145164 Ga0207652_101451642 276
2495 3300025921 Ga0207652_10168657 Ga0207652_101686573 276
2496 3300025921 Ga0207652_10409805 Ga0207652_104098051 276
2497 3300025921 Ga0207652_10545141 Ga0207652_105451411 276
2498 3300025923 Ga0207681_10002111 Ga0207681_1000211112 276
2499 3300025924 Ga0207694_10015318 Ga0207694_100153187 276
2500 3300025924 Ga0207694_10074045 Ga0207694_100740453 276
2501 3300025924 Ga0207694_10101058 Ga0207694_101010583 276
2502 3300025924 Ga0207694_10196832 Ga0207694_101968322 276
2503 3300025925 Ga0207650_10012089 Ga0207650_100120899 276
2504 3300025925 Ga0207650_10360305 Ga0207650_103603052 276
2505 3300025925 Ga0207650_10427307 Ga0207650_104273072 276
2506 3300025926 Ga0207659_10002165 Ga0207659_1000216510 276
2507 3300025927 Ga0207687_10000373 Ga0207687_100003733 276
2508 3300025927 Ga0207687_10005010 Ga0207687_100050102 276
2509 3300025928 Ga0207700_10000775 Ga0207700_100007751 276
2510 3300025929 Ga0207664_10003741 Ga0207664_100037419 276
2511 3300025929 Ga0207664_10209220 Ga0207664_102092203 276
2512 3300025929 Ga0207664_10306496 Ga0207664_103064961 276
2513 3300025931 Ga0207644_10009611 Ga0207644_100096115 276
2514 3300025931 Ga0207644_10055330 Ga0207644_100553303 276
2515 3300025931 Ga0207644_10217076 Ga0207644_102170762 276
2516 3300025932 Ga0207690_10021242 Ga0207690_100212424 276
2517 3300025932 Ga0207690_10038897 Ga0207690_100388972 276
2518 3300025933 Ga0207706_10008770 Ga0207706_1000877010 276
2519 3300025933 Ga0207706_10020035 Ga0207706_100200354 276
2520 3300025933 Ga0207706_10026140 Ga0207706_100261403 276
2521 3300025933 Ga0207706_10047431 Ga0207706_100474313 276
2522 3300025934 Ga0207686_10009442 Ga0207686_100094427 276
2523 3300025934 Ga0207686_10168759 Ga0207686_101687592 276
2524 3300025935 Ga0207709_10000374 Ga0207709_1000037440 276
2525 3300025935 Ga0207709_10021587 Ga0207709_100215873 276
2526 3300025935 Ga0207709_10125408 Ga0207709_101254082 276
2527 3300025936 Ga0207670_10007805 Ga0207670_100078053 276
2528 3300025936 Ga0207670_10128852 Ga0207670_101288522 276
2529 3300025937 Ga0207669_10000587 Ga0207669_1000058710 276
2530 3300025938 Ga0207704_10000119 Ga0207704_1000011913 276
2531 3300025938 Ga0207704_10114392 Ga0207704_101143922 276
2532 3300025939 Ga0207665_10000654 Ga0207665_1000065410 276
2533 3300025940 Ga0207691_10009502 Ga0207691_1000950210 276
2534 3300025940 Ga0207691_10047431 Ga0207691_100474315 276
2535 3300025941 Ga0207711_10004053 Ga0207711_100040532 276
2536 3300025941 Ga0207711_10006173 Ga0207711_100061733 276
2537 3300025941 Ga0207711_10240675 Ga0207711_102406753 276
2538 3300025941 Ga0207711_10292550 Ga0207711_102925502 276
2539 3300025942 Ga0207689_10002861 Ga0207689_1000286110 276
2540 3300025942 Ga0207689_10026454 Ga0207689_100264545 276
2541 3300025942 Ga0207689_10094496 Ga0207689_100944962 276
2542 3300025944 Ga0207661_10001255 Ga0207661_1000125511 276
2543 3300025944 Ga0207661_10153493 Ga0207661_101534933 276
2544 3300025944 Ga0207661_10709749 Ga0207661_107097491 276
2545 3300025945 Ga0207679_10000224 Ga0207679_100002249 276
2546 3300025945 Ga0207679_10125973 Ga0207679_101259731 276
2547 3300025945 Ga0207679_10334582 Ga0207679_103345821 276
2548 3300025949 Ga0207667_10053003 Ga0207667_100530035 276
2549 3300025949 Ga0207667_10075762 Ga0207667_100757622 276
2550 3300025949 Ga0207667_10132526 Ga0207667_101325264 276
2551 3300025949 Ga0207667_10393999 Ga0207667_103939991 276
2552 3300025960 Ga0207651_10000400 Ga0207651_1000040020 276
2553 3300025960 Ga0207651_10065661 Ga0207651_100656613 276
2554 3300025961 Ga0207712_10002420 Ga0207712_1000242010 276
2555 3300025961 Ga0207712_10072600 Ga0207712_100726002 276
2556 3300025961 Ga0207712_10102636 Ga0207712_101026362 276
2557 3300025972 Ga0207668_10000698 Ga0207668_1000069821 276
2558 3300025972 Ga0207668_10034833 Ga0207668_100348334 276
2559 3300025972 Ga0207668_10081745 Ga0207668_100817453 276
2560 3300025972 Ga0207668_10085169 Ga0207668_100851692 276
2561 3300025981 Ga0207640_10002531 Ga0207640_100025318 276
2562 3300025981 Ga0207640_10068098 Ga0207640_100680982 276
2563 3300025986 Ga0207658_10010812 Ga0207658_100108123 276
2564 3300025986 Ga0207658_10077886 Ga0207658_100778863 276
2565 3300026023 Ga0207677_10001410 Ga0207677_1000141011 276
2566 3300026035 Ga0207703_10001072 Ga0207703_1000107219 276
2567 3300026035 Ga0207703_10011414 Ga0207703_100114141 276
2568 3300026035 Ga0207703_10126880 Ga0207703_101268801 276
2569 3300026041 Ga0207639_10000756 Ga0207639_1000075617 276
2570 3300026041 Ga0207639_10132081 Ga0207639_101320812 276
2571 3300026067 Ga0207678_10002752 Ga0207678_1000275212 276
2572 3300026067 Ga0207678_10019314 Ga0207678_100193148 276
2573 3300026067 Ga0207678_10033690 Ga0207678_100336906 276
2574 3300026067 Ga0207678_10054803 Ga0207678_100548033 276
2575 3300026075 Ga0207708_10004096 Ga0207708_100040965 276
2576 3300026075 Ga0207708_10009115 Ga0207708_100091156 276
2577 3300026078 Ga0207702_10065778 Ga0207702_100657783 276
2578 3300026088 Ga0207641_10002800 Ga0207641_100028007 276
2579 3300026088 Ga0207641_10213424 Ga0207641_102134242 276
2580 3300026088 Ga0207641_10272044 Ga0207641_102720442 276
2581 3300026089 Ga0207648_10009523 Ga0207648_100095234 276
2582 3300026095 Ga0207676_10000347 Ga0207676_100003474 276
2583 3300026095 Ga0207676_10045167 Ga0207676_100451672 276
2584 3300026095 Ga0207676_10717307 Ga0207676_107173071 276
2585 3300026116 Ga0207674_10000608 Ga0207674_1000060846 276
2586 3300026116 Ga0207674_10203368 Ga0207674_102033682 276
2587 3300026116 Ga0207674_10277790 Ga0207674_102777902 276
2588 3300026116 Ga0207674_10315933 Ga0207674_103159332 276
2589 3300026118 Ga0207675_100003249 Ga0207675_10000324912 276
2590 3300026118 Ga0207675_100027599 Ga0207675_1000275994 276
2591 3300026121 Ga0207683_10000082 Ga0207683_1000008284 276
2592 3300026121 Ga0207683_10001639 Ga0207683_1000163923 276
2593 3300026121 Ga0207683_10008081 Ga0207683_1000808112 276
2594 3300026142 Ga0207698_10004048 Ga0207698_100040483 276
2595 3300026142 Ga0207698_10030646 Ga0207698_100306465 276
2596 3300026142 Ga0207698_10149564 Ga0207698_101495643 276
2597 3300026142 Ga0207698_10318487 Ga0207698_103184872 276
2598 3300027617 Ga0210002_1001110 Ga0210002_10011102 276
2599 3300027665 Ga0209983_1002766 Ga0209983_10027663 276
2600 3300027682 Ga0209971_1013067 Ga0209971_10130671 276
2601 3300027695 Ga0209966_1004480 Ga0209966_10044802 276
2602 3300027717 Ga0209998_10001378 Ga0209998_100013786 276
2603 3300027717 Ga0209998_10002981 Ga0209998_100029816 276
2604 3300027876 Ga0209974_10001218 Ga0209974_100012184 276
2605 3300027907 Ga0207428_10000256 Ga0207428_1000025625 276
2606 3300027907 Ga0207428_10000338 Ga0207428_1000033814 276
2607 3300027907 Ga0207428_10000804 Ga0207428_1000080420 276
2608 3300028379 Ga0268266_10680030 Ga0268266_106800301 276
2609 3300028380 Ga0268265_10003525 Ga0268265_1000352512 276
2610 3300028380 Ga0268265_10123681 Ga0268265_101236813 276
2611 3300028380 Ga0268265_10145857 Ga0268265_101458572 276
2612 3300028381 Ga0268264_10000762 Ga0268264_100007623 276
2613 3300028381 Ga0268264_10054648 Ga0268264_100546482 276
2614 3300028381 Ga0268264_10057752 Ga0268264_100577523 276
2615 3300028556 Ga0265337_1003113 Ga0265337_10031135 276
2616 3300028666 Ga0265336_10039639 Ga0265336_100396392 276
2617 3300028800 Ga0265338_10022745 Ga0265338_100227453 276
2618 3300031235 Ga0265330_10007596 Ga0265330_100075964 276
2619 3300031235 Ga0265330_10036189 Ga0265330_100361893 276
2620 3300031241 Ga0265325_10000105 Ga0265325_100001059 276
2621 3300031241 Ga0265325_10018514 Ga0265325_100185143 276
2622 3300031241 Ga0265325_10021929 Ga0265325_100219293 276
2623 3300031247 Ga0265340_10030315 Ga0265340_100303154 276
2624 3300031247 Ga0265340_10084741 Ga0265340_100847412 276
2625 3300031249 Ga0265339_10041543 Ga0265339_100415434 276
2626 3300031249 Ga0265339_10106439 Ga0265339_101064392 276
2627 3300031249 Ga0265339_10160008 Ga0265339_101600082 276
2628 3300031344 Ga0265316_10114960 Ga0265316_101149603 276
2629 3300031344 Ga0265316_10116690 Ga0265316_101166902 276
2630 3300031595 Ga0265313_10040269 Ga0265313_100402693 276
2631 3300031665 Ga0316575_10030297 Ga0316575_100302972 276
2632 3300031711 Ga0265314_10020944 Ga0265314_100209446 276
2633 3300031711 Ga0265314_10081817 Ga0265314_100818172 276
2634 3300031712 Ga0265342_10002975 Ga0265342_100029757 276
2635 3300031712 Ga0265342_10012876 Ga0265342_100128765 276
2636 3300034816 Ga0373930_0000013 Ga0373930_0000013_12002_12832 276
2637 3300034817 Ga0373948_0000118 Ga0373948_0000118_2987_3817 276
2638 3300034817 Ga0373948_0000496 Ga0373948_0000496_2588_3418 276
2639 3300034817 Ga0373948_0009819 Ga0373948_0009819_26_856 276
2640 3300034818 Ga0373950_0000691 Ga0373950_0000691_2019_2849 276
2641 3300034819 Ga0373958_0000188 Ga0373958_0000188_2320_3150 276
2642 3300034820 Ga0373959_0035136 Ga0373959_0035136_155_985 276
2643 3300034957 Ga0373938_0000083 Ga0373938_0000083_8954_9784 276
2644 3300034957 Ga0373938_0002057 Ga0373938_0002057_1264_2094 276
2645 3300035084 Ga0373928_0003067 Ga0373928_0003067_2232_3062 276
2646 3300035085 Ga0373929_0000068 Ga0373929_0000068_5352_6182 276
2647 3300035085 Ga0373929_0013157 Ga0373929_0013157_646_1476 276
2648 3300035086 Ga0373934_0001326 Ga0373934_0001326_1477_2307 276
2649 3300035086 Ga0373934_0043029 Ga0373934_0043029_141_971 276
2650 3300035089 Ga0373944_0012539 Ga0373944_0012539_1114_1944 276
2651 3300035089 Ga0373944_0104831 Ga0373944_0104831_36_866 276
2652 3300035090 Ga0373949_0000934 Ga0373949_0000934_1995_2825 276
2653 3300035090 Ga0373949_0002952 Ga0373949_0002952_2907_3737 276
2654 3300035090 Ga0373949_0010566 Ga0373949_0010566_388_1218 276
2655 3300035091 Ga0373951_0001301 Ga0373951_0001301_4753_5583 276
2656 3300035091 Ga0373951_0001345 Ga0373951_0001345_2799_3629 276
2657 3300035092 Ga0373952_0000414 Ga0373952_0000414_6447_7277 276
2658 3300035092 Ga0373952_0001711 Ga0373952_0001711_3014_3844 276
2659 3300035111 Ga0373923_0009654 Ga0373923_0009654_2180_3010 276
2660 3300035112 Ga0373932_0001138 Ga0373932_0001138_1290_2120 276
2661 3300035112 Ga0373932_0003121 Ga0373932_0003121_3013_3843 276
2662 3300035113 Ga0373936_0001160 Ga0373936_0001160_2188_3018 276
2663 3300035113 Ga0373936_0067954 Ga0373936_0067954_553_1383 276
2664 3300035114 Ga0373939_0002139 Ga0373939_0002139_2211_3041 276
2665 3300035114 Ga0373939_0009952 Ga0373939_0009952_648_1478 276
2666 3300035114 Ga0373939_0027034 Ga0373939_0027034_613_1449 276
2667 3300035114 Ga0373939_0045484 Ga0373939_0045484_335_1165 276
2668 3300035114 Ga0373939_0059491 Ga0373939_0059491_234_1064 276
2669 3300035115 Ga0373941_0000938 Ga0373941_0000938_3287_4117 276
2670 3300035115 Ga0373941_0003446 Ga0373941_0003446_390_1220 276
2671 3300035115 Ga0373941_0020523 Ga0373941_0020523_100_930 276
2672 3300035116 Ga0373945_0001093 Ga0373945_0001093_3487_4317 276
2673 3300035116 Ga0373945_0021656 Ga0373945_0021656_621_1451 276
2674 3300035117 Ga0373953_0020595 Ga0373953_0020595_1593_2423 276
2675 3300035118 Ga0373954_0006830 Ga0373954_0006830_1482_2312 276
2676 3300035118 Ga0373954_0087135 Ga0373954_0087135_506_1336 276
2677 3300035119 Ga0373956_0007620 Ga0373956_0007620_3212_4042 276
2678 3300035120 Ga0373957_0069156 Ga0373957_0069156_459_1289 276
2679 3300035121 Ga0373960_0002307 Ga0373960_0002307_1971_2801 276
2680 3300035121 Ga0373960_0003157 Ga0373960_0003157_2235_3065 276
2681 3300035121 Ga0373960_0008174 Ga0373960_0008174_94_924 276
2682 3300035121 Ga0373960_0021877 Ga0373960_0021877_600_1430 276
2683 3300035170 Ga0373943_0000945 Ga0373943_0000945_7905_8735 276
2684 3300035170 Ga0373943_0012663 Ga0373943_0012663_2668_3498 276
2685 3300035170 Ga0373943_0108447 Ga0373943_0108447_507_1337 276
2686 3300035171 Ga0373946_0005866 Ga0373946_0005866_1093_1923 276
2687 3300035172 Ga0373955_0006553 Ga0373955_0006553_745_1575 276
2688 3300035172 Ga0373955_0017381 Ga0373955_0017381_1875_2705 276
2689 3300035172 Ga0373955_0041393 Ga0373955_0041393_905_1735 276
2690 3300035207 Ga0373942_0000520 Ga0373942_0000520_7609_8439 276
2691 3300035207 Ga0373942_0002511 Ga0373942_0002511_1929_2759 276
2692 3300035241 Ga0373961_0001414 Ga0373961_0001414_5003_5833 276
2693 3300035242 Ga0373962_0000558 Ga0373962_0000558_3343_4173 276
2694 3300035242 Ga0373962_0003426 Ga0373962_0003426_1244_2074 276
2695 3300035242 Ga0373962_0041721 Ga0373962_0041721_194_1024 276
2696 3300035410 Ga0373924_0025289 Ga0373924_0025289_589_1419 276
2697 3300035410 Ga0373924_0042730 Ga0373924_0042730_613_1443 276
2698 3300035410 Ga0373924_0044770 Ga0373924_0044770_749_1579 276
2699 3300035691 Ga0373931_0007905 Ga0373931_0007905_2892_3722 276
2700 3300035691 Ga0373931_0008996 Ga0373931_0008996_1971_2801 276
2701 3300035691 Ga0373931_0050128 Ga0373931_0050128_497_1327 276
2702 3300035692 Ga0373935_0185649 Ga0373935_0185649_24_854 276
2703 3300035695 Ga0373927_0060108 Ga0373927_0060108_621_1451 276
2704 3300035724 Ga0373933_0004901 Ga0373933_0004901_2012_2842 276
2705 3300035724 Ga0373933_0030508 Ga0373933_0030508_2000_2830 276
2706 3300035725 Ga0373947_0001671 Ga0373947_0001671_11860_12690 276
2707 3300036401 Ga0373937_0005614 Ga0373937_0005614_4171_5001 276
2708 3300036401 Ga0373937_0008148 Ga0373937_0008148_6509_7339 276
2709 3300036401 Ga0373937_0034353 Ga0373937_0034353_3580_4410 276
2710 3300036401 Ga0373937_0155498 Ga0373937_0155498_1113_1943 276
2711 3300036401 Ga0373937_0175585 Ga0373937_0175585_409_1239 276
2712 3300037068 Ga0373925_0015007 Ga0373925_0015007_1659_2489 276
2713 3300037312 Ga0395899_0008003 Ga0395899_0008003_7188_8018 276
2714 3300037418 Ga0395900_0002888 Ga0395900_0002888_10631_11461 276
2715 3300037418 Ga0395900_0012043 Ga0395900_0012043_7719_8549 276
2716 3300037418 Ga0395900_0490698 Ga0395900_0490698_83_913 276
2717 3300037466 Ga0395898_0007773 Ga0395898_0007773_10477_11307 276
2718 3300037466 Ga0395898_0046567 Ga0395898_0046567_867_1697 276
2719 3300038443 Ga0395901_0021727 Ga0395901_0021727_3111_3941 276
2720 3300042008 Ga0439450_014888 Ga0439450_014888_240_1070 276
2721 3300042012 Ga0439455_0022392 Ga0439455_0022392_177_1007 276
2722 3300042439 Ga0439464_0007232 Ga0439464_0007232_902_1732 276
2723 3300042461 Ga0439460_0068028 Ga0439460_0068028_212_1042 276
2724 3300044719 Ga0466971_0154350 Ga0466971_0154350_120_950 276
2725 3300044719 Ga0466971_0231736 Ga0466971_0231736_31_861 276
2726 3300045051 Ga0451576_0105599 Ga0451576_0105599_623_1453 276
2727 3300045836 Ga0466958_0012605 Ga0466958_0012605_1647_2483 276
2728 3300045976 Ga0466967_0159662 Ga0466967_0159662_375_1205 276
2729 3300046454 Ga0495592_0002225 Ga0495592_0002225_6925_7755 276
2730 3300046454 Ga0495592_0117157 Ga0495592_0117157_884_1714 276
2731 3300046454 Ga0495592_0139526 Ga0495592_0139526_142_972 276
2732 3300046455 Ga0495603_0026838 Ga0495603_0026838_2191_3021 276
2733 3300046459 Ga0495629_0000440 Ga0495629_0000440_5911_6741 276
2734 3300046459 Ga0495629_0023211 Ga0495629_0023211_1984_2814 276
2735 3300046459 Ga0495629_0054577 Ga0495629_0054577_1552_2382 276
2736 3300046461 Ga0495641_0043238 Ga0495641_0043238_566_1396 276
2737 3300046461 Ga0495641_0138510 Ga0495641_0138510_230_1060 276
2738 3300046462 Ga0495651_0004059 Ga0495651_0004059_9923_10753 276
2739 3300046462 Ga0495651_0011906 Ga0495651_0011906_1953_2783 276
2740 3300046462 Ga0495651_0013966 Ga0495651_0013966_2513_3343 276
2741 3300046463 Ga0495653_0006947 Ga0495653_0006947_6663_7493 276
2742 3300046463 Ga0495653_0008183 Ga0495653_0008183_7355_8185 276
2743 3300046463 Ga0495653_0048455 Ga0495653_0048455_1264_2094 276
2744 3300046463 Ga0495653_0173739 Ga0495653_0173739_476_1306 276
2745 3300046472 Ga0495580_0037929 Ga0495580_0037929_532_1362 276
2746 3300046472 Ga0495580_0311624 Ga0495580_0311624_171_1001 276
2747 3300046473 Ga0495582_0000914 Ga0495582_0000914_4949_5779 276
2748 3300046475 Ga0495639_0006388 Ga0495639_0006388_3106_3936 276
2749 3300046475 Ga0495639_0050853 Ga0495639_0050853_514_1344 276
2750 3300046476 Ga0495662_0026739 Ga0495662_0026739_1167_1997 276
2751 3300046477 Ga0495664_0004525 Ga0495664_0004525_4425_5255 276
2752 3300046477 Ga0495664_0031813 Ga0495664_0031813_779_1609 276
2753 3300046491 Ga0495584_0022280 Ga0495584_0022280_2302_3132 276
2754 3300046492 Ga0495585_0017347 Ga0495585_0017347_1485_2315 276
2755 3300046499 Ga0495594_0022816 Ga0495594_0022816_2042_2872 276
2756 3300046499 Ga0495594_0138575 Ga0495594_0138575_239_1069 276
2757 3300046501 Ga0495607_0006526 Ga0495607_0006526_70_900 276
2758 3300046511 Ga0495608_0010975 Ga0495608_0010975_5028_5858 276
2759 3300046511 Ga0495608_0031649 Ga0495608_0031649_2383_3213 276
2760 3300046511 Ga0495608_0061907 Ga0495608_0061907_904_1734 276
2761 3300046511 Ga0495608_0069457 Ga0495608_0069457_377_1207 276
2762 3300046513 Ga0495616_0038046 Ga0495616_0038046_350_1180 276
2763 3300046514 Ga0495618_0005449 Ga0495618_0005449_395_1225 276
2764 3300046514 Ga0495618_0014942 Ga0495618_0014942_3386_4216 276
2765 3300046516 Ga0495628_0027928 Ga0495628_0027928_3279_4109 276
2766 3300046517 Ga0495630_0018564 Ga0495630_0018564_668_1498 276
2767 3300046517 Ga0495630_0085916 Ga0495630_0085916_711_1541 276
2768 3300046517 Ga0495630_0121039 Ga0495630_0121039_761_1591 276
2769 3300046520 Ga0495637_0075845 Ga0495637_0075845_188_1018 276
2770 3300046523 Ga0495644_0010408 Ga0495644_0010408_1346_2176 276
2771 3300046526 Ga0495666_0000884 Ga0495666_0000884_7921_8751 276
2772 3300046526 Ga0495666_0059754 Ga0495666_0059754_146_976 276
2773 3300046529 Ga0495652_0022381 Ga0495652_0022381_502_1332 276
2774 3300046529 Ga0495652_0073360 Ga0495652_0073360_289_1119 276
2775 3300046529 Ga0495652_0126898 Ga0495652_0126898_621_1451 276
2776 3300046529 Ga0495652_0147745 Ga0495652_0147745_988_1818 276
2777 3300046531 Ga0495665_0001249 Ga0495665_0001249_6289_7119 276
2778 3300046533 Ga0495640_0012226 Ga0495640_0012226_2964_3794 276
2779 3300046533 Ga0495640_0176938 Ga0495640_0176938_58_888 276
2780 3300046536 Ga0495587_0013126 Ga0495587_0013126_3955_4785 276
2781 3300046536 Ga0495587_0026760 Ga0495587_0026760_2516_3346 276
2782 3300046537 Ga0495598_0015426 Ga0495598_0015426_524_1354 276
2783 3300046538 Ga0495609_0058060 Ga0495609_0058060_33_863 276
2784 3300046543 Ga0495645_0011912 Ga0495645_0011912_350_1180 276
2785 3300046543 Ga0495645_0030621 Ga0495645_0030621_763_1593 276
2786 3300046543 Ga0495645_0157794 Ga0495645_0157794_235_1065 276
2787 3300046543 Ga0495645_0206217 Ga0495645_0206217_195_1025 276
2788 3300046557 Ga0495622_0003618 Ga0495622_0003618_3015_3845 276
2789 3300046558 Ga0495633_0014580 Ga0495633_0014580_1698_2528 276
2790 3300046559 Ga0495667_0003492 Ga0495667_0003492_6402_7232 276
2791 3300046559 Ga0495667_0007691 Ga0495667_0007691_6308_7138 276
2792 3300046559 Ga0495667_0021620 Ga0495667_0021620_1680_2510 276
2793 3300046559 Ga0495667_0158711 Ga0495667_0158711_589_1419 276
2794 3300046615 Ga0495656_0003231 Ga0495656_0003231_2757_3587 276
2795 3300046642 Ga0495634_0036161 Ga0495634_0036161_24_854 276
2796 3300046648 Ga0495611_0046289 Ga0495611_0046289_864_1694 276
2797 3300046663 Ga0495635_0001695 Ga0495635_0001695_7984_8814 276
2798 3300046663 Ga0495635_0010473 Ga0495635_0010473_3110_3940 276
2799 3300046663 Ga0495635_0044745 Ga0495635_0044745_245_1075 276
2800 3300046663 Ga0495635_0157681 Ga0495635_0157681_693_1523 276
2801 3300046663 Ga0495635_0248499 Ga0495635_0248499_299_1129 276
2802 3300046664 Ga0495659_0000755 Ga0495659_0000755_9619_10449 276
2803 3300046674 Ga0495588_0009671 Ga0495588_0009671_1881_2711 276
2804 3300046674 Ga0495588_0092886 Ga0495588_0092886_617_1447 276
2805 3300046675 Ga0495657_0015245 Ga0495657_0015245_3523_4353 276
2806 3300046678 Ga0495599_0044357 Ga0495599_0044357_546_1376 276
2807 3300046678 Ga0495599_0103005 Ga0495599_0103005_132_962 276
2808 3300046679 Ga0495623_0063995 Ga0495623_0063995_875_1705 276
2809 3300046680 Ga0495646_0007172 Ga0495646_0007172_5285_6115 276
2810 3300046680 Ga0495646_0115273 Ga0495646_0115273_593_1423 276
2811 3300046681 Ga0495647_0003008 Ga0495647_0003008_2923_3753 276
2812 3300046681 Ga0495647_0146994 Ga0495647_0146994_76_906 276
2813 3300046683 Ga0495658_0000200 Ga0495658_0000200_15667_16497 276
2814 3300046683 Ga0495658_0023078 Ga0495658_0023078_2318_3148 276
2815 3300046683 Ga0495658_0037694 Ga0495658_0037694_229_1059 276
2816 3300046684 Ga0495669_0039593 Ga0495669_0039593_728_1558 276
2817 3300046684 Ga0495669_0057334 Ga0495669_0057334_296_1126 276
2818 3300046689 Ga0495613_0012563 Ga0495613_0012563_4938_5768 276
2819 3300046689 Ga0495613_0105367 Ga0495613_0105367_198_1028 276
2820 3300046690 Ga0495624_0025399 Ga0495624_0025399_335_1165 276
2821 3300046691 Ga0495670_0003961 Ga0495670_0003961_1702_2532 276
2822 3300046692 Ga0495671_0067481 Ga0495671_0067481_71_901 276
2823 3300046692 Ga0495671_0158040 Ga0495671_0158040_63_893 276
2824 3300046794 Ga0495589_0071238 Ga0495589_0071238_691_1521 276
2825 3300046809 Ga0495600_0000769 Ga0495600_0000769_10003_10833 276
2826 3300046809 Ga0495600_0081137 Ga0495600_0081137_469_1299 276
2827 3300046809 Ga0495600_0081880 Ga0495600_0081880_1093_1923 276
2828 3300047315 Ga0495581_0011638 Ga0495581_0011638_2740_3570 276
2829 3300047315 Ga0495581_0019388 Ga0495581_0019388_1063_1893 276
2830 3300047315 Ga0495581_0019773 Ga0495581_0019773_2797_3627 276
2831 3300047317 Ga0495604_0000625 Ga0495604_0000625_3773_4603 276
2832 3300047317 Ga0495604_0003181 Ga0495604_0003181_9162_9992 276
2833 3300047317 Ga0495604_0079809 Ga0495604_0079809_889_1719 276
2834 3300047317 Ga0495604_0091311 Ga0495604_0091311_1383_2213 276
2835 3300047319 Ga0495674_0019582 Ga0495674_0019582_4661_5491 276
2836 3300047319 Ga0495674_0167520 Ga0495674_0167520_632_1462 276
2837 3300047321 Ga0495676_0046479 Ga0495676_0046479_2516_3346 276
2838 3300047321 Ga0495676_0053351 Ga0495676_0053351_1237_2067 276
2839 3300047321 Ga0495676_0062782 Ga0495676_0062782_1350_2180 276
2840 3300047322 Ga0495680_0003110 Ga0495680_0003110_4383_5213 276
2841 3300047322 Ga0495680_0004500 Ga0495680_0004500_7333_8163 276
2842 3300047322 Ga0495680_0006435 Ga0495680_0006435_7957_8787 276
2843 3300047322 Ga0495680_0019890 Ga0495680_0019890_3841_4671 276
2844 3300047322 Ga0495680_0027736 Ga0495680_0027736_780_1610 276
2845 3300047322 Ga0495680_0246100 Ga0495680_0246100_249_1079 276
2846 3300047444 Ga0495675_0142951 Ga0495675_0142951_387_1217 276
2847 3300047471 Ga0495684_0002895 Ga0495684_0002895_9092_9922 276
2848 3300047471 Ga0495684_0097659 Ga0495684_0097659_58_888 276
2849 3300047471 Ga0495684_0251304 Ga0495684_0251304_293_1123 276
2850 3300047471 Ga0495684_0253360 Ga0495684_0253360_385_1215 276
2851 3300047673 Ga0495593_0012654 Ga0495593_0012654_2796_3626 276
2852 3300047673 Ga0495593_0018562 Ga0495593_0018562_640_1470 276
2853 3300047673 Ga0495593_0103443 Ga0495593_0103443_203_1033 276
2854 3300048088 Ga0495602_0003565 Ga0495602_0003565_11307_12137 276
2855 3300048088 Ga0495602_0070734 Ga0495602_0070734_1744_2574 276
2856 3300048088 Ga0495602_0074406 Ga0495602_0074406_333_1163 276
2857 3300048089 Ga0495614_0028398 Ga0495614_0028398_270_1100 276
2858 3300048089 Ga0495614_0042245 Ga0495614_0042245_846_1676 276
2859 3300048903 Ga0496100_0000380 Ga0496100_0000380_1137_1967 276
2860 3300048904 Ga0496101_0022384 Ga0496101_0022384_3086_3916 276
2861 3300048904 Ga0496101_0023194 Ga0496101_0023194_625_1455 276
2862 3300048904 Ga0496101_0082737 Ga0496101_0082737_1477_2307 276
2863 3300048905 Ga0496102_0010977 Ga0496102_0010977_497_1327 276
2864 3300048905 Ga0496102_0047316 Ga0496102_0047316_1290_2120 276
2865 3300048906 Ga0496103_0028308 Ga0496103_0028308_882_1712 276
2866 3300048906 Ga0496103_0103633 Ga0496103_0103633_26_856 276
2867 3300048906 Ga0496103_0110200 Ga0496103_0110200_106_936 276
2868 3300048907 Ga0496104_0001998 Ga0496104_0001998_5717_6547 276
2869 3300048907 Ga0496104_0012321 Ga0496104_0012321_6131_6961 276
2870 3300048907 Ga0496104_0109318 Ga0496104_0109318_1763_2593 276
2871 3300048907 Ga0496104_0125209 Ga0496104_0125209_1379_2209 276
2872 3300048908 Ga0496105_0000273 Ga0496105_0000273_26784_27614 276
2873 3300048908 Ga0496105_0162780 Ga0496105_0162780_654_1484 276
2874 3300048909 Ga0496106_0005034 Ga0496106_0005034_5737_6567 276
2875 3300048909 Ga0496106_0011013 Ga0496106_0011013_4040_4870 276
2876 3300048909 Ga0496106_0017277 Ga0496106_0017277_3171_4001 276
2877 3300048910 Ga0496107_0006365 Ga0496107_0006365_1816_2646 276
2878 3300048910 Ga0496107_0013024 Ga0496107_0013024_112_942 276
2879 3300048910 Ga0496107_0063558 Ga0496107_0063558_1591_2421 276
2880 3300048911 Ga0496108_0065272 Ga0496108_0065272_243_1073 276
2881 3300048911 Ga0496108_0129129 Ga0496108_0129129_1119_1949 276
2882 3300048911 Ga0496108_0273172 Ga0496108_0273172_354_1184 276
2883 3300048912 Ga0496109_0000211 Ga0496109_0000211_19258_20088 276
2884 3300048912 Ga0496109_0004878 Ga0496109_0004878_1361_2191 276
2885 3300048912 Ga0496109_0010746 Ga0496109_0010746_5379_6209 276
2886 3300048913 Ga0496110_0025892 Ga0496110_0025892_1369_2199 276
2887 3300048913 Ga0496110_0057725 Ga0496110_0057725_673_1503 276
2888 3300048913 Ga0496110_0088234 Ga0496110_0088234_1657_2487 276
2889 3300048914 Ga0496111_0141877 Ga0496111_0141877_630_1460 276
2890 3300048915 Ga0496112_0003979 Ga0496112_0003979_1786_2616 276
2891 3300048915 Ga0496112_0035820 Ga0496112_0035820_975_1805 276
2892 3300048916 Ga0496113_0025017 Ga0496113_0025017_1563_2393 276
2893 3300048916 Ga0496113_0126942 Ga0496113_0126942_26_856 276
2894 3300048917 Ga0496114_0003482 Ga0496114_0003482_4863_5693 276
2895 3300048917 Ga0496114_0009535 Ga0496114_0009535_5953_6783 276
2896 3300048918 Ga0496115_0008441 Ga0496115_0008441_1408_2238 276
2897 3300048918 Ga0496115_0278816 Ga0496115_0278816_355_1185 276
2898 3300048918 Ga0496115_0342901 Ga0496115_0342901_52_882 276
2899 3300049571 Ga0501034_0005514 Ga0501034_0005514_7472_8302 276
2900 3300049580 Ga0501046_0377812 Ga0501046_0377812_110_940 276
2901 3300049581 Ga0501047_0014702 Ga0501047_0014702_5198_6028 276
2902 3300049586 Ga0501070_0014944 Ga0501070_0014944_1403_2233 276
2903 3300049593 Ga0501077_0003071 Ga0501077_0003071_5413_6243 276
2904 3300049593 Ga0501077_0235801 Ga0501077_0235801_63_893 276
2905 3300049823 Ga0501044_0174070 Ga0501044_0174070_68_898 276
2906 3300050494 nmdc:mga06z11_23090_c1 nmdc:mga06z11_23090_c1_795_1625 276
2907 3300050507 nmdc:mga05p37_24117_c1 nmdc:mga05p37_24117_c1_3810_4640 276
2908 3300050507 nmdc:mga05p37_9055_c1 nmdc:mga05p37_9055_c1_8063_8992 276
2909 3300050508 nmdc:mga09592_1455_c1 nmdc:mga09592_1455_c1_6581_7510 276
2910 3300050509 nmdc:mga0qj67_5882_c1 nmdc:mga0qj67_5882_c1_790_1719 276
2911 3300050510 nmdc:mga06r32_27182_c1 nmdc:mga06r32_27182_c1_2293_3222 276
2912 3300050511 nmdc:mga08y16_11723_c1 nmdc:mga08y16_11723_c1_5090_5920 276
2913 3300050511 nmdc:mga08y16_1227_c1 nmdc:mga08y16_1227_c1_7768_8598 276
2914 3300050511 nmdc:mga08y16_6892_c1 nmdc:mga08y16_6892_c1_4405_5334 276
2915 3300050512 nmdc:mga0n895_146006_c1 nmdc:mga0n895_146006_c1_1373_2203 276
2916 3300050512 nmdc:mga0n895_171_c1 nmdc:mga0n895_171_c1_37043_37873 276
2917 3300050512 nmdc:mga0n895_21574_c1 nmdc:mga0n895_21574_c1_2421_3350 276
2918 3300050512 nmdc:mga0n895_24501_c1 nmdc:mga0n895_24501_c1_913_1743 276
2919 3300050513 nmdc:mga0rr50_12842_c1 nmdc:mga0rr50_12842_c1_3237_4166 276
2920 3300050514 nmdc:mga08x19_140706_c1 nmdc:mga08x19_140706_c1_37_867 276
2921 3300050514 nmdc:mga08x19_270120_c1 nmdc:mga08x19_270120_c1_115_1044 276
2922 3300050514 nmdc:mga08x19_88581_c1 nmdc:mga08x19_88581_c1_35_865 276
2923 3300050515 nmdc:mga0a205_2563_c1 nmdc:mga0a205_2563_c1_7904_8734 276
2924 3300050515 nmdc:mga0a205_3394_c1 nmdc:mga0a205_3394_c1_5145_6074 276
2925 3300053077 Ga0495601_0000379 Ga0495601_0000379_6718_7548 276
2926 3300053077 Ga0495601_0001291 Ga0495601_0001291_1653_2483 276
2927 3300053077 Ga0495601_0006296 Ga0495601_0006296_5493_6323 276
2928 3300053077 Ga0495601_0167917 Ga0495601_0167917_400_1230 276
2929 3300053077 Ga0495601_0181384 Ga0495601_0181384_396_1226 276
2930 3300053078 Ga0495612_0001697 Ga0495612_0001697_5169_5999 276
2931 3300053078 Ga0495612_0005818 Ga0495612_0005818_2862_3692 276
2932 3300053078 Ga0495612_0007362 Ga0495612_0007362_2319_3149 276
2933 3300053078 Ga0495612_0042536 Ga0495612_0042536_347_1177 276
2934 3300053083 Ga0495655_0016429 Ga0495655_0016429_349_1203 276
2935 3300053084 Ga0495595_0001512 Ga0495595_0001512_1029_1859 276
2936 3300053084 Ga0495595_0003018 Ga0495595_0003018_5769_6599 276
2937 3300053084 Ga0495595_0003071 Ga0495595_0003071_4683_5513 276
2938 3300053085 Ga0495619_0000105 Ga0495619_0000105_31138_31968 276
2939 3300053085 Ga0495619_0004472 Ga0495619_0004472_1898_2728 276
2940 3300053085 Ga0495619_0005762 Ga0495619_0005762_1697_2527 276
2941 3300053085 Ga0495619_0021807 Ga0495619_0021807_2867_3697 276
2942 3300053085 Ga0495619_0051507 Ga0495619_0051507_454_1284 276
2943 3300053090 Ga0500646_0067705 Ga0500646_0067705_131_961 276
2944 3300053093 Ga0500651_0012851 Ga0500651_0012851_1115_1945 276
2945 3300053153 Ga0500616_0000006 Ga0500616_0000006_467627_468457 276
2946 3300053730 Ga0500645_002247 Ga0500645_002247_7774_8619 276

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06426

SATase_N

Serine acetyltransferase, N-terminal

57

161

0.99

PF00132

Hexapep

Bacterial transferase hexapeptide (six repeats)

241

276

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hzc-assembly1.cif.gz_E crystal structure of serine acetyltransferase from brucella abortus strain s19 0.9922 15 258
4hzc-assembly2.cif.gz_G crystal structure of serine acetyltransferase from brucella abortus strain s19 0.9911 15 258
3mc4-assembly2.cif.gz_B crystal structure of ww/rsp5/wwp domain: bacterial transferase hexapeptide repeat: serine o-acetyltransferase from brucella melitensis 0.9905 16 257
1ssq-assembly1.cif.gz_A serine acetyltransferase- complex with cysteine 0.9891 18 254
3mc4-assembly1.cif.gz_A crystal structure of ww/rsp5/wwp domain: bacterial transferase hexapeptide repeat: serine o-acetyltransferase from brucella melitensis 0.9887 11 257
ID Description Score Start End Superfamily
4n6bB02 Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins 0.9931 152 253 2.160.10.10
4n6bB02 Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins 0.9831 152 253 2.160.10.10
1s80A01 Mainly Alpha;Orthogonal Bundle;serine acetyltransferase, domain 1;serine acetyltransferase, domain 1 0.9824 18 150 1.10.3130.10
3mc4A01 Mainly Alpha;Orthogonal Bundle;serine acetyltransferase, domain 1;serine acetyltransferase, domain 1 0.9757 11 150 1.10.3130.10
4n6bC01 Mainly Alpha;Orthogonal Bundle;serine acetyltransferase, domain 1;serine acetyltransferase, domain 1 0.9716 18 150 1.10.3130.10
ID Description Score Start End GO Terms
AF-A0A6M1HW22-F1-model_v4 deleted 0.9919 60 232
AF-A0A844VWN9-F1-model_v4 deleted 0.9901 38 216
AF-A0A7R8WWD6-F1-model_v4 serine O-acetyltransferase (EC 2.3.1.30) 0.99 80 268 GO:0005737
GO:0006535
GO:0009001
AF-A0A376VDA1-F1-model_v4 Serine acetyltransferase (EC 2.3.1.30) 0.9897 36 257 GO:0005737
GO:0006535
GO:0009001
AF-A0A3C0KYY1-F1-model_v4 Serine acetyltransferase (EC 2.3.1.30) 0.9894 23 255 GO:0005737
GO:0006535
GO:0009001

Feature Viewer

pLDDT pTM Quality
89.62 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map