F497161
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 2946 | 1379 | 2231 | 276 |
Family's Representative Sequence
| Representative Sequence | 3300041491|Ga0451833_0223154|Ga0451833_0223154_903_1841 |
| Length | 312 |
| Sequence | MLKNHGDGTHLCYWRFPLYIGIPKTAFRLATRRAAMVAKTDIRAFDTGHPLKVMDPIWDSLREEARLAAERDPVLAAFLYSTVINYHSLEECVIHRICERLDHPDMQANLLRQTFEEMLLDWPDWSSILRVDIQAIYDRDPACLRFMEAVLYFKGFHALQTHRLAHWLLNRGRRDFALYLQSRSSSVFQTDINPAARIGKGIFLDHATGLVVGETAVIGDNVSILHGVTLGGTGKEGADRHPKIGSGVMIGAGAKILGNIEIGYCSRVAAGSVVLKAVPPKKTVAGVPAKVVGEAGCSEPSRNMDQVIGADI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 2 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 3 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 4 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 5 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 6 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 7 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 8 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 9 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 10 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 11 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 12 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 13 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 14 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 15 | 2511231027 | Phyllobacterium sp. YR531 | Isolate | Rhizosphere |
| 16 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 17 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 18 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 19 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 20 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 21 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 22 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 23 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 24 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 25 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 26 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 27 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 28 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 29 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 30 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 31 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 32 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 33 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 34 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 35 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 36 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 37 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 38 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 39 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 40 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 41 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 42 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 43 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 44 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 45 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 46 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 47 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 48 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 49 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 50 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 51 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 52 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 53 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 54 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 55 | 2534681786 | Brucella suis 92/29 | Isolate | Unclassified |
| 56 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 57 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 58 | 2545555834 | Methylobacterium sp. WSM2598 | Isolate | Nodule |
| 59 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 60 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 61 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 62 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 63 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 64 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 65 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 66 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 67 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 68 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 69 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 70 | 2558860983 | Allorhizobium undicola ATCC 700741 | Isolate | Rhizoplane |
| 71 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 72 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 73 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 74 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 75 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 76 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 77 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 78 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 79 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 80 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 81 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 82 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 83 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 84 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 85 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 86 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 87 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 88 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 89 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 90 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 91 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 92 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 93 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 94 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 95 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 96 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 97 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 98 | 2595698237 | Methylobacterium sp. UNCCL125 | Isolate | Unclassified |
| 99 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 100 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 101 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 102 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 103 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 104 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 105 | 2600254933 | Rhizobium sp. NFR12 | Isolate | Rhizoplane |
| 106 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 107 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 108 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 109 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 110 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 111 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 112 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 113 | 2643221550 | Mesorhizobium sp. Root552 | Isolate | Unclassified |
| 114 | 2643221551 | Mesorhizobium sp. Root1471 | Isolate | Unclassified |
| 115 | 2643221555 | Mesorhizobium sp. Root554 | Isolate | Unclassified |
| 116 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 117 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 118 | 2643221564 | Mesorhizobium sp. Root157 | Isolate | Unclassified |
| 119 | 2643221568 | Rhizobium sp. Root564 | Isolate | Unclassified |
| 120 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 121 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 122 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 123 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 124 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 125 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 126 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 127 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 128 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 129 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 130 | 2643221653 | Rhizobium sp. Root1240 | Isolate | Unclassified |
| 131 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 132 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 133 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 134 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 135 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 136 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 137 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 138 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 139 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 140 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 141 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 142 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 143 | 2643221719 | Rhizobium sp. Root274 | Isolate | Unclassified |
| 144 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 145 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 146 | 2643221733 | Bosea sp. Root381 | Isolate | Unclassified |
| 147 | 2643221734 | Bosea sp. Root670 | Isolate | Unclassified |
| 148 | 2643221736 | Bosea sp. Root483D1 | Isolate | Unclassified |
| 149 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 150 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 151 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 152 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 153 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 154 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 155 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 156 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 157 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 158 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 159 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 160 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 161 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 162 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 163 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 164 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 165 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 166 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 167 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 168 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 169 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 170 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 171 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 172 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 173 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 174 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 175 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 176 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 177 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 178 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 179 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 180 | 2738541281 | Methylobacterium sp. GV094 | Isolate | Unclassified |
| 181 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 182 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 183 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 184 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 185 | 2738543032 | Methylobacterium sp. GV104 | Isolate | Unclassified |
| 186 | 2757320392 | Phyllobacterium leguminum ORS 1419 | Isolate | Nodule |
| 187 | 2758568016 | [Ochrobactrum] quorumnocens A44 | Isolate | Rhizosphere |
| 188 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 189 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 190 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 191 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 192 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 193 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 194 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 195 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 196 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 197 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 198 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 199 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 200 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 201 | 2791355253 | Rhizobium rhizosphaerae RD15 | Isolate | Rhizosphere |
| 202 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 203 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 204 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 205 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 206 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 207 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 208 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 209 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 210 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 211 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 212 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 213 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 214 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 215 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 216 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 217 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 218 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 219 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 220 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 221 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 222 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 223 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 224 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 225 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 226 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 227 | 2818991272 | Rhizobium sp. SLBN-4 | Isolate | Unclassified |
| 228 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 229 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 230 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 231 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 232 | 2818991467 | Bosea vestrisii 3192 | Isolate | Unclassified |
| 233 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 234 | 2835312727 | Microvirga calopogonii CCBAU 65841 | Isolate | Nodule |
| 235 | 2837678835 | Jiella endophytica CBS5Q-3 | Isolate | Unclassified |
| 236 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 237 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 238 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 239 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 240 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 241 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 242 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 243 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 244 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 245 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 246 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 247 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 248 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 249 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 250 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 251 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 252 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 253 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 254 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 255 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 256 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 257 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 258 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 259 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 260 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 261 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 262 | 2841760612 | Bosea sp. Tri-49 | Isolate | Nodule |
| 263 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 264 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 265 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 266 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 267 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 268 | 2841911363 | Bosea caraganae RCAM04685 | Isolate | Nodule |
| 269 | 2841917233 | Bosea caraganae RCAM04680 | Isolate | Nodule |
| 270 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 271 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 272 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 273 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 274 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 275 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 276 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 277 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 278 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 279 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 280 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 281 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 282 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 283 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 284 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 285 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 286 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 287 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 288 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 289 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 290 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 291 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 292 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 293 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 294 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 295 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 296 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 297 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 298 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 299 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 300 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 301 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 302 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 303 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 304 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 305 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 306 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 307 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 308 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 309 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 310 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 311 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 312 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 313 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 314 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 315 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 316 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 317 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 318 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 319 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 320 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 321 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 322 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 323 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 324 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 325 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 326 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 327 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 328 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 329 | 2842775625 | Roseomonas sp. R-71825 | Isolate | Unclassified |
| 330 | 2842871566 | Phyllobacterium sp. R-73111 | Isolate | Unclassified |
| 331 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 332 | 2844104063 | Bosea sp. Tri-39 | Isolate | Nodule |
| 333 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 334 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 335 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 336 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 337 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 338 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 339 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 340 | 2851182111 | Bosea sp. Tri-44 | Isolate | Nodule |
| 341 | 2851246043 | Bosea sp. Tri-54 | Isolate | Nodule |
| 342 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 343 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 344 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 345 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 346 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 347 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 348 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 349 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 350 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 351 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 352 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 353 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 354 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 355 | 2871444079 | Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 | Isolate | Nodule |
| 356 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 357 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 358 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 359 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 360 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 361 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 362 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 363 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 364 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 365 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 366 | 2878788777 | Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 | Isolate | Nodule |
| 367 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 368 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 369 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 370 | 2884298095 | Microvirga thermotolerans HR1 | Isolate | Rhizosphere |
| 371 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 372 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 373 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 374 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 375 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 376 | 2889306138 | Methylobacterium sp. PvR107 | Isolate | Rhizosphere |
| 377 | 2889790730 | Chelativorans xinjiangense lm93 | Isolate | Rhizosphere |
| 378 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 379 | 2891048133 | Martelella lutilitoris GH2-6 | Isolate | Rhizosphere |
| 380 | 2891373044 | Shinella sp. AETb1-6 | Isolate | Rhizosphere |
| 381 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 382 | 2894652903 | Phyllobacterium sp. SYP-B3895 | Isolate | Rhizosphere |
| 383 | 2894817345 | Aureimonas psammosilenae YIM DR1026 | Isolate | Unclassified |
| 384 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 385 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 386 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 387 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 388 | 2902330777 | Methylobacterium sp. 2A | Isolate | Unclassified |
| 389 | 2902405164 | Methylobacterium sp. P1-11 | Isolate | Unclassified |
| 390 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 391 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 392 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 393 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 394 | 2906354277 | Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 | Isolate | Nodule |
| 395 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 396 | 2909042592 | Labrys sp. LIt4 | Isolate | Nodule |
| 397 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 398 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 399 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 400 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 401 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 402 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 403 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 404 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 405 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 406 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 407 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 408 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 409 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 410 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 411 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 412 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 413 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 414 | 2917699015 | Bosea sp. F3-2 | Isolate | Rhizosphere |
| 415 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 416 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 417 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 418 | 2919166419 | Agrobacterium cavarae 2074 | Isolate | Unclassified |
| 419 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 420 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 421 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 422 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 423 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 424 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 425 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 426 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 427 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 428 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 429 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 430 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 431 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 432 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 433 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 434 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 435 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 436 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 437 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 438 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 439 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 440 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 441 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 442 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 443 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 444 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 445 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 446 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 447 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 448 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 449 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 450 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 451 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 452 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 453 | 2928125067 | Methylobacterium sp. 1973 | Isolate | Unclassified |
| 454 | 2928521798 | Phyllobacterium ifriqiyense 1451 | Isolate | Rhizosphere |
| 455 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 456 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 457 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 458 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 459 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 460 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 461 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 462 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 463 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 464 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 465 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 466 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 467 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 468 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 469 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 470 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 471 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 472 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 473 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 474 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 475 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 476 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 477 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 478 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 479 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 480 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 481 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 482 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 483 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 484 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 485 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 486 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 487 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 488 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 489 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 490 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 491 | 2939669807 | Kaistia defluvii 3207 | Isolate | Rhizosphere |
| 492 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 493 | 2954011201 | Phyllobacterium ifrigiyense W4I11 | Isolate | Rhizosphere |
| 494 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 495 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 496 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 497 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 498 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 499 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 500 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 501 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 502 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 503 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 504 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 505 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 506 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 507 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 508 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 509 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 510 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 511 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 512 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 513 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 514 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 515 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 516 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 517 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 518 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 519 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 520 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 521 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 522 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 523 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 524 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 525 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 526 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 527 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 528 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 529 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 530 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 531 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 532 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 533 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 534 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 535 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 536 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 537 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 538 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 539 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 540 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 541 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 542 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 543 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 544 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 545 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 546 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 547 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 548 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 549 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 550 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 551 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 552 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 553 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 554 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 555 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 556 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 557 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 558 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 559 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 560 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 561 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 562 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 563 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 564 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 565 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 566 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 567 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 568 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 569 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 570 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 571 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 572 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 573 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 574 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 575 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 576 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 577 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 578 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 579 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 580 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 581 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 582 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 583 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 584 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 585 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 586 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 587 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 588 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 589 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 590 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 591 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 592 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 593 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 594 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 595 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 596 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 597 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 598 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 599 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 600 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 601 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 602 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 603 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 604 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 605 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 606 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 607 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 608 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 609 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 610 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 611 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 612 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 613 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 614 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 615 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 616 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 617 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 618 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 619 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 620 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 621 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 622 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 623 | 2978969890 | Agrobacterium sp. SORGH_AS 787 | Isolate | Unclassified |
| 624 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 625 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 626 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 627 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 628 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 629 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 630 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 631 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 632 | 2984587000 | Agrobacterium larrymoorei SORGH_AS974 | Isolate | Aerial Root |
| 633 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 634 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 635 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 636 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 637 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 638 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 639 | 2989776772 | Rhizobium glycinendophyticum CL12 | Isolate | Unclassified |
| 640 | 2995392953 | Martelella limonii NBRC 109441 | Isolate | Unclassified |
| 641 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 642 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 643 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 644 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 645 | 3003665799 | Methylobacterium aquaticum BG2 | Isolate | Unclassified |
| 646 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 647 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 648 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 649 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 650 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 651 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 652 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 653 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 654 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 655 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 656 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 657 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 658 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 659 | 3300001430 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 | Metagenome | Rhizosphere |
| 660 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 661 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 662 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 663 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 664 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 665 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 666 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 667 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 668 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 669 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 670 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 671 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 672 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 673 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 674 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 675 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 676 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 677 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 678 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 679 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 680 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 681 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 682 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 683 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 684 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 685 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 686 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 687 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 688 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 689 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 690 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 691 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 692 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 693 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 694 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 695 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 696 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 697 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 698 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 699 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 700 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 701 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 702 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 703 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 704 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 705 | 3300005276 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 | Metagenome | Rhizosphere |
| 706 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 707 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 708 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 709 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 710 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 711 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 712 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 713 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 714 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 715 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 716 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 717 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 718 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 719 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 720 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 721 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 722 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 723 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 724 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 725 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 726 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 727 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 728 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 729 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 730 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 731 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 732 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 733 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 734 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 735 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 736 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 737 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 738 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 739 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 740 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 741 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 742 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 743 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 744 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 745 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 746 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 747 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 748 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 749 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 750 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 751 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 752 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 753 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 754 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 755 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 756 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 757 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 758 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 759 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 760 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 761 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 762 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 763 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 764 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 765 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 766 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 767 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 768 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 769 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 770 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 771 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 772 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 773 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 774 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 775 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 776 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 777 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 778 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 779 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 780 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 781 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 782 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 783 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 784 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 785 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 786 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 787 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 788 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 789 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 790 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 791 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 792 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 793 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 794 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 795 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 796 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 797 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 798 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 799 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 800 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 801 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 802 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 803 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 804 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 805 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 806 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 807 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 808 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 809 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 810 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 811 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 812 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 813 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 814 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 815 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 816 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 817 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 818 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 819 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 820 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 821 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 822 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 823 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 824 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 825 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 826 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 827 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 828 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 829 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 830 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 831 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 832 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 833 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 834 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 835 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 836 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 837 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 838 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 839 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 840 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 841 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 842 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 843 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 844 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 845 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 846 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 847 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 848 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 849 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 850 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 851 | 3300015684 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 | Metagenome | Unclassified |
| 852 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 853 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 854 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 855 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 856 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 857 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 858 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 859 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 860 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 861 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 862 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 863 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 864 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 865 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 866 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 867 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 868 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 869 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 870 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 871 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 872 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 873 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 874 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 875 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 876 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 877 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 878 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 879 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 880 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 881 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 882 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 883 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 884 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 885 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 886 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 887 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 888 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 889 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 890 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 891 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 892 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 893 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 894 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 895 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 896 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 897 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 898 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 899 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 900 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 901 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 902 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 903 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 904 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 905 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 906 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 907 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 908 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 909 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 910 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 911 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 912 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 913 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 914 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 915 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 916 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 917 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 918 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 919 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 920 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 921 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 922 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 923 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 924 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 925 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 926 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 927 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 928 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 929 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 930 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 931 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 932 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 933 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 934 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 935 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 936 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 937 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 938 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 939 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 940 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 941 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 942 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 943 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 944 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 945 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 946 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 947 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 948 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 949 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 950 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 951 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 952 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 953 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 954 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 955 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 956 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 957 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 958 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 959 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 960 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 961 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 962 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 963 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 964 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 965 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 966 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 967 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 968 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 969 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 970 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 971 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 972 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 973 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 974 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 975 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 976 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 977 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 978 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 979 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 980 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 981 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 982 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 983 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 984 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 985 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 986 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 987 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 988 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 989 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 990 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 991 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 992 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 993 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 994 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 995 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 996 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 997 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 998 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 999 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 1000 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 1001 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 1002 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 1003 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 1004 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 1005 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 1006 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 1007 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 1008 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 1009 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 1010 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 1011 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 1012 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 1013 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 1014 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 1015 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 1016 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 1017 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 1018 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 1019 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 1020 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 1021 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 1022 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 1023 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 1024 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 1025 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 1026 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 1027 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 1028 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 1029 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 1030 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 1031 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 1032 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 1033 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 1034 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 1035 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 1036 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 1037 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 1038 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 1039 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 1040 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 1041 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 1042 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 1043 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 1044 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 1045 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 1046 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 1047 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 1048 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 1049 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 1050 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 1051 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 1052 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 1053 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 1054 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 1055 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 1056 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 1057 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 1058 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 1059 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 1060 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 1061 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 1062 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 1063 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 1064 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 1065 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 1066 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 1067 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 1068 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 1069 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 1070 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 1071 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 1072 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 1073 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 1074 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 1075 | 3300041502 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT | Metatranscriptome | Unclassified |
| 1076 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 1077 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 1078 | 3300041506 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT | Metatranscriptome | Unclassified |
| 1079 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 1080 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 1081 | 3300041510 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT | Metatranscriptome | Unclassified |
| 1082 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 1083 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 1084 | 3300041907 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT_extra_run | Metatranscriptome | Unclassified |
| 1085 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 1086 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 1087 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 1088 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 1089 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 1090 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 1091 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 1092 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 1093 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 1094 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 1095 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 1096 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 1097 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 1098 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 1099 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 1100 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 1101 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 1102 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 1103 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 1104 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 1105 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 1106 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 1107 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 1108 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 1109 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 1110 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 1111 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 1112 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 1113 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 1114 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 1115 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 1116 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 1117 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 1118 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 1119 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 1120 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 1121 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 1122 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 1123 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 1124 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 1125 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 1126 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 1127 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 1128 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 1129 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 1130 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 1131 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 1132 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 1133 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 1134 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 1135 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 1136 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 1137 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 1138 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 1139 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 1140 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 1141 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 1142 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 1143 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 1144 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 1145 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 1146 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 1147 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 1148 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 1149 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 1150 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 1151 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 1152 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 1153 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 1154 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 1155 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 1156 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 1157 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 1158 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 1159 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 1160 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 1161 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 1162 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 1163 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 1164 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 1165 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 1166 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 1167 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 1168 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 1169 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 1170 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 1171 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 1172 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 1173 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 1174 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 1175 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 1176 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 1177 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 1178 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 1179 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 1180 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 1181 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 1182 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 1183 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 1184 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 1185 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 1186 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 1187 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 1188 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 1189 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 1190 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 1191 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 1192 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 1193 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 1194 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 1195 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 1196 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 1197 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 1198 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 1199 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 1200 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 1201 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 1202 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 1203 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 1204 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 1205 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 1206 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 1207 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 1208 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 1209 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 1210 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 1211 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 1212 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 1213 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 1214 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 1215 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1216 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1217 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1218 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1219 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1220 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1221 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1222 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1223 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1224 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1225 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1226 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1227 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1228 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1229 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1230 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1231 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1232 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1233 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1234 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 1235 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1236 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1237 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 1238 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1239 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1240 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 1241 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1242 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1243 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 1244 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1245 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1246 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 1247 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1248 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 1249 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1250 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1251 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1252 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 1253 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 1254 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 1255 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 1256 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 1257 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 1258 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 1259 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 1260 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 1261 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 1262 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 1263 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 1264 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 1265 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 1266 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 1267 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 1268 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 1269 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 1270 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 1271 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 1272 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 1273 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 1274 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 1275 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 1276 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 1277 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 1278 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 1279 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 1280 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 1281 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 1282 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 1283 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 1284 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 1285 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 1286 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 1287 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 1288 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 1289 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 1290 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 1291 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 1292 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 1293 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 1294 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 1295 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 1296 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 1297 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 1298 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 1299 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 1300 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 1301 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 1302 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 1303 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 1304 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 1305 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 1306 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 1307 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 1308 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1309 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1310 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1311 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1312 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1313 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1314 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1315 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1316 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1317 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 1318 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 1319 | 641522639 | Methylobacterium sp. 4-46 | Isolate | Nodule |
| 1320 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
| 1321 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 1322 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 1323 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 1324 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 1325 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 1326 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 1327 | 8004395343 | Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 | Isolate | Nodule |
| 1328 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 1329 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 1330 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 1331 | 8005246636 | Rhizobium wuzhouense W44 | Isolate | Rhizosphere |
| 1332 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 1333 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 1334 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 1335 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 1336 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 1337 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 1338 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 1339 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 1340 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 1341 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 1342 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 1343 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 1344 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 1345 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 1346 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 1347 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 1348 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 1349 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 1350 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 1351 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 1352 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 1353 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 1354 | 8005658619 | Rhizobium terrae CC-HIH110 | Isolate | Unclassified |
| 1355 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 1356 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 1357 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 1358 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 1359 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 1360 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 1361 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 1362 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 1363 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 1364 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 1365 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 1366 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 1367 | 8045864390 | Aurantimonas endophytica KCTC 52296 | Isolate | Unclassified |
| 1368 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 1369 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 1370 | 8054460903 | Agrobacterium vaccinii B7.6 | Isolate | Unclassified |
| 1371 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 1372 | 8055431914 | Allorhizobium sonneratiae BGMRC 0089 | Isolate | Unclassified |
| 1373 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
| 1374 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 1375 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 1376 | 8056875544 | Rhizobium halophilum TRM95001 | Isolate | Rhizosphere |
| 1377 | 8057529695 | Bosea vestrisii A18/4-2 | Isolate | Nodule |
| 1378 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
| 1379 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 74.88 |
| Metatranscriptomes | 0.85 |
| Isolates | 24.27 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.17 |
| Bulb | 0 |
| Endosphere | 9.71 |
| Nodule | 17.85 |
| Rhizoplane | 4.48 |
| Rhizosphere | 58.49 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.3 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | 2214911870 | 2209111006 | Bacteria | 6751 |
| 2 | ARcpr5oldR_c000058 | 3300000041 | Bacteria | 20592 |
| 3 | ARSoilYngRDRAFT_c00199 | 3300000042 | Bacteria | 10042 |
| 4 | ARcpr5yngRDRAFT_c000188 | 3300000043 | Bacteria | 9598 |
| 5 | ARSoilOldRDRAFT_c000028 | 3300000044 | Bacteria | 32672 |
| 6 | ARCol0oldRDRAFT_c00565 | 3300000045 | Bacteria | 3301 |
| 7 | ARCol0yngRDRAFT_1000057 | 3300000652 | Bacteria | 20005 |
| 8 | JGI24032J14994_100133 | 3300001430 | Bacteria | 3489 |
| 9 | JGI24752J21851_1001260 | 3300001976 | Bacteria | 3439 |
| 10 | JGI24746J21847_1000137 | 3300001977 | Bacteria | 9051 |
| 11 | JGI24747J21853_1000013 | 3300001978 | Bacteria | 7120 |
| 12 | JGI24740J21852_10000001 | 3300001979 | Bacteria | 168537 |
| 13 | JGI24739J22299_10000400 | 3300001989 | Bacteria | 15068 |
| 14 | JGI24737J22298_10000531 | 3300001990 | Bacteria | 13359 |
| 15 | JGI24737J22298_10002432 | 3300001990 | Bacteria | 6639 |
| 16 | JGI24750J21931_1000240 | 3300002070 | Bacteria | 9414 |
| 17 | JGI24745J21846_1000114 | 3300002073 | Bacteria | 6121 |
| 18 | JGI24748J21848_1000264 | 3300002074 | Bacteria | 6239 |
| 19 | JGI24738J21930_10002058 | 3300002075 | Bacteria | 5391 |
| 20 | JGI24749J21850_1003004 | 3300002076 | Bacteria | 2355 |
| 21 | JGI24749J21850_1007729 | 3300002076 | Bacteria | 1499 |
| 22 | JGI24744J21845_10001857 | 3300002077 | Bacteria | 4242 |
| 23 | JGI24744J21845_10006387 | 3300002077 | Bacteria | 2446 |
| 24 | JGI24035J26624_1000224 | 3300002126 | Bacteria | 5199 |
| 25 | JGI24033J26618_1000662 | 3300002155 | Bacteria | 3301 |
| 26 | JGI24034J26672_10001369 | 3300002239 | Bacteria | 3226 |
| 27 | JGI24742J22300_10000135 | 3300002244 | Bacteria | 10797 |
| 28 | JGI24742J22300_10004158 | 3300002244 | Bacteria | 2360 |
| 29 | JGI25155J39150_1000011 | 3300002704 | Bacteria | 207685 |
| 30 | JGI25156J39149_1000027 | 3300002705 | Bacteria | 127396 |
| 31 | JGI25162J39368_1000923 | 3300002737 | Bacteria | 18856 |
| 32 | JGI25162J39368_1001104 | 3300002737 | Bacteria | 16375 |
| 33 | JGI25162J39368_1001271 | 3300002737 | Bacteria | 14357 |
| 34 | JGI25154J39366_1000057 | 3300002738 | Bacteria | 110584 |
| 35 | JGI25154J39366_1000368 | 3300002738 | Bacteria | 25167 |
| 36 | JGI25158J39367_1000203 | 3300002739 | Bacteria | 14163 |
| 37 | JGI25157J39369_1000010 | 3300002741 | Bacteria | 207685 |
| 38 | JGI25152J39213_1001188 | 3300002773 | Bacteria | 11978 |
| 39 | JGI25152J39213_1001618 | 3300002773 | Bacteria | 9407 |
| 40 | JGI25152J39213_1005646 | 3300002773 | Bacteria | 3588 |
| 41 | JGI25152J39213_1006889 | 3300002773 | Bacteria | 3007 |
| 42 | JGI25150J39212_1000010 | 3300002774 | Bacteria | 236260 |
| 43 | JGI25150J39212_1012292 | 3300002774 | Bacteria | 1521 |
| 44 | JGI25159J45721_1000006 | 3300002987 | Bacteria | 188201 |
| 45 | JGI25159J45721_1000375 | 3300002987 | Bacteria | 20707 |
| 46 | JGI25159J45721_1000969 | 3300002987 | Bacteria | 12464 |
| 47 | JGI25151J46595_10000066 | 3300003187 | Bacteria | 142963 |
| 48 | JGI25151J46595_10000653 | 3300003187 | Bacteria | 29531 |
| 49 | JGI25151J46595_10000963 | 3300003187 | Bacteria | 21956 |
| 50 | JGI25151J46595_10013982 | 3300003187 | Bacteria | 3593 |
| 51 | JGI25151J46595_10023001 | 3300003187 | Bacteria | 2577 |
| 52 | JGI25151J46595_10025442 | 3300003187 | Bacteria | 2408 |
| 53 | JGI25406J46586_10000165 | 3300003203 | Bacteria | 29331 |
| 54 | JGI25406J46586_10000169 | 3300003203 | Bacteria | 29128 |
| 55 | JGI25406J46586_10008097 | 3300003203 | Bacteria | 4773 |
| 56 | JGI25406J46586_10019430 | 3300003203 | Bacteria | 2769 |
| 57 | JGI25165J46597_1001156 | 3300003214 | Bacteria | 16375 |
| 58 | JGI25165J46597_1001175 | 3300003214 | Bacteria | 16084 |
| 59 | JGI25165J46597_1002353 | 3300003214 | Bacteria | 6349 |
| 60 | JGI25153J46596_10001697 | 3300003215 | Bacteria | 13070 |
| 61 | JGI25153J46596_10013236 | 3300003215 | Bacteria | 3501 |
| 62 | JGI25153J46596_10013822 | 3300003215 | Bacteria | 3390 |
| 63 | JGI25153J46596_10016477 | 3300003215 | Bacteria | 2957 |
| 64 | rootH2_10091763 | 3300003320 | Bacteria | 5125 |
| 65 | JGI25160J50197_1000004 | 3300003354 | Bacteria | 419797 |
| 66 | JGI25160J50197_1000019 | 3300003354 | Bacteria | 233980 |
| 67 | JGI25160J50197_1004333 | 3300003354 | Bacteria | 6151 |
| 68 | JGI25160J50197_1010089 | 3300003354 | Bacteria | 3445 |
| 69 | JGI25160J50197_1010772 | 3300003354 | Bacteria | 3286 |
| 70 | JGI25161J50226_1000003 | 3300003374 | Bacteria | 413345 |
| 71 | JGI25161J50226_1000053 | 3300003374 | Bacteria | 106635 |
| 72 | JGI25161J50226_1001944 | 3300003374 | Bacteria | 5699 |
| 73 | Ga0006562J51391_1007243 | 3300003578 | Bacteria | 4880 |
| 74 | Ga0006562J51391_1023271 | 3300003578 | Bacteria | 1618 |
| 75 | Ga0055526_1000955 | 3300003771 | Bacteria | 21351 |
| 76 | Ga0055526_1004368 | 3300003771 | Bacteria | 8529 |
| 77 | Ga0055526_1004739 | 3300003771 | Bacteria | 8059 |
| 78 | Ga0055526_1008416 | 3300003771 | Bacteria | 5155 |
| 79 | Ga0055526_1009627 | 3300003771 | Bacteria | 4618 |
| 80 | Ga0055526_1010985 | 3300003771 | Bacteria | 4137 |
| 81 | Ga0055526_1025466 | 3300003771 | Bacteria | 1897 |
| 82 | Ga0055524_1000035 | 3300003775 | Bacteria | 174636 |
| 83 | Ga0055524_1002113 | 3300003775 | Bacteria | 10499 |
| 84 | Ga0055524_1002391 | 3300003775 | Bacteria | 9723 |
| 85 | Ga0055524_1003568 | 3300003775 | Bacteria | 7502 |
| 86 | Ga0055524_1007500 | 3300003775 | Bacteria | 4620 |
| 87 | Ga0055524_1009140 | 3300003775 | Bacteria | 4056 |
| 88 | Ga0055524_1011053 | 3300003775 | Bacteria | 3553 |
| 89 | Ga0055524_1013589 | 3300003775 | Bacteria | 3065 |
| 90 | Ga0055536_1005413 | 3300003781 | Bacteria | 6251 |
| 91 | Ga0055528_1001604 | 3300003790 | Bacteria | 13372 |
| 92 | Ga0055528_1002265 | 3300003790 | Bacteria | 10440 |
| 93 | Ga0055528_1007370 | 3300003790 | Bacteria | 4869 |
| 94 | Ga0055528_1009553 | 3300003790 | Bacteria | 4039 |
| 95 | Ga0055528_1011715 | 3300003790 | Bacteria | 3457 |
| 96 | Ga0055528_1014009 | 3300003790 | Bacteria | 2996 |
| 97 | Ga0055530_10018616 | 3300003791 | Bacteria | 2134 |
| 98 | Ga0055540_1000748 | 3300003792 | Bacteria | 22053 |
| 99 | Ga0055540_1004719 | 3300003792 | Bacteria | 6028 |
| 100 | Ga0055540_1018177 | 3300003792 | Bacteria | 1934 |
| 101 | Ga0055531_10007165 | 3300003794 | Bacteria | 6141 |
| 102 | Ga0055531_10025155 | 3300003794 | Bacteria | 2172 |
| 103 | Ga0058692_1012800 | 3300003856 | Bacteria | 1973 |
| 104 | JGI25405J52794_10002890 | 3300003911 | Bacteria | 2989 |
| 105 | Ga0055543_1000001 | 3300004625 | Bacteria | 419949 |
| 106 | Ga0055543_1000019 | 3300004625 | Bacteria | 161035 |
| 107 | Ga0055543_1000147 | 3300004625 | Bacteria | 58621 |
| 108 | Ga0055543_1000976 | 3300004625 | Bacteria | 12941 |
| 109 | Ga0055543_1012257 | 3300004625 | Bacteria | 1731 |
| 110 | Ga0058859_10007620 | 3300004798 | Bacteria | 885 |
| 111 | Ga0065165_1000049 | 3300005262 | Bacteria | 195588 |
| 112 | Ga0065165_1000180 | 3300005262 | Bacteria | 111768 |
| 113 | Ga0065165_1000714 | 3300005262 | Bacteria | 46888 |
| 114 | Ga0065165_1005412 | 3300005262 | Bacteria | 7193 |
| 115 | Ga0065165_1008068 | 3300005262 | Bacteria | 5024 |
| 116 | Ga0065165_1025717 | 3300005262 | Bacteria | 1951 |
| 117 | Ga0065165_1044964 | 3300005262 | Bacteria | 1288 |
| 118 | Ga0065717_1002161 | 3300005276 | Bacteria | 2670 |
| 119 | Ga0065716_1002870 | 3300005277 | Bacteria | 1468 |
| 120 | Ga0065712_10001072 | 3300005290 | Bacteria | 8689 |
| 121 | Ga0065712_10006568 | 3300005290 | Bacteria | 3619 |
| 122 | Ga0065715_10000559 | 3300005293 | Bacteria | 15927 |
| 123 | Ga0065715_10000988 | 3300005293 | Bacteria | 7912 |
| 124 | Ga0070658_10003419 | 3300005327 | Bacteria | 13063 |
| 125 | Ga0070658_10052232 | 3300005327 | Bacteria | 3314 |
| 126 | Ga0070658_10072315 | 3300005327 | Bacteria | 2826 |
| 127 | Ga0070676_10000174 | 3300005328 | Bacteria | 26356 |
| 128 | Ga0070676_10091025 | 3300005328 | Bacteria | 1869 |
| 129 | Ga0070676_10193627 | 3300005328 | Bacteria | 1329 |
| 130 | Ga0070683_100055976 | 3300005329 | Bacteria | 3662 |
| 131 | Ga0070683_100179465 | 3300005329 | Bacteria | 2010 |
| 132 | Ga0070683_100770555 | 3300005329 | Bacteria | 922 |
| 133 | Ga0070690_100000898 | 3300005330 | Bacteria | 15174 |
| 134 | Ga0070690_100017757 | 3300005330 | Bacteria | 4286 |
| 135 | Ga0070690_100306060 | 3300005330 | Bacteria | 1141 |
| 136 | Ga0070670_100019541 | 3300005331 | Bacteria | 5815 |
| 137 | Ga0070670_100035365 | 3300005331 | Bacteria | 4300 |
| 138 | Ga0070670_100073543 | 3300005331 | Bacteria | 2935 |
| 139 | Ga0070677_10000194 | 3300005333 | Bacteria | 20895 |
| 140 | Ga0070677_10158540 | 3300005333 | Bacteria | 1060 |
| 141 | Ga0068869_100000260 | 3300005334 | Bacteria | 27848 |
| 142 | Ga0068869_100097519 | 3300005334 | Bacteria | 2220 |
| 143 | Ga0068869_100184823 | 3300005334 | Bacteria | 1636 |
| 144 | Ga0068869_100405698 | 3300005334 | Bacteria | 1122 |
| 145 | Ga0070666_10011624 | 3300005335 | Bacteria | 5531 |
| 146 | Ga0070666_10011732 | 3300005335 | Bacteria | 5510 |
| 147 | Ga0070666_10053643 | 3300005335 | Bacteria | 2719 |
| 148 | Ga0070666_10070448 | 3300005335 | Bacteria | 2379 |
| 149 | Ga0070680_100013955 | 3300005336 | Bacteria | 6270 |
| 150 | Ga0070680_100016957 | 3300005336 | Bacteria | 5734 |
| 151 | Ga0070680_100038173 | 3300005336 | Bacteria | 3884 |
| 152 | Ga0070680_100081515 | 3300005336 | Bacteria | 2669 |
| 153 | Ga0070680_100124092 | 3300005336 | Bacteria | 2157 |
| 154 | Ga0070680_100182287 | 3300005336 | Bacteria | 1769 |
| 155 | Ga0070682_100000141 | 3300005337 | Bacteria | 57251 |
| 156 | Ga0070682_100029121 | 3300005337 | Bacteria | 3324 |
| 157 | Ga0070682_100029709 | 3300005337 | Bacteria | 3293 |
| 158 | Ga0068868_100004211 | 3300005338 | Bacteria | 10061 |
| 159 | Ga0068868_100007943 | 3300005338 | Bacteria | 7580 |
| 160 | Ga0068868_100098559 | 3300005338 | Bacteria | 2363 |
| 161 | Ga0070660_100000408 | 3300005339 | Bacteria | 28632 |
| 162 | Ga0070660_100032982 | 3300005339 | Bacteria | 3900 |
| 163 | Ga0070660_100097940 | 3300005339 | Bacteria | 2321 |
| 164 | Ga0070660_100128962 | 3300005339 | Bacteria | 2023 |
| 165 | Ga0070660_100150819 | 3300005339 | Bacteria | 1869 |
| 166 | Ga0070660_100152049 | 3300005339 | Bacteria | 1861 |
| 167 | Ga0070689_100000179 | 3300005340 | Bacteria | 38027 |
| 168 | Ga0070689_100013840 | 3300005340 | Bacteria | 5845 |
| 169 | Ga0070689_100037080 | 3300005340 | Bacteria | 3728 |
| 170 | Ga0070689_100087092 | 3300005340 | Bacteria | 2457 |
| 171 | Ga0070689_100132572 | 3300005340 | Bacteria | 1999 |
| 172 | Ga0070691_10000381 | 3300005341 | Bacteria | 16082 |
| 173 | Ga0070691_10059778 | 3300005341 | Bacteria | 1832 |
| 174 | Ga0070691_10117334 | 3300005341 | Bacteria | 1337 |
| 175 | Ga0070687_100006870 | 3300005343 | Bacteria | 4697 |
| 176 | Ga0070687_100070357 | 3300005343 | Bacteria | 1877 |
| 177 | Ga0070687_100113502 | 3300005343 | Bacteria | 1538 |
| 178 | Ga0070687_100165984 | 3300005343 | Bacteria | 1310 |
| 179 | Ga0070661_100000898 | 3300005344 | Bacteria | 21346 |
| 180 | Ga0070661_100037633 | 3300005344 | Bacteria | 3520 |
| 181 | Ga0070661_100043723 | 3300005344 | Bacteria | 3272 |
| 182 | Ga0070661_100070495 | 3300005344 | Bacteria | 2571 |
| 183 | Ga0070692_10000075 | 3300005345 | Bacteria | 20376 |
| 184 | Ga0070668_100007936 | 3300005347 | Bacteria | 7882 |
| 185 | Ga0070668_100380748 | 3300005347 | Bacteria | 1201 |
| 186 | Ga0070669_100002705 | 3300005353 | Bacteria | 12786 |
| 187 | Ga0070669_100008764 | 3300005353 | Bacteria | 7217 |
| 188 | Ga0070669_100190994 | 3300005353 | Bacteria | 1607 |
| 189 | Ga0070669_100287215 | 3300005353 | Bacteria | 1319 |
| 190 | Ga0070675_100000650 | 3300005354 | Bacteria | 24028 |
| 191 | Ga0070675_100012558 | 3300005354 | Bacteria | 6640 |
| 192 | Ga0070671_100000690 | 3300005355 | Bacteria | 24237 |
| 193 | Ga0070671_100006037 | 3300005355 | Bacteria | 9650 |
| 194 | Ga0070671_100021863 | 3300005355 | Bacteria | 5224 |
| 195 | Ga0070671_100025121 | 3300005355 | Bacteria | 4884 |
| 196 | Ga0070671_100026345 | 3300005355 | Bacteria | 4777 |
| 197 | Ga0070671_100354249 | 3300005355 | Bacteria | 1253 |
| 198 | Ga0070674_100001356 | 3300005356 | Bacteria | 12905 |
| 199 | Ga0070674_100014979 | 3300005356 | Bacteria | 4830 |
| 200 | Ga0070674_100016878 | 3300005356 | Bacteria | 4581 |
| 201 | Ga0070674_100147701 | 3300005356 | Bacteria | 1771 |
| 202 | Ga0070674_100288010 | 3300005356 | Bacteria | 1305 |
| 203 | Ga0070673_100000140 | 3300005364 | Bacteria | 34135 |
| 204 | Ga0070673_100044060 | 3300005364 | Bacteria | 3452 |
| 205 | Ga0070673_100075828 | 3300005364 | Bacteria | 2714 |
| 206 | Ga0070673_100124667 | 3300005364 | Bacteria | 2154 |
| 207 | Ga0070673_100505375 | 3300005364 | Bacteria | 1094 |
| 208 | Ga0070688_100001252 | 3300005365 | Bacteria | 12666 |
| 209 | Ga0070688_100030387 | 3300005365 | Bacteria | 3242 |
| 210 | Ga0070659_100003666 | 3300005366 | Bacteria | 10950 |
| 211 | Ga0070659_100085461 | 3300005366 | Bacteria | 2523 |
| 212 | Ga0070659_100099191 | 3300005366 | Bacteria | 2343 |
| 213 | Ga0070659_100203664 | 3300005366 | Bacteria | 1629 |
| 214 | Ga0070659_100231999 | 3300005366 | Bacteria | 1525 |
| 215 | Ga0070659_100346405 | 3300005366 | Bacteria | 1246 |
| 216 | Ga0070667_100004745 | 3300005367 | Bacteria | 11390 |
| 217 | Ga0070667_100074027 | 3300005367 | Bacteria | 2905 |
| 218 | Ga0070667_100107168 | 3300005367 | Bacteria | 2419 |
| 219 | Ga0070667_100107509 | 3300005367 | Bacteria | 2416 |
| 220 | Ga0070667_100144438 | 3300005367 | Bacteria | 2086 |
| 221 | Ga0070667_100307003 | 3300005367 | Bacteria | 1429 |
| 222 | Ga0070703_10002730 | 3300005406 | Bacteria | 5067 |
| 223 | Ga0070709_10022303 | 3300005434 | Bacteria | 3701 |
| 224 | Ga0070714_100002352 | 3300005435 | Bacteria | 13910 |
| 225 | Ga0070714_100032451 | 3300005435 | Bacteria | 4359 |
| 226 | Ga0070714_100100977 | 3300005435 | Bacteria | 2541 |
| 227 | Ga0070714_100101214 | 3300005435 | Bacteria | 2539 |
| 228 | Ga0070714_100120538 | 3300005435 | Bacteria | 2333 |
| 229 | Ga0070713_100012353 | 3300005436 | Bacteria | 6259 |
| 230 | Ga0070713_100041195 | 3300005436 | Bacteria | 3761 |
| 231 | Ga0070713_100061871 | 3300005436 | Bacteria | 3133 |
| 232 | Ga0070713_100103742 | 3300005436 | Bacteria | 2468 |
| 233 | Ga0070713_100147078 | 3300005436 | Bacteria | 2092 |
| 234 | Ga0070713_100293961 | 3300005436 | Bacteria | 1494 |
| 235 | Ga0070710_10034907 | 3300005437 | Bacteria | 2738 |
| 236 | Ga0070710_10126217 | 3300005437 | Bacteria | 1555 |
| 237 | Ga0070710_10282888 | 3300005437 | Bacteria | 1077 |
| 238 | Ga0070701_10000625 | 3300005438 | Bacteria | 12409 |
| 239 | Ga0070701_10016555 | 3300005438 | Bacteria | 3430 |
| 240 | Ga0070701_10064481 | 3300005438 | Bacteria | 1941 |
| 241 | Ga0070711_100112398 | 3300005439 | Bacteria | 2001 |
| 242 | Ga0070711_100134867 | 3300005439 | Bacteria | 1844 |
| 243 | Ga0070705_100004136 | 3300005440 | Bacteria | 7090 |
| 244 | Ga0070705_100021343 | 3300005440 | Bacteria | 3443 |
| 245 | Ga0070700_100013930 | 3300005441 | Bacteria | 4529 |
| 246 | Ga0070700_100128649 | 3300005441 | Bacteria | 1706 |
| 247 | Ga0070694_100000797 | 3300005444 | Bacteria | 17663 |
| 248 | Ga0070694_100003678 | 3300005444 | Bacteria | 9150 |
| 249 | Ga0070708_100453291 | 3300005445 | Bacteria | 1210 |
| 250 | Ga0070663_100003209 | 3300005455 | Bacteria | 9392 |
| 251 | Ga0070663_100014800 | 3300005455 | Bacteria | 5015 |
| 252 | Ga0070663_100106845 | 3300005455 | Bacteria | 2097 |
| 253 | Ga0070678_100000125 | 3300005456 | Bacteria | 30477 |
| 254 | Ga0070678_100029543 | 3300005456 | Bacteria | 3755 |
| 255 | Ga0070662_100006627 | 3300005457 | Bacteria | 7476 |
| 256 | Ga0070662_100046587 | 3300005457 | Bacteria | 3116 |
| 257 | Ga0070662_100143060 | 3300005457 | Bacteria | 1855 |
| 258 | Ga0070681_10003210 | 3300005458 | Bacteria | 15238 |
| 259 | Ga0070681_10025108 | 3300005458 | Bacteria | 5997 |
| 260 | Ga0070681_10070283 | 3300005458 | Bacteria | 3466 |
| 261 | Ga0070681_10193409 | 3300005458 | Bacteria | 1954 |
| 262 | Ga0070681_10232697 | 3300005458 | Bacteria | 1757 |
| 263 | Ga0068867_100000260 | 3300005459 | Bacteria | 34790 |
| 264 | Ga0068867_100134170 | 3300005459 | Bacteria | 1928 |
| 265 | Ga0070685_10000957 | 3300005466 | Bacteria | 15502 |
| 266 | Ga0070685_10014503 | 3300005466 | Bacteria | 4176 |
| 267 | Ga0070685_10062381 | 3300005466 | Bacteria | 2185 |
| 268 | Ga0070685_10103765 | 3300005466 | Bacteria | 1740 |
| 269 | Ga0070699_100010135 | 3300005518 | Bacteria | 8158 |
| 270 | Ga0070699_100068823 | 3300005518 | Bacteria | 3075 |
| 271 | Ga0070679_100001673 | 3300005530 | Bacteria | 19987 |
| 272 | Ga0070679_100007152 | 3300005530 | Bacteria | 10416 |
| 273 | Ga0070679_100066377 | 3300005530 | Bacteria | 3597 |
| 274 | Ga0070679_100077347 | 3300005530 | Bacteria | 3316 |
| 275 | Ga0070679_100097897 | 3300005530 | Bacteria | 2921 |
| 276 | Ga0070679_100152198 | 3300005530 | Bacteria | 2290 |
| 277 | Ga0070679_100201165 | 3300005530 | Bacteria | 1958 |
| 278 | Ga0070679_100322291 | 3300005530 | Bacteria | 1494 |
| 279 | Ga0070679_100421267 | 3300005530 | Bacteria | 1280 |
| 280 | Ga0070679_100505135 | 3300005530 | Bacteria | 1153 |
| 281 | Ga0070684_100000145 | 3300005535 | Bacteria | 47556 |
| 282 | Ga0070684_100050925 | 3300005535 | Bacteria | 3598 |
| 283 | Ga0070684_100074969 | 3300005535 | Bacteria | 2983 |
| 284 | Ga0070684_100396772 | 3300005535 | Bacteria | 1272 |
| 285 | Ga0070684_100807923 | 3300005535 | Bacteria | 877 |
| 286 | Ga0070697_100007057 | 3300005536 | Bacteria | 8733 |
| 287 | Ga0070697_100132361 | 3300005536 | Bacteria | 2092 |
| 288 | Ga0070697_100430363 | 3300005536 | Bacteria | 1147 |
| 289 | Ga0068853_100002655 | 3300005539 | Bacteria | 13488 |
| 290 | Ga0068853_100030677 | 3300005539 | Bacteria | 4542 |
| 291 | Ga0068853_100044363 | 3300005539 | Bacteria | 3806 |
| 292 | Ga0068853_100638603 | 3300005539 | Bacteria | 1013 |
| 293 | Ga0070672_100000307 | 3300005543 | Bacteria | 27667 |
| 294 | Ga0070672_100002417 | 3300005543 | Bacteria | 11834 |
| 295 | Ga0070672_100071053 | 3300005543 | Bacteria | 2768 |
| 296 | Ga0070672_100301741 | 3300005543 | Bacteria | 1358 |
| 297 | Ga0070686_100001373 | 3300005544 | Bacteria | 13757 |
| 298 | Ga0070686_100018296 | 3300005544 | Bacteria | 4109 |
| 299 | Ga0070686_100027342 | 3300005544 | Bacteria | 3452 |
| 300 | Ga0070686_100077584 | 3300005544 | Bacteria | 2191 |
| 301 | Ga0070686_100332265 | 3300005544 | Bacteria | 1137 |
| 302 | Ga0070695_100004808 | 3300005545 | Bacteria | 7948 |
| 303 | Ga0070695_100005884 | 3300005545 | Bacteria | 7236 |
| 304 | Ga0070695_100007987 | 3300005545 | Bacteria | 6269 |
| 305 | Ga0070695_100154710 | 3300005545 | Bacteria | 1603 |
| 306 | Ga0070696_100016423 | 3300005546 | Bacteria | 4985 |
| 307 | Ga0070696_100242783 | 3300005546 | Bacteria | 1359 |
| 308 | Ga0070693_100004447 | 3300005547 | Bacteria | 6627 |
| 309 | Ga0070693_100010465 | 3300005547 | Bacteria | 4649 |
| 310 | Ga0070693_100014012 | 3300005547 | Bacteria | 4096 |
| 311 | Ga0070693_100063637 | 3300005547 | Bacteria | 2150 |
| 312 | Ga0070665_100029923 | 3300005548 | Bacteria | 5481 |
| 313 | Ga0070665_100058162 | 3300005548 | Bacteria | 3876 |
| 314 | Ga0070665_100105556 | 3300005548 | Bacteria | 2819 |
| 315 | Ga0070665_100134505 | 3300005548 | Bacteria | 2474 |
| 316 | Ga0070665_100266074 | 3300005548 | Bacteria | 1716 |
| 317 | Ga0070665_100363407 | 3300005548 | Bacteria | 1453 |
| 318 | Ga0070704_100000971 | 3300005549 | Bacteria | 14560 |
| 319 | Ga0070704_100003196 | 3300005549 | Bacteria | 9366 |
| 320 | Ga0070704_100021004 | 3300005549 | Bacteria | 4224 |
| 321 | Ga0070704_100127670 | 3300005549 | Bacteria | 1965 |
| 322 | Ga0068855_100010074 | 3300005563 | Bacteria | 11393 |
| 323 | Ga0068855_100032994 | 3300005563 | Bacteria | 6181 |
| 324 | Ga0068855_100045548 | 3300005563 | Bacteria | 5189 |
| 325 | Ga0068855_100168322 | 3300005563 | Bacteria | 2483 |
| 326 | Ga0068855_100232873 | 3300005563 | Bacteria | 2061 |
| 327 | Ga0070664_100001196 | 3300005564 | Bacteria | 20672 |
| 328 | Ga0070664_100017176 | 3300005564 | Bacteria | 5940 |
| 329 | Ga0070664_100035333 | 3300005564 | Bacteria | 4195 |
| 330 | Ga0070664_100058190 | 3300005564 | Bacteria | 3287 |
| 331 | Ga0070664_100184368 | 3300005564 | Bacteria | 1857 |
| 332 | Ga0068857_100007702 | 3300005577 | Bacteria | 9280 |
| 333 | Ga0068857_100298575 | 3300005577 | Bacteria | 1485 |
| 334 | Ga0068854_100019924 | 3300005578 | Bacteria | 4529 |
| 335 | Ga0068854_100087720 | 3300005578 | Bacteria | 2309 |
| 336 | Ga0068854_100148738 | 3300005578 | Bacteria | 1804 |
| 337 | Ga0068856_100001970 | 3300005614 | Bacteria | 21399 |
| 338 | Ga0068856_100126899 | 3300005614 | Bacteria | 2555 |
| 339 | Ga0068856_100164389 | 3300005614 | Bacteria | 2230 |
| 340 | Ga0068856_100539635 | 3300005614 | Bacteria | 1187 |
| 341 | Ga0070702_100000318 | 3300005615 | Bacteria | 16680 |
| 342 | Ga0068852_100014756 | 3300005616 | Bacteria | 6031 |
| 343 | Ga0068852_100026811 | 3300005616 | Bacteria | 4689 |
| 344 | Ga0068852_100029311 | 3300005616 | Bacteria | 4520 |
| 345 | Ga0068852_100034218 | 3300005616 | Bacteria | 4226 |
| 346 | Ga0068852_100043249 | 3300005616 | Bacteria | 3819 |
| 347 | Ga0068852_100214745 | 3300005616 | Bacteria | 1827 |
| 348 | Ga0068859_100008171 | 3300005617 | Bacteria | 10616 |
| 349 | Ga0068859_100029050 | 3300005617 | Bacteria | 5547 |
| 350 | Ga0068859_100172295 | 3300005617 | Bacteria | 2245 |
| 351 | Ga0068859_100434766 | 3300005617 | Bacteria | 1409 |
| 352 | Ga0068864_100005352 | 3300005618 | Bacteria | 10515 |
| 353 | Ga0068864_100005535 | 3300005618 | Bacteria | 10355 |
| 354 | Ga0068864_100025377 | 3300005618 | Bacteria | 4990 |
| 355 | Ga0068864_100075961 | 3300005618 | Bacteria | 2934 |
| 356 | Ga0068864_100300817 | 3300005618 | Bacteria | 1502 |
| 357 | Ga0068866_10002714 | 3300005718 | Bacteria | 7303 |
| 358 | Ga0068866_10031643 | 3300005718 | Bacteria | 2550 |
| 359 | Ga0068861_100007326 | 3300005719 | Bacteria | 7559 |
| 360 | Ga0068861_100011934 | 3300005719 | Bacteria | 6050 |
| 361 | Ga0068861_100253136 | 3300005719 | Bacteria | 1504 |
| 362 | Ga0068851_10030836 | 3300005834 | Bacteria | 2661 |
| 363 | Ga0068851_10053995 | 3300005834 | Bacteria | 2046 |
| 364 | Ga0068870_10000114 | 3300005840 | Bacteria | 27448 |
| 365 | Ga0068870_10001565 | 3300005840 | Bacteria | 9301 |
| 366 | Ga0068863_100029430 | 3300005841 | Bacteria | 5242 |
| 367 | Ga0068863_100051908 | 3300005841 | Bacteria | 3886 |
| 368 | Ga0068863_100052497 | 3300005841 | Bacteria | 3863 |
| 369 | Ga0068863_100367217 | 3300005841 | Bacteria | 1404 |
| 370 | Ga0068858_100002190 | 3300005842 | Bacteria | 19792 |
| 371 | Ga0068858_100025387 | 3300005842 | Bacteria | 5513 |
| 372 | Ga0068858_100081088 | 3300005842 | Bacteria | 3015 |
| 373 | Ga0068860_100000550 | 3300005843 | Bacteria | 45703 |
| 374 | Ga0068860_100004828 | 3300005843 | Bacteria | 13727 |
| 375 | Ga0068860_100051781 | 3300005843 | Bacteria | 3905 |
| 376 | Ga0068860_100122832 | 3300005843 | Bacteria | 2488 |
| 377 | Ga0068860_100126507 | 3300005843 | Bacteria | 2449 |
| 378 | Ga0068860_100542298 | 3300005843 | Bacteria | 1165 |
| 379 | Ga0068862_100007745 | 3300005844 | Bacteria | 8883 |
| 380 | Ga0068862_100028014 | 3300005844 | Bacteria | 4744 |
| 381 | Ga0068862_100068662 | 3300005844 | Bacteria | 3058 |
| 382 | Ga0068862_100213878 | 3300005844 | Bacteria | 1743 |
| 383 | Ga0081455_10000237 | 3300005937 | Bacteria | 71335 |
| 384 | Ga0081455_10001351 | 3300005937 | Bacteria | 30344 |
| 385 | Ga0081455_10003815 | 3300005937 | Bacteria | 17198 |
| 386 | Ga0081455_10004892 | 3300005937 | Bacteria | 14844 |
| 387 | Ga0081455_10010610 | 3300005937 | Bacteria | 9322 |
| 388 | Ga0081455_10044817 | 3300005937 | Bacteria | 3853 |
| 389 | Ga0081455_10109150 | 3300005937 | Bacteria | 2202 |
| 390 | Ga0081455_10317684 | 3300005937 | Bacteria | 1111 |
| 391 | Ga0081538_10002177 | 3300005981 | Bacteria | 19445 |
| 392 | Ga0081538_10102101 | 3300005981 | Bacteria | 1440 |
| 393 | Ga0081540_1006167 | 3300005983 | Bacteria | 8793 |
| 394 | Ga0081540_1057755 | 3300005983 | Bacteria | 1874 |
| 395 | Ga0081539_10000255 | 3300005985 | Bacteria | 123054 |
| 396 | Ga0081539_10000688 | 3300005985 | Bacteria | 67723 |
| 397 | Ga0081539_10001525 | 3300005985 | Bacteria | 38837 |
| 398 | Ga0070717_10003859 | 3300006028 | Bacteria | 10778 |
| 399 | Ga0070717_10060695 | 3300006028 | Bacteria | 3131 |
| 400 | Ga0070717_10230786 | 3300006028 | Bacteria | 1629 |
| 401 | Ga0070717_10365219 | 3300006028 | Bacteria | 1293 |
| 402 | Ga0075365_10001260 | 3300006038 | Bacteria | 11231 |
| 403 | Ga0075365_10027441 | 3300006038 | Bacteria | 3624 |
| 404 | Ga0075365_10102973 | 3300006038 | Bacteria | 1956 |
| 405 | Ga0075368_10001271 | 3300006042 | Bacteria | 7995 |
| 406 | Ga0075368_10022709 | 3300006042 | Bacteria | 2389 |
| 407 | Ga0075363_100044970 | 3300006048 | Bacteria | 2341 |
| 408 | Ga0075363_100152348 | 3300006048 | Bacteria | 1305 |
| 409 | Ga0075363_100186794 | 3300006048 | Bacteria | 1181 |
| 410 | Ga0075364_10015127 | 3300006051 | Bacteria | 4778 |
| 411 | Ga0075364_10049304 | 3300006051 | Bacteria | 2745 |
| 412 | Ga0075364_10091084 | 3300006051 | Bacteria | 2023 |
| 413 | Ga0075364_10145088 | 3300006051 | Bacteria | 1598 |
| 414 | Ga0070715_10021216 | 3300006163 | Bacteria | 2516 |
| 415 | Ga0070715_10037890 | 3300006163 | Bacteria | 1998 |
| 416 | Ga0070716_100045849 | 3300006173 | Bacteria | 2457 |
| 417 | Ga0070712_100071741 | 3300006175 | Bacteria | 2479 |
| 418 | Ga0070712_100095593 | 3300006175 | Bacteria | 2186 |
| 419 | Ga0070712_100113042 | 3300006175 | Bacteria | 2030 |
| 420 | Ga0070712_100445290 | 3300006175 | Bacteria | 1077 |
| 421 | Ga0075362_10000880 | 3300006177 | Bacteria | 9098 |
| 422 | Ga0075362_10109090 | 3300006177 | Bacteria | 1301 |
| 423 | Ga0075362_10169280 | 3300006177 | Bacteria | 1055 |
| 424 | Ga0075362_10173357 | 3300006177 | Bacteria | 1043 |
| 425 | Ga0075367_10007767 | 3300006178 | Bacteria | 5516 |
| 426 | Ga0075367_10010791 | 3300006178 | Bacteria | 4812 |
| 427 | Ga0075367_10023504 | 3300006178 | Bacteria | 3469 |
| 428 | Ga0075367_10047033 | 3300006178 | Bacteria | 2537 |
| 429 | Ga0075367_10180884 | 3300006178 | Bacteria | 1315 |
| 430 | Ga0075367_10321941 | 3300006178 | Bacteria | 974 |
| 431 | Ga0075367_10394420 | 3300006178 | Bacteria | 875 |
| 432 | Ga0075369_10012303 | 3300006186 | Bacteria | 3381 |
| 433 | Ga0075369_10020793 | 3300006186 | Bacteria | 2689 |
| 434 | Ga0075427_10000718 | 3300006194 | Bacteria | 3975 |
| 435 | Ga0075366_10002163 | 3300006195 | Bacteria | 10020 |
| 436 | Ga0075366_10008391 | 3300006195 | Bacteria | 5741 |
| 437 | Ga0075366_10055826 | 3300006195 | Bacteria | 2345 |
| 438 | Ga0075366_10082552 | 3300006195 | Bacteria | 1920 |
| 439 | Ga0075366_10169878 | 3300006195 | Bacteria | 1323 |
| 440 | Ga0097621_100000010 | 3300006237 | Bacteria | 112867 |
| 441 | Ga0097621_100032153 | 3300006237 | Bacteria | 4169 |
| 442 | Ga0097621_100101351 | 3300006237 | Bacteria | 2423 |
| 443 | Ga0075370_10029947 | 3300006353 | Bacteria | 3035 |
| 444 | Ga0075370_10037466 | 3300006353 | Bacteria | 2727 |
| 445 | Ga0075370_10243124 | 3300006353 | Bacteria | 1066 |
| 446 | Ga0075370_10290360 | 3300006353 | Bacteria | 972 |
| 447 | Ga0068871_100000034 | 3300006358 | Bacteria | 71462 |
| 448 | Ga0068871_100025867 | 3300006358 | Bacteria | 4573 |
| 449 | Ga0068871_100027389 | 3300006358 | Bacteria | 4457 |
| 450 | Ga0068871_100081145 | 3300006358 | Bacteria | 2687 |
| 451 | Ga0075428_100011698 | 3300006844 | Bacteria | 9768 |
| 452 | Ga0075428_100031023 | 3300006844 | Bacteria | 5910 |
| 453 | Ga0075428_100076394 | 3300006844 | Bacteria | 3656 |
| 454 | Ga0075428_100091914 | 3300006844 | Bacteria | 3309 |
| 455 | Ga0075428_100143208 | 3300006844 | Bacteria | 2599 |
| 456 | Ga0075428_100191811 | 3300006844 | Bacteria | 2210 |
| 457 | Ga0075428_100372214 | 3300006844 | Bacteria | 1532 |
| 458 | Ga0075428_100487337 | 3300006844 | Bacteria | 1319 |
| 459 | Ga0075428_100697007 | 3300006844 | Bacteria | 1082 |
| 460 | Ga0075430_100005198 | 3300006846 | Bacteria | 10968 |
| 461 | Ga0075430_100040340 | 3300006846 | Bacteria | 3952 |
| 462 | Ga0075430_100061692 | 3300006846 | Bacteria | 3150 |
| 463 | Ga0075430_100387236 | 3300006846 | Bacteria | 1154 |
| 464 | Ga0075431_100000053 | 3300006847 | Bacteria | 62977 |
| 465 | Ga0075431_100014358 | 3300006847 | Bacteria | 8010 |
| 466 | Ga0075431_100024458 | 3300006847 | Bacteria | 6190 |
| 467 | Ga0075431_100041304 | 3300006847 | Bacteria | 4754 |
| 468 | Ga0075431_100270486 | 3300006847 | Bacteria | 1722 |
| 469 | Ga0075433_10010531 | 3300006852 | Bacteria | 7429 |
| 470 | Ga0075434_100000565 | 3300006871 | Bacteria | 28492 |
| 471 | Ga0075434_100016837 | 3300006871 | Bacteria | 7032 |
| 472 | Ga0075434_100059853 | 3300006871 | Bacteria | 3787 |
| 473 | Ga0075434_100081291 | 3300006871 | Bacteria | 3237 |
| 474 | Ga0075434_100123199 | 3300006871 | Bacteria | 2608 |
| 475 | Ga0075434_100162138 | 3300006871 | Bacteria | 2256 |
| 476 | Ga0075434_100377181 | 3300006871 | Bacteria | 1439 |
| 477 | Ga0075434_100481160 | 3300006871 | Bacteria | 1262 |
| 478 | Ga0075429_100004570 | 3300006880 | Bacteria | 11894 |
| 479 | Ga0075429_100006001 | 3300006880 | Bacteria | 10504 |
| 480 | Ga0068865_100000258 | 3300006881 | Bacteria | 29404 |
| 481 | Ga0068865_100012087 | 3300006881 | Bacteria | 5426 |
| 482 | Ga0068865_100034380 | 3300006881 | Bacteria | 3400 |
| 483 | Ga0068865_100099849 | 3300006881 | Bacteria | 2123 |
| 484 | Ga0068865_100156784 | 3300006881 | Bacteria | 1732 |
| 485 | Ga0075436_100002407 | 3300006914 | Bacteria | 12902 |
| 486 | Ga0075436_100068030 | 3300006914 | Bacteria | 2461 |
| 487 | Ga0075436_100125191 | 3300006914 | Bacteria | 1800 |
| 488 | Ga0075436_100138309 | 3300006914 | Bacteria | 1711 |
| 489 | Ga0075436_100227166 | 3300006914 | Bacteria | 1325 |
| 490 | Ga0075436_100336677 | 3300006914 | Bacteria | 1086 |
| 491 | Ga0097620_100008171 | 3300006931 | Bacteria | 10616 |
| 492 | Ga0097620_100029052 | 3300006931 | Bacteria | 5547 |
| 493 | Ga0097620_100172302 | 3300006931 | Bacteria | 2245 |
| 494 | Ga0097620_100434796 | 3300006931 | Bacteria | 1409 |
| 495 | Ga0079104_1000187 | 3300006946 | Bacteria | 86957 |
| 496 | Ga0079104_1003210 | 3300006946 | Bacteria | 7879 |
| 497 | Ga0079104_1008871 | 3300006946 | Bacteria | 3459 |
| 498 | Ga0099826_10000272 | 3300006948 | Bacteria | 22976 |
| 499 | Ga0099826_10056750 | 3300006948 | Bacteria | 2581 |
| 500 | Ga0075435_100021526 | 3300007076 | Bacteria | 4960 |
| 501 | Ga0075435_100029577 | 3300007076 | Bacteria | 4300 |
| 502 | Ga0075435_100052351 | 3300007076 | Bacteria | 3291 |
| 503 | Ga0099794_10047033 | 3300007265 | Bacteria | 2068 |
| 504 | Ga0099794_10135576 | 3300007265 | Bacteria | 1245 |
| 505 | Ga0099795_10017225 | 3300007788 | Bacteria | 2300 |
| 506 | Ga0105251_10029443 | 3300009011 | Bacteria | 2766 |
| 507 | Ga0105250_10036422 | 3300009092 | Bacteria | 1975 |
| 508 | Ga0105240_10000005 | 3300009093 | Bacteria | 702630 |
| 509 | Ga0105240_10139463 | 3300009093 | Bacteria | 2900 |
| 510 | Ga0111539_10000500 | 3300009094 | Bacteria | 49951 |
| 511 | Ga0111539_10001486 | 3300009094 | Bacteria | 31308 |
| 512 | Ga0111539_10003625 | 3300009094 | Bacteria | 20338 |
| 513 | Ga0111539_10018523 | 3300009094 | Bacteria | 8625 |
| 514 | Ga0111539_10058480 | 3300009094 | Bacteria | 4574 |
| 515 | Ga0111539_10079050 | 3300009094 | Bacteria | 3869 |
| 516 | Ga0111539_10149561 | 3300009094 | Bacteria | 2733 |
| 517 | Ga0111539_10592186 | 3300009094 | Bacteria | 1291 |
| 518 | Ga0111539_10699248 | 3300009094 | Bacteria | 1180 |
| 519 | Ga0111539_11058000 | 3300009094 | Bacteria | 943 |
| 520 | Ga0105245_10003131 | 3300009098 | Bacteria | 14802 |
| 521 | Ga0105245_10106909 | 3300009098 | Bacteria | 2597 |
| 522 | Ga0105245_10256166 | 3300009098 | Bacteria | 1702 |
| 523 | Ga0105245_10303236 | 3300009098 | Bacteria | 1568 |
| 524 | Ga0105247_10002505 | 3300009101 | Bacteria | 12483 |
| 525 | Ga0105247_10010561 | 3300009101 | Bacteria | 5578 |
| 526 | Ga0105247_10023791 | 3300009101 | Bacteria | 3692 |
| 527 | Ga0105247_10092970 | 3300009101 | Bacteria | 1917 |
| 528 | Ga0105247_10099429 | 3300009101 | Bacteria | 1858 |
| 529 | Ga0114129_10000237 | 3300009147 | Bacteria | 61463 |
| 530 | Ga0114129_10006403 | 3300009147 | Bacteria | 16695 |
| 531 | Ga0114129_10033328 | 3300009147 | Bacteria | 7279 |
| 532 | Ga0114129_10190167 | 3300009147 | Bacteria | 2788 |
| 533 | Ga0114129_10197471 | 3300009147 | Bacteria | 2727 |
| 534 | Ga0114129_10224348 | 3300009147 | Bacteria | 2533 |
| 535 | Ga0114129_10589498 | 3300009147 | Bacteria | 1441 |
| 536 | Ga0114129_10662038 | 3300009147 | Bacteria | 1346 |
| 537 | Ga0105243_10015073 | 3300009148 | Bacteria | 5850 |
| 538 | Ga0105243_10016989 | 3300009148 | Bacteria | 5502 |
| 539 | Ga0105243_10017278 | 3300009148 | Bacteria | 5454 |
| 540 | Ga0105243_10088180 | 3300009148 | Bacteria | 2549 |
| 541 | Ga0105243_10169275 | 3300009148 | Bacteria | 1891 |
| 542 | Ga0105243_10245424 | 3300009148 | Bacteria | 1596 |
| 543 | Ga0105243_10275470 | 3300009148 | Bacteria | 1513 |
| 544 | Ga0105241_10001911 | 3300009174 | Bacteria | 15768 |
| 545 | Ga0105241_10048051 | 3300009174 | Bacteria | 3246 |
| 546 | Ga0105241_10370202 | 3300009174 | Bacteria | 1249 |
| 547 | Ga0105242_10000037 | 3300009176 | Bacteria | 91293 |
| 548 | Ga0105242_10025069 | 3300009176 | Bacteria | 4714 |
| 549 | Ga0105242_10054092 | 3300009176 | Bacteria | 3280 |
| 550 | Ga0105242_10155344 | 3300009176 | Bacteria | 1998 |
| 551 | Ga0105248_10002195 | 3300009177 | Bacteria | 21609 |
| 552 | Ga0105248_10027024 | 3300009177 | Bacteria | 6384 |
| 553 | Ga0105248_10064732 | 3300009177 | Bacteria | 4104 |
| 554 | Ga0105248_10195584 | 3300009177 | Bacteria | 2278 |
| 555 | Ga0105237_10001912 | 3300009545 | Bacteria | 26585 |
| 556 | Ga0105237_10063301 | 3300009545 | Bacteria | 3697 |
| 557 | Ga0105237_10674016 | 3300009545 | Bacteria | 1041 |
| 558 | Ga0105238_10023052 | 3300009551 | Bacteria | 6348 |
| 559 | Ga0105238_10032764 | 3300009551 | Bacteria | 5289 |
| 560 | Ga0105238_10091427 | 3300009551 | Bacteria | 3030 |
| 561 | Ga0105238_10096421 | 3300009551 | Bacteria | 2944 |
| 562 | Ga0105238_10124656 | 3300009551 | Bacteria | 2555 |
| 563 | Ga0105238_10129451 | 3300009551 | Bacteria | 2502 |
| 564 | Ga0105249_10000209 | 3300009553 | Bacteria | 67037 |
| 565 | Ga0105249_10033836 | 3300009553 | Bacteria | 4629 |
| 566 | Ga0105249_10067118 | 3300009553 | Bacteria | 3304 |
| 567 | Ga0105249_10240650 | 3300009553 | Bacteria | 1789 |
| 568 | Ga0105249_10304666 | 3300009553 | Bacteria | 1599 |
| 569 | Ga0123341_1000001 | 3300009765 | Bacteria | 314908 |
| 570 | Ga0123341_1059495 | 3300009765 | Bacteria | 1913 |
| 571 | Ga0123342_1014422 | 3300009766 | Bacteria | 7541 |
| 572 | Ga0123342_1014579 | 3300009766 | Bacteria | 7444 |
| 573 | Ga0105239_10006977 | 3300010375 | Bacteria | 13013 |
| 574 | Ga0105239_10007427 | 3300010375 | Bacteria | 12573 |
| 575 | Ga0105239_10009869 | 3300010375 | Bacteria | 10726 |
| 576 | Ga0105239_10028131 | 3300010375 | Bacteria | 6186 |
| 577 | Ga0105239_10194863 | 3300010375 | Bacteria | 2269 |
| 578 | Ga0105239_10358720 | 3300010375 | Bacteria | 1646 |
| 579 | Ga0105239_10430800 | 3300010375 | Bacteria | 1495 |
| 580 | Ga0105239_10871621 | 3300010375 | Bacteria | 1033 |
| 581 | Ga0105246_10000614 | 3300011119 | Bacteria | 19862 |
| 582 | Ga0105246_10058128 | 3300011119 | Bacteria | 2678 |
| 583 | Ga0105246_10299844 | 3300011119 | Bacteria | 1297 |
| 584 | Ga0105246_10328221 | 3300011119 | Bacteria | 1246 |
| 585 | Ga0157338_1001045 | 3300012515 | Bacteria | 1884 |
| 586 | Ga0157373_10016809 | 3300013100 | Bacteria | 5334 |
| 587 | Ga0157373_10030942 | 3300013100 | Bacteria | 3851 |
| 588 | Ga0157373_10035992 | 3300013100 | Bacteria | 3554 |
| 589 | Ga0157371_10000015 | 3300013102 | Bacteria | 339838 |
| 590 | Ga0157371_10015657 | 3300013102 | Bacteria | 5680 |
| 591 | Ga0157371_10121499 | 3300013102 | Bacteria | 1857 |
| 592 | Ga0157370_10002129 | 3300013104 | Bacteria | 24176 |
| 593 | Ga0157370_10002232 | 3300013104 | Bacteria | 23559 |
| 594 | Ga0157370_10238146 | 3300013104 | Bacteria | 1684 |
| 595 | Ga0157369_10037588 | 3300013105 | Bacteria | 5300 |
| 596 | Ga0157369_10223031 | 3300013105 | Bacteria | 1972 |
| 597 | Ga0157369_10306067 | 3300013105 | Bacteria | 1653 |
| 598 | Ga0157369_10405496 | 3300013105 | Bacteria | 1414 |
| 599 | Ga0157369_10490627 | 3300013105 | Bacteria | 1271 |
| 600 | Ga0157369_10623480 | 3300013105 | Bacteria | 1113 |
| 601 | Ga0171463_1011 | 3300013249 | Bacteria | 230603 |
| 602 | Ga0157374_10019131 | 3300013296 | Bacteria | 6059 |
| 603 | Ga0157374_10105303 | 3300013296 | Bacteria | 2709 |
| 604 | Ga0157378_10000566 | 3300013297 | Bacteria | 35090 |
| 605 | Ga0157378_10330184 | 3300013297 | Bacteria | 1484 |
| 606 | Ga0163162_10000896 | 3300013306 | Bacteria | 27745 |
| 607 | Ga0163162_10005353 | 3300013306 | Bacteria | 12389 |
| 608 | Ga0163162_10023128 | 3300013306 | Bacteria | 6130 |
| 609 | Ga0163162_10128458 | 3300013306 | Bacteria | 2642 |
| 610 | Ga0163162_10360712 | 3300013306 | Bacteria | 1586 |
| 611 | Ga0157372_10118899 | 3300013307 | Bacteria | 3033 |
| 612 | Ga0157372_10219645 | 3300013307 | Bacteria | 2203 |
| 613 | Ga0157372_10653491 | 3300013307 | Bacteria | 1224 |
| 614 | Ga0157372_10834172 | 3300013307 | Bacteria | 1070 |
| 615 | Ga0157375_10000263 | 3300013308 | Bacteria | 47730 |
| 616 | Ga0157375_10039237 | 3300013308 | Bacteria | 4556 |
| 617 | Ga0157375_10040699 | 3300013308 | Bacteria | 4482 |
| 618 | Ga0163163_10017489 | 3300014325 | Bacteria | 6688 |
| 619 | Ga0163163_10046941 | 3300014325 | Bacteria | 4243 |
| 620 | Ga0163163_10052731 | 3300014325 | Bacteria | 4013 |
| 621 | Ga0163163_10299537 | 3300014325 | Bacteria | 1660 |
| 622 | Ga0163163_10439922 | 3300014325 | Bacteria | 1363 |
| 623 | Ga0163163_10497105 | 3300014325 | Bacteria | 1281 |
| 624 | Ga0163163_10623630 | 3300014325 | Bacteria | 1142 |
| 625 | Ga0157380_10001922 | 3300014326 | Bacteria | 13804 |
| 626 | Ga0157380_10010005 | 3300014326 | Bacteria | 6808 |
| 627 | Ga0157380_10022136 | 3300014326 | Bacteria | 4778 |
| 628 | Ga0157377_10000214 | 3300014745 | Bacteria | 31569 |
| 629 | Ga0157377_10106629 | 3300014745 | Bacteria | 1678 |
| 630 | Ga0157379_10000666 | 3300014968 | Bacteria | 27844 |
| 631 | Ga0157379_10271196 | 3300014968 | Bacteria | 1543 |
| 632 | Ga0157379_10272658 | 3300014968 | Bacteria | 1539 |
| 633 | Ga0157379_10483455 | 3300014968 | Bacteria | 1146 |
| 634 | Ga0157376_10000879 | 3300014969 | Bacteria | 19699 |
| 635 | Ga0157376_10278371 | 3300014969 | Bacteria | 1575 |
| 636 | Ga0182007_10001634 | 3300015262 | Bacteria | 11880 |
| 637 | Ga0182005_1008240 | 3300015265 | Bacteria | 3082 |
| 638 | Ga0183365_10962 | 3300015684 | Bacteria | 1014 |
| 639 | Ga0183363_1279 | 3300015690 | Bacteria | 7796 |
| 640 | Ga0163161_10003116 | 3300017792 | Bacteria | 11693 |
| 641 | Ga0163161_10039168 | 3300017792 | Bacteria | 3401 |
| 642 | Ga0163161_10118372 | 3300017792 | Bacteria | 1988 |
| 643 | Ga0163161_10205959 | 3300017792 | Bacteria | 1518 |
| 644 | Ga0163161_10243817 | 3300017792 | Bacteria | 1398 |
| 645 | Ga0197907_10374128 | 3300020069 | Bacteria | 1502 |
| 646 | Ga0206356_10019253 | 3300020070 | Bacteria | 1823 |
| 647 | Ga0206356_11744201 | 3300020070 | Bacteria | 3758 |
| 648 | Ga0214544_1000024 | 3300021320 | Bacteria | 163562 |
| 649 | Ga0214542_1000015 | 3300021321 | Bacteria | 227912 |
| 650 | Ga0214543_1000011 | 3300021327 | Bacteria | 344093 |
| 651 | Ga0214543_1000032 | 3300021327 | Bacteria | 200766 |
| 652 | Ga0213873_10007595 | 3300021358 | Bacteria | 2180 |
| 653 | Ga0213876_10042285 | 3300021384 | Bacteria | 2408 |
| 654 | Ga0213876_10065419 | 3300021384 | Bacteria | 1919 |
| 655 | Ga0213875_10007177 | 3300021388 | Bacteria | 5787 |
| 656 | Ga0213871_10011341 | 3300021441 | Bacteria | 2045 |
| 657 | Ga0224712_10074973 | 3300022467 | Bacteria | 1383 |
| 658 | Ga0228711_1000012 | 3300022739 | Bacteria | 132594 |
| 659 | Ga0228710_1000006 | 3300022740 | Bacteria | 209134 |
| 660 | Ga0228598_1037468 | 3300024227 | Bacteria | 956 |
| 661 | Ga0209435_100022 | 3300025206 | Bacteria | 207766 |
| 662 | Ga0209436_100155 | 3300025208 | Bacteria | 32910 |
| 663 | Ga0209436_102600 | 3300025208 | Bacteria | 5306 |
| 664 | Ga0209563_107580 | 3300025230 | Bacteria | 1770 |
| 665 | Ga0209437_100153 | 3300025233 | Bacteria | 154068 |
| 666 | Ga0209437_100577 | 3300025233 | Bacteria | 23562 |
| 667 | Ga0207425_1000010 | 3300025245 | Bacteria | 572898 |
| 668 | Ga0207425_1003736 | 3300025245 | Bacteria | 4762 |
| 669 | Ga0207425_1008252 | 3300025245 | Bacteria | 2681 |
| 670 | Ga0209646_1000078 | 3300025246 | Bacteria | 207766 |
| 671 | Ga0209026_1000065 | 3300025250 | Bacteria | 207766 |
| 672 | Ga0209677_100355 | 3300025253 | Bacteria | 28569 |
| 673 | Ga0209148_1011825 | 3300025254 | Bacteria | 1612 |
| 674 | Ga0209759_1000055 | 3300025256 | Bacteria | 207766 |
| 675 | Ga0209759_1010178 | 3300025256 | Bacteria | 2776 |
| 676 | Ga0209129_1000034 | 3300025258 | Bacteria | 330950 |
| 677 | Ga0209129_1000329 | 3300025258 | Bacteria | 41319 |
| 678 | Ga0209129_1003358 | 3300025258 | Bacteria | 7041 |
| 679 | Ga0209129_1004787 | 3300025258 | Bacteria | 5112 |
| 680 | Ga0209129_1004973 | 3300025258 | Bacteria | 4921 |
| 681 | Ga0209129_1011476 | 3300025258 | Bacteria | 2111 |
| 682 | Ga0209233_1000175 | 3300025261 | Bacteria | 144221 |
| 683 | Ga0209233_1000248 | 3300025261 | Bacteria | 87812 |
| 684 | Ga0209233_1000676 | 3300025261 | Bacteria | 16375 |
| 685 | Ga0209233_1017822 | 3300025261 | Bacteria | 1925 |
| 686 | Ga0209565_1023569 | 3300025263 | Bacteria | 1263 |
| 687 | Ga0207666_1000010 | 3300025271 | Bacteria | 46973 |
| 688 | Ga0207666_1000379 | 3300025271 | Bacteria | 5888 |
| 689 | Ga0209673_1000068 | 3300025273 | Bacteria | 245891 |
| 690 | Ga0209673_1000456 | 3300025273 | Bacteria | 69267 |
| 691 | Ga0209673_1001837 | 3300025273 | Bacteria | 17367 |
| 692 | Ga0209673_1002251 | 3300025273 | Bacteria | 13913 |
| 693 | Ga0209673_1002368 | 3300025273 | Bacteria | 13243 |
| 694 | Ga0209673_1003459 | 3300025273 | Bacteria | 9294 |
| 695 | Ga0209673_1018492 | 3300025273 | Bacteria | 2532 |
| 696 | Ga0209130_1000007 | 3300025284 | Bacteria | 591584 |
| 697 | Ga0209130_1000012 | 3300025284 | Bacteria | 421329 |
| 698 | Ga0209130_1000097 | 3300025284 | Bacteria | 143750 |
| 699 | Ga0209130_1000111 | 3300025284 | Bacteria | 131855 |
| 700 | Ga0209130_1028763 | 3300025284 | Bacteria | 1164 |
| 701 | Ga0207673_1000091 | 3300025290 | Bacteria | 8127 |
| 702 | Ga0209675_1000816 | 3300025291 | Bacteria | 20520 |
| 703 | Ga0209676_1002428 | 3300025292 | Bacteria | 13266 |
| 704 | Ga0209676_1003690 | 3300025292 | Bacteria | 9152 |
| 705 | Ga0209676_1013668 | 3300025292 | Bacteria | 3106 |
| 706 | Ga0209025_1000008 | 3300025294 | Bacteria | 1130876 |
| 707 | Ga0209025_1000022 | 3300025294 | Bacteria | 574487 |
| 708 | Ga0209025_1000033 | 3300025294 | Bacteria | 414511 |
| 709 | Ga0209025_1000094 | 3300025294 | Bacteria | 241080 |
| 710 | Ga0209025_1000320 | 3300025294 | Bacteria | 106773 |
| 711 | Ga0209025_1001164 | 3300025294 | Bacteria | 37261 |
| 712 | Ga0209025_1002864 | 3300025294 | Bacteria | 17307 |
| 713 | Ga0209025_1006481 | 3300025294 | Bacteria | 9062 |
| 714 | Ga0209025_1024154 | 3300025294 | Bacteria | 3149 |
| 715 | Ga0209025_1046094 | 3300025294 | Bacteria | 1798 |
| 716 | Ga0209564_1000049 | 3300025295 | Bacteria | 362075 |
| 717 | Ga0209564_1000054 | 3300025295 | Bacteria | 350653 |
| 718 | Ga0209564_1000140 | 3300025295 | Bacteria | 179856 |
| 719 | Ga0209564_1000453 | 3300025295 | Bacteria | 69474 |
| 720 | Ga0209564_1002007 | 3300025295 | Bacteria | 17768 |
| 721 | Ga0209564_1003996 | 3300025295 | Bacteria | 9357 |
| 722 | Ga0209564_1004499 | 3300025295 | Bacteria | 8501 |
| 723 | Ga0209564_1014707 | 3300025295 | Bacteria | 3234 |
| 724 | Ga0209758_1000086 | 3300025297 | Bacteria | 254778 |
| 725 | Ga0209758_1000155 | 3300025297 | Bacteria | 160455 |
| 726 | Ga0209758_1001803 | 3300025297 | Bacteria | 23651 |
| 727 | Ga0209758_1001857 | 3300025297 | Bacteria | 23182 |
| 728 | Ga0209758_1002012 | 3300025297 | Bacteria | 21869 |
| 729 | Ga0209758_1002381 | 3300025297 | Bacteria | 19357 |
| 730 | Ga0209758_1006966 | 3300025297 | Bacteria | 7879 |
| 731 | Ga0209758_1011351 | 3300025297 | Bacteria | 5173 |
| 732 | Ga0209758_1012175 | 3300025297 | Bacteria | 4852 |
| 733 | Ga0209758_1016148 | 3300025297 | Bacteria | 3808 |
| 734 | Ga0209050_1003731 | 3300025298 | Bacteria | 10954 |
| 735 | Ga0209050_1007606 | 3300025298 | Bacteria | 6020 |
| 736 | Ga0209050_1018005 | 3300025298 | Bacteria | 2776 |
| 737 | Ga0209256_1000014 | 3300025299 | Bacteria | 687409 |
| 738 | Ga0209256_1000319 | 3300025299 | Bacteria | 82827 |
| 739 | Ga0209256_1000836 | 3300025299 | Bacteria | 38702 |
| 740 | Ga0209256_1001441 | 3300025299 | Bacteria | 24594 |
| 741 | Ga0209256_1001576 | 3300025299 | Bacteria | 22391 |
| 742 | Ga0209256_1003708 | 3300025299 | Bacteria | 10376 |
| 743 | Ga0209256_1004027 | 3300025299 | Bacteria | 9590 |
| 744 | Ga0209256_1013705 | 3300025299 | Bacteria | 2987 |
| 745 | Ga0209256_1021989 | 3300025299 | Bacteria | 1943 |
| 746 | Ga0207426_1000003 | 3300025302 | Bacteria | 1063212 |
| 747 | Ga0207426_1000010 | 3300025302 | Bacteria | 796003 |
| 748 | Ga0207426_1000094 | 3300025302 | Bacteria | 275293 |
| 749 | Ga0207426_1000111 | 3300025302 | Bacteria | 234032 |
| 750 | Ga0207426_1005192 | 3300025302 | Bacteria | 6050 |
| 751 | Ga0207426_1027328 | 3300025302 | Bacteria | 1902 |
| 752 | Ga0207426_1043572 | 3300025302 | Bacteria | 1377 |
| 753 | Ga0209051_1001055 | 3300025303 | Bacteria | 25767 |
| 754 | Ga0209051_1002245 | 3300025303 | Bacteria | 14201 |
| 755 | Ga0209051_1010194 | 3300025303 | Bacteria | 4776 |
| 756 | Ga0209051_1017610 | 3300025303 | Bacteria | 3188 |
| 757 | Ga0209257_1002064 | 3300025304 | Bacteria | 21210 |
| 758 | Ga0209257_1003261 | 3300025304 | Bacteria | 14200 |
| 759 | Ga0209257_1008688 | 3300025304 | Bacteria | 5681 |
| 760 | Ga0209257_1033156 | 3300025304 | Bacteria | 1628 |
| 761 | Ga0207697_10000424 | 3300025315 | Bacteria | 23811 |
| 762 | Ga0207697_10005789 | 3300025315 | Bacteria | 5697 |
| 763 | Ga0207656_10019037 | 3300025321 | Bacteria | 2712 |
| 764 | Ga0207656_10082012 | 3300025321 | Bacteria | 1451 |
| 765 | Ga0207696_1023741 | 3300025711 | Bacteria | 1930 |
| 766 | Ga0207653_10007266 | 3300025885 | Bacteria | 3455 |
| 767 | Ga0207682_10000035 | 3300025893 | Bacteria | 56611 |
| 768 | Ga0207692_10001776 | 3300025898 | Bacteria | 8187 |
| 769 | Ga0207692_10034699 | 3300025898 | Bacteria | 2444 |
| 770 | Ga0207692_10117796 | 3300025898 | Bacteria | 1483 |
| 771 | Ga0207642_10002311 | 3300025899 | Bacteria | 5941 |
| 772 | Ga0207710_10017802 | 3300025900 | Bacteria | 3016 |
| 773 | Ga0207688_10000881 | 3300025901 | Bacteria | 15161 |
| 774 | Ga0207688_10002888 | 3300025901 | Bacteria | 9337 |
| 775 | Ga0207688_10051209 | 3300025901 | Bacteria | 2313 |
| 776 | Ga0207688_10124428 | 3300025901 | Bacteria | 1507 |
| 777 | Ga0207688_10170247 | 3300025901 | Bacteria | 1295 |
| 778 | Ga0207680_10003962 | 3300025903 | Bacteria | 6988 |
| 779 | Ga0207680_10024905 | 3300025903 | Bacteria | 3293 |
| 780 | Ga0207680_10025139 | 3300025903 | Bacteria | 3281 |
| 781 | Ga0207680_10138629 | 3300025903 | Bacteria | 1611 |
| 782 | Ga0207647_10005370 | 3300025904 | Bacteria | 9418 |
| 783 | Ga0207647_10017164 | 3300025904 | Bacteria | 4925 |
| 784 | Ga0207647_10047610 | 3300025904 | Bacteria | 2666 |
| 785 | Ga0207647_10144788 | 3300025904 | Bacteria | 1391 |
| 786 | Ga0207685_10011259 | 3300025905 | Bacteria | 2681 |
| 787 | Ga0207685_10221766 | 3300025905 | Bacteria | 900 |
| 788 | Ga0207699_10000837 | 3300025906 | Bacteria | 14654 |
| 789 | Ga0207699_10288406 | 3300025906 | Bacteria | 1143 |
| 790 | Ga0207645_10005339 | 3300025907 | Bacteria | 9340 |
| 791 | Ga0207645_10048611 | 3300025907 | Bacteria | 2709 |
| 792 | Ga0207645_10129898 | 3300025907 | Bacteria | 1639 |
| 793 | Ga0207645_10162128 | 3300025907 | Bacteria | 1463 |
| 794 | Ga0207643_10000147 | 3300025908 | Bacteria | 48010 |
| 795 | Ga0207643_10044142 | 3300025908 | Bacteria | 2516 |
| 796 | Ga0207654_10001288 | 3300025911 | Bacteria | 13343 |
| 797 | Ga0207654_10157774 | 3300025911 | Bacteria | 1463 |
| 798 | Ga0207654_10355604 | 3300025911 | Bacteria | 1009 |
| 799 | Ga0207707_10009366 | 3300025912 | Bacteria | 8496 |
| 800 | Ga0207707_10039324 | 3300025912 | Bacteria | 4135 |
| 801 | Ga0207707_10080096 | 3300025912 | Bacteria | 2852 |
| 802 | Ga0207707_10381333 | 3300025912 | Bacteria | 1212 |
| 803 | Ga0207695_10000011 | 3300025913 | Bacteria | 910221 |
| 804 | Ga0207695_10163070 | 3300025913 | Bacteria | 2159 |
| 805 | Ga0207671_10000276 | 3300025914 | Bacteria | 76490 |
| 806 | Ga0207671_10017241 | 3300025914 | Bacteria | 5577 |
| 807 | Ga0207693_10002714 | 3300025915 | Bacteria | 15344 |
| 808 | Ga0207693_10005189 | 3300025915 | Bacteria | 10906 |
| 809 | Ga0207693_10016626 | 3300025915 | Bacteria | 5877 |
| 810 | Ga0207693_10051743 | 3300025915 | Bacteria | 3222 |
| 811 | Ga0207693_10083006 | 3300025915 | Bacteria | 2509 |
| 812 | Ga0207693_10129901 | 3300025915 | Bacteria | 1980 |
| 813 | Ga0207663_10021096 | 3300025916 | Bacteria | 3702 |
| 814 | Ga0207663_10092998 | 3300025916 | Bacteria | 2006 |
| 815 | Ga0207663_10125232 | 3300025916 | Bacteria | 1766 |
| 816 | Ga0207663_10189864 | 3300025916 | Bacteria | 1474 |
| 817 | Ga0207660_10001257 | 3300025917 | Bacteria | 16994 |
| 818 | Ga0207660_10016618 | 3300025917 | Bacteria | 4875 |
| 819 | Ga0207660_10055630 | 3300025917 | Bacteria | 2828 |
| 820 | Ga0207660_10121584 | 3300025917 | Bacteria | 1978 |
| 821 | Ga0207660_10125900 | 3300025917 | Bacteria | 1946 |
| 822 | Ga0207660_10190343 | 3300025917 | Bacteria | 1597 |
| 823 | Ga0207662_10000948 | 3300025918 | Bacteria | 13473 |
| 824 | Ga0207662_10006511 | 3300025918 | Bacteria | 6309 |
| 825 | Ga0207662_10036523 | 3300025918 | Bacteria | 2872 |
| 826 | Ga0207662_10081795 | 3300025918 | Bacteria | 1972 |
| 827 | Ga0207657_10007742 | 3300025919 | Bacteria | 10971 |
| 828 | Ga0207657_10032905 | 3300025919 | Bacteria | 4678 |
| 829 | Ga0207657_10043825 | 3300025919 | Bacteria | 3938 |
| 830 | Ga0207657_10067846 | 3300025919 | Bacteria | 3031 |
| 831 | Ga0207657_10089414 | 3300025919 | Bacteria | 2573 |
| 832 | Ga0207657_10189412 | 3300025919 | Bacteria | 1660 |
| 833 | Ga0207649_10000585 | 3300025920 | Bacteria | 24862 |
| 834 | Ga0207649_10036183 | 3300025920 | Bacteria | 2972 |
| 835 | Ga0207649_10349266 | 3300025920 | Bacteria | 1094 |
| 836 | Ga0207652_10006627 | 3300025921 | Bacteria | 9330 |
| 837 | Ga0207652_10047555 | 3300025921 | Bacteria | 3665 |
| 838 | Ga0207652_10085671 | 3300025921 | Bacteria | 2761 |
| 839 | Ga0207652_10145164 | 3300025921 | Bacteria | 2123 |
| 840 | Ga0207652_10168657 | 3300025921 | Bacteria | 1964 |
| 841 | Ga0207652_10205860 | 3300025921 | Bacteria | 1771 |
| 842 | Ga0207652_10298565 | 3300025921 | Bacteria | 1454 |
| 843 | Ga0207652_10409805 | 3300025921 | Bacteria | 1223 |
| 844 | Ga0207652_10545141 | 3300025921 | Bacteria | 1043 |
| 845 | Ga0207681_10002111 | 3300025923 | Bacteria | 12735 |
| 846 | Ga0207681_10130434 | 3300025923 | Bacteria | 1858 |
| 847 | Ga0207681_10183774 | 3300025923 | Bacteria | 1594 |
| 848 | Ga0207681_10475094 | 3300025923 | Bacteria | 1020 |
| 849 | Ga0207694_10015318 | 3300025924 | Bacteria | 5785 |
| 850 | Ga0207694_10074045 | 3300025924 | Bacteria | 2665 |
| 851 | Ga0207694_10101058 | 3300025924 | Bacteria | 2285 |
| 852 | Ga0207694_10136436 | 3300025924 | Bacteria | 1971 |
| 853 | Ga0207694_10196832 | 3300025924 | Bacteria | 1639 |
| 854 | Ga0207650_10012089 | 3300025925 | Bacteria | 5952 |
| 855 | Ga0207650_10167415 | 3300025925 | Bacteria | 1745 |
| 856 | Ga0207650_10352665 | 3300025925 | Bacteria | 1211 |
| 857 | Ga0207650_10360305 | 3300025925 | Bacteria | 1198 |
| 858 | Ga0207650_10427307 | 3300025925 | Bacteria | 1100 |
| 859 | Ga0207659_10002165 | 3300025926 | Bacteria | 11667 |
| 860 | Ga0207659_10076698 | 3300025926 | Bacteria | 2458 |
| 861 | Ga0207659_10109562 | 3300025926 | Bacteria | 2096 |
| 862 | Ga0207687_10000373 | 3300025927 | Bacteria | 29973 |
| 863 | Ga0207687_10005010 | 3300025927 | Bacteria | 8770 |
| 864 | Ga0207687_10008125 | 3300025927 | Bacteria | 6869 |
| 865 | Ga0207687_10344062 | 3300025927 | Bacteria | 1213 |
| 866 | Ga0207687_10477608 | 3300025927 | Bacteria | 1037 |
| 867 | Ga0207700_10000775 | 3300025928 | Bacteria | 18424 |
| 868 | Ga0207700_10026723 | 3300025928 | Bacteria | 4029 |
| 869 | Ga0207700_10109700 | 3300025928 | Bacteria | 2218 |
| 870 | Ga0207700_10184038 | 3300025928 | Bacteria | 1751 |
| 871 | Ga0207664_10003741 | 3300025929 | Bacteria | 10217 |
| 872 | Ga0207664_10206437 | 3300025929 | Bacteria | 1698 |
| 873 | Ga0207664_10209220 | 3300025929 | Bacteria | 1687 |
| 874 | Ga0207664_10306496 | 3300025929 | Bacteria | 1398 |
| 875 | Ga0207644_10009611 | 3300025931 | Bacteria | 6351 |
| 876 | Ga0207644_10055330 | 3300025931 | Bacteria | 2859 |
| 877 | Ga0207644_10209932 | 3300025931 | Bacteria | 1539 |
| 878 | Ga0207644_10217076 | 3300025931 | Bacteria | 1514 |
| 879 | Ga0207690_10021242 | 3300025932 | Bacteria | 4023 |
| 880 | Ga0207690_10038897 | 3300025932 | Bacteria | 3099 |
| 881 | Ga0207690_10070123 | 3300025932 | Bacteria | 2413 |
| 882 | Ga0207706_10008770 | 3300025933 | Bacteria | 9306 |
| 883 | Ga0207706_10016119 | 3300025933 | Bacteria | 6751 |
| 884 | Ga0207706_10020035 | 3300025933 | Bacteria | 6010 |
| 885 | Ga0207706_10026140 | 3300025933 | Bacteria | 5225 |
| 886 | Ga0207706_10047431 | 3300025933 | Bacteria | 3800 |
| 887 | Ga0207706_10167736 | 3300025933 | Bacteria | 1929 |
| 888 | Ga0207686_10009442 | 3300025934 | Bacteria | 5293 |
| 889 | Ga0207686_10035794 | 3300025934 | Bacteria | 2983 |
| 890 | Ga0207686_10076834 | 3300025934 | Bacteria | 2166 |
| 891 | Ga0207686_10168759 | 3300025934 | Bacteria | 1541 |
| 892 | Ga0207709_10000374 | 3300025935 | Bacteria | 45115 |
| 893 | Ga0207709_10017540 | 3300025935 | Bacteria | 3996 |
| 894 | Ga0207709_10021587 | 3300025935 | Bacteria | 3646 |
| 895 | Ga0207709_10125408 | 3300025935 | Bacteria | 1741 |
| 896 | Ga0207709_10173341 | 3300025935 | Bacteria | 1516 |
| 897 | Ga0207709_10181873 | 3300025935 | Bacteria | 1485 |
| 898 | Ga0207670_10007805 | 3300025936 | Bacteria | 6004 |
| 899 | Ga0207670_10102406 | 3300025936 | Bacteria | 2047 |
| 900 | Ga0207670_10128852 | 3300025936 | Bacteria | 1850 |
| 901 | Ga0207670_10148665 | 3300025936 | Bacteria | 1735 |
| 902 | Ga0207670_10149307 | 3300025936 | Bacteria | 1732 |
| 903 | Ga0207669_10000587 | 3300025937 | Bacteria | 15820 |
| 904 | Ga0207669_10017820 | 3300025937 | Bacteria | 3653 |
| 905 | Ga0207669_10045017 | 3300025937 | Bacteria | 2597 |
| 906 | Ga0207669_10163585 | 3300025937 | Bacteria | 1575 |
| 907 | Ga0207669_10525931 | 3300025937 | Bacteria | 950 |
| 908 | Ga0207704_10000119 | 3300025938 | Bacteria | 43208 |
| 909 | Ga0207704_10048507 | 3300025938 | Bacteria | 2546 |
| 910 | Ga0207704_10114392 | 3300025938 | Bacteria | 1832 |
| 911 | Ga0207665_10000654 | 3300025939 | Bacteria | 23305 |
| 912 | Ga0207665_10034498 | 3300025939 | Bacteria | 3357 |
| 913 | Ga0207665_10441157 | 3300025939 | Bacteria | 997 |
| 914 | Ga0207691_10002396 | 3300025940 | Bacteria | 18341 |
| 915 | Ga0207691_10009502 | 3300025940 | Bacteria | 9337 |
| 916 | Ga0207691_10025977 | 3300025940 | Bacteria | 5496 |
| 917 | Ga0207691_10047431 | 3300025940 | Bacteria | 3942 |
| 918 | Ga0207711_10004053 | 3300025941 | Bacteria | 12576 |
| 919 | Ga0207711_10004447 | 3300025941 | Bacteria | 11946 |
| 920 | Ga0207711_10006173 | 3300025941 | Bacteria | 10125 |
| 921 | Ga0207711_10088037 | 3300025941 | Bacteria | 2726 |
| 922 | Ga0207711_10240675 | 3300025941 | Bacteria | 1659 |
| 923 | Ga0207711_10289889 | 3300025941 | Bacteria | 1508 |
| 924 | Ga0207711_10292550 | 3300025941 | Bacteria | 1501 |
| 925 | Ga0207689_10002861 | 3300025942 | Bacteria | 15909 |
| 926 | Ga0207689_10002971 | 3300025942 | Bacteria | 15641 |
| 927 | Ga0207689_10026454 | 3300025942 | Bacteria | 4858 |
| 928 | Ga0207689_10094496 | 3300025942 | Bacteria | 2456 |
| 929 | Ga0207661_10001255 | 3300025944 | Bacteria | 16972 |
| 930 | Ga0207661_10153493 | 3300025944 | Bacteria | 1992 |
| 931 | Ga0207661_10709749 | 3300025944 | Bacteria | 925 |
| 932 | Ga0207679_10000224 | 3300025945 | Bacteria | 44681 |
| 933 | Ga0207679_10012758 | 3300025945 | Bacteria | 5489 |
| 934 | Ga0207679_10125973 | 3300025945 | Bacteria | 2047 |
| 935 | Ga0207679_10334582 | 3300025945 | Bacteria | 1315 |
| 936 | Ga0207667_10053003 | 3300025949 | Bacteria | 4269 |
| 937 | Ga0207667_10075762 | 3300025949 | Bacteria | 3493 |
| 938 | Ga0207667_10132526 | 3300025949 | Bacteria | 2567 |
| 939 | Ga0207667_10393999 | 3300025949 | Bacteria | 1410 |
| 940 | Ga0207651_10000400 | 3300025960 | Bacteria | 18316 |
| 941 | Ga0207651_10032914 | 3300025960 | Bacteria | 3336 |
| 942 | Ga0207651_10065661 | 3300025960 | Bacteria | 2546 |
| 943 | Ga0207712_10002420 | 3300025961 | Bacteria | 12064 |
| 944 | Ga0207712_10011143 | 3300025961 | Bacteria | 5724 |
| 945 | Ga0207712_10072600 | 3300025961 | Bacteria | 2479 |
| 946 | Ga0207712_10102636 | 3300025961 | Bacteria | 2129 |
| 947 | Ga0207712_10126556 | 3300025961 | Bacteria | 1941 |
| 948 | Ga0207712_10151793 | 3300025961 | Bacteria | 1790 |
| 949 | Ga0207712_10188288 | 3300025961 | Bacteria | 1627 |
| 950 | Ga0207712_10346845 | 3300025961 | Bacteria | 1233 |
| 951 | Ga0207668_10000698 | 3300025972 | Bacteria | 20584 |
| 952 | Ga0207668_10034833 | 3300025972 | Bacteria | 3347 |
| 953 | Ga0207668_10081745 | 3300025972 | Bacteria | 2345 |
| 954 | Ga0207668_10085169 | 3300025972 | Bacteria | 2305 |
| 955 | Ga0207668_10092027 | 3300025972 | Bacteria | 2231 |
| 956 | Ga0207668_10254092 | 3300025972 | Bacteria | 1429 |
| 957 | Ga0207640_10002531 | 3300025981 | Bacteria | 9796 |
| 958 | Ga0207640_10068098 | 3300025981 | Bacteria | 2384 |
| 959 | Ga0207640_10124525 | 3300025981 | Bacteria | 1853 |
| 960 | Ga0207658_10010812 | 3300025986 | Bacteria | 6209 |
| 961 | Ga0207658_10077886 | 3300025986 | Bacteria | 2531 |
| 962 | Ga0207658_10406356 | 3300025986 | Bacteria | 1198 |
| 963 | Ga0207677_10001410 | 3300026023 | Bacteria | 12805 |
| 964 | Ga0207677_10015387 | 3300026023 | Bacteria | 4499 |
| 965 | Ga0207703_10001072 | 3300026035 | Bacteria | 26068 |
| 966 | Ga0207703_10007803 | 3300026035 | Bacteria | 8471 |
| 967 | Ga0207703_10011414 | 3300026035 | Bacteria | 6908 |
| 968 | Ga0207703_10126880 | 3300026035 | Bacteria | 2198 |
| 969 | Ga0207703_10369561 | 3300026035 | Bacteria | 1324 |
| 970 | Ga0207639_10000756 | 3300026041 | Bacteria | 22035 |
| 971 | Ga0207639_10132081 | 3300026041 | Bacteria | 2068 |
| 972 | Ga0207639_10210546 | 3300026041 | Bacteria | 1673 |
| 973 | Ga0207639_10265413 | 3300026041 | Bacteria | 1503 |
| 974 | Ga0207678_10002752 | 3300026067 | Bacteria | 15926 |
| 975 | Ga0207678_10019314 | 3300026067 | Bacteria | 5986 |
| 976 | Ga0207678_10032254 | 3300026067 | Bacteria | 4565 |
| 977 | Ga0207678_10033690 | 3300026067 | Bacteria | 4462 |
| 978 | Ga0207678_10054803 | 3300026067 | Bacteria | 3434 |
| 979 | Ga0207708_10004096 | 3300026075 | Bacteria | 10726 |
| 980 | Ga0207708_10009115 | 3300026075 | Bacteria | 7343 |
| 981 | Ga0207708_10021777 | 3300026075 | Bacteria | 4837 |
| 982 | Ga0207702_10065778 | 3300026078 | Bacteria | 3106 |
| 983 | Ga0207641_10002800 | 3300026088 | Bacteria | 15876 |
| 984 | Ga0207641_10116629 | 3300026088 | Bacteria | 2376 |
| 985 | Ga0207641_10213424 | 3300026088 | Bacteria | 1786 |
| 986 | Ga0207641_10272044 | 3300026088 | Bacteria | 1590 |
| 987 | Ga0207641_10466644 | 3300026088 | Bacteria | 1222 |
| 988 | Ga0207648_10005710 | 3300026089 | Bacteria | 12470 |
| 989 | Ga0207648_10009523 | 3300026089 | Bacteria | 9295 |
| 990 | Ga0207676_10000347 | 3300026095 | Bacteria | 39680 |
| 991 | Ga0207676_10002836 | 3300026095 | Bacteria | 12332 |
| 992 | Ga0207676_10045167 | 3300026095 | Bacteria | 3402 |
| 993 | Ga0207676_10246476 | 3300026095 | Bacteria | 1606 |
| 994 | Ga0207676_10603834 | 3300026095 | Bacteria | 1054 |
| 995 | Ga0207676_10717307 | 3300026095 | Bacteria | 970 |
| 996 | Ga0207674_10000608 | 3300026116 | Bacteria | 46971 |
| 997 | Ga0207674_10203368 | 3300026116 | Bacteria | 1930 |
| 998 | Ga0207674_10277790 | 3300026116 | Bacteria | 1622 |
| 999 | Ga0207674_10315933 | 3300026116 | Bacteria | 1511 |
| 1000 | Ga0207675_100003249 | 3300026118 | Bacteria | 15927 |
| 1001 | Ga0207675_100004191 | 3300026118 | Bacteria | 13954 |
| 1002 | Ga0207675_100027599 | 3300026118 | Bacteria | 5288 |
| 1003 | Ga0207675_100307900 | 3300026118 | Bacteria | 1544 |
| 1004 | Ga0207683_10000082 | 3300026121 | Bacteria | 74842 |
| 1005 | Ga0207683_10001639 | 3300026121 | Bacteria | 20049 |
| 1006 | Ga0207683_10005386 | 3300026121 | Bacteria | 10966 |
| 1007 | Ga0207683_10008081 | 3300026121 | Bacteria | 8999 |
| 1008 | Ga0207683_10287967 | 3300026121 | Bacteria | 1502 |
| 1009 | Ga0207698_10004048 | 3300026142 | Bacteria | 8902 |
| 1010 | Ga0207698_10030646 | 3300026142 | Bacteria | 3872 |
| 1011 | Ga0207698_10149564 | 3300026142 | Bacteria | 2024 |
| 1012 | Ga0207698_10206254 | 3300026142 | Bacteria | 1764 |
| 1013 | Ga0207698_10318487 | 3300026142 | Bacteria | 1455 |
| 1014 | Ga0209281_1000268 | 3300027111 | Bacteria | 100508 |
| 1015 | Ga0209281_1000310 | 3300027111 | Bacteria | 87212 |
| 1016 | Ga0209281_1001674 | 3300027111 | Bacteria | 11676 |
| 1017 | Ga0209371_1000021 | 3300027312 | Bacteria | 555864 |
| 1018 | Ga0209371_1000698 | 3300027312 | Bacteria | 28446 |
| 1019 | Ga0209371_1011725 | 3300027312 | Bacteria | 2582 |
| 1020 | Ga0209179_1001507 | 3300027512 | Bacteria | 2876 |
| 1021 | Ga0210002_1001110 | 3300027617 | Bacteria | 3743 |
| 1022 | Ga0209983_1002766 | 3300027665 | Bacteria | 3804 |
| 1023 | Ga0209282_1000026 | 3300027666 | Bacteria | 166272 |
| 1024 | Ga0209282_1000300 | 3300027666 | Bacteria | 24486 |
| 1025 | Ga0209282_1045429 | 3300027666 | Bacteria | 2570 |
| 1026 | Ga0209971_1013067 | 3300027682 | Bacteria | 1967 |
| 1027 | Ga0209966_1004480 | 3300027695 | Bacteria | 2368 |
| 1028 | Ga0209998_10001378 | 3300027717 | Bacteria | 5895 |
| 1029 | Ga0209998_10002981 | 3300027717 | Bacteria | 3770 |
| 1030 | Ga0209813_10008474 | 3300027866 | Bacteria | 2600 |
| 1031 | Ga0209813_10012073 | 3300027866 | Bacteria | 2273 |
| 1032 | Ga0209974_10001218 | 3300027876 | Bacteria | 9206 |
| 1033 | Ga0207428_10000256 | 3300027907 | Bacteria | 72918 |
| 1034 | Ga0207428_10000338 | 3300027907 | Bacteria | 60937 |
| 1035 | Ga0207428_10000804 | 3300027907 | Bacteria | 35481 |
| 1036 | Ga0207428_10017874 | 3300027907 | Bacteria | 6078 |
| 1037 | Ga0207428_10049144 | 3300027907 | Bacteria | 3381 |
| 1038 | Ga0207428_10355749 | 3300027907 | Bacteria | 1077 |
| 1039 | Ga0265357_1001835 | 3300028023 | Bacteria | 1638 |
| 1040 | Ga0268266_10021269 | 3300028379 | Bacteria | 5527 |
| 1041 | Ga0268266_10061600 | 3300028379 | Bacteria | 3236 |
| 1042 | Ga0268266_10542742 | 3300028379 | Bacteria | 1113 |
| 1043 | Ga0268266_10680030 | 3300028379 | Bacteria | 991 |
| 1044 | Ga0268265_10003525 | 3300028380 | Bacteria | 11193 |
| 1045 | Ga0268265_10123681 | 3300028380 | Bacteria | 2136 |
| 1046 | Ga0268265_10145857 | 3300028380 | Bacteria | 1989 |
| 1047 | Ga0268265_10191916 | 3300028380 | Bacteria | 1765 |
| 1048 | Ga0268265_10302611 | 3300028380 | Bacteria | 1440 |
| 1049 | Ga0268264_10000762 | 3300028381 | Bacteria | 35963 |
| 1050 | Ga0268264_10019150 | 3300028381 | Bacteria | 5595 |
| 1051 | Ga0268264_10054648 | 3300028381 | Bacteria | 3335 |
| 1052 | Ga0268264_10057752 | 3300028381 | Bacteria | 3246 |
| 1053 | Ga0268264_10102557 | 3300028381 | Bacteria | 2490 |
| 1054 | Ga0265337_1003113 | 3300028556 | Bacteria | 7315 |
| 1055 | Ga0265336_10039639 | 3300028666 | Bacteria | 1444 |
| 1056 | Ga0307515_10000274 | 3300028794 | Bacteria | 126011 |
| 1057 | Ga0307515_10040282 | 3300028794 | Bacteria | 7392 |
| 1058 | Ga0307515_10067674 | 3300028794 | Bacteria | 4921 |
| 1059 | Ga0307515_10138433 | 3300028794 | Bacteria | 2628 |
| 1060 | Ga0265338_10022745 | 3300028800 | Bacteria | 6473 |
| 1061 | Ga0265338_10122398 | 3300028800 | Bacteria | 2070 |
| 1062 | Ga0265324_10001149 | 3300029957 | Bacteria | 15817 |
| 1063 | Ga0265324_10035124 | 3300029957 | Bacteria | 1746 |
| 1064 | Ga0268256_1000020 | 3300030500 | Bacteria | 557873 |
| 1065 | Ga0268256_1005121 | 3300030500 | Bacteria | 5221 |
| 1066 | Ga0268256_1015115 | 3300030500 | Bacteria | 2266 |
| 1067 | Ga0265762_1017489 | 3300030760 | Bacteria | 1305 |
| 1068 | Ga0265763_1001123 | 3300030763 | Bacteria | 1839 |
| 1069 | Ga0265760_10044076 | 3300031090 | Bacteria | 1334 |
| 1070 | Ga0265330_10007596 | 3300031235 | Bacteria | 5272 |
| 1071 | Ga0265330_10028620 | 3300031235 | Bacteria | 2510 |
| 1072 | Ga0265330_10036189 | 3300031235 | Bacteria | 2201 |
| 1073 | Ga0265330_10058925 | 3300031235 | Bacteria | 1673 |
| 1074 | Ga0265330_10122354 | 3300031235 | Bacteria | 1108 |
| 1075 | Ga0265332_10000910 | 3300031238 | Bacteria | 17749 |
| 1076 | Ga0265332_10014182 | 3300031238 | Bacteria | 3526 |
| 1077 | Ga0265332_10028016 | 3300031238 | Bacteria | 2467 |
| 1078 | Ga0265328_10117374 | 3300031239 | Bacteria | 991 |
| 1079 | Ga0265320_10004204 | 3300031240 | Bacteria | 9461 |
| 1080 | Ga0265325_10000105 | 3300031241 | Bacteria | 59642 |
| 1081 | Ga0265325_10000230 | 3300031241 | Bacteria | 39802 |
| 1082 | Ga0265325_10000697 | 3300031241 | Bacteria | 24447 |
| 1083 | Ga0265325_10018514 | 3300031241 | Bacteria | 3863 |
| 1084 | Ga0265325_10021929 | 3300031241 | Bacteria | 3502 |
| 1085 | Ga0265325_10031272 | 3300031241 | Bacteria | 2850 |
| 1086 | Ga0265325_10067784 | 3300031241 | Bacteria | 1797 |
| 1087 | Ga0265325_10084512 | 3300031241 | Bacteria | 1573 |
| 1088 | Ga0265329_10009039 | 3300031242 | Bacteria | 3741 |
| 1089 | Ga0265340_10002029 | 3300031247 | Bacteria | 11597 |
| 1090 | Ga0265340_10021000 | 3300031247 | Bacteria | 3349 |
| 1091 | Ga0265340_10030315 | 3300031247 | Bacteria | 2711 |
| 1092 | Ga0265340_10084741 | 3300031247 | Bacteria | 1488 |
| 1093 | Ga0265340_10112303 | 3300031247 | Bacteria | 1259 |
| 1094 | Ga0265339_10000075 | 3300031249 | Bacteria | 85133 |
| 1095 | Ga0265339_10008490 | 3300031249 | Bacteria | 6534 |
| 1096 | Ga0265339_10012275 | 3300031249 | Bacteria | 5236 |
| 1097 | Ga0265339_10017015 | 3300031249 | Bacteria | 4314 |
| 1098 | Ga0265339_10038245 | 3300031249 | Bacteria | 2678 |
| 1099 | Ga0265339_10041543 | 3300031249 | Bacteria | 2551 |
| 1100 | Ga0265339_10106439 | 3300031249 | Bacteria | 1455 |
| 1101 | Ga0265339_10160008 | 3300031249 | Bacteria | 1133 |
| 1102 | Ga0265331_10039368 | 3300031250 | Bacteria | 2306 |
| 1103 | Ga0265331_10164281 | 3300031250 | Bacteria | 1006 |
| 1104 | Ga0265316_10009784 | 3300031344 | Bacteria | 8805 |
| 1105 | Ga0265316_10037266 | 3300031344 | Bacteria | 3927 |
| 1106 | Ga0265316_10114860 | 3300031344 | Bacteria | 2036 |
| 1107 | Ga0265316_10114960 | 3300031344 | Bacteria | 2035 |
| 1108 | Ga0265316_10116095 | 3300031344 | Bacteria | 2023 |
| 1109 | Ga0265316_10116690 | 3300031344 | Bacteria | 2018 |
| 1110 | Ga0265316_10130520 | 3300031344 | Bacteria | 1893 |
| 1111 | Ga0307513_10040399 | 3300031456 | Bacteria | 5159 |
| 1112 | Ga0307513_10166031 | 3300031456 | Bacteria | 2092 |
| 1113 | Ga0307509_10306767 | 3300031507 | Bacteria | 1332 |
| 1114 | Ga0307408_100037549 | 3300031548 | Bacteria | 3413 |
| 1115 | Ga0265313_10000031 | 3300031595 | Bacteria | 128981 |
| 1116 | Ga0265313_10000041 | 3300031595 | Bacteria | 119119 |
| 1117 | Ga0265313_10000540 | 3300031595 | Bacteria | 39475 |
| 1118 | Ga0265313_10000632 | 3300031595 | Bacteria | 36281 |
| 1119 | Ga0265313_10040269 | 3300031595 | Bacteria | 2311 |
| 1120 | Ga0265313_10072741 | 3300031595 | Bacteria | 1579 |
| 1121 | Ga0265313_10105050 | 3300031595 | Bacteria | 1248 |
| 1122 | Ga0316575_10030297 | 3300031665 | Bacteria | 2115 |
| 1123 | Ga0265314_10020944 | 3300031711 | Bacteria | 5040 |
| 1124 | Ga0265314_10036923 | 3300031711 | Bacteria | 3545 |
| 1125 | Ga0265314_10081817 | 3300031711 | Bacteria | 2126 |
| 1126 | Ga0265314_10239823 | 3300031711 | Bacteria | 1047 |
| 1127 | Ga0265342_10000146 | 3300031712 | Bacteria | 80151 |
| 1128 | Ga0265342_10002975 | 3300031712 | Bacteria | 14226 |
| 1129 | Ga0265342_10010066 | 3300031712 | Bacteria | 6594 |
| 1130 | Ga0265342_10012876 | 3300031712 | Bacteria | 5644 |
| 1131 | Ga0265342_10059087 | 3300031712 | Bacteria | 2265 |
| 1132 | Ga0265342_10068900 | 3300031712 | Bacteria | 2067 |
| 1133 | Ga0265342_10271621 | 3300031712 | Bacteria | 900 |
| 1134 | Ga0316578_10137444 | 3300031728 | Bacteria | 1471 |
| 1135 | Ga0307410_10480022 | 3300031852 | Bacteria | 1019 |
| 1136 | Ga0307406_10012890 | 3300031901 | Bacteria | 4775 |
| 1137 | Ga0307406_10129869 | 3300031901 | Bacteria | 1767 |
| 1138 | Ga0307412_10024199 | 3300031911 | Bacteria | 3747 |
| 1139 | Ga0307412_10298148 | 3300031911 | Bacteria | 1273 |
| 1140 | Ga0315914_1000008 | 3300031967 | Bacteria | 209133 |
| 1141 | Ga0307409_100013850 | 3300031995 | Bacteria | 5214 |
| 1142 | Ga0307416_100551217 | 3300032002 | Bacteria | 1226 |
| 1143 | Ga0307414_10189521 | 3300032004 | Bacteria | 1662 |
| 1144 | Ga0307411_10049782 | 3300032005 | Bacteria | 2725 |
| 1145 | Ga0316585_10040220 | 3300032137 | Bacteria | 1488 |
| 1146 | Ga0307510_10068963 | 3300033180 | Bacteria | 3545 |
| 1147 | Ga0315913_1000093 | 3300033430 | Bacteria | 51180 |
| 1148 | Ga0315915_1000014 | 3300033464 | Bacteria | 171068 |
| 1149 | Ga0373930_0000013 | 3300034816 | Bacteria | 17272 |
| 1150 | Ga0373948_0000118 | 3300034817 | Bacteria | 8262 |
| 1151 | Ga0373948_0000496 | 3300034817 | Bacteria | 4915 |
| 1152 | Ga0373948_0009819 | 3300034817 | Bacteria | 1659 |
| 1153 | Ga0373950_0000691 | 3300034818 | Bacteria | 4166 |
| 1154 | Ga0373958_0000188 | 3300034819 | Bacteria | 7177 |
| 1155 | Ga0373959_0035136 | 3300034820 | Bacteria | 1029 |
| 1156 | Ga0373938_0000083 | 3300034957 | Bacteria | 12786 |
| 1157 | Ga0373938_0002057 | 3300034957 | Bacteria | 3230 |
| 1158 | Ga0373928_0003067 | 3300035084 | Bacteria | 3209 |
| 1159 | Ga0373928_0047100 | 3300035084 | Bacteria | 1008 |
| 1160 | Ga0373929_0000068 | 3300035085 | Bacteria | 17576 |
| 1161 | Ga0373929_0013157 | 3300035085 | Bacteria | 1582 |
| 1162 | Ga0373934_0001326 | 3300035086 | Bacteria | 9034 |
| 1163 | Ga0373934_0043029 | 3300035086 | Bacteria | 1785 |
| 1164 | Ga0373944_0011106 | 3300035089 | Bacteria | 2463 |
| 1165 | Ga0373944_0012539 | 3300035089 | Bacteria | 2338 |
| 1166 | Ga0373944_0049692 | 3300035089 | Bacteria | 1319 |
| 1167 | Ga0373944_0104831 | 3300035089 | Bacteria | 959 |
| 1168 | Ga0373949_0000934 | 3300035090 | Bacteria | 9111 |
| 1169 | Ga0373949_0002952 | 3300035090 | Bacteria | 4186 |
| 1170 | Ga0373949_0010566 | 3300035090 | Bacteria | 2024 |
| 1171 | Ga0373949_0062024 | 3300035090 | Bacteria | 964 |
| 1172 | Ga0373951_0001301 | 3300035091 | Bacteria | 6589 |
| 1173 | Ga0373951_0001345 | 3300035091 | Bacteria | 6466 |
| 1174 | Ga0373952_0000414 | 3300035092 | Bacteria | 7370 |
| 1175 | Ga0373952_0001711 | 3300035092 | Bacteria | 3990 |
| 1176 | Ga0373923_0009654 | 3300035111 | Bacteria | 3489 |
| 1177 | Ga0373923_0146548 | 3300035111 | Bacteria | 1070 |
| 1178 | Ga0373932_0001138 | 3300035112 | Bacteria | 7655 |
| 1179 | Ga0373932_0003121 | 3300035112 | Bacteria | 4032 |
| 1180 | Ga0373936_0000315 | 3300035113 | Bacteria | 16336 |
| 1181 | Ga0373936_0001160 | 3300035113 | Bacteria | 9476 |
| 1182 | Ga0373936_0021334 | 3300035113 | Bacteria | 2519 |
| 1183 | Ga0373936_0067954 | 3300035113 | Bacteria | 1465 |
| 1184 | Ga0373939_0002139 | 3300035114 | Bacteria | 4699 |
| 1185 | Ga0373939_0009952 | 3300035114 | Bacteria | 2366 |
| 1186 | Ga0373939_0010074 | 3300035114 | Bacteria | 2355 |
| 1187 | Ga0373939_0027034 | 3300035114 | Bacteria | 1622 |
| 1188 | Ga0373939_0045484 | 3300035114 | Bacteria | 1340 |
| 1189 | Ga0373939_0059491 | 3300035114 | Bacteria | 1212 |
| 1190 | Ga0373941_0000938 | 3300035115 | Bacteria | 6009 |
| 1191 | Ga0373941_0003446 | 3300035115 | Bacteria | 3582 |
| 1192 | Ga0373941_0020523 | 3300035115 | Bacteria | 1853 |
| 1193 | Ga0373945_0001093 | 3300035116 | Bacteria | 8162 |
| 1194 | Ga0373945_0005613 | 3300035116 | Bacteria | 4023 |
| 1195 | Ga0373945_0021656 | 3300035116 | Bacteria | 2210 |
| 1196 | Ga0373953_0020595 | 3300035117 | Bacteria | 2465 |
| 1197 | Ga0373954_0006830 | 3300035118 | Bacteria | 4979 |
| 1198 | Ga0373954_0043269 | 3300035118 | Bacteria | 2100 |
| 1199 | Ga0373954_0087135 | 3300035118 | Bacteria | 1496 |
| 1200 | Ga0373956_0007620 | 3300035119 | Bacteria | 4362 |
| 1201 | Ga0373956_0018744 | 3300035119 | Bacteria | 2933 |
| 1202 | Ga0373957_0069156 | 3300035120 | Bacteria | 1378 |
| 1203 | Ga0373960_0002307 | 3300035121 | Bacteria | 4292 |
| 1204 | Ga0373960_0003157 | 3300035121 | Bacteria | 3725 |
| 1205 | Ga0373960_0008174 | 3300035121 | Bacteria | 2500 |
| 1206 | Ga0373960_0021877 | 3300035121 | Bacteria | 1706 |
| 1207 | Ga0373943_0000209 | 3300035170 | Bacteria | 24029 |
| 1208 | Ga0373943_0000945 | 3300035170 | Bacteria | 12841 |
| 1209 | Ga0373943_0007527 | 3300035170 | Bacteria | 4891 |
| 1210 | Ga0373943_0012663 | 3300035170 | Bacteria | 3802 |
| 1211 | Ga0373943_0108447 | 3300035170 | Bacteria | 1461 |
| 1212 | Ga0373946_0000216 | 3300035171 | Bacteria | 17908 |
| 1213 | Ga0373946_0001244 | 3300035171 | Bacteria | 8814 |
| 1214 | Ga0373946_0005866 | 3300035171 | Bacteria | 4448 |
| 1215 | Ga0373955_0006553 | 3300035172 | Bacteria | 5310 |
| 1216 | Ga0373955_0017381 | 3300035172 | Bacteria | 3559 |
| 1217 | Ga0373955_0041393 | 3300035172 | Bacteria | 2469 |
| 1218 | Ga0373955_0042929 | 3300035172 | Bacteria | 2430 |
| 1219 | Ga0373942_0000520 | 3300035207 | Bacteria | 10751 |
| 1220 | Ga0373942_0002511 | 3300035207 | Bacteria | 4446 |
| 1221 | Ga0373961_0001414 | 3300035241 | Bacteria | 7150 |
| 1222 | Ga0373961_0011252 | 3300035241 | Bacteria | 2218 |
| 1223 | Ga0373962_0000558 | 3300035242 | Bacteria | 8384 |
| 1224 | Ga0373962_0003426 | 3300035242 | Bacteria | 3810 |
| 1225 | Ga0373962_0041721 | 3300035242 | Bacteria | 1295 |
| 1226 | Ga0373962_0100762 | 3300035242 | Bacteria | 901 |
| 1227 | Ga0316574_0000583 | 3300035398 | Bacteria | 15122 |
| 1228 | Ga0373924_0000349 | 3300035410 | Bacteria | 14213 |
| 1229 | Ga0373924_0025289 | 3300035410 | Bacteria | 2347 |
| 1230 | Ga0373924_0042730 | 3300035410 | Bacteria | 1860 |
| 1231 | Ga0373924_0044770 | 3300035410 | Bacteria | 1819 |
| 1232 | Ga0373924_0060228 | 3300035410 | Bacteria | 1587 |
| 1233 | Ga0373931_0007905 | 3300035691 | Bacteria | 5030 |
| 1234 | Ga0373931_0008996 | 3300035691 | Bacteria | 4760 |
| 1235 | Ga0373931_0015638 | 3300035691 | Bacteria | 3724 |
| 1236 | Ga0373931_0046184 | 3300035691 | Bacteria | 2301 |
| 1237 | Ga0373931_0050128 | 3300035691 | Bacteria | 2220 |
| 1238 | Ga0373931_0230123 | 3300035691 | Bacteria | 1120 |
| 1239 | Ga0373931_0271151 | 3300035691 | Bacteria | 1039 |
| 1240 | Ga0373935_0000292 | 3300035692 | Bacteria | 24777 |
| 1241 | Ga0373935_0019413 | 3300035692 | Bacteria | 4145 |
| 1242 | Ga0373935_0037058 | 3300035692 | Bacteria | 3051 |
| 1243 | Ga0373935_0042240 | 3300035692 | Bacteria | 2866 |
| 1244 | Ga0373935_0185649 | 3300035692 | Bacteria | 1429 |
| 1245 | Ga0373927_0002703 | 3300035695 | Bacteria | 12925 |
| 1246 | Ga0373927_0003567 | 3300035695 | Bacteria | 11110 |
| 1247 | Ga0373927_0011896 | 3300035695 | Bacteria | 5793 |
| 1248 | Ga0373927_0020628 | 3300035695 | Bacteria | 4320 |
| 1249 | Ga0373927_0060108 | 3300035695 | Bacteria | 2458 |
| 1250 | Ga0373927_0105441 | 3300035695 | Bacteria | 1835 |
| 1251 | Ga0373927_0160967 | 3300035695 | Bacteria | 1470 |
| 1252 | Ga0373933_0000518 | 3300035724 | Bacteria | 24100 |
| 1253 | Ga0373933_0004901 | 3300035724 | Bacteria | 7305 |
| 1254 | Ga0373933_0030508 | 3300035724 | Bacteria | 3122 |
| 1255 | Ga0373947_0000365 | 3300035725 | Bacteria | 25566 |
| 1256 | Ga0373947_0000379 | 3300035725 | Bacteria | 25163 |
| 1257 | Ga0373947_0001671 | 3300035725 | Bacteria | 13579 |
| 1258 | Ga0373947_0023554 | 3300035725 | Bacteria | 3583 |
| 1259 | Ga0373947_0045411 | 3300035725 | Bacteria | 2629 |
| 1260 | Ga0373947_0082367 | 3300035725 | Bacteria | 1994 |
| 1261 | Ga0373937_0001710 | 3300036401 | Bacteria | 18446 |
| 1262 | Ga0373937_0005614 | 3300036401 | Bacteria | 10769 |
| 1263 | Ga0373937_0008148 | 3300036401 | Bacteria | 9098 |
| 1264 | Ga0373937_0034353 | 3300036401 | Bacteria | 4612 |
| 1265 | Ga0373937_0068299 | 3300036401 | Bacteria | 3277 |
| 1266 | Ga0373937_0155498 | 3300036401 | Bacteria | 2143 |
| 1267 | Ga0373937_0175585 | 3300036401 | Bacteria | 2011 |
| 1268 | Ga0373937_0555311 | 3300036401 | Bacteria | 1091 |
| 1269 | Ga0373937_0627728 | 3300036401 | Bacteria | 1020 |
| 1270 | Ga0373937_0744621 | 3300036401 | Bacteria | 927 |
| 1271 | Ga0316582_0034396 | 3300036647 | Bacteria | 3121 |
| 1272 | Ga0316584_0021319 | 3300036712 | Bacteria | 4708 |
| 1273 | Ga0373925_0000018 | 3300037068 | Bacteria | 174213 |
| 1274 | Ga0373925_0001344 | 3300037068 | Bacteria | 21480 |
| 1275 | Ga0373925_0001465 | 3300037068 | Bacteria | 20320 |
| 1276 | Ga0373925_0015007 | 3300037068 | Bacteria | 5600 |
| 1277 | Ga0373925_0041952 | 3300037068 | Bacteria | 3394 |
| 1278 | Ga0373925_0115236 | 3300037068 | Bacteria | 2081 |
| 1279 | Ga0373925_0142520 | 3300037068 | Bacteria | 1877 |
| 1280 | Ga0373925_0210883 | 3300037068 | Bacteria | 1547 |
| 1281 | Ga0395899_0008003 | 3300037312 | Bacteria | 8142 |
| 1282 | Ga0395899_0132245 | 3300037312 | Bacteria | 1781 |
| 1283 | Ga0395900_0002888 | 3300037418 | Bacteria | 18709 |
| 1284 | Ga0395900_0012043 | 3300037418 | Bacteria | 8841 |
| 1285 | Ga0395900_0146307 | 3300037418 | Bacteria | 2416 |
| 1286 | Ga0395900_0490698 | 3300037418 | Bacteria | 1180 |
| 1287 | Ga0395898_0007773 | 3300037466 | Bacteria | 11384 |
| 1288 | Ga0395898_0046567 | 3300037466 | Bacteria | 4260 |
| 1289 | Ga0395898_0079433 | 3300037466 | Bacteria | 3165 |
| 1290 | Ga0395905_0000658 | 3300037471 | Bacteria | 45924 |
| 1291 | Ga0395905_0005373 | 3300037471 | Bacteria | 13092 |
| 1292 | Ga0395905_0015770 | 3300037471 | Bacteria | 7178 |
| 1293 | Ga0395905_0084201 | 3300037471 | Bacteria | 2979 |
| 1294 | Ga0436364_0161603 | 3300037853 | Bacteria | 2070 |
| 1295 | Ga0436364_0410618 | 3300037853 | Bacteria | 84995 |
| 1296 | Ga0436364_0681691 | 3300037853 | Bacteria | 1572 |
| 1297 | Ga0436364_0773514 | 3300037853 | Bacteria | 3091 |
| 1298 | Ga0436364_0774545 | 3300037853 | Bacteria | 3389 |
| 1299 | Ga0436364_1053682 | 3300037853 | Bacteria | 2868 |
| 1300 | Ga0395901_0021727 | 3300038443 | Bacteria | 6575 |
| 1301 | Ga0395901_0120912 | 3300038443 | Bacteria | 2752 |
| 1302 | Ga0395901_0181108 | 3300038443 | Bacteria | 2210 |
| 1303 | Ga0395901_0276015 | 3300038443 | Bacteria | 1747 |
| 1304 | Ga0436365_0000552 | 3300039437 | Bacteria | 1542 |
| 1305 | Ga0436365_0219019 | 3300039437 | Bacteria | 1215 |
| 1306 | Ga0436365_0780547 | 3300039437 | Bacteria | 4510 |
| 1307 | Ga0436365_0934594 | 3300039437 | Bacteria | 2372 |
| 1308 | Ga0436365_1689635 | 3300039437 | Bacteria | 1084 |
| 1309 | Ga0436360_1030738 | 3300039438 | Bacteria | 1177 |
| 1310 | Ga0436361_0447916 | 3300039447 | Bacteria | 3739 |
| 1311 | Ga0436361_0583883 | 3300039447 | Bacteria | 1757 |
| 1312 | Ga0436361_1191526 | 3300039447 | Bacteria | 2024 |
| 1313 | Ga0436363_0551050 | 3300039450 | Bacteria | 963 |
| 1314 | Ga0436363_0575052 | 3300039450 | Bacteria | 1702 |
| 1315 | Ga0436363_0634809 | 3300039450 | Bacteria | 5257 |
| 1316 | Ga0436362_0292983 | 3300039453 | Bacteria | 3480 |
| 1317 | Ga0436362_0772071 | 3300039453 | Bacteria | 1616 |
| 1318 | Ga0436362_0838148 | 3300039453 | Bacteria | 856 |
| 1319 | Ga0439436_0008690 | 3300041404 | Bacteria | 3122 |
| 1320 | Ga0439436_0046246 | 3300041404 | Bacteria | 1237 |
| 1321 | Ga0439439_0005910 | 3300041406 | Bacteria | 2818 |
| 1322 | Ga0439439_0032432 | 3300041406 | Bacteria | 1334 |
| 1323 | Ga0439447_027226 | 3300041407 | Bacteria | 1460 |
| 1324 | Ga0439453_0003170 | 3300041408 | Bacteria | 2341 |
| 1325 | Ga0439465_0001450 | 3300041413 | Bacteria | 7677 |
| 1326 | Ga0439465_0004393 | 3300041413 | Bacteria | 4561 |
| 1327 | Ga0439465_0027863 | 3300041413 | Bacteria | 1790 |
| 1328 | Ga0451833_0223154 | 3300041491 | Bacteria | 8683 |
| 1329 | Ga0451837_0499150 | 3300041494 | Bacteria | 1118 |
| 1330 | Ga0451837_1523969 | 3300041494 | Bacteria | 1074 |
| 1331 | Ga0451845_0654372 | 3300041501 | Bacteria | 2233 |
| 1332 | Ga0451846_70228 | 3300041502 | Bacteria | 1805 |
| 1333 | Ga0451847_0083388 | 3300041503 | Bacteria | 2144 |
| 1334 | Ga0451849_0489010 | 3300041505 | Bacteria | 994 |
| 1335 | Ga0451850_35806 | 3300041506 | Bacteria | 986 |
| 1336 | Ga0451851_0987432 | 3300041507 | Bacteria | 1473 |
| 1337 | Ga0451843_0065450 | 3300041509 | Bacteria | 4230 |
| 1338 | Ga0451854_37387 | 3300041510 | Bacteria | 1426 |
| 1339 | Ga0451855_1098170 | 3300041511 | Bacteria | 2084 |
| 1340 | Ga0451853_2558696 | 3300041512 | Bacteria | 6758 |
| 1341 | Ga0452268_15340 | 3300041907 | Bacteria | 2145 |
| 1342 | Ga0439443_017300 | 3300042003 | Bacteria | 1108 |
| 1343 | Ga0439449_0000949 | 3300042007 | Bacteria | 11352 |
| 1344 | Ga0439449_0008506 | 3300042007 | Bacteria | 3899 |
| 1345 | Ga0439449_0022500 | 3300042007 | Bacteria | 2361 |
| 1346 | Ga0439450_014888 | 3300042008 | Bacteria | 1584 |
| 1347 | Ga0439455_0022392 | 3300042012 | Bacteria | 1514 |
| 1348 | Ga0439462_0032319 | 3300042015 | Bacteria | 1387 |
| 1349 | Ga0439462_0066949 | 3300042015 | Bacteria | 974 |
| 1350 | Ga0450923_006239 | 3300042125 | Bacteria | 1966 |
| 1351 | Ga0450906_006925 | 3300042145 | Bacteria | 2262 |
| 1352 | Ga0439435_0001488 | 3300042436 | Bacteria | 4353 |
| 1353 | Ga0439435_0026765 | 3300042436 | Bacteria | 1538 |
| 1354 | Ga0439464_0007232 | 3300042439 | Bacteria | 2902 |
| 1355 | Ga0439460_0068028 | 3300042461 | Bacteria | 1098 |
| 1356 | Ga0466972_0109823 | 3300044658 | Bacteria | 1303 |
| 1357 | Ga0466972_0167256 | 3300044658 | Bacteria | 1032 |
| 1358 | Ga0466963_0153839 | 3300044694 | Bacteria | 1598 |
| 1359 | Ga0453684_0026923 | 3300044712 | Bacteria | 8281 |
| 1360 | Ga0453684_0134128 | 3300044712 | Bacteria | 2967 |
| 1361 | Ga0466971_0059506 | 3300044719 | Bacteria | 1726 |
| 1362 | Ga0466971_0154350 | 3300044719 | Bacteria | 1073 |
| 1363 | Ga0466971_0231736 | 3300044719 | Bacteria | 877 |
| 1364 | Ga0466970_0014361 | 3300044765 | Bacteria | 4066 |
| 1365 | Ga0466970_0187936 | 3300044765 | Bacteria | 1147 |
| 1366 | Ga0466957_0024191 | 3300044842 | Bacteria | 3593 |
| 1367 | Ga0466960_0054234 | 3300044901 | Bacteria | 1946 |
| 1368 | Ga0466960_0092051 | 3300044901 | Bacteria | 1547 |
| 1369 | Ga0466960_0183827 | 3300044901 | Bacteria | 1134 |
| 1370 | Ga0466960_0284038 | 3300044901 | Bacteria | 928 |
| 1371 | Ga0451576_0105599 | 3300045051 | Bacteria | 2930 |
| 1372 | Ga0466958_0012605 | 3300045836 | Bacteria | 4791 |
| 1373 | Ga0466967_0159662 | 3300045976 | Bacteria | 2115 |
| 1374 | Ga0466967_0368081 | 3300045976 | Bacteria | 1394 |
| 1375 | Ga0495592_0000001 | 3300046454 | Bacteria | 305819 |
| 1376 | Ga0495592_0002225 | 3300046454 | Bacteria | 13688 |
| 1377 | Ga0495592_0082329 | 3300046454 | Bacteria | 2326 |
| 1378 | Ga0495592_0117157 | 3300046454 | Bacteria | 1878 |
| 1379 | Ga0495592_0139526 | 3300046454 | Bacteria | 1687 |
| 1380 | Ga0495592_0296730 | 3300046454 | Bacteria | 1052 |
| 1381 | Ga0495603_0026838 | 3300046455 | Bacteria | 3478 |
| 1382 | Ga0495603_0030937 | 3300046455 | Bacteria | 3223 |
| 1383 | Ga0495629_0000440 | 3300046459 | Bacteria | 34677 |
| 1384 | Ga0495629_0023211 | 3300046459 | Bacteria | 4420 |
| 1385 | Ga0495629_0024988 | 3300046459 | Bacteria | 4249 |
| 1386 | Ga0495629_0038204 | 3300046459 | Bacteria | 3383 |
| 1387 | Ga0495629_0054577 | 3300046459 | Bacteria | 2794 |
| 1388 | Ga0495638_0001347 | 3300046460 | Bacteria | 22537 |
| 1389 | Ga0495638_0014704 | 3300046460 | Bacteria | 5279 |
| 1390 | Ga0495641_0043238 | 3300046461 | Bacteria | 2084 |
| 1391 | Ga0495641_0138510 | 3300046461 | Bacteria | 1087 |
| 1392 | Ga0495651_0002430 | 3300046462 | Bacteria | 14380 |
| 1393 | Ga0495651_0004059 | 3300046462 | Bacteria | 11187 |
| 1394 | Ga0495651_0011906 | 3300046462 | Bacteria | 6692 |
| 1395 | Ga0495651_0013966 | 3300046462 | Bacteria | 6211 |
| 1396 | Ga0495651_0113334 | 3300046462 | Bacteria | 2002 |
| 1397 | Ga0495653_0000092 | 3300046463 | Bacteria | 74868 |
| 1398 | Ga0495653_0006947 | 3300046463 | Bacteria | 9293 |
| 1399 | Ga0495653_0008183 | 3300046463 | Bacteria | 8563 |
| 1400 | Ga0495653_0048455 | 3300046463 | Bacteria | 3280 |
| 1401 | Ga0495653_0173739 | 3300046463 | Bacteria | 1485 |
| 1402 | Ga0495580_0002900 | 3300046472 | Bacteria | 14738 |
| 1403 | Ga0495580_0037929 | 3300046472 | Bacteria | 3455 |
| 1404 | Ga0495580_0311624 | 3300046472 | Bacteria | 1070 |
| 1405 | Ga0495582_0000914 | 3300046473 | Bacteria | 16434 |
| 1406 | Ga0495582_0025155 | 3300046473 | Bacteria | 3261 |
| 1407 | Ga0495582_0087153 | 3300046473 | Bacteria | 1738 |
| 1408 | Ga0495605_0003366 | 3300046474 | Bacteria | 9555 |
| 1409 | Ga0495605_0055337 | 3300046474 | Bacteria | 1917 |
| 1410 | Ga0495605_0121668 | 3300046474 | Bacteria | 1183 |
| 1411 | Ga0495639_0006388 | 3300046475 | Bacteria | 5068 |
| 1412 | Ga0495639_0050853 | 3300046475 | Bacteria | 1883 |
| 1413 | Ga0495639_0069438 | 3300046475 | Bacteria | 1625 |
| 1414 | Ga0495662_0014931 | 3300046476 | Bacteria | 3772 |
| 1415 | Ga0495662_0016685 | 3300046476 | Bacteria | 3558 |
| 1416 | Ga0495662_0026739 | 3300046476 | Bacteria | 2786 |
| 1417 | Ga0495662_0028884 | 3300046476 | Bacteria | 2677 |
| 1418 | Ga0495662_0136709 | 3300046476 | Bacteria | 1205 |
| 1419 | Ga0495662_0169166 | 3300046476 | Bacteria | 1077 |
| 1420 | Ga0495664_0000001 | 3300046477 | Bacteria | 757730 |
| 1421 | Ga0495664_0000814 | 3300046477 | Bacteria | 15977 |
| 1422 | Ga0495664_0004525 | 3300046477 | Bacteria | 7604 |
| 1423 | Ga0495664_0031813 | 3300046477 | Bacteria | 3093 |
| 1424 | Ga0495664_0265202 | 3300046477 | Bacteria | 1038 |
| 1425 | Ga0495584_0022280 | 3300046491 | Bacteria | 3215 |
| 1426 | Ga0495584_0126197 | 3300046491 | Bacteria | 1297 |
| 1427 | Ga0495585_0008712 | 3300046492 | Bacteria | 6133 |
| 1428 | Ga0495585_0017056 | 3300046492 | Bacteria | 4202 |
| 1429 | Ga0495585_0017347 | 3300046492 | Bacteria | 4159 |
| 1430 | Ga0495594_0022816 | 3300046499 | Bacteria | 3350 |
| 1431 | Ga0495594_0138575 | 3300046499 | Bacteria | 1379 |
| 1432 | Ga0495607_0006526 | 3300046501 | Bacteria | 8201 |
| 1433 | Ga0495607_0019982 | 3300046501 | Bacteria | 4242 |
| 1434 | Ga0495583_0002986 | 3300046506 | Bacteria | 13562 |
| 1435 | Ga0495583_0036678 | 3300046506 | Bacteria | 2330 |
| 1436 | Ga0495606_0000519 | 3300046507 | Bacteria | 62313 |
| 1437 | Ga0495606_0002491 | 3300046507 | Bacteria | 21290 |
| 1438 | Ga0495606_0010164 | 3300046507 | Bacteria | 7850 |
| 1439 | Ga0495606_0210997 | 3300046507 | Bacteria | 1100 |
| 1440 | Ga0495608_0000109 | 3300046511 | Bacteria | 59207 |
| 1441 | Ga0495608_0010975 | 3300046511 | Bacteria | 6313 |
| 1442 | Ga0495608_0031649 | 3300046511 | Bacteria | 3576 |
| 1443 | Ga0495608_0061907 | 3300046511 | Bacteria | 2460 |
| 1444 | Ga0495608_0069457 | 3300046511 | Bacteria | 2301 |
| 1445 | Ga0495610_0007132 | 3300046512 | Bacteria | 7531 |
| 1446 | Ga0495610_0052713 | 3300046512 | Bacteria | 1973 |
| 1447 | Ga0495610_0158020 | 3300046512 | Bacteria | 961 |
| 1448 | Ga0495616_0038046 | 3300046513 | Bacteria | 2472 |
| 1449 | Ga0495618_0000064 | 3300046514 | Bacteria | 77194 |
| 1450 | Ga0495618_0000996 | 3300046514 | Bacteria | 19404 |
| 1451 | Ga0495618_0005449 | 3300046514 | Bacteria | 7754 |
| 1452 | Ga0495618_0014942 | 3300046514 | Bacteria | 4735 |
| 1453 | Ga0495618_0339685 | 3300046514 | Bacteria | 927 |
| 1454 | Ga0495620_0009503 | 3300046515 | Bacteria | 5167 |
| 1455 | Ga0495620_0038067 | 3300046515 | Bacteria | 2137 |
| 1456 | Ga0495628_0000003 | 3300046516 | Bacteria | 470339 |
| 1457 | Ga0495628_0027928 | 3300046516 | Bacteria | 4588 |
| 1458 | Ga0495628_0155210 | 3300046516 | Bacteria | 1742 |
| 1459 | Ga0495630_0000850 | 3300046517 | Bacteria | 21530 |
| 1460 | Ga0495630_0003083 | 3300046517 | Bacteria | 11559 |
| 1461 | Ga0495630_0018564 | 3300046517 | Bacteria | 5111 |
| 1462 | Ga0495630_0042458 | 3300046517 | Bacteria | 3396 |
| 1463 | Ga0495630_0085916 | 3300046517 | Bacteria | 2375 |
| 1464 | Ga0495630_0100353 | 3300046517 | Bacteria | 2190 |
| 1465 | Ga0495630_0121039 | 3300046517 | Bacteria | 1985 |
| 1466 | Ga0495630_0196499 | 3300046517 | Bacteria | 1539 |
| 1467 | Ga0495631_0002151 | 3300046518 | Bacteria | 11384 |
| 1468 | Ga0495631_0090472 | 3300046518 | Bacteria | 1318 |
| 1469 | Ga0495637_0069554 | 3300046520 | Bacteria | 1424 |
| 1470 | Ga0495637_0075845 | 3300046520 | Bacteria | 1348 |
| 1471 | Ga0495643_0016698 | 3300046522 | Bacteria | 4310 |
| 1472 | Ga0495643_0038505 | 3300046522 | Bacteria | 2618 |
| 1473 | Ga0495643_0045214 | 3300046522 | Bacteria | 2391 |
| 1474 | Ga0495644_0010408 | 3300046523 | Bacteria | 3584 |
| 1475 | Ga0495644_0074383 | 3300046523 | Bacteria | 1278 |
| 1476 | Ga0495648_0070121 | 3300046524 | Bacteria | 2038 |
| 1477 | Ga0495648_0131491 | 3300046524 | Bacteria | 1330 |
| 1478 | Ga0495648_0188306 | 3300046524 | Bacteria | 1043 |
| 1479 | Ga0495666_0000884 | 3300046526 | Bacteria | 14016 |
| 1480 | Ga0495666_0059754 | 3300046526 | Bacteria | 1823 |
| 1481 | Ga0495666_0156427 | 3300046526 | Bacteria | 1058 |
| 1482 | Ga0495652_0000001 | 3300046529 | Bacteria | 1045081 |
| 1483 | Ga0495652_0019698 | 3300046529 | Bacteria | 6005 |
| 1484 | Ga0495652_0022381 | 3300046529 | Bacteria | 5607 |
| 1485 | Ga0495652_0073360 | 3300046529 | Bacteria | 2850 |
| 1486 | Ga0495652_0126898 | 3300046529 | Bacteria | 2025 |
| 1487 | Ga0495652_0147745 | 3300046529 | Bacteria | 1840 |
| 1488 | Ga0495654_0002779 | 3300046530 | Bacteria | 11033 |
| 1489 | Ga0495654_0128846 | 3300046530 | Bacteria | 1138 |
| 1490 | Ga0495665_0001249 | 3300046531 | Bacteria | 13536 |
| 1491 | Ga0495665_0003072 | 3300046531 | Bacteria | 9031 |
| 1492 | Ga0495665_0054702 | 3300046531 | Bacteria | 2108 |
| 1493 | Ga0495665_0058547 | 3300046531 | Bacteria | 2034 |
| 1494 | Ga0495640_0000012 | 3300046533 | Bacteria | 194692 |
| 1495 | Ga0495640_0007360 | 3300046533 | Bacteria | 8664 |
| 1496 | Ga0495640_0012226 | 3300046533 | Bacteria | 6569 |
| 1497 | Ga0495640_0021850 | 3300046533 | Bacteria | 4687 |
| 1498 | Ga0495640_0032197 | 3300046533 | Bacteria | 3736 |
| 1499 | Ga0495640_0072546 | 3300046533 | Bacteria | 2307 |
| 1500 | Ga0495640_0176938 | 3300046533 | Bacteria | 1361 |
| 1501 | Ga0495586_0020580 | 3300046535 | Bacteria | 3513 |
| 1502 | Ga0495587_0000028 | 3300046536 | Bacteria | 138663 |
| 1503 | Ga0495587_0013126 | 3300046536 | Bacteria | 5209 |
| 1504 | Ga0495587_0026760 | 3300046536 | Bacteria | 3513 |
| 1505 | Ga0495598_0015426 | 3300046537 | Bacteria | 1929 |
| 1506 | Ga0495609_0046643 | 3300046538 | Bacteria | 1940 |
| 1507 | Ga0495609_0058060 | 3300046538 | Bacteria | 1712 |
| 1508 | Ga0495609_0120709 | 3300046538 | Bacteria | 1127 |
| 1509 | Ga0495621_0043196 | 3300046539 | Bacteria | 1590 |
| 1510 | Ga0495597_0003588 | 3300046542 | Bacteria | 8943 |
| 1511 | Ga0495645_0000004 | 3300046543 | Bacteria | 532661 |
| 1512 | Ga0495645_0011912 | 3300046543 | Bacteria | 6126 |
| 1513 | Ga0495645_0027733 | 3300046543 | Bacteria | 4114 |
| 1514 | Ga0495645_0030621 | 3300046543 | Bacteria | 3920 |
| 1515 | Ga0495645_0157794 | 3300046543 | Bacteria | 1571 |
| 1516 | Ga0495645_0206217 | 3300046543 | Bacteria | 1330 |
| 1517 | Ga0495622_0003618 | 3300046557 | Bacteria | 7255 |
| 1518 | Ga0495633_0014580 | 3300046558 | Bacteria | 4103 |
| 1519 | Ga0495633_0022000 | 3300046558 | Bacteria | 3180 |
| 1520 | Ga0495633_0074244 | 3300046558 | Bacteria | 1585 |
| 1521 | Ga0495633_0127155 | 3300046558 | Bacteria | 1179 |
| 1522 | Ga0495667_0000001 | 3300046559 | Bacteria | 834831 |
| 1523 | Ga0495667_0003492 | 3300046559 | Bacteria | 10534 |
| 1524 | Ga0495667_0007691 | 3300046559 | Bacteria | 7305 |
| 1525 | Ga0495667_0021620 | 3300046559 | Bacteria | 4341 |
| 1526 | Ga0495667_0088532 | 3300046559 | Bacteria | 2007 |
| 1527 | Ga0495667_0158711 | 3300046559 | Bacteria | 1455 |
| 1528 | Ga0495656_0003231 | 3300046615 | Bacteria | 5498 |
| 1529 | Ga0495656_0012678 | 3300046615 | Bacteria | 3117 |
| 1530 | Ga0495656_0095466 | 3300046615 | Bacteria | 1367 |
| 1531 | Ga0495668_0009435 | 3300046616 | Bacteria | 5995 |
| 1532 | Ga0495668_0177477 | 3300046616 | Bacteria | 1167 |
| 1533 | Ga0495634_0000075 | 3300046642 | Bacteria | 77824 |
| 1534 | Ga0495634_0005439 | 3300046642 | Bacteria | 9804 |
| 1535 | Ga0495634_0006407 | 3300046642 | Bacteria | 8945 |
| 1536 | Ga0495634_0036161 | 3300046642 | Bacteria | 3378 |
| 1537 | Ga0495634_0049953 | 3300046642 | Bacteria | 2811 |
| 1538 | Ga0495634_0059655 | 3300046642 | Bacteria | 2541 |
| 1539 | Ga0495611_0028203 | 3300046648 | Bacteria | 2457 |
| 1540 | Ga0495611_0046289 | 3300046648 | Bacteria | 1950 |
| 1541 | Ga0495611_0091944 | 3300046648 | Bacteria | 1403 |
| 1542 | Ga0495625_0001123 | 3300046660 | Bacteria | 34651 |
| 1543 | Ga0495635_0000015 | 3300046663 | Bacteria | 215468 |
| 1544 | Ga0495635_0001695 | 3300046663 | Bacteria | 14847 |
| 1545 | Ga0495635_0008986 | 3300046663 | Bacteria | 6970 |
| 1546 | Ga0495635_0010473 | 3300046663 | Bacteria | 6485 |
| 1547 | Ga0495635_0044745 | 3300046663 | Bacteria | 3053 |
| 1548 | Ga0495635_0145957 | 3300046663 | Bacteria | 1611 |
| 1549 | Ga0495635_0157681 | 3300046663 | Bacteria | 1544 |
| 1550 | Ga0495635_0248499 | 3300046663 | Bacteria | 1199 |
| 1551 | Ga0495659_0000755 | 3300046664 | Bacteria | 11615 |
| 1552 | Ga0495588_0003191 | 3300046674 | Bacteria | 7096 |
| 1553 | Ga0495588_0009671 | 3300046674 | Bacteria | 4466 |
| 1554 | Ga0495588_0048326 | 3300046674 | Bacteria | 2185 |
| 1555 | Ga0495588_0092886 | 3300046674 | Bacteria | 1581 |
| 1556 | Ga0495588_0173762 | 3300046674 | Bacteria | 1139 |
| 1557 | Ga0495657_0000155 | 3300046675 | Bacteria | 62116 |
| 1558 | Ga0495657_0015245 | 3300046675 | Bacteria | 5626 |
| 1559 | Ga0495599_0000029 | 3300046678 | Bacteria | 113803 |
| 1560 | Ga0495599_0044357 | 3300046678 | Bacteria | 2788 |
| 1561 | Ga0495599_0103005 | 3300046678 | Bacteria | 1778 |
| 1562 | Ga0495623_0000012 | 3300046679 | Bacteria | 120267 |
| 1563 | Ga0495623_0063995 | 3300046679 | Bacteria | 2302 |
| 1564 | Ga0495646_0000006 | 3300046680 | Bacteria | 258496 |
| 1565 | Ga0495646_0007172 | 3300046680 | Bacteria | 7079 |
| 1566 | Ga0495646_0115273 | 3300046680 | Bacteria | 1526 |
| 1567 | Ga0495647_0003008 | 3300046681 | Bacteria | 5363 |
| 1568 | Ga0495647_0146994 | 3300046681 | Bacteria | 1008 |
| 1569 | Ga0495658_0000200 | 3300046683 | Bacteria | 34796 |
| 1570 | Ga0495658_0023078 | 3300046683 | Bacteria | 3299 |
| 1571 | Ga0495658_0037694 | 3300046683 | Bacteria | 2673 |
| 1572 | Ga0495658_0051619 | 3300046683 | Bacteria | 2330 |
| 1573 | Ga0495658_0054538 | 3300046683 | Bacteria | 2274 |
| 1574 | Ga0495658_0329953 | 3300046683 | Bacteria | 968 |
| 1575 | Ga0495669_0039593 | 3300046684 | Bacteria | 2087 |
| 1576 | Ga0495669_0044918 | 3300046684 | Bacteria | 1969 |
| 1577 | Ga0495669_0057334 | 3300046684 | Bacteria | 1757 |
| 1578 | Ga0495613_0012563 | 3300046689 | Bacteria | 6294 |
| 1579 | Ga0495613_0037492 | 3300046689 | Bacteria | 3594 |
| 1580 | Ga0495613_0042847 | 3300046689 | Bacteria | 3348 |
| 1581 | Ga0495613_0105367 | 3300046689 | Bacteria | 2035 |
| 1582 | Ga0495613_0180831 | 3300046689 | Bacteria | 1493 |
| 1583 | Ga0495624_0004405 | 3300046690 | Bacteria | 10305 |
| 1584 | Ga0495624_0025399 | 3300046690 | Bacteria | 3889 |
| 1585 | Ga0495624_0135007 | 3300046690 | Bacteria | 1512 |
| 1586 | Ga0495670_0003961 | 3300046691 | Bacteria | 7270 |
| 1587 | Ga0495670_0056140 | 3300046691 | Bacteria | 1975 |
| 1588 | Ga0495671_0067481 | 3300046692 | Bacteria | 1759 |
| 1589 | Ga0495671_0158040 | 3300046692 | Bacteria | 1103 |
| 1590 | Ga0495671_0161207 | 3300046692 | Bacteria | 1091 |
| 1591 | Ga0495589_0071238 | 3300046794 | Bacteria | 1699 |
| 1592 | Ga0495600_0000286 | 3300046809 | Bacteria | 27213 |
| 1593 | Ga0495600_0000769 | 3300046809 | Bacteria | 16893 |
| 1594 | Ga0495600_0081137 | 3300046809 | Bacteria | 2117 |
| 1595 | Ga0495600_0081880 | 3300046809 | Bacteria | 2106 |
| 1596 | Ga0495581_0007762 | 3300047315 | Bacteria | 6210 |
| 1597 | Ga0495581_0011638 | 3300047315 | Bacteria | 5092 |
| 1598 | Ga0495581_0019388 | 3300047315 | Bacteria | 3948 |
| 1599 | Ga0495581_0019773 | 3300047315 | Bacteria | 3910 |
| 1600 | Ga0495581_0022637 | 3300047315 | Bacteria | 3640 |
| 1601 | Ga0495581_0060666 | 3300047315 | Bacteria | 2186 |
| 1602 | Ga0495604_0000091 | 3300047317 | Bacteria | 77216 |
| 1603 | Ga0495604_0000625 | 3300047317 | Bacteria | 30418 |
| 1604 | Ga0495604_0003181 | 3300047317 | Bacteria | 13120 |
| 1605 | Ga0495604_0079809 | 3300047317 | Bacteria | 2453 |
| 1606 | Ga0495604_0091311 | 3300047317 | Bacteria | 2259 |
| 1607 | Ga0495604_0164754 | 3300047317 | Bacteria | 1564 |
| 1608 | Ga0495674_0000001 | 3300047319 | Bacteria | 778665 |
| 1609 | Ga0495674_0000267 | 3300047319 | Bacteria | 44377 |
| 1610 | Ga0495674_0019582 | 3300047319 | Bacteria | 6278 |
| 1611 | Ga0495674_0149677 | 3300047319 | Bacteria | 1958 |
| 1612 | Ga0495674_0156336 | 3300047319 | Bacteria | 1910 |
| 1613 | Ga0495674_0167520 | 3300047319 | Bacteria | 1835 |
| 1614 | Ga0495674_0219464 | 3300047319 | Bacteria | 1572 |
| 1615 | Ga0495672_0132500 | 3300047320 | Bacteria | 1310 |
| 1616 | Ga0495672_0178828 | 3300047320 | Bacteria | 1076 |
| 1617 | Ga0495676_0046479 | 3300047321 | Bacteria | 3522 |
| 1618 | Ga0495676_0053351 | 3300047321 | Bacteria | 3222 |
| 1619 | Ga0495676_0062782 | 3300047321 | Bacteria | 2898 |
| 1620 | Ga0495676_0091423 | 3300047321 | Bacteria | 2275 |
| 1621 | Ga0495680_0000489 | 3300047322 | Bacteria | 44631 |
| 1622 | Ga0495680_0003110 | 3300047322 | Bacteria | 16521 |
| 1623 | Ga0495680_0004500 | 3300047322 | Bacteria | 13332 |
| 1624 | Ga0495680_0006435 | 3300047322 | Bacteria | 10914 |
| 1625 | Ga0495680_0019890 | 3300047322 | Bacteria | 5658 |
| 1626 | Ga0495680_0027736 | 3300047322 | Bacteria | 4647 |
| 1627 | Ga0495680_0246100 | 3300047322 | Bacteria | 1268 |
| 1628 | Ga0495687_113581 | 3300047443 | Bacteria | 990 |
| 1629 | Ga0495675_0000113 | 3300047444 | Bacteria | 58250 |
| 1630 | Ga0495675_0142951 | 3300047444 | Bacteria | 1482 |
| 1631 | Ga0495675_0174034 | 3300047444 | Bacteria | 1321 |
| 1632 | Ga0495679_062000 | 3300047446 | Bacteria | 1095 |
| 1633 | Ga0495681_0006372 | 3300047470 | Bacteria | 7765 |
| 1634 | Ga0495684_0000055 | 3300047471 | Bacteria | 79796 |
| 1635 | Ga0495684_0002895 | 3300047471 | Bacteria | 13512 |
| 1636 | Ga0495684_0005380 | 3300047471 | Bacteria | 9968 |
| 1637 | Ga0495684_0097564 | 3300047471 | Bacteria | 2223 |
| 1638 | Ga0495684_0097659 | 3300047471 | Bacteria | 2222 |
| 1639 | Ga0495684_0251304 | 3300047471 | Bacteria | 1286 |
| 1640 | Ga0495684_0253360 | 3300047471 | Bacteria | 1280 |
| 1641 | Ga0495684_0256987 | 3300047471 | Bacteria | 1269 |
| 1642 | Ga0495686_0004635 | 3300047472 | Bacteria | 11180 |
| 1643 | Ga0495686_0025709 | 3300047472 | Bacteria | 3857 |
| 1644 | Ga0495686_0032707 | 3300047472 | Bacteria | 3364 |
| 1645 | Ga0495593_0003290 | 3300047673 | Bacteria | 9694 |
| 1646 | Ga0495593_0006737 | 3300047673 | Bacteria | 6725 |
| 1647 | Ga0495593_0012654 | 3300047673 | Bacteria | 4820 |
| 1648 | Ga0495593_0018562 | 3300047673 | Bacteria | 3906 |
| 1649 | Ga0495593_0103443 | 3300047673 | Bacteria | 1459 |
| 1650 | Ga0495602_0000002 | 3300048088 | Bacteria | 422216 |
| 1651 | Ga0495602_0003565 | 3300048088 | Bacteria | 16106 |
| 1652 | Ga0495602_0070734 | 3300048088 | Bacteria | 2984 |
| 1653 | Ga0495602_0074406 | 3300048088 | Bacteria | 2887 |
| 1654 | Ga0495602_0119203 | 3300048088 | Bacteria | 2127 |
| 1655 | Ga0495614_0028398 | 3300048089 | Bacteria | 2410 |
| 1656 | Ga0495614_0042245 | 3300048089 | Bacteria | 1955 |
| 1657 | Ga0496100_0000380 | 3300048903 | Bacteria | 21636 |
| 1658 | Ga0496100_0006540 | 3300048903 | Bacteria | 6360 |
| 1659 | Ga0496101_0001315 | 3300048904 | Bacteria | 14856 |
| 1660 | Ga0496101_0022384 | 3300048904 | Bacteria | 4350 |
| 1661 | Ga0496101_0023194 | 3300048904 | Bacteria | 4283 |
| 1662 | Ga0496101_0082737 | 3300048904 | Bacteria | 2375 |
| 1663 | Ga0496101_0171593 | 3300048904 | Bacteria | 1667 |
| 1664 | Ga0496102_0010977 | 3300048905 | Bacteria | 7806 |
| 1665 | Ga0496102_0047316 | 3300048905 | Bacteria | 3908 |
| 1666 | Ga0496102_0058141 | 3300048905 | Bacteria | 3532 |
| 1667 | Ga0496102_0058840 | 3300048905 | Bacteria | 3512 |
| 1668 | Ga0496102_0062013 | 3300048905 | Bacteria | 3423 |
| 1669 | Ga0496102_0103547 | 3300048905 | Bacteria | 2647 |
| 1670 | Ga0496102_0205453 | 3300048905 | Bacteria | 1857 |
| 1671 | Ga0496102_0247947 | 3300048905 | Bacteria | 1679 |
| 1672 | Ga0496103_0002582 | 3300048906 | Bacteria | 11343 |
| 1673 | Ga0496103_0016337 | 3300048906 | Bacteria | 4429 |
| 1674 | Ga0496103_0028308 | 3300048906 | Bacteria | 3399 |
| 1675 | Ga0496103_0051744 | 3300048906 | Bacteria | 2542 |
| 1676 | Ga0496103_0103633 | 3300048906 | Bacteria | 1802 |
| 1677 | Ga0496103_0110200 | 3300048906 | Bacteria | 1748 |
| 1678 | Ga0496104_0000069 | 3300048907 | Bacteria | 107511 |
| 1679 | Ga0496104_0001998 | 3300048907 | Bacteria | 17696 |
| 1680 | Ga0496104_0002038 | 3300048907 | Bacteria | 17538 |
| 1681 | Ga0496104_0009701 | 3300048907 | Bacteria | 8579 |
| 1682 | Ga0496104_0012321 | 3300048907 | Bacteria | 7685 |
| 1683 | Ga0496104_0032924 | 3300048907 | Bacteria | 4825 |
| 1684 | Ga0496104_0051175 | 3300048907 | Bacteria | 3898 |
| 1685 | Ga0496104_0108687 | 3300048907 | Bacteria | 2658 |
| 1686 | Ga0496104_0109318 | 3300048907 | Bacteria | 2650 |
| 1687 | Ga0496104_0125209 | 3300048907 | Bacteria | 2467 |
| 1688 | Ga0496104_0221311 | 3300048907 | Bacteria | 1805 |
| 1689 | Ga0496104_0257990 | 3300048907 | Bacteria | 1656 |
| 1690 | Ga0496105_0000273 | 3300048908 | Bacteria | 34154 |
| 1691 | Ga0496105_0003200 | 3300048908 | Bacteria | 12054 |
| 1692 | Ga0496105_0012407 | 3300048908 | Bacteria | 6745 |
| 1693 | Ga0496105_0027217 | 3300048908 | Bacteria | 4669 |
| 1694 | Ga0496105_0035427 | 3300048908 | Bacteria | 4106 |
| 1695 | Ga0496105_0127865 | 3300048908 | Bacteria | 2095 |
| 1696 | Ga0496105_0162780 | 3300048908 | Bacteria | 1831 |
| 1697 | Ga0496105_0195128 | 3300048908 | Bacteria | 1654 |
| 1698 | Ga0496106_0004905 | 3300048909 | Bacteria | 9902 |
| 1699 | Ga0496106_0005034 | 3300048909 | Bacteria | 9780 |
| 1700 | Ga0496106_0006158 | 3300048909 | Bacteria | 8868 |
| 1701 | Ga0496106_0011013 | 3300048909 | Bacteria | 6685 |
| 1702 | Ga0496106_0017277 | 3300048909 | Bacteria | 5340 |
| 1703 | Ga0496106_0221426 | 3300048909 | Bacteria | 1509 |
| 1704 | Ga0496107_0000537 | 3300048910 | Bacteria | 21180 |
| 1705 | Ga0496107_0006365 | 3300048910 | Bacteria | 8115 |
| 1706 | Ga0496107_0013024 | 3300048910 | Bacteria | 5810 |
| 1707 | Ga0496107_0063558 | 3300048910 | Bacteria | 2675 |
| 1708 | Ga0496107_0067169 | 3300048910 | Bacteria | 2601 |
| 1709 | Ga0496107_0091491 | 3300048910 | Bacteria | 2223 |
| 1710 | Ga0496107_0215224 | 3300048910 | Bacteria | 1429 |
| 1711 | Ga0496108_0018111 | 3300048911 | Bacteria | 5762 |
| 1712 | Ga0496108_0025662 | 3300048911 | Bacteria | 4858 |
| 1713 | Ga0496108_0065272 | 3300048911 | Bacteria | 3068 |
| 1714 | Ga0496108_0115557 | 3300048911 | Bacteria | 2298 |
| 1715 | Ga0496108_0129129 | 3300048911 | Bacteria | 2172 |
| 1716 | Ga0496108_0201138 | 3300048911 | Bacteria | 1729 |
| 1717 | Ga0496108_0273172 | 3300048911 | Bacteria | 1471 |
| 1718 | Ga0496108_0555650 | 3300048911 | Bacteria | 1001 |
| 1719 | Ga0496109_0000211 | 3300048912 | Bacteria | 57066 |
| 1720 | Ga0496109_0004878 | 3300048912 | Bacteria | 11204 |
| 1721 | Ga0496109_0007320 | 3300048912 | Bacteria | 9332 |
| 1722 | Ga0496109_0010746 | 3300048912 | Bacteria | 7837 |
| 1723 | Ga0496109_0055426 | 3300048912 | Bacteria | 3616 |
| 1724 | Ga0496109_0094753 | 3300048912 | Bacteria | 2763 |
| 1725 | Ga0496110_0005109 | 3300048913 | Bacteria | 10251 |
| 1726 | Ga0496110_0025892 | 3300048913 | Bacteria | 5016 |
| 1727 | Ga0496110_0042808 | 3300048913 | Bacteria | 3953 |
| 1728 | Ga0496110_0047098 | 3300048913 | Bacteria | 3774 |
| 1729 | Ga0496110_0047695 | 3300048913 | Bacteria | 3752 |
| 1730 | Ga0496110_0054506 | 3300048913 | Bacteria | 3517 |
| 1731 | Ga0496110_0057725 | 3300048913 | Bacteria | 3417 |
| 1732 | Ga0496110_0068717 | 3300048913 | Bacteria | 3136 |
| 1733 | Ga0496110_0088234 | 3300048913 | Bacteria | 2770 |
| 1734 | Ga0496110_0387450 | 3300048913 | Bacteria | 1274 |
| 1735 | Ga0496110_0502226 | 3300048913 | Bacteria | 1104 |
| 1736 | Ga0496111_0000797 | 3300048914 | Bacteria | 16881 |
| 1737 | Ga0496111_0014125 | 3300048914 | Bacteria | 5448 |
| 1738 | Ga0496111_0031739 | 3300048914 | Bacteria | 3763 |
| 1739 | Ga0496111_0141877 | 3300048914 | Bacteria | 1780 |
| 1740 | Ga0496111_0154797 | 3300048914 | Bacteria | 1701 |
| 1741 | Ga0496112_0000016 | 3300048915 | Bacteria | 194634 |
| 1742 | Ga0496112_0003979 | 3300048915 | Bacteria | 12379 |
| 1743 | Ga0496112_0005033 | 3300048915 | Bacteria | 11346 |
| 1744 | Ga0496112_0010105 | 3300048915 | Bacteria | 8545 |
| 1745 | Ga0496112_0035820 | 3300048915 | Bacteria | 4836 |
| 1746 | Ga0496112_0056278 | 3300048915 | Bacteria | 3870 |
| 1747 | Ga0496112_0090590 | 3300048915 | Bacteria | 3027 |
| 1748 | Ga0496112_0273024 | 3300048915 | Bacteria | 1639 |
| 1749 | Ga0496113_0000104 | 3300048916 | Bacteria | 35682 |
| 1750 | Ga0496113_0004791 | 3300048916 | Bacteria | 8362 |
| 1751 | Ga0496113_0013067 | 3300048916 | Bacteria | 5605 |
| 1752 | Ga0496113_0016231 | 3300048916 | Bacteria | 5141 |
| 1753 | Ga0496113_0025017 | 3300048916 | Bacteria | 4251 |
| 1754 | Ga0496113_0080700 | 3300048916 | Bacteria | 2492 |
| 1755 | Ga0496113_0126942 | 3300048916 | Bacteria | 1998 |
| 1756 | Ga0496113_0374952 | 3300048916 | Bacteria | 1142 |
| 1757 | Ga0496114_0003482 | 3300048917 | Bacteria | 12085 |
| 1758 | Ga0496114_0009535 | 3300048917 | Bacteria | 7703 |
| 1759 | Ga0496114_0057063 | 3300048917 | Bacteria | 3259 |
| 1760 | Ga0496114_0123135 | 3300048917 | Bacteria | 2232 |
| 1761 | Ga0496114_0186865 | 3300048917 | Bacteria | 1811 |
| 1762 | Ga0496114_0197612 | 3300048917 | Bacteria | 1760 |
| 1763 | Ga0496114_0238901 | 3300048917 | Bacteria | 1597 |
| 1764 | Ga0496114_0270501 | 3300048917 | Bacteria | 1497 |
| 1765 | Ga0496114_0279228 | 3300048917 | Bacteria | 1472 |
| 1766 | Ga0496115_0008441 | 3300048918 | Bacteria | 7622 |
| 1767 | Ga0496115_0011629 | 3300048918 | Bacteria | 6603 |
| 1768 | Ga0496115_0014721 | 3300048918 | Bacteria | 5926 |
| 1769 | Ga0496115_0037604 | 3300048918 | Bacteria | 3836 |
| 1770 | Ga0496115_0047177 | 3300048918 | Bacteria | 3444 |
| 1771 | Ga0496115_0047227 | 3300048918 | Bacteria | 3442 |
| 1772 | Ga0496115_0055149 | 3300048918 | Bacteria | 3192 |
| 1773 | Ga0496115_0075559 | 3300048918 | Bacteria | 2737 |
| 1774 | Ga0496115_0082979 | 3300048918 | Bacteria | 2612 |
| 1775 | Ga0496115_0278816 | 3300048918 | Bacteria | 1372 |
| 1776 | Ga0496115_0342901 | 3300048918 | Bacteria | 1219 |
| 1777 | Ga0496115_0377426 | 3300048918 | Bacteria | 1153 |
| 1778 | Ga0496116_0000043 | 3300048919 | Bacteria | 328085 |
| 1779 | Ga0496116_0010081 | 3300048919 | Bacteria | 7968 |
| 1780 | Ga0496116_0020796 | 3300048919 | Bacteria | 4971 |
| 1781 | Ga0496116_0068414 | 3300048919 | Bacteria | 2262 |
| 1782 | Ga0496116_0086799 | 3300048919 | Bacteria | 1917 |
| 1783 | Ga0496117_0000002 | 3300048920 | Bacteria | 2483758 |
| 1784 | Ga0496117_0002626 | 3300048920 | Bacteria | 22299 |
| 1785 | Ga0496117_0034760 | 3300048920 | Bacteria | 3793 |
| 1786 | Ga0496117_0174387 | 3300048920 | Bacteria | 1244 |
| 1787 | Ga0496118_0000355 | 3300048921 | Bacteria | 77500 |
| 1788 | Ga0496118_0002908 | 3300048921 | Bacteria | 22263 |
| 1789 | Ga0496118_0016639 | 3300048921 | Bacteria | 6738 |
| 1790 | Ga0496118_0030122 | 3300048921 | Bacteria | 4537 |
| 1791 | Ga0496118_0049303 | 3300048921 | Bacteria | 3244 |
| 1792 | Ga0496118_0049811 | 3300048921 | Bacteria | 3221 |
| 1793 | Ga0496118_0083290 | 3300048921 | Bacteria | 2237 |
| 1794 | Ga0496118_0148090 | 3300048921 | Bacteria | 1474 |
| 1795 | Ga0496118_0291683 | 3300048921 | Bacteria | 901 |
| 1796 | Ga0496119_0001049 | 3300048922 | Bacteria | 35355 |
| 1797 | Ga0496119_0019289 | 3300048922 | Bacteria | 5030 |
| 1798 | Ga0496119_0022816 | 3300048922 | Bacteria | 4462 |
| 1799 | Ga0496119_0023480 | 3300048922 | Bacteria | 4370 |
| 1800 | Ga0496119_0023830 | 3300048922 | Bacteria | 4326 |
| 1801 | Ga0496119_0060646 | 3300048922 | Bacteria | 2263 |
| 1802 | Ga0496119_0075211 | 3300048922 | Bacteria | 1964 |
| 1803 | Ga0496119_0152504 | 3300048922 | Bacteria | 1236 |
| 1804 | Ga0496119_0154007 | 3300048922 | Bacteria | 1229 |
| 1805 | Ga0496119_0161280 | 3300048922 | Bacteria | 1192 |
| 1806 | Ga0496120_0001026 | 3300048923 | Bacteria | 37324 |
| 1807 | Ga0496120_0041615 | 3300048923 | Bacteria | 2689 |
| 1808 | Ga0496121_0000001 | 3300048924 | Bacteria | 1830318 |
| 1809 | Ga0496121_0002834 | 3300048924 | Bacteria | 25612 |
| 1810 | Ga0496121_0007292 | 3300048924 | Bacteria | 13377 |
| 1811 | Ga0496121_0008324 | 3300048924 | Bacteria | 12253 |
| 1812 | Ga0496121_0022576 | 3300048924 | Bacteria | 6098 |
| 1813 | Ga0496121_0037196 | 3300048924 | Bacteria | 4326 |
| 1814 | Ga0496121_0039941 | 3300048924 | Bacteria | 4126 |
| 1815 | Ga0496121_0064770 | 3300048924 | Bacteria | 2978 |
| 1816 | Ga0496121_0128354 | 3300048924 | Bacteria | 1903 |
| 1817 | Ga0496121_0180096 | 3300048924 | Bacteria | 1526 |
| 1818 | Ga0496121_0235180 | 3300048924 | Bacteria | 1280 |
| 1819 | Ga0496121_0322992 | 3300048924 | Bacteria | 1038 |
| 1820 | Ga0496122_0000001 | 3300048925 | Bacteria | 1827766 |
| 1821 | Ga0496122_0000025 | 3300048925 | Bacteria | 362915 |
| 1822 | Ga0496122_0007050 | 3300048925 | Bacteria | 12635 |
| 1823 | Ga0496122_0013982 | 3300048925 | Bacteria | 7799 |
| 1824 | Ga0496122_0020485 | 3300048925 | Bacteria | 5973 |
| 1825 | Ga0496122_0026337 | 3300048925 | Bacteria | 5016 |
| 1826 | Ga0496122_0027134 | 3300048925 | Bacteria | 4906 |
| 1827 | Ga0496122_0037582 | 3300048925 | Bacteria | 3894 |
| 1828 | Ga0496122_0072488 | 3300048925 | Bacteria | 2448 |
| 1829 | Ga0496122_0086527 | 3300048925 | Bacteria | 2156 |
| 1830 | Ga0496122_0104427 | 3300048925 | Bacteria | 1882 |
| 1831 | Ga0496123_0000001 | 3300048926 | Bacteria | 1831497 |
| 1832 | Ga0496123_0000032 | 3300048926 | Bacteria | 285282 |
| 1833 | Ga0496123_0000043 | 3300048926 | Bacteria | 253752 |
| 1834 | Ga0496123_0010783 | 3300048926 | Bacteria | 8020 |
| 1835 | Ga0496123_0010935 | 3300048926 | Bacteria | 7938 |
| 1836 | Ga0496123_0013675 | 3300048926 | Bacteria | 6789 |
| 1837 | Ga0496123_0029237 | 3300048926 | Bacteria | 4063 |
| 1838 | Ga0496123_0041064 | 3300048926 | Bacteria | 3212 |
| 1839 | Ga0496123_0046657 | 3300048926 | Bacteria | 2936 |
| 1840 | Ga0496123_0139205 | 3300048926 | Bacteria | 1330 |
| 1841 | Ga0496124_0000112 | 3300048927 | Bacteria | 166282 |
| 1842 | Ga0496124_0003528 | 3300048927 | Bacteria | 19047 |
| 1843 | Ga0496124_0008106 | 3300048927 | Bacteria | 11034 |
| 1844 | Ga0496124_0018233 | 3300048927 | Bacteria | 6581 |
| 1845 | Ga0496124_0019709 | 3300048927 | Bacteria | 6266 |
| 1846 | Ga0496124_0023074 | 3300048927 | Bacteria | 5692 |
| 1847 | Ga0496124_0038848 | 3300048927 | Bacteria | 4130 |
| 1848 | Ga0496124_0046692 | 3300048927 | Bacteria | 3707 |
| 1849 | Ga0496124_0055085 | 3300048927 | Bacteria | 3363 |
| 1850 | Ga0496124_0106758 | 3300048927 | Bacteria | 2260 |
| 1851 | Ga0496124_0126394 | 3300048927 | Bacteria | 2036 |
| 1852 | Ga0496124_0128101 | 3300048927 | Bacteria | 2020 |
| 1853 | Ga0496124_0145251 | 3300048927 | Bacteria | 1867 |
| 1854 | Ga0496124_0205767 | 3300048927 | Bacteria | 1493 |
| 1855 | Ga0496125_0000001 | 3300048928 | Bacteria | 1766138 |
| 1856 | Ga0496125_0000092 | 3300048928 | Bacteria | 211050 |
| 1857 | Ga0496125_0001341 | 3300048928 | Bacteria | 36276 |
| 1858 | Ga0496125_0001770 | 3300048928 | Bacteria | 29917 |
| 1859 | Ga0496125_0010044 | 3300048928 | Bacteria | 9610 |
| 1860 | Ga0496125_0029434 | 3300048928 | Bacteria | 4935 |
| 1861 | Ga0496125_0054611 | 3300048928 | Bacteria | 3262 |
| 1862 | Ga0496126_0000369 | 3300048929 | Bacteria | 92814 |
| 1863 | Ga0496126_0005296 | 3300048929 | Bacteria | 14808 |
| 1864 | Ga0496126_0025621 | 3300048929 | Bacteria | 5670 |
| 1865 | Ga0496126_0027521 | 3300048929 | Bacteria | 5429 |
| 1866 | Ga0495678_008204 | 3300049459 | Bacteria | 5299 |
| 1867 | Ga0501317_017280 | 3300049533 | Bacteria | 944 |
| 1868 | Ga0501321_009974 | 3300049537 | Bacteria | 1035 |
| 1869 | Ga0501325_002693 | 3300049541 | Bacteria | 1237 |
| 1870 | Ga0501031_0023684 | 3300049568 | Bacteria | 4002 |
| 1871 | Ga0501031_0095847 | 3300049568 | Bacteria | 1936 |
| 1872 | Ga0501031_0110215 | 3300049568 | Bacteria | 1797 |
| 1873 | Ga0501032_0031972 | 3300049569 | Bacteria | 3607 |
| 1874 | Ga0501032_0038066 | 3300049569 | Bacteria | 3277 |
| 1875 | Ga0501032_0079969 | 3300049569 | Bacteria | 2175 |
| 1876 | Ga0501032_0142313 | 3300049569 | Bacteria | 1579 |
| 1877 | Ga0501032_0159647 | 3300049569 | Bacteria | 1480 |
| 1878 | Ga0501032_0227329 | 3300049569 | Bacteria | 1213 |
| 1879 | Ga0501033_0006664 | 3300049570 | Bacteria | 9026 |
| 1880 | Ga0501033_0020232 | 3300049570 | Bacteria | 5031 |
| 1881 | Ga0501033_0030642 | 3300049570 | Bacteria | 4041 |
| 1882 | Ga0501033_0062652 | 3300049570 | Bacteria | 2738 |
| 1883 | Ga0501033_0073315 | 3300049570 | Bacteria | 2513 |
| 1884 | Ga0501033_0074314 | 3300049570 | Bacteria | 2495 |
| 1885 | Ga0501033_0274779 | 3300049570 | Bacteria | 1190 |
| 1886 | Ga0501033_0385188 | 3300049570 | Bacteria | 979 |
| 1887 | Ga0501034_0005514 | 3300049571 | Bacteria | 13808 |
| 1888 | Ga0501034_0008639 | 3300049571 | Bacteria | 10742 |
| 1889 | Ga0501034_0033130 | 3300049571 | Bacteria | 5244 |
| 1890 | Ga0501034_0062839 | 3300049571 | Bacteria | 3728 |
| 1891 | Ga0501034_0082818 | 3300049571 | Bacteria | 3210 |
| 1892 | Ga0501034_0105586 | 3300049571 | Bacteria | 2809 |
| 1893 | Ga0501034_0136543 | 3300049571 | Bacteria | 2433 |
| 1894 | Ga0501034_0187086 | 3300049571 | Bacteria | 2034 |
| 1895 | Ga0501034_0196037 | 3300049571 | Bacteria | 1979 |
| 1896 | Ga0501034_0211117 | 3300049571 | Bacteria | 1896 |
| 1897 | Ga0501034_0578866 | 3300049571 | Bacteria | 1030 |
| 1898 | Ga0501036_0003373 | 3300049572 | Bacteria | 12758 |
| 1899 | Ga0501036_0017490 | 3300049572 | Bacteria | 5994 |
| 1900 | Ga0501036_0026291 | 3300049572 | Bacteria | 4911 |
| 1901 | Ga0501036_0032301 | 3300049572 | Bacteria | 4423 |
| 1902 | Ga0501036_0051586 | 3300049572 | Bacteria | 3483 |
| 1903 | Ga0501036_0073064 | 3300049572 | Bacteria | 2900 |
| 1904 | Ga0501036_0087633 | 3300049572 | Bacteria | 2631 |
| 1905 | Ga0501036_0282371 | 3300049572 | Bacteria | 1389 |
| 1906 | Ga0501037_0011514 | 3300049573 | Bacteria | 6511 |
| 1907 | Ga0501037_0016929 | 3300049573 | Bacteria | 5364 |
| 1908 | Ga0501037_0017813 | 3300049573 | Bacteria | 5229 |
| 1909 | Ga0501037_0048981 | 3300049573 | Bacteria | 3094 |
| 1910 | Ga0501037_0061852 | 3300049573 | Bacteria | 2730 |
| 1911 | Ga0501037_0071527 | 3300049573 | Bacteria | 2523 |
| 1912 | Ga0501037_0100601 | 3300049573 | Bacteria | 2087 |
| 1913 | Ga0501037_0119962 | 3300049573 | Bacteria | 1891 |
| 1914 | Ga0501038_0009517 | 3300049574 | Bacteria | 8918 |
| 1915 | Ga0501038_0012909 | 3300049574 | Bacteria | 7620 |
| 1916 | Ga0501038_0026739 | 3300049574 | Bacteria | 5137 |
| 1917 | Ga0501038_0031324 | 3300049574 | Bacteria | 4700 |
| 1918 | Ga0501038_0036530 | 3300049574 | Bacteria | 4311 |
| 1919 | Ga0501038_0075778 | 3300049574 | Bacteria | 2843 |
| 1920 | Ga0501038_0108493 | 3300049574 | Bacteria | 2301 |
| 1921 | Ga0501038_0260926 | 3300049574 | Bacteria | 1369 |
| 1922 | Ga0501038_0287591 | 3300049574 | Bacteria | 1293 |
| 1923 | Ga0501038_0437177 | 3300049574 | Bacteria | 1008 |
| 1924 | Ga0501039_0036175 | 3300049575 | Bacteria | 3809 |
| 1925 | Ga0501039_0082559 | 3300049575 | Bacteria | 2502 |
| 1926 | Ga0501039_0366127 | 3300049575 | Bacteria | 1132 |
| 1927 | Ga0501040_0096153 | 3300049576 | Bacteria | 2062 |
| 1928 | Ga0501040_0120120 | 3300049576 | Bacteria | 1844 |
| 1929 | Ga0501041_0279550 | 3300049577 | Bacteria | 1050 |
| 1930 | Ga0501043_0009122 | 3300049579 | Bacteria | 7803 |
| 1931 | Ga0501043_0034750 | 3300049579 | Bacteria | 3964 |
| 1932 | Ga0501043_0045712 | 3300049579 | Bacteria | 3443 |
| 1933 | Ga0501043_0107704 | 3300049579 | Bacteria | 2189 |
| 1934 | Ga0501043_0220985 | 3300049579 | Bacteria | 1465 |
| 1935 | Ga0501043_0364252 | 3300049579 | Bacteria | 1097 |
| 1936 | Ga0501046_0003405 | 3300049580 | Bacteria | 14597 |
| 1937 | Ga0501046_0010978 | 3300049580 | Bacteria | 7767 |
| 1938 | Ga0501046_0073455 | 3300049580 | Bacteria | 2654 |
| 1939 | Ga0501046_0377812 | 3300049580 | Bacteria | 1026 |
| 1940 | Ga0501047_0000228 | 3300049581 | Bacteria | 66588 |
| 1941 | Ga0501047_0005864 | 3300049581 | Bacteria | 11561 |
| 1942 | Ga0501047_0009086 | 3300049581 | Bacteria | 9386 |
| 1943 | Ga0501047_0014702 | 3300049581 | Bacteria | 7448 |
| 1944 | Ga0501047_0025685 | 3300049581 | Bacteria | 5664 |
| 1945 | Ga0501047_0068784 | 3300049581 | Bacteria | 3411 |
| 1946 | Ga0501047_0130434 | 3300049581 | Bacteria | 2394 |
| 1947 | Ga0501048_0000331 | 3300049582 | Bacteria | 32529 |
| 1948 | Ga0501048_0001758 | 3300049582 | Bacteria | 16487 |
| 1949 | Ga0501067_0002567 | 3300049583 | Bacteria | 10034 |
| 1950 | Ga0501068_0003377 | 3300049584 | Bacteria | 8581 |
| 1951 | Ga0501068_0003420 | 3300049584 | Bacteria | 8541 |
| 1952 | Ga0501068_0014151 | 3300049584 | Bacteria | 4556 |
| 1953 | Ga0501068_0035476 | 3300049584 | Bacteria | 2978 |
| 1954 | Ga0501068_0278424 | 3300049584 | Bacteria | 1069 |
| 1955 | Ga0501069_0003872 | 3300049585 | Bacteria | 7708 |
| 1956 | Ga0501069_0180713 | 3300049585 | Bacteria | 1219 |
| 1957 | Ga0501070_0007225 | 3300049586 | Bacteria | 9430 |
| 1958 | Ga0501070_0012830 | 3300049586 | Bacteria | 7062 |
| 1959 | Ga0501070_0014246 | 3300049586 | Bacteria | 6692 |
| 1960 | Ga0501070_0014944 | 3300049586 | Bacteria | 6531 |
| 1961 | Ga0501070_0019565 | 3300049586 | Bacteria | 5677 |
| 1962 | Ga0501070_0071103 | 3300049586 | Bacteria | 2881 |
| 1963 | Ga0501070_0074251 | 3300049586 | Bacteria | 2815 |
| 1964 | Ga0501070_0104200 | 3300049586 | Bacteria | 2346 |
| 1965 | Ga0501070_0131097 | 3300049586 | Bacteria | 2070 |
| 1966 | Ga0501070_0229724 | 3300049586 | Bacteria | 1520 |
| 1967 | Ga0501070_0287393 | 3300049586 | Bacteria | 1341 |
| 1968 | Ga0501070_0549747 | 3300049586 | Bacteria | 924 |
| 1969 | Ga0501071_0053053 | 3300049587 | Bacteria | 2924 |
| 1970 | Ga0501071_0098601 | 3300049587 | Bacteria | 2153 |
| 1971 | Ga0501071_0141871 | 3300049587 | Bacteria | 1789 |
| 1972 | Ga0501072_0001711 | 3300049588 | Bacteria | 16332 |
| 1973 | Ga0501072_0055644 | 3300049588 | Bacteria | 3118 |
| 1974 | Ga0501072_0074478 | 3300049588 | Bacteria | 2685 |
| 1975 | Ga0501072_0095850 | 3300049588 | Bacteria | 2358 |
| 1976 | Ga0501072_0226065 | 3300049588 | Bacteria | 1491 |
| 1977 | Ga0501073_0009199 | 3300049589 | Bacteria | 7287 |
| 1978 | Ga0501073_0018457 | 3300049589 | Bacteria | 5042 |
| 1979 | Ga0501073_0030347 | 3300049589 | Bacteria | 3860 |
| 1980 | Ga0501073_0061579 | 3300049589 | Bacteria | 2618 |
| 1981 | Ga0501073_0382526 | 3300049589 | Bacteria | 972 |
| 1982 | Ga0501074_0102810 | 3300049590 | Bacteria | 2045 |
| 1983 | Ga0501074_0154458 | 3300049590 | Bacteria | 1640 |
| 1984 | Ga0501075_0171507 | 3300049591 | Bacteria | 1656 |
| 1985 | Ga0501076_0046862 | 3300049592 | Bacteria | 3416 |
| 1986 | Ga0501076_0095437 | 3300049592 | Bacteria | 2395 |
| 1987 | Ga0501076_0342683 | 3300049592 | Bacteria | 1227 |
| 1988 | Ga0501077_0003071 | 3300049593 | Bacteria | 10027 |
| 1989 | Ga0501077_0023941 | 3300049593 | Bacteria | 3873 |
| 1990 | Ga0501077_0033066 | 3300049593 | Bacteria | 3293 |
| 1991 | Ga0501077_0235801 | 3300049593 | Unclassified | 1163 |
| 1992 | Ga0501252_004934 | 3300049682 | Bacteria | 1436 |
| 1993 | Ga0501079_0052582 | 3300049741 | Bacteria | 3143 |
| 1994 | Ga0501079_0084729 | 3300049741 | Bacteria | 2452 |
| 1995 | Ga0501079_0216653 | 3300049741 | Bacteria | 1495 |
| 1996 | Ga0501079_0310709 | 3300049741 | Bacteria | 1233 |
| 1997 | Ga0501079_0383821 | 3300049741 | Bacteria | 1101 |
| 1998 | Ga0501079_0516014 | 3300049741 | Bacteria | 940 |
| 1999 | Ga0501079_0531435 | 3300049741 | Bacteria | 925 |
| 2000 | Ga0501080_0001137 | 3300049742 | Bacteria | 21908 |
| 2001 | Ga0501080_0015938 | 3300049742 | Bacteria | 6932 |
| 2002 | Ga0501080_0072959 | 3300049742 | Bacteria | 3193 |
| 2003 | Ga0501080_0083608 | 3300049742 | Bacteria | 2965 |
| 2004 | Ga0501080_0122374 | 3300049742 | Bacteria | 2410 |
| 2005 | Ga0501080_0149652 | 3300049742 | Bacteria | 2158 |
| 2006 | Ga0501080_0202934 | 3300049742 | Bacteria | 1820 |
| 2007 | Ga0501080_0267177 | 3300049742 | Bacteria | 1557 |
| 2008 | Ga0501080_0377481 | 3300049742 | Bacteria | 1278 |
| 2009 | Ga0501081_0027275 | 3300049743 | Bacteria | 3853 |
| 2010 | Ga0501081_0045755 | 3300049743 | Bacteria | 3005 |
| 2011 | Ga0501081_0048305 | 3300049743 | Bacteria | 2929 |
| 2012 | Ga0501081_0224396 | 3300049743 | Bacteria | 1367 |
| 2013 | Ga0501083_0025094 | 3300049744 | Bacteria | 4128 |
| 2014 | Ga0501083_0035347 | 3300049744 | Bacteria | 3414 |
| 2015 | Ga0501083_0043017 | 3300049744 | Bacteria | 3061 |
| 2016 | Ga0501083_0055575 | 3300049744 | Bacteria | 2653 |
| 2017 | Ga0501083_0079080 | 3300049744 | Bacteria | 2181 |
| 2018 | Ga0501083_0101911 | 3300049744 | Bacteria | 1892 |
| 2019 | Ga0501280_001053 | 3300049776 | Bacteria | 5620 |
| 2020 | Ga0501035_0022065 | 3300049822 | Bacteria | 5848 |
| 2021 | Ga0501035_0034511 | 3300049822 | Bacteria | 4596 |
| 2022 | Ga0501035_0063571 | 3300049822 | Bacteria | 3282 |
| 2023 | Ga0501035_0089644 | 3300049822 | Bacteria | 2708 |
| 2024 | Ga0501035_0121641 | 3300049822 | Bacteria | 2281 |
| 2025 | Ga0501044_0002904 | 3300049823 | Bacteria | 19514 |
| 2026 | Ga0501044_0006495 | 3300049823 | Bacteria | 12918 |
| 2027 | Ga0501044_0010842 | 3300049823 | Bacteria | 9888 |
| 2028 | Ga0501044_0094692 | 3300049823 | Bacteria | 3010 |
| 2029 | Ga0501044_0152045 | 3300049823 | Bacteria | 2296 |
| 2030 | Ga0501044_0174070 | 3300049823 | Bacteria | 2122 |
| 2031 | Ga0501044_0179096 | 3300049823 | Bacteria | 2087 |
| 2032 | Ga0501044_0180971 | 3300049823 | Bacteria | 2075 |
| 2033 | Ga0501044_0352644 | 3300049823 | Bacteria | 1390 |
| 2034 | Ga0501044_0450393 | 3300049823 | Bacteria | 1194 |
| 2035 | Ga0501044_0556774 | 3300049823 | Bacteria | 1043 |
| 2036 | Ga0501044_0590499 | 3300049823 | Bacteria | 1004 |
| 2037 | Ga0501044_0606439 | 3300049823 | Bacteria | 987 |
| 2038 | Ga0501045_0019735 | 3300049824 | Bacteria | 4809 |
| 2039 | Ga0501045_0067502 | 3300049824 | Bacteria | 2627 |
| 2040 | nmdc:mga03683_1313_c1 | 3300050489 | Bacteria | 7347 |
| 2041 | nmdc:mga03683_17711_c1 | 3300050489 | Bacteria | 2700 |
| 2042 | nmdc:mga00v17_22699_c1 | 3300050491 | Bacteria | 3623 |
| 2043 | nmdc:mga00v17_287268_c1 | 3300050491 | Bacteria | 1068 |
| 2044 | nmdc:mga00v17_6_c1 | 3300050491 | Bacteria | 179509 |
| 2045 | nmdc:mga00v17_74_c2 | 3300050491 | Bacteria | 26063 |
| 2046 | nmdc:mga00v17_95613_c1 | 3300050491 | Bacteria | 1870 |
| 2047 | nmdc:mga0yw44_10927_c1 | 3300050492 | Bacteria | 4656 |
| 2048 | nmdc:mga0yw44_15015_c1 | 3300050492 | Bacteria | 4134 |
| 2049 | nmdc:mga0yw44_208030_c1 | 3300050492 | Bacteria | 1294 |
| 2050 | nmdc:mga0yw44_382836_c1 | 3300050492 | Bacteria | 950 |
| 2051 | nmdc:mga0yw44_86857_c1 | 3300050492 | Bacteria | 1971 |
| 2052 | nmdc:mga0yw44_9825_c1 | 3300050492 | Bacteria | 4859 |
| 2053 | nmdc:mga0k408_115448_c1 | 3300050493 | Bacteria | 1588 |
| 2054 | nmdc:mga0k408_13060_c1 | 3300050493 | Bacteria | 4547 |
| 2055 | nmdc:mga0k408_165436_c1 | 3300050493 | Bacteria | 1318 |
| 2056 | nmdc:mga0k408_189006_c1 | 3300050493 | Bacteria | 1229 |
| 2057 | nmdc:mga0k408_38530_c2 | 3300050493 | Bacteria | 2040 |
| 2058 | nmdc:mga0k408_83973_c1 | 3300050493 | Bacteria | 1868 |
| 2059 | nmdc:mga06z11_158174_c1 | 3300050494 | Bacteria | 1293 |
| 2060 | nmdc:mga06z11_17428_c1 | 3300050494 | Bacteria | 3259 |
| 2061 | nmdc:mga06z11_186672_c1 | 3300050494 | Bacteria | 1198 |
| 2062 | nmdc:mga06z11_23090_c1 | 3300050494 | Bacteria | 2916 |
| 2063 | nmdc:mga06z11_52530_c1 | 3300050494 | Bacteria | 2092 |
| 2064 | nmdc:mga06z11_78913_c1 | 3300050494 | Bacteria | 1761 |
| 2065 | nmdc:mga06z11_85042_c1 | 3300050494 | Bacteria | 1706 |
| 2066 | nmdc:mga04h51_26632_c1 | 3300050495 | Bacteria | 1790 |
| 2067 | nmdc:mga07m45_101116_c1 | 3300050496 | Bacteria | 1655 |
| 2068 | nmdc:mga07m45_125816_c1 | 3300050496 | Bacteria | 1482 |
| 2069 | nmdc:mga07m45_256283_c1 | 3300050496 | Bacteria | 1018 |
| 2070 | nmdc:mga05p37_131667_c1 | 3300050507 | Bacteria | 3069 |
| 2071 | nmdc:mga05p37_183765_c1 | 3300050507 | Bacteria | 2542 |
| 2072 | nmdc:mga05p37_24117_c1 | 3300050507 | Bacteria | 7390 |
| 2073 | nmdc:mga05p37_4180_c1 | 3300050507 | Bacteria | 16868 |
| 2074 | nmdc:mga05p37_635_c1 | 3300050507 | Bacteria | 38849 |
| 2075 | nmdc:mga05p37_9055_c1 | 3300050507 | Bacteria | 11768 |
| 2076 | nmdc:mga09592_135018_c1 | 3300050508 | Bacteria | 2125 |
| 2077 | nmdc:mga09592_1455_c1 | 3300050508 | Bacteria | 19027 |
| 2078 | nmdc:mga09592_4975_c1 | 3300050508 | Bacteria | 10770 |
| 2079 | nmdc:mga09592_542116_c1 | 3300050508 | Bacteria | 999 |
| 2080 | nmdc:mga0qj67_4711_c1 | 3300050509 | Bacteria | 9909 |
| 2081 | nmdc:mga0qj67_57496_c1 | 3300050509 | Bacteria | 3083 |
| 2082 | nmdc:mga0qj67_5882_c1 | 3300050509 | Bacteria | 8985 |
| 2083 | nmdc:mga06r32_232775_c1 | 3300050510 | Bacteria | 1830 |
| 2084 | nmdc:mga06r32_234900_c1 | 3300050510 | Bacteria | 1821 |
| 2085 | nmdc:mga06r32_249043_c1 | 3300050510 | Bacteria | 1764 |
| 2086 | nmdc:mga06r32_27182_c1 | 3300050510 | Bacteria | 5342 |
| 2087 | nmdc:mga06r32_566_c1 | 3300050510 | Bacteria | 32215 |
| 2088 | nmdc:mga08y16_11723_c1 | 3300050511 | Bacteria | 9209 |
| 2089 | nmdc:mga08y16_1227_c1 | 3300050511 | Bacteria | 25379 |
| 2090 | nmdc:mga08y16_134_c1 | 3300050511 | Bacteria | 64270 |
| 2091 | nmdc:mga08y16_17037_c1 | 3300050511 | Bacteria | 7651 |
| 2092 | nmdc:mga08y16_199269_c1 | 3300050511 | Bacteria | 2075 |
| 2093 | nmdc:mga08y16_445280_c1 | 3300050511 | Bacteria | 1321 |
| 2094 | nmdc:mga08y16_6892_c1 | 3300050511 | Bacteria | 11914 |
| 2095 | nmdc:mga0n895_109586_c1 | 3300050512 | Bacteria | 2776 |
| 2096 | nmdc:mga0n895_146006_c1 | 3300050512 | Bacteria | 2395 |
| 2097 | nmdc:mga0n895_171_c1 | 3300050512 | Bacteria | 40104 |
| 2098 | nmdc:mga0n895_21574_c1 | 3300050512 | Bacteria | 6027 |
| 2099 | nmdc:mga0n895_24501_c1 | 3300050512 | Bacteria | 5688 |
| 2100 | nmdc:mga0n895_76894_c1 | 3300050512 | Bacteria | 3319 |
| 2101 | nmdc:mga0n895_86278_c1 | 3300050512 | Bacteria | 3135 |
| 2102 | nmdc:mga0rr50_12842_c1 | 3300050513 | Bacteria | 5429 |
| 2103 | nmdc:mga0rr50_13993_c1 | 3300050513 | Bacteria | 5245 |
| 2104 | nmdc:mga0rr50_193567_c1 | 3300050513 | Bacteria | 1668 |
| 2105 | nmdc:mga0rr50_21706_c1 | 3300050513 | Bacteria | 4389 |
| 2106 | nmdc:mga0rr50_515938_c1 | 3300050513 | Bacteria | 1017 |
| 2107 | nmdc:mga08x19_140706_c1 | 3300050514 | Bacteria | 1630 |
| 2108 | nmdc:mga08x19_23_c1 | 3300050514 | Bacteria | 288286 |
| 2109 | nmdc:mga08x19_270120_c1 | 3300050514 | Bacteria | 1177 |
| 2110 | nmdc:mga08x19_66052_c1 | 3300050514 | Bacteria | 2350 |
| 2111 | nmdc:mga08x19_88581_c1 | 3300050514 | Bacteria | 2040 |
| 2112 | nmdc:mga0a205_15686_c1 | 3300050515 | Bacteria | 7079 |
| 2113 | nmdc:mga0a205_2563_c1 | 3300050515 | Bacteria | 16021 |
| 2114 | nmdc:mga0a205_3394_c1 | 3300050515 | Bacteria | 14195 |
| 2115 | nmdc:mga0sz30_1690_c1 | 3300050516 | Bacteria | 7841 |
| 2116 | nmdc:mga0sz30_17676_c1 | 3300050516 | Bacteria | 2846 |
| 2117 | nmdc:mga0sz30_21874_c1 | 3300050516 | Bacteria | 2592 |
| 2118 | nmdc:mga0sz30_44938_c1 | 3300050516 | Bacteria | 1862 |
| 2119 | Ga0495601_0000006 | 3300053077 | Bacteria | 373770 |
| 2120 | Ga0495601_0000379 | 3300053077 | Bacteria | 23511 |
| 2121 | Ga0495601_0001291 | 3300053077 | Bacteria | 13761 |
| 2122 | Ga0495601_0005176 | 3300053077 | Bacteria | 7579 |
| 2123 | Ga0495601_0006296 | 3300053077 | Bacteria | 6933 |
| 2124 | Ga0495601_0022891 | 3300053077 | Bacteria | 3839 |
| 2125 | Ga0495601_0075700 | 3300053077 | Bacteria | 2154 |
| 2126 | Ga0495601_0110667 | 3300053077 | Bacteria | 1779 |
| 2127 | Ga0495601_0127997 | 3300053077 | Bacteria | 1653 |
| 2128 | Ga0495601_0167917 | 3300053077 | Bacteria | 1434 |
| 2129 | Ga0495601_0181384 | 3300053077 | Bacteria | 1376 |
| 2130 | Ga0495612_0000007 | 3300053078 | Bacteria | 253300 |
| 2131 | Ga0495612_0000306 | 3300053078 | Bacteria | 19924 |
| 2132 | Ga0495612_0001697 | 3300053078 | Bacteria | 9058 |
| 2133 | Ga0495612_0005818 | 3300053078 | Bacteria | 5091 |
| 2134 | Ga0495612_0007362 | 3300053078 | Bacteria | 4498 |
| 2135 | Ga0495612_0042536 | 3300053078 | Bacteria | 1854 |
| 2136 | Ga0495612_0161214 | 3300053078 | Bacteria | 979 |
| 2137 | Ga0495612_0189253 | 3300053078 | Bacteria | 905 |
| 2138 | Ga0500610_0104204 | 3300053079 | Bacteria | 1465 |
| 2139 | Ga0500635_0006227 | 3300053080 | Bacteria | 3176 |
| 2140 | Ga0495655_0016429 | 3300053083 | Bacteria | 1594 |
| 2141 | Ga0495595_0000051 | 3300053084 | Bacteria | 60041 |
| 2142 | Ga0495595_0001512 | 3300053084 | Bacteria | 9085 |
| 2143 | Ga0495595_0003018 | 3300053084 | Bacteria | 6655 |
| 2144 | Ga0495595_0003071 | 3300053084 | Bacteria | 6606 |
| 2145 | Ga0495595_0033968 | 3300053084 | Bacteria | 2305 |
| 2146 | Ga0495595_0110988 | 3300053084 | Bacteria | 1330 |
| 2147 | Ga0495595_0161242 | 3300053084 | Bacteria | 1106 |
| 2148 | Ga0495619_0000027 | 3300053085 | Bacteria | 165001 |
| 2149 | Ga0495619_0000105 | 3300053085 | Bacteria | 62599 |
| 2150 | Ga0495619_0004472 | 3300053085 | Bacteria | 8925 |
| 2151 | Ga0495619_0005762 | 3300053085 | Bacteria | 7849 |
| 2152 | Ga0495619_0021807 | 3300053085 | Bacteria | 4092 |
| 2153 | Ga0495619_0024578 | 3300053085 | Bacteria | 3865 |
| 2154 | Ga0495619_0041815 | 3300053085 | Bacteria | 2999 |
| 2155 | Ga0495619_0049686 | 3300053085 | Bacteria | 2766 |
| 2156 | Ga0495619_0051507 | 3300053085 | Bacteria | 2720 |
| 2157 | Ga0495619_0056407 | 3300053085 | Bacteria | 2604 |
| 2158 | Ga0495619_0062165 | 3300053085 | Bacteria | 2485 |
| 2159 | Ga0495619_0106556 | 3300053085 | Bacteria | 1911 |
| 2160 | Ga0495619_0114935 | 3300053085 | Bacteria | 1841 |
| 2161 | Ga0495619_0291563 | 3300053085 | Bacteria | 1130 |
| 2162 | Ga0500646_0067705 | 3300053090 | Bacteria | 1065 |
| 2163 | Ga0500651_0012851 | 3300053093 | Bacteria | 5084 |
| 2164 | Ga0500641_0015533 | 3300053096 | Bacteria | 2829 |
| 2165 | Ga0500654_085932 | 3300053099 | Bacteria | 1434 |
| 2166 | Ga0500554_012124 | 3300053102 | Bacteria | 2158 |
| 2167 | Ga0500556_0007667 | 3300053104 | Bacteria | 3090 |
| 2168 | Ga0500556_0048019 | 3300053104 | Bacteria | 1534 |
| 2169 | Ga0500560_015739 | 3300053107 | Bacteria | 2048 |
| 2170 | Ga0500562_025006 | 3300053108 | Bacteria | 1562 |
| 2171 | Ga0500592_014781 | 3300053116 | Bacteria | 1251 |
| 2172 | Ga0500594_0009623 | 3300053118 | Bacteria | 2230 |
| 2173 | Ga0500595_016023 | 3300053119 | Bacteria | 2799 |
| 2174 | Ga0500595_022555 | 3300053119 | Bacteria | 2226 |
| 2175 | Ga0500607_124219 | 3300053121 | Bacteria | 1243 |
| 2176 | Ga0500608_010666 | 3300053122 | Bacteria | 3953 |
| 2177 | Ga0500618_000192 | 3300053125 | Bacteria | 50229 |
| 2178 | Ga0500618_000361 | 3300053125 | Bacteria | 31600 |
| 2179 | Ga0500618_007452 | 3300053125 | Bacteria | 3122 |
| 2180 | Ga0500618_009031 | 3300053125 | Bacteria | 2743 |
| 2181 | Ga0500642_0019592 | 3300053130 | Bacteria | 2642 |
| 2182 | Ga0500658_0043364 | 3300053134 | Bacteria | 1812 |
| 2183 | Ga0500559_0009585 | 3300053136 | Bacteria | 4182 |
| 2184 | Ga0500561_0008364 | 3300053137 | Bacteria | 2058 |
| 2185 | Ga0500568_0000506 | 3300053139 | Bacteria | 28722 |
| 2186 | Ga0500568_0017135 | 3300053139 | Bacteria | 3204 |
| 2187 | Ga0500573_0001363 | 3300053140 | Bacteria | 11624 |
| 2188 | Ga0500573_0004799 | 3300053140 | Bacteria | 7157 |
| 2189 | Ga0500577_0000183 | 3300053142 | Bacteria | 16294 |
| 2190 | Ga0500603_000278 | 3300053150 | Bacteria | 13480 |
| 2191 | Ga0500604_0006742 | 3300053151 | Bacteria | 3039 |
| 2192 | Ga0500604_0023089 | 3300053151 | Bacteria | 1772 |
| 2193 | Ga0500616_0000006 | 3300053153 | Bacteria | 944738 |
| 2194 | Ga0500616_0001455 | 3300053153 | Bacteria | 22611 |
| 2195 | Ga0500616_0001481 | 3300053153 | Bacteria | 22313 |
| 2196 | Ga0500616_0023325 | 3300053153 | Bacteria | 3447 |
| 2197 | Ga0500616_0143148 | 3300053153 | Bacteria | 1115 |
| 2198 | Ga0500622_0001030 | 3300053156 | Bacteria | 23359 |
| 2199 | Ga0500622_0037417 | 3300053156 | Bacteria | 2535 |
| 2200 | Ga0500622_0067344 | 3300053156 | Bacteria | 1817 |
| 2201 | Ga0500627_0024215 | 3300053158 | Bacteria | 2481 |
| 2202 | Ga0500627_0126281 | 3300053158 | Bacteria | 1155 |
| 2203 | Ga0500627_0127910 | 3300053158 | Bacteria | 1147 |
| 2204 | Ga0500633_0006714 | 3300053160 | Bacteria | 2842 |
| 2205 | Ga0500633_0085919 | 3300053160 | Bacteria | 1144 |
| 2206 | Ga0500636_0000019 | 3300053177 | Bacteria | 105042 |
| 2207 | Ga0500637_0067505 | 3300053178 | Bacteria | 2054 |
| 2208 | Ga0500611_006236 | 3300053727 | Bacteria | 1726 |
| 2209 | Ga0500645_002247 | 3300053730 | Bacteria | 8787 |
| 2210 | Ga0501084_0010849 | 3300054114 | Bacteria | 7546 |
| 2211 | Ga0501084_0021997 | 3300054114 | Bacteria | 5320 |
| 2212 | Ga0501084_0265941 | 3300054114 | Bacteria | 1448 |
| 2213 | Ga0501084_0403331 | 3300054114 | Bacteria | 1155 |
| 2214 | Ga0587066_010363 | 3300059490 | Bacteria | 1342 |
| 2215 | Ga0587070_016503 | 3300059491 | Bacteria | 1183 |
| 2216 | Ga0587082_022111 | 3300059504 | Bacteria | 1044 |
| 2217 | Ga0587088_016173 | 3300059508 | Bacteria | 1185 |
| 2218 | Ga0587101_012922 | 3300059623 | Bacteria | 1093 |
| 2219 | Ga0587128_015306 | 3300059630 | Bacteria | 1110 |
| 2220 | Ga0587072_015368 | 3300059643 | Bacteria | 1300 |
| 2221 | Ga0587111_0018765 | 3300060346 | Bacteria | 1305 |
| 2222 | Ga0501082_0000008 | 3300060353 | Bacteria | 125977 |
| 2223 | Ga0501082_0008268 | 3300060353 | Bacteria | 8973 |
| 2224 | Ga0501082_0043601 | 3300060353 | Bacteria | 3868 |
| 2225 | Ga0501082_0155204 | 3300060353 | Bacteria | 1989 |
| 2226 | Ga0501082_0183376 | 3300060353 | Bacteria | 1821 |
| 2227 | Ga0501082_0190013 | 3300060353 | Bacteria | 1787 |
| 2228 | Ga0501082_0194035 | 3300060353 | Bacteria | 1766 |
| 2229 | Ga0501082_0332185 | 3300060353 | Bacteria | 1324 |
| 2230 | Ga0501082_0526761 | 3300060353 | Bacteria | 1033 |
| 2231 | Ga0530510_0214609 | 3300061734 | Bacteria | 1430 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044712 | Ga0453684_0134128 | Ga0453684_0134128_1738_2598 | 246 |
| 2 | 3300039447 | Ga0436361_1191526 | Ga0436361_1191526_1064_1891 | 247 |
| 3 | 3300039450 | Ga0436363_0551050 | Ga0436363_0551050_21_836 | 247 |
| 4 | 3300029957 | Ga0265324_10001149 | Ga0265324_100011494 | 249 |
| 5 | 3300048922 | Ga0496119_0154007 | Ga0496119_0154007_442_1215 | 250 |
| 6 | 3300009093 | Ga0105240_10000005 | Ga0105240_10000005286 | 251 |
| 7 | 3300009545 | Ga0105237_10001912 | Ga0105237_100019125 | 251 |
| 8 | 3300010375 | Ga0105239_10007427 | Ga0105239_100074274 | 251 |
| 9 | 3300013104 | Ga0157370_10002129 | Ga0157370_100021295 | 251 |
| 10 | 3300015262 | Ga0182007_10001634 | Ga0182007_100016344 | 251 |
| 11 | 3300048905 | Ga0496102_0062013 | Ga0496102_0062013_1146_1934 | 251 |
| 12 | 3300048906 | Ga0496103_0016337 | Ga0496103_0016337_2002_2790 | 251 |
| 13 | 3300048916 | Ga0496113_0080700 | Ga0496113_0080700_236_1024 | 251 |
| 14 | 3300048919 | Ga0496116_0020796 | Ga0496116_0020796_1640_2428 | 251 |
| 15 | 3300048920 | Ga0496117_0002626 | Ga0496117_0002626_19759_20547 | 251 |
| 16 | 3300048921 | Ga0496118_0002908 | Ga0496118_0002908_1717_2505 | 251 |
| 17 | 3300048922 | Ga0496119_0019289 | Ga0496119_0019289_1699_2487 | 251 |
| 18 | 3300048923 | Ga0496120_0041615 | Ga0496120_0041615_1673_2461 | 251 |
| 19 | 3300048924 | Ga0496121_0007292 | Ga0496121_0007292_10858_11646 | 251 |
| 20 | 3300048925 | Ga0496122_0013982 | Ga0496122_0013982_5498_6286 | 251 |
| 21 | 3300048926 | Ga0496123_0010935 | Ga0496123_0010935_5481_6269 | 251 |
| 22 | 3300048927 | Ga0496124_0038848 | Ga0496124_0038848_1612_2400 | 251 |
| 23 | 3300003578 | Ga0006562J51391_1007243 | Ga0006562J51391_10072434 | 252 |
| 24 | 3300031239 | Ga0265328_10117374 | Ga0265328_101173741 | 252 |
| 25 | 3300037853 | Ga0436364_0681691 | Ga0436364_0681691_101_928 | 252 |
| 26 | 3300039450 | Ga0436363_0634809 | Ga0436363_0634809_35_862 | 252 |
| 27 | 3300049570 | Ga0501033_0073315 | Ga0501033_0073315_1312_2142 | 252 |
| 28 | 3300049571 | Ga0501034_0105586 | Ga0501034_0105586_372_1202 | 252 |
| 29 | 3300049579 | Ga0501043_0045712 | Ga0501043_0045712_890_1720 | 252 |
| 30 | 3300049581 | Ga0501047_0005864 | Ga0501047_0005864_10536_11366 | 252 |
| 31 | 3300049822 | Ga0501035_0121641 | Ga0501035_0121641_865_1695 | 252 |
| 32 | 3300048907 | Ga0496104_0000069 | Ga0496104_0000069_98148_98978 | 254 |
| 33 | 3300048907 | Ga0496104_0009701 | Ga0496104_0009701_4131_4961 | 254 |
| 34 | 3300048908 | Ga0496105_0035427 | Ga0496105_0035427_144_974 | 254 |
| 35 | 3300048913 | Ga0496110_0068717 | Ga0496110_0068717_1717_2547 | 254 |
| 36 | 3300048914 | Ga0496111_0014125 | Ga0496111_0014125_2604_3434 | 254 |
| 37 | 3300048916 | Ga0496113_0013067 | Ga0496113_0013067_3601_4431 | 254 |
| 38 | 3300025904 | Ga0207647_10144788 | Ga0207647_101447882 | 255 |
| 39 | 3300031235 | Ga0265330_10058925 | Ga0265330_100589251 | 255 |
| 40 | 3300031241 | Ga0265325_10084512 | Ga0265325_100845121 | 255 |
| 41 | 3300031247 | Ga0265340_10002029 | Ga0265340_1000202912 | 255 |
| 42 | 3300031595 | Ga0265313_10000031 | Ga0265313_1000003125 | 255 |
| 43 | 3300031711 | Ga0265314_10239823 | Ga0265314_102398231 | 255 |
| 44 | 3300031712 | Ga0265342_10010066 | Ga0265342_100100666 | 255 |
| 45 | 3300048907 | Ga0496104_0108687 | Ga0496104_0108687_494_1360 | 255 |
| 46 | 3300048917 | Ga0496114_0057063 | Ga0496114_0057063_1537_2403 | 255 |
| 47 | 3300048918 | Ga0496115_0047227 | Ga0496115_0047227_1203_2069 | 255 |
| 48 | 3300048918 | Ga0496115_0055149 | Ga0496115_0055149_181_1047 | 255 |
| 49 | 3300048922 | Ga0496119_0001049 | Ga0496119_0001049_16183_17049 | 255 |
| 50 | 3300041404 | Ga0439436_0046246 | Ga0439436_0046246_25_804 | 257 |
| 51 | 3300041505 | Ga0451849_0489010 | Ga0451849_0489010_22_801 | 257 |
| 52 | 3300042015 | Ga0439462_0066949 | Ga0439462_0066949_156_938 | 257 |
| 53 | 3300047443 | Ga0495687_113581 | Ga0495687_113581_11_790 | 257 |
| 54 | 3300048910 | Ga0496107_0215224 | Ga0496107_0215224_631_1404 | 257 |
| 55 | 3300048929 | Ga0496126_0025621 | Ga0496126_0025621_2289_3122 | 257 |
| 56 | 3300025294 | Ga0209025_1000320 | Ga0209025_100032099 | 258 |
| 57 | 3300031344 | Ga0265316_10037266 | Ga0265316_100372663 | 258 |
| 58 | 3300031852 | Ga0307410_10480022 | Ga0307410_104800222 | 258 |
| 59 | 3300031995 | Ga0307409_100013850 | Ga0307409_1000138502 | 258 |
| 60 | 3300032005 | Ga0307411_10049782 | Ga0307411_100497824 | 258 |
| 61 | 3300048925 | Ga0496122_0007050 | Ga0496122_0007050_2630_3463 | 258 |
| 62 | 3300048926 | Ga0496123_0000043 | Ga0496123_0000043_76994_77827 | 258 |
| 63 | 3300048927 | Ga0496124_0008106 | Ga0496124_0008106_9136_9990 | 258 |
| 64 | 3300048928 | Ga0496125_0001770 | Ga0496125_0001770_18212_19045 | 258 |
| 65 | 3300048929 | Ga0496126_0005296 | Ga0496126_0005296_10695_11549 | 258 |
| 66 | 3300049533 | Ga0501317_017280 | Ga0501317_017280_80_916 | 258 |
| 67 | 3300049537 | Ga0501321_009974 | Ga0501321_009974_64_900 | 258 |
| 68 | 3300049541 | Ga0501325_002693 | Ga0501325_002693_17_853 | 258 |
| 69 | 3300049568 | Ga0501031_0023684 | Ga0501031_0023684_2582_3412 | 258 |
| 70 | 3300049569 | Ga0501032_0227329 | Ga0501032_0227329_68_898 | 258 |
| 71 | 3300049573 | Ga0501037_0061852 | Ga0501037_0061852_816_1646 | 258 |
| 72 | 3300049574 | Ga0501038_0036530 | Ga0501038_0036530_1357_2187 | 258 |
| 73 | 3300049575 | Ga0501039_0082559 | Ga0501039_0082559_1434_2264 | 258 |
| 74 | 3300049586 | Ga0501070_0104200 | Ga0501070_0104200_869_1699 | 258 |
| 75 | 3300013100 | Ga0157373_10035992 | Ga0157373_100359922 | 259 |
| 76 | 3300013105 | Ga0157369_10037588 | Ga0157369_100375884 | 259 |
| 77 | 3300048917 | Ga0496114_0123135 | Ga0496114_0123135_31_819 | 259 |
| 78 | 3300042125 | Ga0450923_006239 | Ga0450923_006239_1165_1947 | 260 |
| 79 | 3300053104 | Ga0500556_0048019 | Ga0500556_0048019_20_802 | 260 |
| 80 | 3300053121 | Ga0500607_124219 | Ga0500607_124219_30_827 | 260 |
| 81 | 3300003792 | Ga0055540_1000748 | Ga0055540_100074829 | 261 |
| 82 | 3300009765 | Ga0123341_1000001 | Ga0123341_100000178 | 261 |
| 83 | 3300009766 | Ga0123342_1014579 | Ga0123342_10145795 | 261 |
| 84 | 3300025273 | Ga0209673_1001837 | Ga0209673_10018374 | 261 |
| 85 | 3300025298 | Ga0209050_1018005 | Ga0209050_10180054 | 261 |
| 86 | 3300025303 | Ga0209051_1001055 | Ga0209051_10010554 | 261 |
| 87 | 3300025304 | Ga0209257_1002064 | Ga0209257_100206425 | 261 |
| 88 | 3300031249 | Ga0265339_10017015 | Ga0265339_100170155 | 261 |
| 89 | 3300046690 | Ga0495624_0135007 | Ga0495624_0135007_536_1321 | 261 |
| 90 | 3300048922 | Ga0496119_0023830 | Ga0496119_0023830_1165_1989 | 261 |
| 91 | 3300037312 | Ga0395899_0132245 | Ga0395899_0132245_361_1179 | 262 |
| 92 | 3300037471 | Ga0395905_0084201 | Ga0395905_0084201_1991_2809 | 262 |
| 93 | 3300044658 | Ga0466972_0167256 | Ga0466972_0167256_28_846 | 262 |
| 94 | 3300044901 | Ga0466960_0092051 | Ga0466960_0092051_27_845 | 262 |
| 95 | 3300048919 | Ga0496116_0086799 | Ga0496116_0086799_1064_1888 | 263 |
| 96 | 3300048924 | Ga0496121_0000001 | Ga0496121_0000001_1248838_1249662 | 263 |
| 97 | 3300048925 | Ga0496122_0086527 | Ga0496122_0086527_46_870 | 263 |
| 98 | 3300048927 | Ga0496124_0106758 | Ga0496124_0106758_1033_1857 | 263 |
| 99 | 3300048928 | Ga0496125_0000001 | Ga0496125_0000001_1407918_1408742 | 263 |
| 100 | 3300048929 | Ga0496126_0027521 | Ga0496126_0027521_3651_4475 | 263 |
| 101 | iso_pu_bacteria | 2970149975 | 2970155244 | 263 |
| 102 | 3300017792 | Ga0163161_10243817 | Ga0163161_102438171 | 264 |
| 103 | iso_pu_bacteria | 2842775625 | 2842777693 | 264 |
| 104 | iso_pu_bacteria | 3003665799 | 3003670649 | 264 |
| 105 | iso_pu_bacteria | 2595698237 | 2596377478 | 265 |
| 106 | iso_pu_bacteria | 2773857925 | 2774869867 | 265 |
| 107 | iso_pu_bacteria | 2775506901 | 2776259081 | 265 |
| 108 | iso_pu_bacteria | 2835312727 | 2835315053 | 265 |
| 109 | iso_pu_bacteria | 2837678835 | 2837680925 | 265 |
| 110 | iso_pu_bacteria | 2838074704 | 2838079344 | 265 |
| 111 | iso_pu_bacteria | 2876377896 | 2876378520 | 265 |
| 112 | iso_pu_bacteria | 2882456835 | 2882461889 | 265 |
| 113 | iso_pu_bacteria | 2884298095 | 2884300505 | 265 |
| 114 | iso_pu_bacteria | 2889306138 | 2889308690 | 265 |
| 115 | iso_pu_bacteria | 2889790730 | 2889794659 | 265 |
| 116 | iso_pu_bacteria | 2889914905 | 2889917873 | 265 |
| 117 | iso_pu_bacteria | 2894232714 | 2894239879 | 265 |
| 118 | iso_pu_bacteria | 2902330777 | 2902331245 | 265 |
| 119 | iso_pu_bacteria | 2902405164 | 2902407308 | 265 |
| 120 | iso_pu_bacteria | 2928125067 | 2928127441 | 265 |
| 121 | iso_pu_bacteria | 2558860983 | 2561466266 | 266 |
| 122 | iso_pu_bacteria | 2643221550 | 2643770471 | 266 |
| 123 | iso_pu_bacteria | 2643221564 | 2643840577 | 266 |
| 124 | iso_pu_bacteria | 2757320392 | 2757569941 | 266 |
| 125 | iso_pu_bacteria | 2791355253 | 2793279488 | 266 |
| 126 | iso_pu_bacteria | 2894817345 | 2894819905 | 266 |
| 127 | iso_pu_bacteria | 8005658619 | 8005659327 | 266 |
| 128 | 3300013297 | Ga0157378_10330184 | Ga0157378_103301841 | 267 |
| 129 | iso_pu_bacteria | 2510461069 | 2510841049 | 267 |
| 130 | iso_pu_bacteria | 2510917026 | 2511170810 | 267 |
| 131 | iso_pu_bacteria | 2511231027 | 2511389413 | 267 |
| 132 | iso_pu_bacteria | 2545555834 | 2545677849 | 267 |
| 133 | iso_pu_bacteria | 2585427633 | 2585995615 | 267 |
| 134 | iso_pu_bacteria | 2585427634 | 2586000188 | 267 |
| 135 | iso_pu_bacteria | 2643221558 | 2643811800 | 267 |
| 136 | iso_pu_bacteria | 2643221653 | 2644300326 | 267 |
| 137 | iso_pu_bacteria | 2643221719 | 2644658550 | 267 |
| 138 | iso_pu_bacteria | 2738541281 | 2738747374 | 267 |
| 139 | iso_pu_bacteria | 2738541317 | 2738945406 | 267 |
| 140 | iso_pu_bacteria | 2738543032 | 2739356603 | 267 |
| 141 | iso_pu_bacteria | 2765235802 | 2765466050 | 267 |
| 142 | iso_pu_bacteria | 2767802442 | 2770197662 | 267 |
| 143 | iso_pu_bacteria | 2775506902 | 2776271688 | 267 |
| 144 | iso_pu_bacteria | 2775506904 | 2776279799 | 267 |
| 145 | iso_pu_bacteria | 2775507049 | 2776913245 | 267 |
| 146 | iso_pu_bacteria | 2818991272 | 2819242056 | 267 |
| 147 | iso_pu_bacteria | 2839993093 | 2839995232 | 267 |
| 148 | iso_pu_bacteria | 2840764183 | 2840769991 | 267 |
| 149 | iso_pu_bacteria | 2842871566 | 2842872775 | 267 |
| 150 | iso_pu_bacteria | 2891048133 | 2891051928 | 267 |
| 151 | iso_pu_bacteria | 2894652903 | 2894654600 | 267 |
| 152 | iso_pu_bacteria | 2904578770 | 2904583322 | 267 |
| 153 | iso_pu_bacteria | 2913308742 | 2913310112 | 267 |
| 154 | iso_pu_bacteria | 2919119836 | 2919121058 | 267 |
| 155 | iso_pu_bacteria | 2919171160 | 2919175379 | 267 |
| 156 | iso_pu_bacteria | 2928521798 | 2928523215 | 267 |
| 157 | iso_pu_bacteria | 2939669807 | 2939671454 | 267 |
| 158 | iso_pu_bacteria | 2954011201 | 2954015485 | 267 |
| 159 | iso_pu_bacteria | 2958172287 | 2958172409 | 267 |
| 160 | iso_pu_bacteria | 2989776772 | 2989778668 | 267 |
| 161 | iso_pu_bacteria | 2995392953 | 2995395014 | 267 |
| 162 | iso_pu_bacteria | 3002141150 | 3002144044 | 267 |
| 163 | iso_pu_bacteria | 641522639 | 641642625 | 267 |
| 164 | iso_pu_bacteria | 643348564 | 643600519 | 267 |
| 165 | iso_pu_bacteria | 8005246636 | 8005250759 | 267 |
| 166 | iso_pu_bacteria | 8024486573 | 8024492517 | 267 |
| 167 | iso_pu_bacteria | 8045864390 | 8045865560 | 267 |
| 168 | 3300005981 | Ga0081538_10002177 | Ga0081538_100021776 | 268 |
| 169 | 3300005983 | Ga0081540_1006167 | Ga0081540_10061676 | 268 |
| 170 | 3300006844 | Ga0075428_100143208 | Ga0075428_1001432084 | 268 |
| 171 | 3300044901 | Ga0466960_0183827 | Ga0466960_0183827_117_947 | 268 |
| 172 | 3300046530 | Ga0495654_0002779 | Ga0495654_0002779_8330_9142 | 268 |
| 173 | 3300046692 | Ga0495671_0161207 | Ga0495671_0161207_135_959 | 268 |
| 174 | 3300049571 | Ga0501034_0062839 | Ga0501034_0062839_1548_2429 | 268 |
| 175 | 3300053125 | Ga0500618_000361 | Ga0500618_000361_28678_29490 | 268 |
| 176 | iso_pu_bacteria | 2508501122 | 2509107842 | 268 |
| 177 | iso_pu_bacteria | 2508501127 | 2509144679 | 268 |
| 178 | iso_pu_bacteria | 2509276019 | 2509376239 | 268 |
| 179 | iso_pu_bacteria | 2509276021 | 2509387102 | 268 |
| 180 | iso_pu_bacteria | 2509276033 | 2509442593 | 268 |
| 181 | iso_pu_bacteria | 2510065019 | 2510132858 | 268 |
| 182 | iso_pu_bacteria | 2510065057 | 2510307525 | 268 |
| 183 | iso_pu_bacteria | 2510461076 | 2510894232 | 268 |
| 184 | iso_pu_bacteria | 2510461076 | 2510899257 | 268 |
| 185 | iso_pu_bacteria | 2510917028 | 2511182723 | 268 |
| 186 | iso_pu_bacteria | 2510917030 | 2511200572 | 268 |
| 187 | iso_pu_bacteria | 2511231052 | 2511501396 | 268 |
| 188 | iso_pu_bacteria | 2512047086 | 2512532810 | 268 |
| 189 | iso_pu_bacteria | 2512875026 | 2512971859 | 268 |
| 190 | iso_pu_bacteria | 2513237084 | 2513570053 | 268 |
| 191 | iso_pu_bacteria | 2513237085 | 2513575303 | 268 |
| 192 | iso_pu_bacteria | 2513237086 | 2513583151 | 268 |
| 193 | iso_pu_bacteria | 2513237087 | 2513593893 | 268 |
| 194 | iso_pu_bacteria | 2513237088 | 2513599274 | 268 |
| 195 | iso_pu_bacteria | 2513237089 | 2513607515 | 268 |
| 196 | iso_pu_bacteria | 2513237090 | 2513610077 | 268 |
| 197 | iso_pu_bacteria | 2513237091 | 2513617774 | 268 |
| 198 | iso_pu_bacteria | 2513237093 | 2513633008 | 268 |
| 199 | iso_pu_bacteria | 2513237103 | 2513710271 | 268 |
| 200 | iso_pu_bacteria | 2513237138 | 2513870578 | 268 |
| 201 | iso_pu_bacteria | 2513237140 | 2513886274 | 268 |
| 202 | iso_pu_bacteria | 2513237143 | 2513906329 | 268 |
| 203 | iso_pu_bacteria | 2513237144 | 2513909745 | 268 |
| 204 | iso_pu_bacteria | 2513237146 | 2513926515 | 268 |
| 205 | iso_pu_bacteria | 2513237156 | 2513988399 | 268 |
| 206 | iso_pu_bacteria | 2513237159 | 2514000307 | 268 |
| 207 | iso_pu_bacteria | 2513237160 | 2514005410 | 268 |
| 208 | iso_pu_bacteria | 2513237162 | 2514019855 | 268 |
| 209 | iso_pu_bacteria | 2515075009 | 2515111810 | 268 |
| 210 | iso_pu_bacteria | 2515154107 | 2515611467 | 268 |
| 211 | iso_pu_bacteria | 2515154113 | 2515639411 | 268 |
| 212 | iso_pu_bacteria | 2515154114 | 2515642142 | 268 |
| 213 | iso_pu_bacteria | 2515154116 | 2515656195 | 268 |
| 214 | iso_pu_bacteria | 2515154134 | 2515739001 | 268 |
| 215 | iso_pu_bacteria | 2516143018 | 2516209265 | 268 |
| 216 | iso_pu_bacteria | 2516653046 | 2516892675 | 268 |
| 217 | iso_pu_bacteria | 2516653077 | 2517035534 | 268 |
| 218 | iso_pu_bacteria | 2516653085 | 2517075994 | 268 |
| 219 | iso_pu_bacteria | 2517093000 | 2517094733 | 268 |
| 220 | iso_pu_bacteria | 2517287029 | 2517406358 | 268 |
| 221 | iso_pu_bacteria | 2517487022 | 2517569483 | 268 |
| 222 | iso_pu_bacteria | 2519899620 | 2520379485 | 268 |
| 223 | iso_pu_bacteria | 2524023207 | 2524452896 | 268 |
| 224 | iso_pu_bacteria | 2529292951 | 2530645117 | 268 |
| 225 | iso_pu_bacteria | 2534681786 | 2535484975 | 268 |
| 226 | iso_pu_bacteria | 2534681796 | 2535516134 | 268 |
| 227 | iso_pu_bacteria | 2537561587 | 2537877635 | 268 |
| 228 | iso_pu_bacteria | 2551306084 | 2551674144 | 268 |
| 229 | iso_pu_bacteria | 2551306084 | 2551676295 | 268 |
| 230 | iso_pu_bacteria | 2551306085 | 2551689591 | 268 |
| 231 | iso_pu_bacteria | 2551306086 | 2551695726 | 268 |
| 232 | iso_pu_bacteria | 2551306087 | 2551698579 | 268 |
| 233 | iso_pu_bacteria | 2551306089 | 2551710488 | 268 |
| 234 | iso_pu_bacteria | 2551306090 | 2551718688 | 268 |
| 235 | iso_pu_bacteria | 2551306092 | 2551737771 | 268 |
| 236 | iso_pu_bacteria | 2551306093 | 2551739998 | 268 |
| 237 | iso_pu_bacteria | 2554235003 | 2554247654 | 268 |
| 238 | iso_pu_bacteria | 2558860100 | 2558863107 | 268 |
| 239 | iso_pu_bacteria | 2558860242 | 2559294787 | 268 |
| 240 | iso_pu_bacteria | 2582581283 | 2585168323 | 268 |
| 241 | iso_pu_bacteria | 2582581294 | 2585199852 | 268 |
| 242 | iso_pu_bacteria | 2582581298 | 2585225925 | 268 |
| 243 | iso_pu_bacteria | 2582581299 | 2585230072 | 268 |
| 244 | iso_pu_bacteria | 2582581304 | 2585254336 | 268 |
| 245 | iso_pu_bacteria | 2582581306 | 2585268950 | 268 |
| 246 | iso_pu_bacteria | 2582581865 | 2585389475 | 268 |
| 247 | iso_pu_bacteria | 2582581866 | 2585393911 | 268 |
| 248 | iso_pu_bacteria | 2582581867 | 2585400689 | 268 |
| 249 | iso_pu_bacteria | 2585427526 | 2585528136 | 268 |
| 250 | iso_pu_bacteria | 2585427528 | 2585540344 | 268 |
| 251 | iso_pu_bacteria | 2585427529 | 2585546885 | 268 |
| 252 | iso_pu_bacteria | 2585427590 | 2585819751 | 268 |
| 253 | iso_pu_bacteria | 2585427593 | 2585838543 | 268 |
| 254 | iso_pu_bacteria | 2597489875 | 2597814632 | 268 |
| 255 | iso_pu_bacteria | 2599185170 | 2599418054 | 268 |
| 256 | iso_pu_bacteria | 2599185210 | 2599604051 | 268 |
| 257 | iso_pu_bacteria | 2599185236 | 2599721994 | 268 |
| 258 | iso_pu_bacteria | 2599185352 | 2600192352 | 268 |
| 259 | iso_pu_bacteria | 2600254933 | 2600375622 | 268 |
| 260 | iso_pu_bacteria | 2600255279 | 2601608216 | 268 |
| 261 | iso_pu_bacteria | 2600255308 | 2601744990 | 268 |
| 262 | iso_pu_bacteria | 2615840624 | 2616292838 | 268 |
| 263 | iso_pu_bacteria | 2643221551 | 2643775086 | 268 |
| 264 | iso_pu_bacteria | 2643221555 | 2643793531 | 268 |
| 265 | iso_pu_bacteria | 2643221557 | 2643808434 | 268 |
| 266 | iso_pu_bacteria | 2643221568 | 2643855680 | 268 |
| 267 | iso_pu_bacteria | 2643221582 | 2643919275 | 268 |
| 268 | iso_pu_bacteria | 2643221599 | 2644005908 | 268 |
| 269 | iso_pu_bacteria | 2643221607 | 2644049539 | 268 |
| 270 | iso_pu_bacteria | 2643221610 | 2644066473 | 268 |
| 271 | iso_pu_bacteria | 2643221618 | 2644109505 | 268 |
| 272 | iso_pu_bacteria | 2643221626 | 2644145189 | 268 |
| 273 | iso_pu_bacteria | 2643221634 | 2644193133 | 268 |
| 274 | iso_pu_bacteria | 2643221636 | 2644204053 | 268 |
| 275 | iso_pu_bacteria | 2643221637 | 2644210958 | 268 |
| 276 | iso_pu_bacteria | 2643221643 | 2644239225 | 268 |
| 277 | iso_pu_bacteria | 2643221655 | 2644307770 | 268 |
| 278 | iso_pu_bacteria | 2643221659 | 2644332545 | 268 |
| 279 | iso_pu_bacteria | 2643221668 | 2644378061 | 268 |
| 280 | iso_pu_bacteria | 2643221675 | 2644415314 | 268 |
| 281 | iso_pu_bacteria | 2643221680 | 2644450285 | 268 |
| 282 | iso_pu_bacteria | 2643221686 | 2644482573 | 268 |
| 283 | iso_pu_bacteria | 2643221688 | 2644494697 | 268 |
| 284 | iso_pu_bacteria | 2643221689 | 2644499075 | 268 |
| 285 | iso_pu_bacteria | 2643221693 | 2644522180 | 268 |
| 286 | iso_pu_bacteria | 2643221698 | 2644544292 | 268 |
| 287 | iso_pu_bacteria | 2643221712 | 2644613859 | 268 |
| 288 | iso_pu_bacteria | 2643221718 | 2644654613 | 268 |
| 289 | iso_pu_bacteria | 2643221723 | 2644677928 | 268 |
| 290 | iso_pu_bacteria | 2643221726 | 2644687837 | 268 |
| 291 | iso_pu_bacteria | 2643221733 | 2644731991 | 268 |
| 292 | iso_pu_bacteria | 2643221734 | 2644735259 | 268 |
| 293 | iso_pu_bacteria | 2643221736 | 2644745552 | 268 |
| 294 | iso_pu_bacteria | 2657244999 | 2657683686 | 268 |
| 295 | iso_pu_bacteria | 2690316117 | 2692316411 | 268 |
| 296 | iso_pu_bacteria | 2693429783 | 2694630544 | 268 |
| 297 | iso_pu_bacteria | 2693429784 | 2694638953 | 268 |
| 298 | iso_pu_bacteria | 2718217882 | 2719180752 | 268 |
| 299 | iso_pu_bacteria | 2718217927 | 2719385388 | 268 |
| 300 | iso_pu_bacteria | 2718217997 | 2719665217 | 268 |
| 301 | iso_pu_bacteria | 2718218009 | 2719731501 | 268 |
| 302 | iso_pu_bacteria | 2718218199 | 2720491637 | 268 |
| 303 | iso_pu_bacteria | 2718218232 | 2720612890 | 268 |
| 304 | iso_pu_bacteria | 2718218233 | 2720619751 | 268 |
| 305 | iso_pu_bacteria | 2718218235 | 2720631182 | 268 |
| 306 | iso_pu_bacteria | 2718218269 | 2720774909 | 268 |
| 307 | iso_pu_bacteria | 2718218363 | 2721146846 | 268 |
| 308 | iso_pu_bacteria | 2718218365 | 2721158373 | 268 |
| 309 | iso_pu_bacteria | 2718218366 | 2721163725 | 268 |
| 310 | iso_pu_bacteria | 2718218423 | 2721399137 | 268 |
| 311 | iso_pu_bacteria | 2721755514 | 2722839895 | 268 |
| 312 | iso_pu_bacteria | 2721755556 | 2723026546 | 268 |
| 313 | iso_pu_bacteria | 2721755684 | 2723560150 | 268 |
| 314 | iso_pu_bacteria | 2721755685 | 2723566708 | 268 |
| 315 | iso_pu_bacteria | 2721755809 | 2724037950 | 268 |
| 316 | iso_pu_bacteria | 2721755810 | 2724044257 | 268 |
| 317 | iso_pu_bacteria | 2721755819 | 2724089516 | 268 |
| 318 | iso_pu_bacteria | 2721755822 | 2724103973 | 268 |
| 319 | iso_pu_bacteria | 2721755823 | 2724109810 | 268 |
| 320 | iso_pu_bacteria | 2724679232 | 2725950417 | 268 |
| 321 | iso_pu_bacteria | 2728369352 | 2730107482 | 268 |
| 322 | iso_pu_bacteria | 2728369365 | 2730163989 | 268 |
| 323 | iso_pu_bacteria | 2728369397 | 2730298005 | 268 |
| 324 | iso_pu_bacteria | 2738541333 | 2739038269 | 268 |
| 325 | iso_pu_bacteria | 2738543024 | 2739309281 | 268 |
| 326 | iso_pu_bacteria | 2765235942 | 2766067941 | 268 |
| 327 | iso_pu_bacteria | 2791355082 | 2792581178 | 268 |
| 328 | iso_pu_bacteria | 2791355091 | 2792623185 | 268 |
| 329 | iso_pu_bacteria | 2791355092 | 2792626949 | 268 |
| 330 | iso_pu_bacteria | 2791355094 | 2792642622 | 268 |
| 331 | iso_pu_bacteria | 2791355256 | 2793297129 | 268 |
| 332 | iso_pu_bacteria | 2791355259 | 2793313891 | 268 |
| 333 | iso_pu_bacteria | 2791355260 | 2793321266 | 268 |
| 334 | iso_pu_bacteria | 2791355261 | 2793331193 | 268 |
| 335 | iso_pu_bacteria | 2791355262 | 2793337321 | 268 |
| 336 | iso_pu_bacteria | 2791355263 | 2793343078 | 268 |
| 337 | iso_pu_bacteria | 2791355264 | 2793347786 | 268 |
| 338 | iso_pu_bacteria | 2791355265 | 2793352231 | 268 |
| 339 | iso_pu_bacteria | 2791355266 | 2793360408 | 268 |
| 340 | iso_pu_bacteria | 2791355267 | 2793366388 | 268 |
| 341 | iso_pu_bacteria | 2802428858 | 2802718855 | 268 |
| 342 | iso_pu_bacteria | 2802428859 | 2802726466 | 268 |
| 343 | iso_pu_bacteria | 2802428860 | 2802733009 | 268 |
| 344 | iso_pu_bacteria | 2802428861 | 2802738364 | 268 |
| 345 | iso_pu_bacteria | 2802428862 | 2802744696 | 268 |
| 346 | iso_pu_bacteria | 2802428863 | 2802751098 | 268 |
| 347 | iso_pu_bacteria | 2802429268 | 2804751877 | 268 |
| 348 | iso_pu_bacteria | 2802429605 | 2805927560 | 268 |
| 349 | iso_pu_bacteria | 2802429606 | 2805936034 | 268 |
| 350 | iso_pu_bacteria | 2802429633 | 2806045556 | 268 |
| 351 | iso_pu_bacteria | 2802429634 | 2806051640 | 268 |
| 352 | iso_pu_bacteria | 2802429635 | 2806061684 | 268 |
| 353 | iso_pu_bacteria | 2802429636 | 2806067865 | 268 |
| 354 | iso_pu_bacteria | 2802429637 | 2806072782 | 268 |
| 355 | iso_pu_bacteria | 2808606387 | 2808985444 | 268 |
| 356 | iso_pu_bacteria | 2818991439 | 2819559879 | 268 |
| 357 | iso_pu_bacteria | 2818991461 | 2819687455 | 268 |
| 358 | iso_pu_bacteria | 2818991467 | 2819720806 | 268 |
| 359 | iso_pu_bacteria | 2821123053 | 2821127667 | 268 |
| 360 | iso_pu_bacteria | 2838016132 | 2838018745 | 268 |
| 361 | iso_pu_bacteria | 2838022645 | 2838025546 | 268 |
| 362 | iso_pu_bacteria | 2838035591 | 2838040992 | 268 |
| 363 | iso_pu_bacteria | 2838042994 | 2838043052 | 268 |
| 364 | iso_pu_bacteria | 2838048938 | 2838052183 | 268 |
| 365 | iso_pu_bacteria | 2838061910 | 2838067900 | 268 |
| 366 | iso_pu_bacteria | 2838068647 | 2838071312 | 268 |
| 367 | iso_pu_bacteria | 2838661181 | 2838666163 | 268 |
| 368 | iso_pu_bacteria | 2838668709 | 2838670001 | 268 |
| 369 | iso_pu_bacteria | 2838675328 | 2838676292 | 268 |
| 370 | iso_pu_bacteria | 2838680041 | 2838682637 | 268 |
| 371 | iso_pu_bacteria | 2838686498 | 2838689066 | 268 |
| 372 | iso_pu_bacteria | 2838694306 | 2838697216 | 268 |
| 373 | iso_pu_bacteria | 2838701080 | 2838702373 | 268 |
| 374 | iso_pu_bacteria | 2838707686 | 2838709551 | 268 |
| 375 | iso_pu_bacteria | 2838714209 | 2838715175 | 268 |
| 376 | iso_pu_bacteria | 2838719591 | 2838721025 | 268 |
| 377 | iso_pu_bacteria | 2838724970 | 2838725933 | 268 |
| 378 | iso_pu_bacteria | 2838729681 | 2838730401 | 268 |
| 379 | iso_pu_bacteria | 2838736955 | 2838738090 | 268 |
| 380 | iso_pu_bacteria | 2838742623 | 2838743342 | 268 |
| 381 | iso_pu_bacteria | 2841734538 | 2841740558 | 268 |
| 382 | iso_pu_bacteria | 2841760612 | 2841761349 | 268 |
| 383 | iso_pu_bacteria | 2841840854 | 2841841541 | 268 |
| 384 | iso_pu_bacteria | 2841846520 | 2841847984 | 268 |
| 385 | iso_pu_bacteria | 2841851746 | 2841854971 | 268 |
| 386 | iso_pu_bacteria | 2841859092 | 2841859465 | 268 |
| 387 | iso_pu_bacteria | 2841864319 | 2841864973 | 268 |
| 388 | iso_pu_bacteria | 2841911363 | 2841913305 | 268 |
| 389 | iso_pu_bacteria | 2841917233 | 2841919052 | 268 |
| 390 | iso_pu_bacteria | 2842077413 | 2842077717 | 268 |
| 391 | iso_pu_bacteria | 2842110456 | 2842110950 | 268 |
| 392 | iso_pu_bacteria | 2842118031 | 2842119774 | 268 |
| 393 | iso_pu_bacteria | 2842124991 | 2842125986 | 268 |
| 394 | iso_pu_bacteria | 2842130223 | 2842131186 | 268 |
| 395 | iso_pu_bacteria | 2842140634 | 2842141319 | 268 |
| 396 | iso_pu_bacteria | 2842146304 | 2842147082 | 268 |
| 397 | iso_pu_bacteria | 2842152218 | 2842153644 | 268 |
| 398 | iso_pu_bacteria | 2842156927 | 2842157833 | 268 |
| 399 | iso_pu_bacteria | 2842163707 | 2842165048 | 268 |
| 400 | iso_pu_bacteria | 2842170452 | 2842171418 | 268 |
| 401 | iso_pu_bacteria | 2842175837 | 2842177264 | 268 |
| 402 | iso_pu_bacteria | 2842180545 | 2842180583 | 268 |
| 403 | iso_pu_bacteria | 2842187318 | 2842188283 | 268 |
| 404 | iso_pu_bacteria | 2842192696 | 2842197079 | 268 |
| 405 | iso_pu_bacteria | 2842198810 | 2842201115 | 268 |
| 406 | iso_pu_bacteria | 2842205361 | 2842206479 | 268 |
| 407 | iso_pu_bacteria | 2842211629 | 2842212594 | 268 |
| 408 | iso_pu_bacteria | 2842217011 | 2842220559 | 268 |
| 409 | iso_pu_bacteria | 2842224351 | 2842225787 | 268 |
| 410 | iso_pu_bacteria | 2842229732 | 2842236268 | 268 |
| 411 | iso_pu_bacteria | 2842237096 | 2842238964 | 268 |
| 412 | iso_pu_bacteria | 2842243621 | 2842244520 | 268 |
| 413 | iso_pu_bacteria | 2842250916 | 2842252147 | 268 |
| 414 | iso_pu_bacteria | 2842257432 | 2842258333 | 268 |
| 415 | iso_pu_bacteria | 2842264693 | 2842267582 | 268 |
| 416 | iso_pu_bacteria | 2842271015 | 2842273086 | 268 |
| 417 | iso_pu_bacteria | 2842278818 | 2842279936 | 268 |
| 418 | iso_pu_bacteria | 2842285085 | 2842287565 | 268 |
| 419 | iso_pu_bacteria | 2842291075 | 2842291379 | 268 |
| 420 | iso_pu_bacteria | 2842304105 | 2842309433 | 268 |
| 421 | iso_pu_bacteria | 2842311132 | 2842315369 | 268 |
| 422 | iso_pu_bacteria | 2842317721 | 2842318328 | 268 |
| 423 | iso_pu_bacteria | 2842341865 | 2842346965 | 268 |
| 424 | iso_pu_bacteria | 2842363717 | 2842366798 | 268 |
| 425 | iso_pu_bacteria | 2842370503 | 2842373212 | 268 |
| 426 | iso_pu_bacteria | 2842377471 | 2842377775 | 268 |
| 427 | iso_pu_bacteria | 2842384541 | 2842386284 | 268 |
| 428 | iso_pu_bacteria | 2842395702 | 2842399549 | 268 |
| 429 | iso_pu_bacteria | 2842402390 | 2842404906 | 268 |
| 430 | iso_pu_bacteria | 2842409023 | 2842411488 | 268 |
| 431 | iso_pu_bacteria | 2842415677 | 2842418061 | 268 |
| 432 | iso_pu_bacteria | 2842422224 | 2842425031 | 268 |
| 433 | iso_pu_bacteria | 2842428310 | 2842431840 | 268 |
| 434 | iso_pu_bacteria | 2842434925 | 2842437953 | 268 |
| 435 | iso_pu_bacteria | 2842441272 | 2842444767 | 268 |
| 436 | iso_pu_bacteria | 2842447887 | 2842451683 | 268 |
| 437 | iso_pu_bacteria | 2842462802 | 2842465856 | 268 |
| 438 | iso_pu_bacteria | 2842469257 | 2842472570 | 268 |
| 439 | iso_pu_bacteria | 2842489311 | 2842492691 | 268 |
| 440 | iso_pu_bacteria | 2842495871 | 2842500698 | 268 |
| 441 | iso_pu_bacteria | 2842515876 | 2842516249 | 268 |
| 442 | iso_pu_bacteria | 2842521101 | 2842525976 | 268 |
| 443 | iso_pu_bacteria | 2844104063 | 2844104374 | 268 |
| 444 | iso_pu_bacteria | 2844163670 | 2844170381 | 268 |
| 445 | iso_pu_bacteria | 2844454524 | 2844459580 | 268 |
| 446 | iso_pu_bacteria | 2847417321 | 2847418520 | 268 |
| 447 | iso_pu_bacteria | 2847670302 | 2847676158 | 268 |
| 448 | iso_pu_bacteria | 2847686936 | 2847692798 | 268 |
| 449 | iso_pu_bacteria | 2848992105 | 2848993498 | 268 |
| 450 | iso_pu_bacteria | 2850079185 | 2850080821 | 268 |
| 451 | iso_pu_bacteria | 2851182111 | 2851184422 | 268 |
| 452 | iso_pu_bacteria | 2851246043 | 2851247362 | 268 |
| 453 | iso_pu_bacteria | 2854896431 | 2854902015 | 268 |
| 454 | iso_pu_bacteria | 2854911287 | 2854912198 | 268 |
| 455 | iso_pu_bacteria | 2854916844 | 2854916923 | 268 |
| 456 | iso_pu_bacteria | 2855825444 | 2855825486 | 268 |
| 457 | iso_pu_bacteria | 2855839649 | 2855840864 | 268 |
| 458 | iso_pu_bacteria | 2855872281 | 2855873317 | 268 |
| 459 | iso_pu_bacteria | 2856314179 | 2856315944 | 268 |
| 460 | iso_pu_bacteria | 2856342000 | 2856347680 | 268 |
| 461 | iso_pu_bacteria | 2857349434 | 2857350450 | 268 |
| 462 | iso_pu_bacteria | 2857516855 | 2857522932 | 268 |
| 463 | iso_pu_bacteria | 2857531043 | 2857534671 | 268 |
| 464 | iso_pu_bacteria | 2858800743 | 2858801407 | 268 |
| 465 | iso_pu_bacteria | 2871444079 | 2871446038 | 268 |
| 466 | iso_pu_bacteria | 2871474448 | 2871478173 | 268 |
| 467 | iso_pu_bacteria | 2871495908 | 2871503153 | 268 |
| 468 | iso_pu_bacteria | 2874102143 | 2874107397 | 268 |
| 469 | iso_pu_bacteria | 2874123672 | 2874127958 | 268 |
| 470 | iso_pu_bacteria | 2876369609 | 2876376087 | 268 |
| 471 | iso_pu_bacteria | 2876392853 | 2876394814 | 268 |
| 472 | iso_pu_bacteria | 2878035449 | 2878040212 | 268 |
| 473 | iso_pu_bacteria | 2878760144 | 2878767042 | 268 |
| 474 | iso_pu_bacteria | 2878767105 | 2878774240 | 268 |
| 475 | iso_pu_bacteria | 2878788777 | 2878796938 | 268 |
| 476 | iso_pu_bacteria | 2881147464 | 2881152159 | 268 |
| 477 | iso_pu_bacteria | 2881161766 | 2881168141 | 268 |
| 478 | iso_pu_bacteria | 2885312484 | 2885316921 | 268 |
| 479 | iso_pu_bacteria | 2888343758 | 2888348020 | 268 |
| 480 | iso_pu_bacteria | 2888350351 | 2888356380 | 268 |
| 481 | iso_pu_bacteria | 2889010040 | 2889011295 | 268 |
| 482 | iso_pu_bacteria | 2889016732 | 2889016977 | 268 |
| 483 | iso_pu_bacteria | 2891373044 | 2891377410 | 268 |
| 484 | iso_pu_bacteria | 2896384573 | 2896387011 | 268 |
| 485 | iso_pu_bacteria | 2899792073 | 2899796262 | 268 |
| 486 | iso_pu_bacteria | 2899845264 | 2899847381 | 268 |
| 487 | iso_pu_bacteria | 2903540706 | 2903548342 | 268 |
| 488 | iso_pu_bacteria | 2904659560 | 2904661445 | 268 |
| 489 | iso_pu_bacteria | 2906328253 | 2906328956 | 268 |
| 490 | iso_pu_bacteria | 2906354277 | 2906361851 | 268 |
| 491 | iso_pu_bacteria | 2906414383 | 2906416081 | 268 |
| 492 | iso_pu_bacteria | 2909042592 | 2909043785 | 268 |
| 493 | iso_pu_bacteria | 2913295892 | 2913300465 | 268 |
| 494 | iso_pu_bacteria | 2915980308 | 2915985224 | 268 |
| 495 | iso_pu_bacteria | 2915986958 | 2915987468 | 268 |
| 496 | iso_pu_bacteria | 2915993759 | 2915999377 | 268 |
| 497 | iso_pu_bacteria | 2916000859 | 2916003939 | 268 |
| 498 | iso_pu_bacteria | 2916007675 | 2916012934 | 268 |
| 499 | iso_pu_bacteria | 2916014648 | 2916015171 | 268 |
| 500 | iso_pu_bacteria | 2916021584 | 2916027883 | 268 |
| 501 | iso_pu_bacteria | 2916028427 | 2916033479 | 268 |
| 502 | iso_pu_bacteria | 2916035215 | 2916041786 | 268 |
| 503 | iso_pu_bacteria | 2916041962 | 2916046818 | 268 |
| 504 | iso_pu_bacteria | 2916048683 | 2916053965 | 268 |
| 505 | iso_pu_bacteria | 2916055098 | 2916060170 | 268 |
| 506 | iso_pu_bacteria | 2916061851 | 2916068093 | 268 |
| 507 | iso_pu_bacteria | 2916068649 | 2916075100 | 268 |
| 508 | iso_pu_bacteria | 2916076590 | 2916078654 | 268 |
| 509 | iso_pu_bacteria | 2917699015 | 2917699135 | 268 |
| 510 | iso_pu_bacteria | 2919100787 | 2919107745 | 268 |
| 511 | iso_pu_bacteria | 2919114240 | 2919115266 | 268 |
| 512 | iso_pu_bacteria | 2919166419 | 2919167556 | 268 |
| 513 | iso_pu_bacteria | 2920760137 | 2920765596 | 268 |
| 514 | iso_pu_bacteria | 2920822456 | 2920824239 | 268 |
| 515 | iso_pu_bacteria | 2921201388 | 2921207723 | 268 |
| 516 | iso_pu_bacteria | 2921208531 | 2921209188 | 268 |
| 517 | iso_pu_bacteria | 2921237296 | 2921243351 | 268 |
| 518 | iso_pu_bacteria | 2921244191 | 2921246802 | 268 |
| 519 | iso_pu_bacteria | 2921250672 | 2921253019 | 268 |
| 520 | iso_pu_bacteria | 2921257292 | 2921260491 | 268 |
| 521 | iso_pu_bacteria | 2921263974 | 2921269076 | 268 |
| 522 | iso_pu_bacteria | 2921282425 | 2921283102 | 268 |
| 523 | iso_pu_bacteria | 2921289301 | 2921294487 | 268 |
| 524 | iso_pu_bacteria | 2921296804 | 2921297220 | 268 |
| 525 | iso_pu_bacteria | 2922130491 | 2922137199 | 268 |
| 526 | iso_pu_bacteria | 2922158528 | 2922158932 | 268 |
| 527 | iso_pu_bacteria | 2922185730 | 2922192201 | 268 |
| 528 | iso_pu_bacteria | 2923556063 | 2923558191 | 268 |
| 529 | iso_pu_bacteria | 2924144063 | 2924146439 | 268 |
| 530 | iso_pu_bacteria | 2924150972 | 2924156092 | 268 |
| 531 | iso_pu_bacteria | 2924158325 | 2924158942 | 268 |
| 532 | iso_pu_bacteria | 2924165586 | 2924170268 | 268 |
| 533 | iso_pu_bacteria | 2924172951 | 2924178273 | 268 |
| 534 | iso_pu_bacteria | 2924179722 | 2924183039 | 268 |
| 535 | iso_pu_bacteria | 2924186466 | 2924189384 | 268 |
| 536 | iso_pu_bacteria | 2924193448 | 2924198626 | 268 |
| 537 | iso_pu_bacteria | 2924200457 | 2924202732 | 268 |
| 538 | iso_pu_bacteria | 2924207177 | 2924213917 | 268 |
| 539 | iso_pu_bacteria | 2924221636 | 2924227875 | 268 |
| 540 | iso_pu_bacteria | 2924228884 | 2924234720 | 268 |
| 541 | iso_pu_bacteria | 2924726620 | 2924731581 | 268 |
| 542 | iso_pu_bacteria | 2924754689 | 2924762525 | 268 |
| 543 | iso_pu_bacteria | 2926754445 | 2926756313 | 268 |
| 544 | iso_pu_bacteria | 2926760298 | 2926760535 | 268 |
| 545 | iso_pu_bacteria | 2929138655 | 2929139867 | 268 |
| 546 | iso_pu_bacteria | 2933006813 | 2933008287 | 268 |
| 547 | iso_pu_bacteria | 2933011516 | 2933013108 | 268 |
| 548 | iso_pu_bacteria | 2933570622 | 2933575793 | 268 |
| 549 | iso_pu_bacteria | 2933586486 | 2933586975 | 268 |
| 550 | iso_pu_bacteria | 2933594066 | 2933597798 | 268 |
| 551 | iso_pu_bacteria | 2933599457 | 2933602111 | 268 |
| 552 | iso_pu_bacteria | 2935894831 | 2935898927 | 268 |
| 553 | iso_pu_bacteria | 2935901341 | 2935904883 | 268 |
| 554 | iso_pu_bacteria | 2936367885 | 2936373183 | 268 |
| 555 | iso_pu_bacteria | 2936375103 | 2936381328 | 268 |
| 556 | iso_pu_bacteria | 2936381700 | 2936384597 | 268 |
| 557 | iso_pu_bacteria | 2936996657 | 2936997751 | 268 |
| 558 | iso_pu_bacteria | 2937002841 | 2937004685 | 268 |
| 559 | iso_pu_bacteria | 2937009748 | 2937012538 | 268 |
| 560 | iso_pu_bacteria | 2937016420 | 2937016990 | 268 |
| 561 | iso_pu_bacteria | 2937023124 | 2937029232 | 268 |
| 562 | iso_pu_bacteria | 2937029754 | 2937031199 | 268 |
| 563 | iso_pu_bacteria | 2937036028 | 2937040855 | 268 |
| 564 | iso_pu_bacteria | 2937042894 | 2937049592 | 268 |
| 565 | iso_pu_bacteria | 2937049772 | 2937052214 | 268 |
| 566 | iso_pu_bacteria | 2937056579 | 2937059620 | 268 |
| 567 | iso_pu_bacteria | 2937063883 | 2937065009 | 268 |
| 568 | iso_pu_bacteria | 2937071275 | 2937075678 | 268 |
| 569 | iso_pu_bacteria | 2937078374 | 2937079993 | 268 |
| 570 | iso_pu_bacteria | 2937084907 | 2937085521 | 268 |
| 571 | iso_pu_bacteria | 2937091812 | 2937097618 | 268 |
| 572 | iso_pu_bacteria | 2937098957 | 2937106014 | 268 |
| 573 | iso_pu_bacteria | 2937106411 | 2937112901 | 268 |
| 574 | iso_pu_bacteria | 2937113482 | 2937117835 | 268 |
| 575 | iso_pu_bacteria | 2937119839 | 2937123141 | 268 |
| 576 | iso_pu_bacteria | 2937126314 | 2937127994 | 268 |
| 577 | iso_pu_bacteria | 2937836603 | 2937839889 | 268 |
| 578 | iso_pu_bacteria | 2937891427 | 2937896838 | 268 |
| 579 | iso_pu_bacteria | 2937994558 | 2938002166 | 268 |
| 580 | iso_pu_bacteria | 2938014810 | 2938018979 | 268 |
| 581 | iso_pu_bacteria | 2941499720 | 2941499804 | 268 |
| 582 | iso_pu_bacteria | 2957375807 | 2957378591 | 268 |
| 583 | iso_pu_bacteria | 2957382221 | 2957384497 | 268 |
| 584 | iso_pu_bacteria | 2957388812 | 2957389720 | 268 |
| 585 | iso_pu_bacteria | 2957395598 | 2957399310 | 268 |
| 586 | iso_pu_bacteria | 2957402308 | 2957405917 | 268 |
| 587 | iso_pu_bacteria | 2957408893 | 2957411224 | 268 |
| 588 | iso_pu_bacteria | 2957415311 | 2957417639 | 268 |
| 589 | iso_pu_bacteria | 2957422303 | 2957428300 | 268 |
| 590 | iso_pu_bacteria | 2957430029 | 2957433522 | 268 |
| 591 | iso_pu_bacteria | 2957437181 | 2957437674 | 268 |
| 592 | iso_pu_bacteria | 2957443900 | 2957448678 | 268 |
| 593 | iso_pu_bacteria | 2957450854 | 2957456339 | 268 |
| 594 | iso_pu_bacteria | 2957457609 | 2957462486 | 268 |
| 595 | iso_pu_bacteria | 2957464669 | 2957467930 | 268 |
| 596 | iso_pu_bacteria | 2957471148 | 2957476174 | 268 |
| 597 | iso_pu_bacteria | 2957478035 | 2957482976 | 268 |
| 598 | iso_pu_bacteria | 2957484790 | 2957485054 | 268 |
| 599 | iso_pu_bacteria | 2957491536 | 2957495648 | 268 |
| 600 | iso_pu_bacteria | 2957498199 | 2957504473 | 268 |
| 601 | iso_pu_bacteria | 2957505466 | 2957511798 | 268 |
| 602 | iso_pu_bacteria | 2958071322 | 2958075161 | 268 |
| 603 | iso_pu_bacteria | 2958100919 | 2958107592 | 268 |
| 604 | iso_pu_bacteria | 2958115193 | 2958122107 | 268 |
| 605 | iso_pu_bacteria | 2958165035 | 2958172220 | 268 |
| 606 | iso_pu_bacteria | 2960584000 | 2960586414 | 268 |
| 607 | iso_pu_bacteria | 2960591022 | 2960596159 | 268 |
| 608 | iso_pu_bacteria | 2960597568 | 2960603257 | 268 |
| 609 | iso_pu_bacteria | 2960603979 | 2960607220 | 268 |
| 610 | iso_pu_bacteria | 2960610863 | 2960616297 | 268 |
| 611 | iso_pu_bacteria | 2960617483 | 2960623135 | 268 |
| 612 | iso_pu_bacteria | 2960624210 | 2960625155 | 268 |
| 613 | iso_pu_bacteria | 2960631154 | 2960637261 | 268 |
| 614 | iso_pu_bacteria | 2960637947 | 2960643641 | 268 |
| 615 | iso_pu_bacteria | 2960645483 | 2960650788 | 268 |
| 616 | iso_pu_bacteria | 2960652885 | 2960658694 | 268 |
| 617 | iso_pu_bacteria | 2960660292 | 2960666688 | 268 |
| 618 | iso_pu_bacteria | 2960667422 | 2960671991 | 268 |
| 619 | iso_pu_bacteria | 2960674078 | 2960678552 | 268 |
| 620 | iso_pu_bacteria | 2960680706 | 2960686855 | 268 |
| 621 | iso_pu_bacteria | 2960687367 | 2960692257 | 268 |
| 622 | iso_pu_bacteria | 2960693952 | 2960695967 | 268 |
| 623 | iso_pu_bacteria | 2961114664 | 2961116597 | 268 |
| 624 | iso_pu_bacteria | 2961163497 | 2961170668 | 268 |
| 625 | iso_pu_bacteria | 2964607997 | 2964611163 | 268 |
| 626 | iso_pu_bacteria | 2964615318 | 2964617485 | 268 |
| 627 | iso_pu_bacteria | 2964621998 | 2964628262 | 268 |
| 628 | iso_pu_bacteria | 2964628898 | 2964633897 | 268 |
| 629 | iso_pu_bacteria | 2964636051 | 2964640611 | 268 |
| 630 | iso_pu_bacteria | 2964643177 | 2964646003 | 268 |
| 631 | iso_pu_bacteria | 2964649959 | 2964655774 | 268 |
| 632 | iso_pu_bacteria | 2964656573 | 2964657538 | 268 |
| 633 | iso_pu_bacteria | 2964663802 | 2964664982 | 268 |
| 634 | iso_pu_bacteria | 2964670856 | 2964675818 | 268 |
| 635 | iso_pu_bacteria | 2964678106 | 2964682178 | 268 |
| 636 | iso_pu_bacteria | 2964685014 | 2964691268 | 268 |
| 637 | iso_pu_bacteria | 2964691889 | 2964693728 | 268 |
| 638 | iso_pu_bacteria | 2964698721 | 2964702056 | 268 |
| 639 | iso_pu_bacteria | 2964705432 | 2964709211 | 268 |
| 640 | iso_pu_bacteria | 2964712639 | 2964716838 | 268 |
| 641 | iso_pu_bacteria | 2964719344 | 2964724503 | 268 |
| 642 | iso_pu_bacteria | 2965018300 | 2965025415 | 268 |
| 643 | iso_pu_bacteria | 2965062239 | 2965069347 | 268 |
| 644 | iso_pu_bacteria | 2965119406 | 2965121166 | 268 |
| 645 | iso_pu_bacteria | 2967664464 | 2967668099 | 268 |
| 646 | iso_pu_bacteria | 2967671571 | 2967674583 | 268 |
| 647 | iso_pu_bacteria | 2967678726 | 2967683786 | 268 |
| 648 | iso_pu_bacteria | 2967686174 | 2967687345 | 268 |
| 649 | iso_pu_bacteria | 2967693043 | 2967693623 | 268 |
| 650 | iso_pu_bacteria | 2967699805 | 2967700857 | 268 |
| 651 | iso_pu_bacteria | 2967706974 | 2967711997 | 268 |
| 652 | iso_pu_bacteria | 2967714385 | 2967720335 | 268 |
| 653 | iso_pu_bacteria | 2967721400 | 2967728192 | 268 |
| 654 | iso_pu_bacteria | 2967728569 | 2967734296 | 268 |
| 655 | iso_pu_bacteria | 2967735183 | 2967741212 | 268 |
| 656 | iso_pu_bacteria | 2967742019 | 2967746288 | 268 |
| 657 | iso_pu_bacteria | 2967748971 | 2967750075 | 268 |
| 658 | iso_pu_bacteria | 2967755722 | 2967758028 | 268 |
| 659 | iso_pu_bacteria | 2967762386 | 2967763487 | 268 |
| 660 | iso_pu_bacteria | 2967769361 | 2967771591 | 268 |
| 661 | iso_pu_bacteria | 2967775926 | 2967777555 | 268 |
| 662 | iso_pu_bacteria | 2968091066 | 2968095916 | 268 |
| 663 | iso_pu_bacteria | 2968097103 | 2968100392 | 268 |
| 664 | iso_pu_bacteria | 2968110612 | 2968112504 | 268 |
| 665 | iso_pu_bacteria | 2968117919 | 2968121279 | 268 |
| 666 | iso_pu_bacteria | 2968128360 | 2968132255 | 268 |
| 667 | iso_pu_bacteria | 2968171901 | 2968179054 | 268 |
| 668 | iso_pu_bacteria | 2970019648 | 2970020079 | 268 |
| 669 | iso_pu_bacteria | 2970026789 | 2970030960 | 268 |
| 670 | iso_pu_bacteria | 2970033650 | 2970038202 | 268 |
| 671 | iso_pu_bacteria | 2970040964 | 2970047184 | 268 |
| 672 | iso_pu_bacteria | 2970047711 | 2970053906 | 268 |
| 673 | iso_pu_bacteria | 2970054988 | 2970061412 | 268 |
| 674 | iso_pu_bacteria | 2970061556 | 2970067556 | 268 |
| 675 | iso_pu_bacteria | 2970068827 | 2970072282 | 268 |
| 676 | iso_pu_bacteria | 2970076120 | 2970077440 | 268 |
| 677 | iso_pu_bacteria | 2970082768 | 2970084789 | 268 |
| 678 | iso_pu_bacteria | 2970088815 | 2970095277 | 268 |
| 679 | iso_pu_bacteria | 2970095765 | 2970099421 | 268 |
| 680 | iso_pu_bacteria | 2970102677 | 2970103684 | 268 |
| 681 | iso_pu_bacteria | 2970109326 | 2970114373 | 268 |
| 682 | iso_pu_bacteria | 2970116247 | 2970122601 | 268 |
| 683 | iso_pu_bacteria | 2970122695 | 2970124710 | 268 |
| 684 | iso_pu_bacteria | 2970129317 | 2970130322 | 268 |
| 685 | iso_pu_bacteria | 2970136068 | 2970141075 | 268 |
| 686 | iso_pu_bacteria | 2970143518 | 2970145523 | 268 |
| 687 | iso_pu_bacteria | 2970156795 | 2970162768 | 268 |
| 688 | iso_pu_bacteria | 2970164137 | 2970170556 | 268 |
| 689 | iso_pu_bacteria | 2970170962 | 2970177117 | 268 |
| 690 | iso_pu_bacteria | 2970177841 | 2970181187 | 268 |
| 691 | iso_pu_bacteria | 2970184632 | 2970190391 | 268 |
| 692 | iso_pu_bacteria | 2970191845 | 2970196943 | 268 |
| 693 | iso_pu_bacteria | 2970524798 | 2970531921 | 268 |
| 694 | iso_pu_bacteria | 2970540015 | 2970546409 | 268 |
| 695 | iso_pu_bacteria | 2970554993 | 2970561898 | 268 |
| 696 | iso_pu_bacteria | 2977516862 | 2977518003 | 268 |
| 697 | iso_pu_bacteria | 2977523885 | 2977528744 | 268 |
| 698 | iso_pu_bacteria | 2977530762 | 2977533856 | 268 |
| 699 | iso_pu_bacteria | 2977537788 | 2977540259 | 268 |
| 700 | iso_pu_bacteria | 2977544691 | 2977547616 | 268 |
| 701 | iso_pu_bacteria | 2977551784 | 2977554861 | 268 |
| 702 | iso_pu_bacteria | 2977558990 | 2977564580 | 268 |
| 703 | iso_pu_bacteria | 2977565890 | 2977568345 | 268 |
| 704 | iso_pu_bacteria | 2977572785 | 2977575531 | 268 |
| 705 | iso_pu_bacteria | 2977579622 | 2977585236 | 268 |
| 706 | iso_pu_bacteria | 2977858184 | 2977861343 | 268 |
| 707 | iso_pu_bacteria | 2977942078 | 2977948161 | 268 |
| 708 | iso_pu_bacteria | 2977971508 | 2977979912 | 268 |
| 709 | iso_pu_bacteria | 2978969890 | 2978974003 | 268 |
| 710 | iso_pu_bacteria | 2979089926 | 2979094185 | 268 |
| 711 | iso_pu_bacteria | 2979095461 | 2979098434 | 268 |
| 712 | iso_pu_bacteria | 2979100975 | 2979106188 | 268 |
| 713 | iso_pu_bacteria | 2979710463 | 2979716863 | 268 |
| 714 | iso_pu_bacteria | 2979779861 | 2979779917 | 268 |
| 715 | iso_pu_bacteria | 2984509177 | 2984512016 | 268 |
| 716 | iso_pu_bacteria | 2984518228 | 2984521623 | 268 |
| 717 | iso_pu_bacteria | 2984537506 | 2984540917 | 268 |
| 718 | iso_pu_bacteria | 2984587000 | 2984589332 | 268 |
| 719 | iso_pu_bacteria | 2984601300 | 2984603179 | 268 |
| 720 | iso_pu_bacteria | 2987636660 | 2987637636 | 268 |
| 721 | iso_pu_bacteria | 2987652177 | 2987655508 | 268 |
| 722 | iso_pu_bacteria | 2987659509 | 2987666907 | 268 |
| 723 | iso_pu_bacteria | 2989349275 | 2989353012 | 268 |
| 724 | iso_pu_bacteria | 2989771324 | 2989773811 | 268 |
| 725 | iso_pu_bacteria | 2996341866 | 2996343919 | 268 |
| 726 | iso_pu_bacteria | 2996887358 | 2996892389 | 268 |
| 727 | iso_pu_bacteria | 2996893221 | 2996893806 | 268 |
| 728 | iso_pu_bacteria | 3003930520 | 3003933527 | 268 |
| 729 | iso_pu_bacteria | 3004188549 | 3004195911 | 268 |
| 730 | iso_pu_bacteria | 3004203850 | 3004206042 | 268 |
| 731 | iso_pu_bacteria | 3005409236 | 3005409694 | 268 |
| 732 | iso_pu_bacteria | 3005445848 | 3005447201 | 268 |
| 733 | iso_pu_bacteria | 3005452660 | 3005453910 | 268 |
| 734 | iso_pu_bacteria | 639633055 | 639648093 | 268 |
| 735 | iso_pu_bacteria | 643692032 | 643825526 | 268 |
| 736 | iso_pu_bacteria | 648276728 | 648740160 | 268 |
| 737 | iso_pu_bacteria | 650716007 | 650740039 | 268 |
| 738 | iso_pu_bacteria | 8003570095 | 8003571038 | 268 |
| 739 | iso_pu_bacteria | 8003992118 | 8003993361 | 268 |
| 740 | iso_pu_bacteria | 8003999396 | 8004000612 | 268 |
| 741 | iso_pu_bacteria | 8004395343 | 8004403888 | 268 |
| 742 | iso_pu_bacteria | 8004445564 | 8004450169 | 268 |
| 743 | iso_pu_bacteria | 8004633249 | 8004639839 | 268 |
| 744 | iso_pu_bacteria | 8004703790 | 8004713541 | 268 |
| 745 | iso_pu_bacteria | 8005258706 | 8005259671 | 268 |
| 746 | iso_pu_bacteria | 8005275841 | 8005280156 | 268 |
| 747 | iso_pu_bacteria | 8005282627 | 8005288228 | 268 |
| 748 | iso_pu_bacteria | 8005289223 | 8005294741 | 268 |
| 749 | iso_pu_bacteria | 8005301065 | 8005307083 | 268 |
| 750 | iso_pu_bacteria | 8005307578 | 8005314601 | 268 |
| 751 | iso_pu_bacteria | 8005321885 | 8005326916 | 268 |
| 752 | iso_pu_bacteria | 8005376324 | 8005378736 | 268 |
| 753 | iso_pu_bacteria | 8005382845 | 8005384994 | 268 |
| 754 | iso_pu_bacteria | 8005395548 | 8005397081 | 268 |
| 755 | iso_pu_bacteria | 8005430974 | 8005436156 | 268 |
| 756 | iso_pu_bacteria | 8005460587 | 8005462468 | 268 |
| 757 | iso_pu_bacteria | 8005497431 | 8005499849 | 268 |
| 758 | iso_pu_bacteria | 8005542996 | 8005544829 | 268 |
| 759 | iso_pu_bacteria | 8005556819 | 8005558159 | 268 |
| 760 | iso_pu_bacteria | 8005563573 | 8005569337 | 268 |
| 761 | iso_pu_bacteria | 8005570704 | 8005575389 | 268 |
| 762 | iso_pu_bacteria | 8005619151 | 8005621218 | 268 |
| 763 | iso_pu_bacteria | 8005626139 | 8005631482 | 268 |
| 764 | iso_pu_bacteria | 8005668836 | 8005671267 | 268 |
| 765 | iso_pu_bacteria | 8005688590 | 8005694997 | 268 |
| 766 | iso_pu_bacteria | 8005695170 | 8005696222 | 268 |
| 767 | iso_pu_bacteria | 8018127388 | 8018129515 | 268 |
| 768 | iso_pu_bacteria | 8018150411 | 8018155657 | 268 |
| 769 | iso_pu_bacteria | 8018163183 | 8018168052 | 268 |
| 770 | iso_pu_bacteria | 8018176218 | 8018180295 | 268 |
| 771 | iso_pu_bacteria | 8023680758 | 8023680930 | 268 |
| 772 | iso_pu_bacteria | 8024479707 | 8024485701 | 268 |
| 773 | iso_pu_bacteria | 8024501048 | 8024505155 | 268 |
| 774 | iso_pu_bacteria | 8049293176 | 8049294411 | 268 |
| 775 | iso_pu_bacteria | 8054460903 | 8054462770 | 268 |
| 776 | iso_pu_bacteria | 8054558443 | 8054562842 | 268 |
| 777 | iso_pu_bacteria | 8055431914 | 8055434382 | 268 |
| 778 | iso_pu_bacteria | 8055617313 | 8055622136 | 268 |
| 779 | iso_pu_bacteria | 8056375014 | 8056380099 | 268 |
| 780 | iso_pu_bacteria | 8056382006 | 8056387612 | 268 |
| 781 | iso_pu_bacteria | 8056875544 | 8056877448 | 268 |
| 782 | iso_pu_bacteria | 8057529695 | 8057530468 | 268 |
| 783 | iso_pu_bacteria | 8057874678 | 8057875540 | 268 |
| 784 | 3300005937 | Ga0081455_10109150 | Ga0081455_101091502 | 269 |
| 785 | 3300006048 | Ga0075363_100186794 | Ga0075363_1001867942 | 269 |
| 786 | 3300006178 | Ga0075367_10321941 | Ga0075367_103219411 | 269 |
| 787 | 3300014326 | Ga0157380_10010005 | Ga0157380_100100058 | 269 |
| 788 | 3300015684 | Ga0183365_10962 | Ga0183365_109621 | 269 |
| 789 | 3300025961 | Ga0207712_10346845 | Ga0207712_103468451 | 269 |
| 790 | 3300025972 | Ga0207668_10254092 | Ga0207668_102540922 | 269 |
| 791 | 3300031595 | Ga0265313_10000632 | Ga0265313_1000063239 | 269 |
| 792 | 3300037471 | Ga0395905_0000658 | Ga0395905_0000658_33337_34158 | 269 |
| 793 | 3300044712 | Ga0453684_0026923 | Ga0453684_0026923_7132_8001 | 269 |
| 794 | 3300044901 | Ga0466960_0054234 | Ga0466960_0054234_955_1791 | 269 |
| 795 | 3300044901 | Ga0466960_0284038 | Ga0466960_0284038_29_880 | 269 |
| 796 | 3300045976 | Ga0466967_0368081 | Ga0466967_0368081_353_1204 | 269 |
| 797 | 3300049570 | Ga0501033_0006664 | Ga0501033_0006664_1122_1973 | 269 |
| 798 | 3300049682 | Ga0501252_004934 | Ga0501252_004934_65_901 | 269 |
| 799 | 3300049822 | Ga0501035_0022065 | Ga0501035_0022065_3864_4715 | 269 |
| 800 | 3300050493 | nmdc:mga0k408_189006_c1 | nmdc:mga0k408_189006_c1_324_1133 | 269 |
| 801 | 3300050493 | nmdc:mga0k408_83973_c1 | nmdc:mga0k408_83973_c1_477_1286 | 269 |
| 802 | 3300050494 | nmdc:mga06z11_186672_c1 | nmdc:mga06z11_186672_c1_22_831 | 269 |
| 803 | 3300050494 | nmdc:mga06z11_52530_c1 | nmdc:mga06z11_52530_c1_755_1564 | 269 |
| 804 | 3300053096 | Ga0500641_0015533 | Ga0500641_0015533_287_1096 | 269 |
| 805 | 3300053134 | Ga0500658_0043364 | Ga0500658_0043364_957_1766 | 269 |
| 806 | iso_pu_bacteria | 2510917022 | 2511133670 | 269 |
| 807 | iso_pu_bacteria | 2524023209 | 2524462639 | 269 |
| 808 | iso_pu_bacteria | 2582581307 | 2585270560 | 269 |
| 809 | iso_pu_bacteria | 2582581308 | 2585276900 | 269 |
| 810 | iso_pu_bacteria | 2582581315 | 2585324096 | 269 |
| 811 | iso_pu_bacteria | 2582581316 | 2585333508 | 269 |
| 812 | iso_pu_bacteria | 2585427527 | 2585534794 | 269 |
| 813 | iso_pu_bacteria | 2585427530 | 2585551760 | 269 |
| 814 | iso_pu_bacteria | 2585427531 | 2585558264 | 269 |
| 815 | iso_pu_bacteria | 2585427594 | 2585845752 | 269 |
| 816 | iso_pu_bacteria | 2585427608 | 2585897657 | 269 |
| 817 | iso_pu_bacteria | 2585427609 | 2585904747 | 269 |
| 818 | iso_pu_bacteria | 2585428125 | 2587980137 | 269 |
| 819 | iso_pu_bacteria | 2599185156 | 2599331528 | 269 |
| 820 | iso_pu_bacteria | 2615840626 | 2616308273 | 269 |
| 821 | iso_pu_bacteria | 2615840698 | 2616556666 | 269 |
| 822 | iso_pu_bacteria | 2617270742 | 2617381627 | 269 |
| 823 | iso_pu_bacteria | 2667528174 | 2671115675 | 269 |
| 824 | iso_pu_bacteria | 2738541293 | 2738799287 | 269 |
| 825 | iso_pu_bacteria | 2758568016 | 2758641865 | 269 |
| 826 | iso_pu_bacteria | 2775507266 | 2778176414 | 269 |
| 827 | iso_pu_bacteria | 2818991448 | 2819610468 | 269 |
| 828 | iso_pu_bacteria | 2818991453 | 2819638212 | 269 |
| 829 | iso_pu_bacteria | 2838029111 | 2838032190 | 269 |
| 830 | iso_pu_bacteria | 2842298080 | 2842301902 | 269 |
| 831 | iso_pu_bacteria | 2842357229 | 2842362300 | 269 |
| 832 | iso_pu_bacteria | 2842475841 | 2842479181 | 269 |
| 833 | iso_pu_bacteria | 2842482326 | 2842487196 | 269 |
| 834 | iso_pu_bacteria | 2842502639 | 2842506099 | 269 |
| 835 | iso_pu_bacteria | 2842509118 | 2842510145 | 269 |
| 836 | iso_pu_bacteria | 2842922631 | 2842923926 | 269 |
| 837 | iso_pu_bacteria | 2852387548 | 2852389553 | 269 |
| 838 | iso_pu_bacteria | 2899803654 | 2899807532 | 269 |
| 839 | iso_pu_bacteria | 2919408235 | 2919409727 | 269 |
| 840 | iso_pu_bacteria | 3005416602 | 3005420411 | 269 |
| 841 | iso_pu_bacteria | 8005314921 | 8005317362 | 269 |
| 842 | iso_pu_bacteria | 8005484373 | 8005486572 | 269 |
| 843 | iso_pu_bacteria | 8005645114 | 8005646280 | 269 |
| 844 | iso_pu_bacteria | 8005682033 | 8005686419 | 269 |
| 845 | iso_pu_bacteria | 8046767195 | 8046770281 | 269 |
| 846 | iso_pu_bacteria | 8057575449 | 8057578209 | 269 |
| 847 | 3300003578 | Ga0006562J51391_1023271 | Ga0006562J51391_10232711 | 270 |
| 848 | 3300003781 | Ga0055536_1005413 | Ga0055536_10054135 | 270 |
| 849 | 3300003792 | Ga0055540_1004719 | Ga0055540_10047194 | 270 |
| 850 | 3300003794 | Ga0055531_10007165 | Ga0055531_100071656 | 270 |
| 851 | 3300005435 | Ga0070714_100101214 | Ga0070714_1001012143 | 270 |
| 852 | 3300005436 | Ga0070713_100103742 | Ga0070713_1001037424 | 270 |
| 853 | 3300006028 | Ga0070717_10230786 | Ga0070717_102307862 | 270 |
| 854 | 3300006028 | Ga0070717_10365219 | Ga0070717_103652192 | 270 |
| 855 | 3300006051 | Ga0075364_10015127 | Ga0075364_100151274 | 270 |
| 856 | 3300006353 | Ga0075370_10290360 | Ga0075370_102903601 | 270 |
| 857 | 3300006914 | Ga0075436_100125191 | Ga0075436_1001251913 | 270 |
| 858 | 3300024227 | Ga0228598_1037468 | Ga0228598_10374681 | 270 |
| 859 | 3300025230 | Ga0209563_107580 | Ga0209563_1075801 | 270 |
| 860 | 3300025292 | Ga0209676_1002428 | Ga0209676_100242813 | 270 |
| 861 | 3300025297 | Ga0209758_1000155 | Ga0209758_1000155133 | 270 |
| 862 | 3300025298 | Ga0209050_1007606 | Ga0209050_10076064 | 270 |
| 863 | 3300025303 | Ga0209051_1002245 | Ga0209051_100224510 | 270 |
| 864 | 3300025304 | Ga0209257_1003261 | Ga0209257_100326110 | 270 |
| 865 | 3300025915 | Ga0207693_10083006 | Ga0207693_100830062 | 270 |
| 866 | 3300025928 | Ga0207700_10026723 | Ga0207700_100267233 | 270 |
| 867 | 3300025928 | Ga0207700_10109700 | Ga0207700_101097003 | 270 |
| 868 | 3300025929 | Ga0207664_10206437 | Ga0207664_102064372 | 270 |
| 869 | 3300028023 | Ga0265357_1001835 | Ga0265357_10018352 | 270 |
| 870 | 3300028800 | Ga0265338_10122398 | Ga0265338_101223983 | 270 |
| 871 | 3300029957 | Ga0265324_10035124 | Ga0265324_100351242 | 270 |
| 872 | 3300030760 | Ga0265762_1017489 | Ga0265762_10174891 | 270 |
| 873 | 3300030763 | Ga0265763_1001123 | Ga0265763_10011231 | 270 |
| 874 | 3300031090 | Ga0265760_10044076 | Ga0265760_100440763 | 270 |
| 875 | 3300031249 | Ga0265339_10000075 | Ga0265339_1000007558 | 270 |
| 876 | 3300031456 | Ga0307513_10166031 | Ga0307513_101660313 | 270 |
| 877 | 3300031595 | Ga0265313_10000540 | Ga0265313_100005407 | 270 |
| 878 | 3300031728 | Ga0316578_10137444 | Ga0316578_101374442 | 270 |
| 879 | 3300032137 | Ga0316585_10040220 | Ga0316585_100402202 | 270 |
| 880 | 3300035398 | Ga0316574_0000583 | Ga0316574_0000583_9386_10207 | 270 |
| 881 | 3300035695 | Ga0373927_0002703 | Ga0373927_0002703_11024_11848 | 270 |
| 882 | 3300036401 | Ga0373937_0555311 | Ga0373937_0555311_72_890 | 270 |
| 883 | 3300036647 | Ga0316582_0034396 | Ga0316582_0034396_1831_2652 | 270 |
| 884 | 3300036712 | Ga0316584_0021319 | Ga0316584_0021319_2922_3743 | 270 |
| 885 | 3300037068 | Ga0373925_0001344 | Ga0373925_0001344_11041_11865 | 270 |
| 886 | 3300037471 | Ga0395905_0005373 | Ga0395905_0005373_7812_8636 | 270 |
| 887 | 3300037471 | Ga0395905_0015770 | Ga0395905_0015770_4084_4908 | 270 |
| 888 | 3300041406 | Ga0439439_0032432 | Ga0439439_0032432_157_987 | 270 |
| 889 | 3300042007 | Ga0439449_0022500 | Ga0439449_0022500_946_1776 | 270 |
| 890 | 3300044694 | Ga0466963_0153839 | Ga0466963_0153839_315_1130 | 270 |
| 891 | 3300044842 | Ga0466957_0024191 | Ga0466957_0024191_1740_2555 | 270 |
| 892 | 3300046454 | Ga0495592_0082329 | Ga0495592_0082329_265_1098 | 270 |
| 893 | 3300046459 | Ga0495629_0038204 | Ga0495629_0038204_100_933 | 270 |
| 894 | 3300046462 | Ga0495651_0113334 | Ga0495651_0113334_1032_1865 | 270 |
| 895 | 3300046476 | Ga0495662_0136709 | Ga0495662_0136709_93_926 | 270 |
| 896 | 3300046524 | Ga0495648_0070121 | Ga0495648_0070121_46_879 | 270 |
| 897 | 3300046642 | Ga0495634_0049953 | Ga0495634_0049953_1452_2285 | 270 |
| 898 | 3300046683 | Ga0495658_0051619 | Ga0495658_0051619_1357_2190 | 270 |
| 899 | 3300048922 | Ga0496119_0161280 | Ga0496119_0161280_230_1171 | 270 |
| 900 | 3300048924 | Ga0496121_0008324 | Ga0496121_0008324_10165_10989 | 270 |
| 901 | 3300048924 | Ga0496121_0322992 | Ga0496121_0322992_103_999 | 270 |
| 902 | 3300048927 | Ga0496124_0205767 | Ga0496124_0205767_441_1301 | 270 |
| 903 | 3300049592 | Ga0501076_0342683 | Ga0501076_0342683_110_940 | 270 |
| 904 | 3300049776 | Ga0501280_001053 | Ga0501280_001053_2226_3050 | 270 |
| 905 | 3300050491 | nmdc:mga00v17_74_c2 | nmdc:mga00v17_74_c2_22942_23766 | 270 |
| 906 | 3300050514 | nmdc:mga08x19_66052_c1 | nmdc:mga08x19_66052_c1_1168_1983 | 270 |
| 907 | 3300053077 | Ga0495601_0127997 | Ga0495601_0127997_338_1156 | 270 |
| 908 | 3300053085 | Ga0495619_0024578 | Ga0495619_0024578_1907_2740 | 270 |
| 909 | 3300053104 | Ga0500556_0007667 | Ga0500556_0007667_433_1257 | 270 |
| 910 | 3300053122 | Ga0500608_010666 | Ga0500608_010666_365_1192 | 270 |
| 911 | 3300053136 | Ga0500559_0009585 | Ga0500559_0009585_2272_3096 | 270 |
| 912 | 3300053153 | Ga0500616_0001455 | Ga0500616_0001455_2699_3541 | 270 |
| 913 | 3300053153 | Ga0500616_0143148 | Ga0500616_0143148_46_870 | 270 |
| 914 | 3300053158 | Ga0500627_0127910 | Ga0500627_0127910_186_1028 | 270 |
| 915 | 3300061734 | Ga0530510_0214609 | Ga0530510_0214609_224_1054 | 270 |
| 916 | 3300002739 | JGI25158J39367_1000203 | JGI25158J39367_10002035 | 271 |
| 917 | 3300002773 | JGI25152J39213_1001188 | JGI25152J39213_10011886 | 271 |
| 918 | 3300002773 | JGI25152J39213_1005646 | JGI25152J39213_10056463 | 271 |
| 919 | 3300002773 | JGI25152J39213_1006889 | JGI25152J39213_10068893 | 271 |
| 920 | 3300002774 | JGI25150J39212_1012292 | JGI25150J39212_10122921 | 271 |
| 921 | 3300002987 | JGI25159J45721_1000006 | JGI25159J45721_1000006113 | 271 |
| 922 | 3300002987 | JGI25159J45721_1000969 | JGI25159J45721_10009695 | 271 |
| 923 | 3300003187 | JGI25151J46595_10000653 | JGI25151J46595_1000065317 | 271 |
| 924 | 3300003187 | JGI25151J46595_10013982 | JGI25151J46595_100139822 | 271 |
| 925 | 3300003187 | JGI25151J46595_10023001 | JGI25151J46595_100230012 | 271 |
| 926 | 3300003187 | JGI25151J46595_10025442 | JGI25151J46595_100254424 | 271 |
| 927 | 3300003203 | JGI25406J46586_10008097 | JGI25406J46586_100080975 | 271 |
| 928 | 3300003215 | JGI25153J46596_10013236 | JGI25153J46596_100132362 | 271 |
| 929 | 3300003215 | JGI25153J46596_10013822 | JGI25153J46596_100138224 | 271 |
| 930 | 3300003215 | JGI25153J46596_10016477 | JGI25153J46596_100164772 | 271 |
| 931 | 3300003354 | JGI25160J50197_1000019 | JGI25160J50197_1000019118 | 271 |
| 932 | 3300003354 | JGI25160J50197_1004333 | JGI25160J50197_10043335 | 271 |
| 933 | 3300003354 | JGI25160J50197_1010089 | JGI25160J50197_10100891 | 271 |
| 934 | 3300003354 | JGI25160J50197_1010772 | JGI25160J50197_10107723 | 271 |
| 935 | 3300003374 | JGI25161J50226_1000053 | JGI25161J50226_100005379 | 271 |
| 936 | 3300003374 | JGI25161J50226_1001944 | JGI25161J50226_10019447 | 271 |
| 937 | 3300003771 | Ga0055526_1004368 | Ga0055526_10043687 | 271 |
| 938 | 3300003771 | Ga0055526_1004739 | Ga0055526_10047398 | 271 |
| 939 | 3300003771 | Ga0055526_1008416 | Ga0055526_10084164 | 271 |
| 940 | 3300003771 | Ga0055526_1009627 | Ga0055526_10096274 | 271 |
| 941 | 3300003771 | Ga0055526_1010985 | Ga0055526_10109854 | 271 |
| 942 | 3300003771 | Ga0055526_1025466 | Ga0055526_10254662 | 271 |
| 943 | 3300003775 | Ga0055524_1002113 | Ga0055524_100211311 | 271 |
| 944 | 3300003775 | Ga0055524_1002391 | Ga0055524_10023915 | 271 |
| 945 | 3300003775 | Ga0055524_1003568 | Ga0055524_10035683 | 271 |
| 946 | 3300003775 | Ga0055524_1007500 | Ga0055524_10075004 | 271 |
| 947 | 3300003775 | Ga0055524_1009140 | Ga0055524_10091402 | 271 |
| 948 | 3300003775 | Ga0055524_1011053 | Ga0055524_10110534 | 271 |
| 949 | 3300003775 | Ga0055524_1013589 | Ga0055524_10135892 | 271 |
| 950 | 3300003790 | Ga0055528_1001604 | Ga0055528_100160412 | 271 |
| 951 | 3300003790 | Ga0055528_1002265 | Ga0055528_10022654 | 271 |
| 952 | 3300003790 | Ga0055528_1007370 | Ga0055528_10073704 | 271 |
| 953 | 3300003790 | Ga0055528_1009553 | Ga0055528_10095531 | 271 |
| 954 | 3300003790 | Ga0055528_1011715 | Ga0055528_10117152 | 271 |
| 955 | 3300003790 | Ga0055528_1014009 | Ga0055528_10140093 | 271 |
| 956 | 3300003791 | Ga0055530_10018616 | Ga0055530_100186161 | 271 |
| 957 | 3300003792 | Ga0055540_1018177 | Ga0055540_10181773 | 271 |
| 958 | 3300003794 | Ga0055531_10025155 | Ga0055531_100251552 | 271 |
| 959 | 3300003856 | Ga0058692_1012800 | Ga0058692_10128001 | 271 |
| 960 | 3300004625 | Ga0055543_1000019 | Ga0055543_100001979 | 271 |
| 961 | 3300004625 | Ga0055543_1000147 | Ga0055543_100014714 | 271 |
| 962 | 3300004625 | Ga0055543_1000976 | Ga0055543_100097611 | 271 |
| 963 | 3300004798 | Ga0058859_10007620 | Ga0058859_100076201 | 271 |
| 964 | 3300005262 | Ga0065165_1000180 | Ga0065165_1000180119 | 271 |
| 965 | 3300005262 | Ga0065165_1005412 | Ga0065165_10054125 | 271 |
| 966 | 3300005262 | Ga0065165_1008068 | Ga0065165_10080686 | 271 |
| 967 | 3300005262 | Ga0065165_1025717 | Ga0065165_10257172 | 271 |
| 968 | 3300005262 | Ga0065165_1044964 | Ga0065165_10449641 | 271 |
| 969 | 3300005328 | Ga0070676_10193627 | Ga0070676_101936272 | 271 |
| 970 | 3300005330 | Ga0070690_100306060 | Ga0070690_1003060602 | 271 |
| 971 | 3300005333 | Ga0070677_10158540 | Ga0070677_101585401 | 271 |
| 972 | 3300005334 | Ga0068869_100097519 | Ga0068869_1000975192 | 271 |
| 973 | 3300005336 | Ga0070680_100038173 | Ga0070680_1000381732 | 271 |
| 974 | 3300005339 | Ga0070660_100097940 | Ga0070660_1000979402 | 271 |
| 975 | 3300005340 | Ga0070689_100132572 | Ga0070689_1001325722 | 271 |
| 976 | 3300005343 | Ga0070687_100165984 | Ga0070687_1001659841 | 271 |
| 977 | 3300005355 | Ga0070671_100026345 | Ga0070671_1000263456 | 271 |
| 978 | 3300005355 | Ga0070671_100354249 | Ga0070671_1003542492 | 271 |
| 979 | 3300005356 | Ga0070674_100014979 | Ga0070674_1000149798 | 271 |
| 980 | 3300005364 | Ga0070673_100124667 | Ga0070673_1001246673 | 271 |
| 981 | 3300005364 | Ga0070673_100505375 | Ga0070673_1005053751 | 271 |
| 982 | 3300005440 | Ga0070705_100021343 | Ga0070705_1000213433 | 271 |
| 983 | 3300005458 | Ga0070681_10025108 | Ga0070681_100251087 | 271 |
| 984 | 3300005458 | Ga0070681_10193409 | Ga0070681_101934091 | 271 |
| 985 | 3300005466 | Ga0070685_10103765 | Ga0070685_101037654 | 271 |
| 986 | 3300005530 | Ga0070679_100007152 | Ga0070679_10000715213 | 271 |
| 987 | 3300005536 | Ga0070697_100007057 | Ga0070697_1000070576 | 271 |
| 988 | 3300005539 | Ga0068853_100044363 | Ga0068853_1000443633 | 271 |
| 989 | 3300005543 | Ga0070672_100301741 | Ga0070672_1003017412 | 271 |
| 990 | 3300005545 | Ga0070695_100005884 | Ga0070695_10000588411 | 271 |
| 991 | 3300005547 | Ga0070693_100014012 | Ga0070693_1000140124 | 271 |
| 992 | 3300005548 | Ga0070665_100029923 | Ga0070665_1000299236 | 271 |
| 993 | 3300005841 | Ga0068863_100051908 | Ga0068863_1000519085 | 271 |
| 994 | 3300005843 | Ga0068860_100542298 | Ga0068860_1005422982 | 271 |
| 995 | 3300005985 | Ga0081539_10000688 | Ga0081539_1000068851 | 271 |
| 996 | 3300006038 | Ga0075365_10001260 | Ga0075365_1000126010 | 271 |
| 997 | 3300006038 | Ga0075365_10102973 | Ga0075365_101029732 | 271 |
| 998 | 3300006042 | Ga0075368_10001271 | Ga0075368_100012713 | 271 |
| 999 | 3300006042 | Ga0075368_10022709 | Ga0075368_100227092 | 271 |
| 1000 | 3300006048 | Ga0075363_100152348 | Ga0075363_1001523481 | 271 |
| 1001 | 3300006177 | Ga0075362_10000880 | Ga0075362_100008809 | 271 |
| 1002 | 3300006177 | Ga0075362_10109090 | Ga0075362_101090901 | 271 |
| 1003 | 3300006177 | Ga0075362_10169280 | Ga0075362_101692801 | 271 |
| 1004 | 3300006177 | Ga0075362_10173357 | Ga0075362_101733571 | 271 |
| 1005 | 3300006178 | Ga0075367_10010791 | Ga0075367_100107911 | 271 |
| 1006 | 3300006178 | Ga0075367_10023504 | Ga0075367_100235043 | 271 |
| 1007 | 3300006178 | Ga0075367_10394420 | Ga0075367_103944201 | 271 |
| 1008 | 3300006186 | Ga0075369_10020793 | Ga0075369_100207934 | 271 |
| 1009 | 3300006195 | Ga0075366_10002163 | Ga0075366_100021636 | 271 |
| 1010 | 3300006195 | Ga0075366_10008391 | Ga0075366_100083915 | 271 |
| 1011 | 3300006195 | Ga0075366_10055826 | Ga0075366_100558263 | 271 |
| 1012 | 3300006195 | Ga0075366_10082552 | Ga0075366_100825523 | 271 |
| 1013 | 3300006195 | Ga0075366_10169878 | Ga0075366_101698781 | 271 |
| 1014 | 3300006237 | Ga0097621_100101351 | Ga0097621_1001013512 | 271 |
| 1015 | 3300006353 | Ga0075370_10037466 | Ga0075370_100374662 | 271 |
| 1016 | 3300006353 | Ga0075370_10243124 | Ga0075370_102431241 | 271 |
| 1017 | 3300006881 | Ga0068865_100099849 | Ga0068865_1000998491 | 271 |
| 1018 | 3300006914 | Ga0075436_100002407 | Ga0075436_10000240713 | 271 |
| 1019 | 3300006946 | Ga0079104_1000187 | Ga0079104_100018784 | 271 |
| 1020 | 3300006946 | Ga0079104_1003210 | Ga0079104_10032106 | 271 |
| 1021 | 3300006946 | Ga0079104_1008871 | Ga0079104_10088714 | 271 |
| 1022 | 3300006948 | Ga0099826_10000272 | Ga0099826_1000027216 | 271 |
| 1023 | 3300006948 | Ga0099826_10056750 | Ga0099826_100567503 | 271 |
| 1024 | 3300007076 | Ga0075435_100021526 | Ga0075435_1000215264 | 271 |
| 1025 | 3300009094 | Ga0111539_10592186 | Ga0111539_105921862 | 271 |
| 1026 | 3300009101 | Ga0105247_10092970 | Ga0105247_100929702 | 271 |
| 1027 | 3300009147 | Ga0114129_10589498 | Ga0114129_105894982 | 271 |
| 1028 | 3300009148 | Ga0105243_10017278 | Ga0105243_100172785 | 271 |
| 1029 | 3300009176 | Ga0105242_10054092 | Ga0105242_100540923 | 271 |
| 1030 | 3300009177 | Ga0105248_10064732 | Ga0105248_100647325 | 271 |
| 1031 | 3300009177 | Ga0105248_10195584 | Ga0105248_101955842 | 271 |
| 1032 | 3300009545 | Ga0105237_10674016 | Ga0105237_106740161 | 271 |
| 1033 | 3300009551 | Ga0105238_10032764 | Ga0105238_100327645 | 271 |
| 1034 | 3300009765 | Ga0123341_1059495 | Ga0123341_10594952 | 271 |
| 1035 | 3300009766 | Ga0123342_1014422 | Ga0123342_10144221 | 271 |
| 1036 | 3300010375 | Ga0105239_10871621 | Ga0105239_108716211 | 271 |
| 1037 | 3300013100 | Ga0157373_10016809 | Ga0157373_100168094 | 271 |
| 1038 | 3300013102 | Ga0157371_10000015 | Ga0157371_1000001591 | 271 |
| 1039 | 3300013104 | Ga0157370_10002232 | Ga0157370_100022328 | 271 |
| 1040 | 3300013105 | Ga0157369_10490627 | Ga0157369_104906271 | 271 |
| 1041 | 3300013249 | Ga0171463_1011 | Ga0171463_1011171 | 271 |
| 1042 | 3300014325 | Ga0163163_10623630 | Ga0163163_106236302 | 271 |
| 1043 | 3300015690 | Ga0183363_1279 | Ga0183363_12799 | 271 |
| 1044 | 3300021320 | Ga0214544_1000024 | Ga0214544_1000024155 | 271 |
| 1045 | 3300021321 | Ga0214542_1000015 | Ga0214542_1000015140 | 271 |
| 1046 | 3300021327 | Ga0214543_1000011 | Ga0214543_1000011264 | 271 |
| 1047 | 3300021327 | Ga0214543_1000032 | Ga0214543_100003230 | 271 |
| 1048 | 3300022739 | Ga0228711_1000012 | Ga0228711_100001293 | 271 |
| 1049 | 3300022740 | Ga0228710_1000006 | Ga0228710_100000693 | 271 |
| 1050 | 3300025208 | Ga0209436_100155 | Ga0209436_10015537 | 271 |
| 1051 | 3300025208 | Ga0209436_102600 | Ga0209436_1026004 | 271 |
| 1052 | 3300025245 | Ga0207425_1003736 | Ga0207425_10037364 | 271 |
| 1053 | 3300025245 | Ga0207425_1008252 | Ga0207425_10082524 | 271 |
| 1054 | 3300025258 | Ga0209129_1000329 | Ga0209129_100032941 | 271 |
| 1055 | 3300025258 | Ga0209129_1003358 | Ga0209129_10033587 | 271 |
| 1056 | 3300025258 | Ga0209129_1004787 | Ga0209129_10047875 | 271 |
| 1057 | 3300025258 | Ga0209129_1004973 | Ga0209129_10049732 | 271 |
| 1058 | 3300025258 | Ga0209129_1011476 | Ga0209129_10114763 | 271 |
| 1059 | 3300025263 | Ga0209565_1023569 | Ga0209565_10235691 | 271 |
| 1060 | 3300025273 | Ga0209673_1000068 | Ga0209673_1000068139 | 271 |
| 1061 | 3300025273 | Ga0209673_1000456 | Ga0209673_100045618 | 271 |
| 1062 | 3300025273 | Ga0209673_1002251 | Ga0209673_100225110 | 271 |
| 1063 | 3300025273 | Ga0209673_1002368 | Ga0209673_10023686 | 271 |
| 1064 | 3300025273 | Ga0209673_1003459 | Ga0209673_10034599 | 271 |
| 1065 | 3300025273 | Ga0209673_1018492 | Ga0209673_10184922 | 271 |
| 1066 | 3300025284 | Ga0209130_1000007 | Ga0209130_1000007471 | 271 |
| 1067 | 3300025284 | Ga0209130_1000097 | Ga0209130_10000979 | 271 |
| 1068 | 3300025284 | Ga0209130_1028763 | Ga0209130_10287632 | 271 |
| 1069 | 3300025292 | Ga0209676_1003690 | Ga0209676_10036909 | 271 |
| 1070 | 3300025292 | Ga0209676_1013668 | Ga0209676_10136684 | 271 |
| 1071 | 3300025294 | Ga0209025_1000033 | Ga0209025_1000033387 | 271 |
| 1072 | 3300025294 | Ga0209025_1000094 | Ga0209025_100009495 | 271 |
| 1073 | 3300025294 | Ga0209025_1001164 | Ga0209025_100116441 | 271 |
| 1074 | 3300025294 | Ga0209025_1002864 | Ga0209025_100286418 | 271 |
| 1075 | 3300025294 | Ga0209025_1006481 | Ga0209025_10064815 | 271 |
| 1076 | 3300025294 | Ga0209025_1024154 | Ga0209025_10241544 | 271 |
| 1077 | 3300025294 | Ga0209025_1046094 | Ga0209025_10460943 | 271 |
| 1078 | 3300025295 | Ga0209564_1000140 | Ga0209564_100014026 | 271 |
| 1079 | 3300025295 | Ga0209564_1000453 | Ga0209564_100045367 | 271 |
| 1080 | 3300025295 | Ga0209564_1002007 | Ga0209564_10020074 | 271 |
| 1081 | 3300025295 | Ga0209564_1003996 | Ga0209564_10039965 | 271 |
| 1082 | 3300025295 | Ga0209564_1004499 | Ga0209564_10044994 | 271 |
| 1083 | 3300025295 | Ga0209564_1014707 | Ga0209564_10147074 | 271 |
| 1084 | 3300025297 | Ga0209758_1001803 | Ga0209758_100180318 | 271 |
| 1085 | 3300025297 | Ga0209758_1001857 | Ga0209758_100185713 | 271 |
| 1086 | 3300025297 | Ga0209758_1002381 | Ga0209758_100238117 | 271 |
| 1087 | 3300025297 | Ga0209758_1006966 | Ga0209758_10069668 | 271 |
| 1088 | 3300025297 | Ga0209758_1011351 | Ga0209758_10113516 | 271 |
| 1089 | 3300025297 | Ga0209758_1012175 | Ga0209758_10121754 | 271 |
| 1090 | 3300025297 | Ga0209758_1016148 | Ga0209758_10161483 | 271 |
| 1091 | 3300025298 | Ga0209050_1003731 | Ga0209050_10037314 | 271 |
| 1092 | 3300025299 | Ga0209256_1000319 | Ga0209256_100031912 | 271 |
| 1093 | 3300025299 | Ga0209256_1000836 | Ga0209256_100083631 | 271 |
| 1094 | 3300025299 | Ga0209256_1001441 | Ga0209256_100144128 | 271 |
| 1095 | 3300025299 | Ga0209256_1001576 | Ga0209256_100157615 | 271 |
| 1096 | 3300025299 | Ga0209256_1003708 | Ga0209256_10037085 | 271 |
| 1097 | 3300025299 | Ga0209256_1004027 | Ga0209256_10040276 | 271 |
| 1098 | 3300025299 | Ga0209256_1013705 | Ga0209256_10137052 | 271 |
| 1099 | 3300025299 | Ga0209256_1021989 | Ga0209256_10219892 | 271 |
| 1100 | 3300025302 | Ga0207426_1000003 | Ga0207426_1000003856 | 271 |
| 1101 | 3300025302 | Ga0207426_1000094 | Ga0207426_100009443 | 271 |
| 1102 | 3300025302 | Ga0207426_1000111 | Ga0207426_1000111112 | 271 |
| 1103 | 3300025302 | Ga0207426_1005192 | Ga0207426_10051926 | 271 |
| 1104 | 3300025302 | Ga0207426_1043572 | Ga0207426_10435722 | 271 |
| 1105 | 3300025303 | Ga0209051_1010194 | Ga0209051_10101945 | 271 |
| 1106 | 3300025303 | Ga0209051_1017610 | Ga0209051_10176102 | 271 |
| 1107 | 3300025304 | Ga0209257_1008688 | Ga0209257_10086885 | 271 |
| 1108 | 3300025304 | Ga0209257_1033156 | Ga0209257_10331562 | 271 |
| 1109 | 3300025907 | Ga0207645_10129898 | Ga0207645_101298982 | 271 |
| 1110 | 3300025912 | Ga0207707_10381333 | Ga0207707_103813332 | 271 |
| 1111 | 3300025917 | Ga0207660_10016618 | Ga0207660_100166182 | 271 |
| 1112 | 3300025919 | Ga0207657_10189412 | Ga0207657_101894122 | 271 |
| 1113 | 3300025921 | Ga0207652_10205860 | Ga0207652_102058603 | 271 |
| 1114 | 3300025921 | Ga0207652_10298565 | Ga0207652_102985652 | 271 |
| 1115 | 3300025923 | Ga0207681_10130434 | Ga0207681_101304341 | 271 |
| 1116 | 3300025926 | Ga0207659_10076698 | Ga0207659_100766983 | 271 |
| 1117 | 3300025931 | Ga0207644_10209932 | Ga0207644_102099322 | 271 |
| 1118 | 3300025934 | Ga0207686_10035794 | Ga0207686_100357943 | 271 |
| 1119 | 3300025936 | Ga0207670_10149307 | Ga0207670_101493072 | 271 |
| 1120 | 3300025937 | Ga0207669_10525931 | Ga0207669_105259311 | 271 |
| 1121 | 3300025939 | Ga0207665_10034498 | Ga0207665_100344984 | 271 |
| 1122 | 3300025939 | Ga0207665_10441157 | Ga0207665_104411571 | 271 |
| 1123 | 3300025941 | Ga0207711_10088037 | Ga0207711_100880373 | 271 |
| 1124 | 3300025986 | Ga0207658_10406356 | Ga0207658_104063561 | 271 |
| 1125 | 3300026095 | Ga0207676_10603834 | Ga0207676_106038341 | 271 |
| 1126 | 3300026118 | Ga0207675_100307900 | Ga0207675_1003079002 | 271 |
| 1127 | 3300026121 | Ga0207683_10287967 | Ga0207683_102879672 | 271 |
| 1128 | 3300027111 | Ga0209281_1000268 | Ga0209281_10002686 | 271 |
| 1129 | 3300027111 | Ga0209281_1000310 | Ga0209281_100031084 | 271 |
| 1130 | 3300027111 | Ga0209281_1001674 | Ga0209281_10016747 | 271 |
| 1131 | 3300027312 | Ga0209371_1000021 | Ga0209371_100002161 | 271 |
| 1132 | 3300027312 | Ga0209371_1000698 | Ga0209371_100069823 | 271 |
| 1133 | 3300027666 | Ga0209282_1000026 | Ga0209282_1000026181 | 271 |
| 1134 | 3300027666 | Ga0209282_1000300 | Ga0209282_100030010 | 271 |
| 1135 | 3300027666 | Ga0209282_1045429 | Ga0209282_10454293 | 271 |
| 1136 | 3300027866 | Ga0209813_10008474 | Ga0209813_100084742 | 271 |
| 1137 | 3300027866 | Ga0209813_10012073 | Ga0209813_100120733 | 271 |
| 1138 | 3300028379 | Ga0268266_10021269 | Ga0268266_100212691 | 271 |
| 1139 | 3300028381 | Ga0268264_10102557 | Ga0268264_101025573 | 271 |
| 1140 | 3300028794 | Ga0307515_10000274 | Ga0307515_1000027426 | 271 |
| 1141 | 3300028794 | Ga0307515_10040282 | Ga0307515_100402827 | 271 |
| 1142 | 3300028794 | Ga0307515_10067674 | Ga0307515_100676745 | 271 |
| 1143 | 3300030500 | Ga0268256_1000020 | Ga0268256_100002067 | 271 |
| 1144 | 3300030500 | Ga0268256_1005121 | Ga0268256_10051215 | 271 |
| 1145 | 3300031235 | Ga0265330_10028620 | Ga0265330_100286202 | 271 |
| 1146 | 3300031235 | Ga0265330_10122354 | Ga0265330_101223541 | 271 |
| 1147 | 3300031241 | Ga0265325_10000230 | Ga0265325_1000023035 | 271 |
| 1148 | 3300031241 | Ga0265325_10031272 | Ga0265325_100312724 | 271 |
| 1149 | 3300031247 | Ga0265340_10021000 | Ga0265340_100210003 | 271 |
| 1150 | 3300031249 | Ga0265339_10008490 | Ga0265339_100084905 | 271 |
| 1151 | 3300031250 | Ga0265331_10039368 | Ga0265331_100393683 | 271 |
| 1152 | 3300031344 | Ga0265316_10114860 | Ga0265316_101148603 | 271 |
| 1153 | 3300031344 | Ga0265316_10130520 | Ga0265316_101305202 | 271 |
| 1154 | 3300031456 | Ga0307513_10040399 | Ga0307513_100403993 | 271 |
| 1155 | 3300031548 | Ga0307408_100037549 | Ga0307408_1000375495 | 271 |
| 1156 | 3300031712 | Ga0265342_10271621 | Ga0265342_102716211 | 271 |
| 1157 | 3300031911 | Ga0307412_10024199 | Ga0307412_100241993 | 271 |
| 1158 | 3300031911 | Ga0307412_10298148 | Ga0307412_102981481 | 271 |
| 1159 | 3300031967 | Ga0315914_1000008 | Ga0315914_100000892 | 271 |
| 1160 | 3300032002 | Ga0307416_100551217 | Ga0307416_1005512171 | 271 |
| 1161 | 3300032004 | Ga0307414_10189521 | Ga0307414_101895212 | 271 |
| 1162 | 3300033430 | Ga0315913_1000093 | Ga0315913_10000939 | 271 |
| 1163 | 3300033464 | Ga0315915_1000014 | Ga0315915_100001484 | 271 |
| 1164 | 3300035089 | Ga0373944_0049692 | Ga0373944_0049692_104_919 | 271 |
| 1165 | 3300035090 | Ga0373949_0062024 | Ga0373949_0062024_87_908 | 271 |
| 1166 | 3300035111 | Ga0373923_0146548 | Ga0373923_0146548_133_948 | 271 |
| 1167 | 3300035114 | Ga0373939_0010074 | Ga0373939_0010074_48_869 | 271 |
| 1168 | 3300035241 | Ga0373961_0011252 | Ga0373961_0011252_277_1092 | 271 |
| 1169 | 3300035691 | Ga0373931_0015638 | Ga0373931_0015638_1958_2779 | 271 |
| 1170 | 3300035691 | Ga0373931_0046184 | Ga0373931_0046184_986_1801 | 271 |
| 1171 | 3300036401 | Ga0373937_0068299 | Ga0373937_0068299_494_1309 | 271 |
| 1172 | 3300036401 | Ga0373937_0744621 | Ga0373937_0744621_37_852 | 271 |
| 1173 | 3300037068 | Ga0373925_0115236 | Ga0373925_0115236_632_1447 | 271 |
| 1174 | 3300037068 | Ga0373925_0210883 | Ga0373925_0210883_105_929 | 271 |
| 1175 | 3300037466 | Ga0395898_0079433 | Ga0395898_0079433_2044_2889 | 271 |
| 1176 | 3300037853 | Ga0436364_1053682 | Ga0436364_1053682_1049_1879 | 271 |
| 1177 | 3300038443 | Ga0395901_0276015 | Ga0395901_0276015_637_1482 | 271 |
| 1178 | 3300039438 | Ga0436360_1030738 | Ga0436360_1030738_267_1097 | 271 |
| 1179 | 3300039447 | Ga0436361_0447916 | Ga0436361_0447916_899_1729 | 271 |
| 1180 | 3300039447 | Ga0436361_0583883 | Ga0436361_0583883_325_1155 | 271 |
| 1181 | 3300039453 | Ga0436362_0772071 | Ga0436362_0772071_30_860 | 271 |
| 1182 | 3300041404 | Ga0439436_0008690 | Ga0439436_0008690_360_1187 | 271 |
| 1183 | 3300041406 | Ga0439439_0005910 | Ga0439439_0005910_1844_2671 | 271 |
| 1184 | 3300041407 | Ga0439447_027226 | Ga0439447_027226_229_1056 | 271 |
| 1185 | 3300041413 | Ga0439465_0001450 | Ga0439465_0001450_6823_7656 | 271 |
| 1186 | 3300041413 | Ga0439465_0004393 | Ga0439465_0004393_1107_1934 | 271 |
| 1187 | 3300041413 | Ga0439465_0027863 | Ga0439465_0027863_723_1556 | 271 |
| 1188 | 3300041491 | Ga0451833_0223154 | Ga0451833_0223154_903_1841 | 271 |
| 1189 | 3300041494 | Ga0451837_0499150 | Ga0451837_0499150_92_925 | 271 |
| 1190 | 3300041494 | Ga0451837_1523969 | Ga0451837_1523969_194_1027 | 271 |
| 1191 | 3300041501 | Ga0451845_0654372 | Ga0451845_0654372_74_907 | 271 |
| 1192 | 3300041502 | Ga0451846_70228 | Ga0451846_70228_440_1378 | 271 |
| 1193 | 3300041503 | Ga0451847_0083388 | Ga0451847_0083388_1013_1951 | 271 |
| 1194 | 3300041506 | Ga0451850_35806 | Ga0451850_35806_32_865 | 271 |
| 1195 | 3300041507 | Ga0451851_0987432 | Ga0451851_0987432_342_1280 | 271 |
| 1196 | 3300041509 | Ga0451843_0065450 | Ga0451843_0065450_2254_3192 | 271 |
| 1197 | 3300041510 | Ga0451854_37387 | Ga0451854_37387_448_1281 | 271 |
| 1198 | 3300041511 | Ga0451855_1098170 | Ga0451855_1098170_1095_2033 | 271 |
| 1199 | 3300041512 | Ga0451853_2558696 | Ga0451853_2558696_520_1458 | 271 |
| 1200 | 3300041907 | Ga0452268_15340 | Ga0452268_15340_1247_2080 | 271 |
| 1201 | 3300042007 | Ga0439449_0000949 | Ga0439449_0000949_2824_3651 | 271 |
| 1202 | 3300042007 | Ga0439449_0008506 | Ga0439449_0008506_1356_2183 | 271 |
| 1203 | 3300042015 | Ga0439462_0032319 | Ga0439462_0032319_384_1211 | 271 |
| 1204 | 3300042145 | Ga0450906_006925 | Ga0450906_006925_1254_2081 | 271 |
| 1205 | 3300042436 | Ga0439435_0026765 | Ga0439435_0026765_284_1099 | 271 |
| 1206 | 3300044658 | Ga0466972_0109823 | Ga0466972_0109823_20_868 | 271 |
| 1207 | 3300044719 | Ga0466971_0059506 | Ga0466971_0059506_577_1407 | 271 |
| 1208 | 3300044765 | Ga0466970_0187936 | Ga0466970_0187936_123_947 | 271 |
| 1209 | 3300046460 | Ga0495638_0001347 | Ga0495638_0001347_2241_3074 | 271 |
| 1210 | 3300046474 | Ga0495605_0003366 | Ga0495605_0003366_6445_7278 | 271 |
| 1211 | 3300046474 | Ga0495605_0055337 | Ga0495605_0055337_100_933 | 271 |
| 1212 | 3300046477 | Ga0495664_0265202 | Ga0495664_0265202_153_968 | 271 |
| 1213 | 3300046492 | Ga0495585_0008712 | Ga0495585_0008712_1555_2388 | 271 |
| 1214 | 3300046492 | Ga0495585_0017056 | Ga0495585_0017056_1222_2055 | 271 |
| 1215 | 3300046501 | Ga0495607_0019982 | Ga0495607_0019982_211_1149 | 271 |
| 1216 | 3300046506 | Ga0495583_0002986 | Ga0495583_0002986_2245_3078 | 271 |
| 1217 | 3300046506 | Ga0495583_0036678 | Ga0495583_0036678_1294_2127 | 271 |
| 1218 | 3300046507 | Ga0495606_0000519 | Ga0495606_0000519_59790_60638 | 271 |
| 1219 | 3300046507 | Ga0495606_0010164 | Ga0495606_0010164_2481_3419 | 271 |
| 1220 | 3300046507 | Ga0495606_0210997 | Ga0495606_0210997_97_930 | 271 |
| 1221 | 3300046512 | Ga0495610_0007132 | Ga0495610_0007132_2137_3000 | 271 |
| 1222 | 3300046512 | Ga0495610_0052713 | Ga0495610_0052713_122_1060 | 271 |
| 1223 | 3300046512 | Ga0495610_0158020 | Ga0495610_0158020_50_883 | 271 |
| 1224 | 3300046515 | Ga0495620_0009503 | Ga0495620_0009503_1964_2902 | 271 |
| 1225 | 3300046515 | Ga0495620_0038067 | Ga0495620_0038067_235_1098 | 271 |
| 1226 | 3300046518 | Ga0495631_0002151 | Ga0495631_0002151_8415_9248 | 271 |
| 1227 | 3300046522 | Ga0495643_0016698 | Ga0495643_0016698_1350_2183 | 271 |
| 1228 | 3300046522 | Ga0495643_0038505 | Ga0495643_0038505_1750_2583 | 271 |
| 1229 | 3300046524 | Ga0495648_0131491 | Ga0495648_0131491_348_1181 | 271 |
| 1230 | 3300046524 | Ga0495648_0188306 | Ga0495648_0188306_86_919 | 271 |
| 1231 | 3300046530 | Ga0495654_0128846 | Ga0495654_0128846_32_865 | 271 |
| 1232 | 3300046533 | Ga0495640_0072546 | Ga0495640_0072546_716_1531 | 271 |
| 1233 | 3300046538 | Ga0495609_0046643 | Ga0495609_0046643_742_1575 | 271 |
| 1234 | 3300046538 | Ga0495609_0120709 | Ga0495609_0120709_152_1090 | 271 |
| 1235 | 3300046542 | Ga0495597_0003588 | Ga0495597_0003588_880_1818 | 271 |
| 1236 | 3300046558 | Ga0495633_0022000 | Ga0495633_0022000_1593_2426 | 271 |
| 1237 | 3300046558 | Ga0495633_0074244 | Ga0495633_0074244_475_1308 | 271 |
| 1238 | 3300046558 | Ga0495633_0127155 | Ga0495633_0127155_130_954 | 271 |
| 1239 | 3300046615 | Ga0495656_0012678 | Ga0495656_0012678_891_1724 | 271 |
| 1240 | 3300046615 | Ga0495656_0095466 | Ga0495656_0095466_19_834 | 271 |
| 1241 | 3300046616 | Ga0495668_0009435 | Ga0495668_0009435_1998_2831 | 271 |
| 1242 | 3300046616 | Ga0495668_0177477 | Ga0495668_0177477_96_935 | 271 |
| 1243 | 3300046648 | Ga0495611_0028203 | Ga0495611_0028203_112_945 | 271 |
| 1244 | 3300046660 | Ga0495625_0001123 | Ga0495625_0001123_31574_32407 | 271 |
| 1245 | 3300046674 | Ga0495588_0003191 | Ga0495588_0003191_5456_6280 | 271 |
| 1246 | 3300046674 | Ga0495588_0048326 | Ga0495588_0048326_1087_1920 | 271 |
| 1247 | 3300046674 | Ga0495588_0173762 | Ga0495588_0173762_46_870 | 271 |
| 1248 | 3300046691 | Ga0495670_0056140 | Ga0495670_0056140_939_1772 | 271 |
| 1249 | 3300047319 | Ga0495674_0156336 | Ga0495674_0156336_24_839 | 271 |
| 1250 | 3300047444 | Ga0495675_0174034 | Ga0495675_0174034_335_1150 | 271 |
| 1251 | 3300047446 | Ga0495679_062000 | Ga0495679_062000_227_1060 | 271 |
| 1252 | 3300047470 | Ga0495681_0006372 | Ga0495681_0006372_1352_2176 | 271 |
| 1253 | 3300047472 | Ga0495686_0004635 | Ga0495686_0004635_1580_2428 | 271 |
| 1254 | 3300047472 | Ga0495686_0025709 | Ga0495686_0025709_948_1886 | 271 |
| 1255 | 3300047472 | Ga0495686_0032707 | Ga0495686_0032707_360_1223 | 271 |
| 1256 | 3300048088 | Ga0495602_0119203 | Ga0495602_0119203_267_1082 | 271 |
| 1257 | 3300048904 | Ga0496101_0171593 | Ga0496101_0171593_698_1588 | 271 |
| 1258 | 3300048905 | Ga0496102_0103547 | Ga0496102_0103547_537_1352 | 271 |
| 1259 | 3300048905 | Ga0496102_0205453 | Ga0496102_0205453_962_1783 | 271 |
| 1260 | 3300048905 | Ga0496102_0247947 | Ga0496102_0247947_233_1081 | 271 |
| 1261 | 3300048907 | Ga0496104_0221311 | Ga0496104_0221311_63_890 | 271 |
| 1262 | 3300048907 | Ga0496104_0257990 | Ga0496104_0257990_558_1448 | 271 |
| 1263 | 3300048908 | Ga0496105_0127865 | Ga0496105_0127865_1129_1944 | 271 |
| 1264 | 3300048908 | Ga0496105_0195128 | Ga0496105_0195128_456_1346 | 271 |
| 1265 | 3300048909 | Ga0496106_0004905 | Ga0496106_0004905_7645_8478 | 271 |
| 1266 | 3300048909 | Ga0496106_0221426 | Ga0496106_0221426_76_891 | 271 |
| 1267 | 3300048910 | Ga0496107_0067169 | Ga0496107_0067169_1566_2381 | 271 |
| 1268 | 3300048911 | Ga0496108_0115557 | Ga0496108_0115557_38_853 | 271 |
| 1269 | 3300048911 | Ga0496108_0201138 | Ga0496108_0201138_99_929 | 271 |
| 1270 | 3300048912 | Ga0496109_0094753 | Ga0496109_0094753_1060_1875 | 271 |
| 1271 | 3300048913 | Ga0496110_0054506 | Ga0496110_0054506_1885_2700 | 271 |
| 1272 | 3300048913 | Ga0496110_0502226 | Ga0496110_0502226_75_890 | 271 |
| 1273 | 3300048914 | Ga0496111_0031739 | Ga0496111_0031739_1171_1995 | 271 |
| 1274 | 3300048914 | Ga0496111_0154797 | Ga0496111_0154797_637_1452 | 271 |
| 1275 | 3300048915 | Ga0496112_0056278 | Ga0496112_0056278_692_1507 | 271 |
| 1276 | 3300048915 | Ga0496112_0090590 | Ga0496112_0090590_2067_2882 | 271 |
| 1277 | 3300048915 | Ga0496112_0273024 | Ga0496112_0273024_36_851 | 271 |
| 1278 | 3300048916 | Ga0496113_0016231 | Ga0496113_0016231_608_1432 | 271 |
| 1279 | 3300048916 | Ga0496113_0374952 | Ga0496113_0374952_241_1056 | 271 |
| 1280 | 3300048917 | Ga0496114_0186865 | Ga0496114_0186865_741_1631 | 271 |
| 1281 | 3300048917 | Ga0496114_0197612 | Ga0496114_0197612_825_1640 | 271 |
| 1282 | 3300048917 | Ga0496114_0270501 | Ga0496114_0270501_198_1031 | 271 |
| 1283 | 3300048918 | Ga0496115_0014721 | Ga0496115_0014721_853_1668 | 271 |
| 1284 | 3300048918 | Ga0496115_0037604 | Ga0496115_0037604_2400_3215 | 271 |
| 1285 | 3300048918 | Ga0496115_0047177 | Ga0496115_0047177_1599_2420 | 271 |
| 1286 | 3300048918 | Ga0496115_0075559 | Ga0496115_0075559_1651_2541 | 271 |
| 1287 | 3300048919 | Ga0496116_0000043 | Ga0496116_0000043_84216_85040 | 271 |
| 1288 | 3300048920 | Ga0496117_0000002 | Ga0496117_0000002_1033638_1034462 | 271 |
| 1289 | 3300048920 | Ga0496117_0034760 | Ga0496117_0034760_1952_2785 | 271 |
| 1290 | 3300048921 | Ga0496118_0000355 | Ga0496118_0000355_47779_48603 | 271 |
| 1291 | 3300048921 | Ga0496118_0016639 | Ga0496118_0016639_1495_2433 | 271 |
| 1292 | 3300048921 | Ga0496118_0030122 | Ga0496118_0030122_2075_2908 | 271 |
| 1293 | 3300048921 | Ga0496118_0083290 | Ga0496118_0083290_1344_2168 | 271 |
| 1294 | 3300048921 | Ga0496118_0291683 | Ga0496118_0291683_17_841 | 271 |
| 1295 | 3300048922 | Ga0496119_0022816 | Ga0496119_0022816_3496_4320 | 271 |
| 1296 | 3300048922 | Ga0496119_0023480 | Ga0496119_0023480_1039_1887 | 271 |
| 1297 | 3300048922 | Ga0496119_0152504 | Ga0496119_0152504_227_1060 | 271 |
| 1298 | 3300048923 | Ga0496120_0001026 | Ga0496120_0001026_13098_13922 | 271 |
| 1299 | 3300048924 | Ga0496121_0022576 | Ga0496121_0022576_721_1584 | 271 |
| 1300 | 3300048924 | Ga0496121_0037196 | Ga0496121_0037196_736_1569 | 271 |
| 1301 | 3300048924 | Ga0496121_0039941 | Ga0496121_0039941_1642_2490 | 271 |
| 1302 | 3300048924 | Ga0496121_0128354 | Ga0496121_0128354_1049_1882 | 271 |
| 1303 | 3300048924 | Ga0496121_0180096 | Ga0496121_0180096_641_1474 | 271 |
| 1304 | 3300048925 | Ga0496122_0000001 | Ga0496122_0000001_340092_340916 | 271 |
| 1305 | 3300048925 | Ga0496122_0000025 | Ga0496122_0000025_350799_351623 | 271 |
| 1306 | 3300048925 | Ga0496122_0020485 | Ga0496122_0020485_3194_4018 | 271 |
| 1307 | 3300048925 | Ga0496122_0027134 | Ga0496122_0027134_2683_3516 | 271 |
| 1308 | 3300048925 | Ga0496122_0072488 | Ga0496122_0072488_1361_2185 | 271 |
| 1309 | 3300048926 | Ga0496123_0000001 | Ga0496123_0000001_343823_344647 | 271 |
| 1310 | 3300048926 | Ga0496123_0000032 | Ga0496123_0000032_12590_13414 | 271 |
| 1311 | 3300048926 | Ga0496123_0013675 | Ga0496123_0013675_4474_5307 | 271 |
| 1312 | 3300048926 | Ga0496123_0139205 | Ga0496123_0139205_148_972 | 271 |
| 1313 | 3300048927 | Ga0496124_0000112 | Ga0496124_0000112_14358_15182 | 271 |
| 1314 | 3300048927 | Ga0496124_0019709 | Ga0496124_0019709_2587_3411 | 271 |
| 1315 | 3300048927 | Ga0496124_0023074 | Ga0496124_0023074_1653_2477 | 271 |
| 1316 | 3300048927 | Ga0496124_0046692 | Ga0496124_0046692_1960_2793 | 271 |
| 1317 | 3300048927 | Ga0496124_0055085 | Ga0496124_0055085_2197_3060 | 271 |
| 1318 | 3300048927 | Ga0496124_0128101 | Ga0496124_0128101_512_1345 | 271 |
| 1319 | 3300048927 | Ga0496124_0145251 | Ga0496124_0145251_273_1106 | 271 |
| 1320 | 3300048928 | Ga0496125_0010044 | Ga0496125_0010044_1497_2330 | 271 |
| 1321 | 3300048929 | Ga0496126_0000369 | Ga0496126_0000369_42229_43053 | 271 |
| 1322 | 3300049459 | Ga0495678_008204 | Ga0495678_008204_2151_2984 | 271 |
| 1323 | 3300049568 | Ga0501031_0095847 | Ga0501031_0095847_1072_1908 | 271 |
| 1324 | 3300049568 | Ga0501031_0110215 | Ga0501031_0110215_541_1374 | 271 |
| 1325 | 3300049569 | Ga0501032_0038066 | Ga0501032_0038066_549_1382 | 271 |
| 1326 | 3300049569 | Ga0501032_0079969 | Ga0501032_0079969_984_1799 | 271 |
| 1327 | 3300049570 | Ga0501033_0074314 | Ga0501033_0074314_535_1350 | 271 |
| 1328 | 3300049570 | Ga0501033_0385188 | Ga0501033_0385188_46_879 | 271 |
| 1329 | 3300049571 | Ga0501034_0033130 | Ga0501034_0033130_3099_3938 | 271 |
| 1330 | 3300049571 | Ga0501034_0578866 | Ga0501034_0578866_30_863 | 271 |
| 1331 | 3300049572 | Ga0501036_0026291 | Ga0501036_0026291_984_1799 | 271 |
| 1332 | 3300049572 | Ga0501036_0073064 | Ga0501036_0073064_1338_2171 | 271 |
| 1333 | 3300049572 | Ga0501036_0282371 | Ga0501036_0282371_209_1042 | 271 |
| 1334 | 3300049573 | Ga0501037_0011514 | Ga0501037_0011514_407_1222 | 271 |
| 1335 | 3300049573 | Ga0501037_0017813 | Ga0501037_0017813_834_1667 | 271 |
| 1336 | 3300049573 | Ga0501037_0071527 | Ga0501037_0071527_1349_2182 | 271 |
| 1337 | 3300049574 | Ga0501038_0031324 | Ga0501038_0031324_3729_4544 | 271 |
| 1338 | 3300049574 | Ga0501038_0075778 | Ga0501038_0075778_344_1177 | 271 |
| 1339 | 3300049574 | Ga0501038_0287591 | Ga0501038_0287591_216_1049 | 271 |
| 1340 | 3300049575 | Ga0501039_0036175 | Ga0501039_0036175_2222_3037 | 271 |
| 1341 | 3300049577 | Ga0501041_0279550 | Ga0501041_0279550_174_1010 | 271 |
| 1342 | 3300049579 | Ga0501043_0034750 | Ga0501043_0034750_1622_2437 | 271 |
| 1343 | 3300049579 | Ga0501043_0220985 | Ga0501043_0220985_128_961 | 271 |
| 1344 | 3300049580 | Ga0501046_0003405 | Ga0501046_0003405_5290_6105 | 271 |
| 1345 | 3300049581 | Ga0501047_0068784 | Ga0501047_0068784_2297_3130 | 271 |
| 1346 | 3300049582 | Ga0501048_0001758 | Ga0501048_0001758_5882_6697 | 271 |
| 1347 | 3300049583 | Ga0501067_0002567 | Ga0501067_0002567_3275_4090 | 271 |
| 1348 | 3300049584 | Ga0501068_0014151 | Ga0501068_0014151_3224_4039 | 271 |
| 1349 | 3300049584 | Ga0501068_0035476 | Ga0501068_0035476_1484_2317 | 271 |
| 1350 | 3300049584 | Ga0501068_0278424 | Ga0501068_0278424_85_900 | 271 |
| 1351 | 3300049585 | Ga0501069_0003872 | Ga0501069_0003872_397_1212 | 271 |
| 1352 | 3300049585 | Ga0501069_0180713 | Ga0501069_0180713_367_1206 | 271 |
| 1353 | 3300049586 | Ga0501070_0007225 | Ga0501070_0007225_3198_4013 | 271 |
| 1354 | 3300049587 | Ga0501071_0141871 | Ga0501071_0141871_578_1393 | 271 |
| 1355 | 3300049588 | Ga0501072_0055644 | Ga0501072_0055644_653_1483 | 271 |
| 1356 | 3300049588 | Ga0501072_0095850 | Ga0501072_0095850_1522_2337 | 271 |
| 1357 | 3300049589 | Ga0501073_0009199 | Ga0501073_0009199_6119_6934 | 271 |
| 1358 | 3300049589 | Ga0501073_0030347 | Ga0501073_0030347_1516_2349 | 271 |
| 1359 | 3300049589 | Ga0501073_0061579 | Ga0501073_0061579_1121_1951 | 271 |
| 1360 | 3300049590 | Ga0501074_0154458 | Ga0501074_0154458_525_1355 | 271 |
| 1361 | 3300049592 | Ga0501076_0095437 | Ga0501076_0095437_1162_1977 | 271 |
| 1362 | 3300049741 | Ga0501079_0216653 | Ga0501079_0216653_314_1129 | 271 |
| 1363 | 3300049741 | Ga0501079_0516014 | Ga0501079_0516014_51_887 | 271 |
| 1364 | 3300049742 | Ga0501080_0072959 | Ga0501080_0072959_1195_2028 | 271 |
| 1365 | 3300049742 | Ga0501080_0083608 | Ga0501080_0083608_1234_2049 | 271 |
| 1366 | 3300049742 | Ga0501080_0122374 | Ga0501080_0122374_1312_2142 | 271 |
| 1367 | 3300049742 | Ga0501080_0149652 | Ga0501080_0149652_363_1202 | 271 |
| 1368 | 3300049742 | Ga0501080_0377481 | Ga0501080_0377481_121_936 | 271 |
| 1369 | 3300049743 | Ga0501081_0027275 | Ga0501081_0027275_329_1165 | 271 |
| 1370 | 3300049744 | Ga0501083_0035347 | Ga0501083_0035347_100_915 | 271 |
| 1371 | 3300049744 | Ga0501083_0043017 | Ga0501083_0043017_1169_2002 | 271 |
| 1372 | 3300049744 | Ga0501083_0055575 | Ga0501083_0055575_163_996 | 271 |
| 1373 | 3300049744 | Ga0501083_0079080 | Ga0501083_0079080_491_1306 | 271 |
| 1374 | 3300049822 | Ga0501035_0089644 | Ga0501035_0089644_366_1181 | 271 |
| 1375 | 3300049823 | Ga0501044_0002904 | Ga0501044_0002904_12836_13669 | 271 |
| 1376 | 3300049823 | Ga0501044_0179096 | Ga0501044_0179096_953_1786 | 271 |
| 1377 | 3300049823 | Ga0501044_0352644 | Ga0501044_0352644_419_1234 | 271 |
| 1378 | 3300049823 | Ga0501044_0556774 | Ga0501044_0556774_208_1023 | 271 |
| 1379 | 3300049824 | Ga0501045_0019735 | Ga0501045_0019735_3381_4196 | 271 |
| 1380 | 3300050489 | nmdc:mga03683_1313_c1 | nmdc:mga03683_1313_c1_167_1000 | 271 |
| 1381 | 3300050491 | nmdc:mga00v17_287268_c1 | nmdc:mga00v17_287268_c1_184_1008 | 271 |
| 1382 | 3300050491 | nmdc:mga00v17_6_c1 | nmdc:mga00v17_6_c1_114787_115611 | 271 |
| 1383 | 3300050492 | nmdc:mga0yw44_208030_c1 | nmdc:mga0yw44_208030_c1_166_1104 | 271 |
| 1384 | 3300050492 | nmdc:mga0yw44_382836_c1 | nmdc:mga0yw44_382836_c1_42_899 | 271 |
| 1385 | 3300050492 | nmdc:mga0yw44_9825_c1 | nmdc:mga0yw44_9825_c1_2167_2991 | 271 |
| 1386 | 3300050493 | nmdc:mga0k408_13060_c1 | nmdc:mga0k408_13060_c1_1969_2802 | 271 |
| 1387 | 3300050493 | nmdc:mga0k408_38530_c2 | nmdc:mga0k408_38530_c2_493_1308 | 271 |
| 1388 | 3300050494 | nmdc:mga06z11_158174_c1 | nmdc:mga06z11_158174_c1_44_859 | 271 |
| 1389 | 3300050494 | nmdc:mga06z11_17428_c1 | nmdc:mga06z11_17428_c1_324_1148 | 271 |
| 1390 | 3300050494 | nmdc:mga06z11_78913_c1 | nmdc:mga06z11_78913_c1_869_1702 | 271 |
| 1391 | 3300050495 | nmdc:mga04h51_26632_c1 | nmdc:mga04h51_26632_c1_398_1222 | 271 |
| 1392 | 3300050496 | nmdc:mga07m45_256283_c1 | nmdc:mga07m45_256283_c1_134_958 | 271 |
| 1393 | 3300050511 | nmdc:mga08y16_445280_c1 | nmdc:mga08y16_445280_c1_347_1162 | 271 |
| 1394 | 3300050513 | nmdc:mga0rr50_13993_c1 | nmdc:mga0rr50_13993_c1_1195_2034 | 271 |
| 1395 | 3300050514 | nmdc:mga08x19_23_c1 | nmdc:mga08x19_23_c1_180669_181508 | 271 |
| 1396 | 3300050516 | nmdc:mga0sz30_1690_c1 | nmdc:mga0sz30_1690_c1_2003_2827 | 271 |
| 1397 | 3300050516 | nmdc:mga0sz30_17676_c1 | nmdc:mga0sz30_17676_c1_1839_2672 | 271 |
| 1398 | 3300050516 | nmdc:mga0sz30_21874_c1 | nmdc:mga0sz30_21874_c1_1620_2444 | 271 |
| 1399 | 3300053077 | Ga0495601_0022891 | Ga0495601_0022891_2484_3374 | 271 |
| 1400 | 3300053077 | Ga0495601_0075700 | Ga0495601_0075700_723_1538 | 271 |
| 1401 | 3300053078 | Ga0495612_0161214 | Ga0495612_0161214_61_951 | 271 |
| 1402 | 3300053078 | Ga0495612_0189253 | Ga0495612_0189253_15_830 | 271 |
| 1403 | 3300053084 | Ga0495595_0161242 | Ga0495595_0161242_113_928 | 271 |
| 1404 | 3300053085 | Ga0495619_0041815 | Ga0495619_0041815_60_875 | 271 |
| 1405 | 3300053085 | Ga0495619_0114935 | Ga0495619_0114935_586_1476 | 271 |
| 1406 | 3300053085 | Ga0495619_0291563 | Ga0495619_0291563_127_1044 | 271 |
| 1407 | 3300053099 | Ga0500654_085932 | Ga0500654_085932_208_1035 | 271 |
| 1408 | 3300053107 | Ga0500560_015739 | Ga0500560_015739_291_1115 | 271 |
| 1409 | 3300053108 | Ga0500562_025006 | Ga0500562_025006_61_894 | 271 |
| 1410 | 3300053118 | Ga0500594_0009623 | Ga0500594_0009623_917_1750 | 271 |
| 1411 | 3300053125 | Ga0500618_000192 | Ga0500618_000192_2424_3248 | 271 |
| 1412 | 3300053125 | Ga0500618_009031 | Ga0500618_009031_955_1779 | 271 |
| 1413 | 3300053137 | Ga0500561_0008364 | Ga0500561_0008364_80_904 | 271 |
| 1414 | 3300053139 | Ga0500568_0000506 | Ga0500568_0000506_2193_3026 | 271 |
| 1415 | 3300053139 | Ga0500568_0017135 | Ga0500568_0017135_1135_1968 | 271 |
| 1416 | 3300053151 | Ga0500604_0006742 | Ga0500604_0006742_1088_1921 | 271 |
| 1417 | 3300053151 | Ga0500604_0023089 | Ga0500604_0023089_484_1311 | 271 |
| 1418 | 3300053153 | Ga0500616_0001481 | Ga0500616_0001481_2254_3087 | 271 |
| 1419 | 3300053153 | Ga0500616_0023325 | Ga0500616_0023325_1761_2699 | 271 |
| 1420 | 3300053156 | Ga0500622_0001030 | Ga0500622_0001030_20894_21727 | 271 |
| 1421 | 3300053156 | Ga0500622_0067344 | Ga0500622_0067344_366_1199 | 271 |
| 1422 | 3300053158 | Ga0500627_0024215 | Ga0500627_0024215_702_1535 | 271 |
| 1423 | 3300053160 | Ga0500633_0006714 | Ga0500633_0006714_85_918 | 271 |
| 1424 | 3300053177 | Ga0500636_0000019 | Ga0500636_0000019_44278_45102 | 271 |
| 1425 | 3300053727 | Ga0500611_006236 | Ga0500611_006236_846_1685 | 271 |
| 1426 | 3300054114 | Ga0501084_0010849 | Ga0501084_0010849_6177_6992 | 271 |
| 1427 | 3300054114 | Ga0501084_0265941 | Ga0501084_0265941_130_966 | 271 |
| 1428 | 3300059490 | Ga0587066_010363 | Ga0587066_010363_135_998 | 271 |
| 1429 | 3300059491 | Ga0587070_016503 | Ga0587070_016503_13_876 | 271 |
| 1430 | 3300059504 | Ga0587082_022111 | Ga0587082_022111_115_939 | 271 |
| 1431 | 3300059508 | Ga0587088_016173 | Ga0587088_016173_342_1175 | 271 |
| 1432 | 3300059623 | Ga0587101_012922 | Ga0587101_012922_218_1081 | 271 |
| 1433 | 3300059630 | Ga0587128_015306 | Ga0587128_015306_172_996 | 271 |
| 1434 | 3300059643 | Ga0587072_015368 | Ga0587072_015368_234_1058 | 271 |
| 1435 | 3300060346 | Ga0587111_0018765 | Ga0587111_0018765_155_979 | 271 |
| 1436 | 3300060353 | Ga0501082_0043601 | Ga0501082_0043601_505_1320 | 271 |
| 1437 | 3300060353 | Ga0501082_0183376 | Ga0501082_0183376_162_995 | 271 |
| 1438 | 3300060353 | Ga0501082_0194035 | Ga0501082_0194035_867_1703 | 271 |
| 1439 | iso_pu_bacteria | 2643221547 | 2643755606 | 271 |
| 1440 | 3300001979 | JGI24740J21852_10000001 | JGI24740J21852_10000001103 | 272 |
| 1441 | 3300002704 | JGI25155J39150_1000011 | JGI25155J39150_100001176 | 272 |
| 1442 | 3300002705 | JGI25156J39149_1000027 | JGI25156J39149_100002776 | 272 |
| 1443 | 3300002737 | JGI25162J39368_1000923 | JGI25162J39368_10009234 | 272 |
| 1444 | 3300002737 | JGI25162J39368_1001104 | JGI25162J39368_10011044 | 272 |
| 1445 | 3300002737 | JGI25162J39368_1001271 | JGI25162J39368_100127117 | 272 |
| 1446 | 3300002738 | JGI25154J39366_1000057 | JGI25154J39366_10000573 | 272 |
| 1447 | 3300002738 | JGI25154J39366_1000368 | JGI25154J39366_10003684 | 272 |
| 1448 | 3300002741 | JGI25157J39369_1000010 | JGI25157J39369_1000010135 | 272 |
| 1449 | 3300002773 | JGI25152J39213_1001618 | JGI25152J39213_10016187 | 272 |
| 1450 | 3300002774 | JGI25150J39212_1000010 | JGI25150J39212_10000107 | 272 |
| 1451 | 3300002987 | JGI25159J45721_1000375 | JGI25159J45721_10003753 | 272 |
| 1452 | 3300003187 | JGI25151J46595_10000066 | JGI25151J46595_1000006670 | 272 |
| 1453 | 3300003187 | JGI25151J46595_10000963 | JGI25151J46595_1000096311 | 272 |
| 1454 | 3300003214 | JGI25165J46597_1001156 | JGI25165J46597_10011564 | 272 |
| 1455 | 3300003214 | JGI25165J46597_1001175 | JGI25165J46597_100117520 | 272 |
| 1456 | 3300003214 | JGI25165J46597_1002353 | JGI25165J46597_10023534 | 272 |
| 1457 | 3300003215 | JGI25153J46596_10001697 | JGI25153J46596_1000169711 | 272 |
| 1458 | 3300003320 | rootH2_10091763 | rootH2_100917633 | 272 |
| 1459 | 3300003354 | JGI25160J50197_1000004 | JGI25160J50197_1000004139 | 272 |
| 1460 | 3300003374 | JGI25161J50226_1000003 | JGI25161J50226_1000003289 | 272 |
| 1461 | 3300003771 | Ga0055526_1000955 | Ga0055526_100095516 | 272 |
| 1462 | 3300003775 | Ga0055524_1000035 | Ga0055524_1000035130 | 272 |
| 1463 | 3300004625 | Ga0055543_1000001 | Ga0055543_1000001295 | 272 |
| 1464 | 3300004625 | Ga0055543_1012257 | Ga0055543_10122572 | 272 |
| 1465 | 3300005262 | Ga0065165_1000049 | Ga0065165_1000049116 | 272 |
| 1466 | 3300005262 | Ga0065165_1000714 | Ga0065165_10007147 | 272 |
| 1467 | 3300005367 | Ga0070667_100074027 | Ga0070667_1000740272 | 272 |
| 1468 | 3300005548 | Ga0070665_100058162 | Ga0070665_1000581621 | 272 |
| 1469 | 3300005548 | Ga0070665_100363407 | Ga0070665_1003634072 | 272 |
| 1470 | 3300005563 | Ga0068855_100032994 | Ga0068855_1000329945 | 272 |
| 1471 | 3300005616 | Ga0068852_100029311 | Ga0068852_1000293114 | 272 |
| 1472 | 3300006048 | Ga0075363_100044970 | Ga0075363_1000449702 | 272 |
| 1473 | 3300006051 | Ga0075364_10145088 | Ga0075364_101450882 | 272 |
| 1474 | 3300006178 | Ga0075367_10047033 | Ga0075367_100470332 | 272 |
| 1475 | 3300006186 | Ga0075369_10012303 | Ga0075369_100123033 | 272 |
| 1476 | 3300006353 | Ga0075370_10029947 | Ga0075370_100299472 | 272 |
| 1477 | 3300009148 | Ga0105243_10275470 | Ga0105243_102754701 | 272 |
| 1478 | 3300015265 | Ga0182005_1008240 | Ga0182005_10082404 | 272 |
| 1479 | 3300021358 | Ga0213873_10007595 | Ga0213873_100075952 | 272 |
| 1480 | 3300021384 | Ga0213876_10065419 | Ga0213876_100654192 | 272 |
| 1481 | 3300021388 | Ga0213875_10007177 | Ga0213875_100071773 | 272 |
| 1482 | 3300021441 | Ga0213871_10011341 | Ga0213871_100113411 | 272 |
| 1483 | 3300025206 | Ga0209435_100022 | Ga0209435_100022135 | 272 |
| 1484 | 3300025233 | Ga0209437_100153 | Ga0209437_10015316 | 272 |
| 1485 | 3300025233 | Ga0209437_100577 | Ga0209437_10057721 | 272 |
| 1486 | 3300025245 | Ga0207425_1000010 | Ga0207425_1000010336 | 272 |
| 1487 | 3300025246 | Ga0209646_1000078 | Ga0209646_1000078135 | 272 |
| 1488 | 3300025250 | Ga0209026_1000065 | Ga0209026_1000065135 | 272 |
| 1489 | 3300025253 | Ga0209677_100355 | Ga0209677_1003557 | 272 |
| 1490 | 3300025254 | Ga0209148_1011825 | Ga0209148_10118252 | 272 |
| 1491 | 3300025256 | Ga0209759_1000055 | Ga0209759_1000055135 | 272 |
| 1492 | 3300025256 | Ga0209759_1010178 | Ga0209759_10101782 | 272 |
| 1493 | 3300025258 | Ga0209129_1000034 | Ga0209129_10000345 | 272 |
| 1494 | 3300025261 | Ga0209233_1000175 | Ga0209233_10001755 | 272 |
| 1495 | 3300025261 | Ga0209233_1000248 | Ga0209233_100024893 | 272 |
| 1496 | 3300025261 | Ga0209233_1000676 | Ga0209233_100067622 | 272 |
| 1497 | 3300025284 | Ga0209130_1000012 | Ga0209130_1000012139 | 272 |
| 1498 | 3300025284 | Ga0209130_1000111 | Ga0209130_1000111122 | 272 |
| 1499 | 3300025291 | Ga0209675_1000816 | Ga0209675_100081615 | 272 |
| 1500 | 3300025294 | Ga0209025_1000008 | Ga0209025_10000081042 | 272 |
| 1501 | 3300025294 | Ga0209025_1000022 | Ga0209025_1000022246 | 272 |
| 1502 | 3300025295 | Ga0209564_1000049 | Ga0209564_100004974 | 272 |
| 1503 | 3300025295 | Ga0209564_1000054 | Ga0209564_1000054178 | 272 |
| 1504 | 3300025297 | Ga0209758_1000086 | Ga0209758_100008612 | 272 |
| 1505 | 3300025299 | Ga0209256_1000014 | Ga0209256_1000014565 | 272 |
| 1506 | 3300025302 | Ga0207426_1000010 | Ga0207426_1000010498 | 272 |
| 1507 | 3300025302 | Ga0207426_1027328 | Ga0207426_10273282 | 272 |
| 1508 | 3300025901 | Ga0207688_10051209 | Ga0207688_100512093 | 272 |
| 1509 | 3300025913 | Ga0207695_10000011 | Ga0207695_10000011628 | 272 |
| 1510 | 3300025914 | Ga0207671_10000276 | Ga0207671_1000027674 | 272 |
| 1511 | 3300025935 | Ga0207709_10181873 | Ga0207709_101818731 | 272 |
| 1512 | 3300025961 | Ga0207712_10011143 | Ga0207712_100111437 | 272 |
| 1513 | 3300027312 | Ga0209371_1011725 | Ga0209371_10117253 | 272 |
| 1514 | 3300028794 | Ga0307515_10138433 | Ga0307515_101384332 | 272 |
| 1515 | 3300030500 | Ga0268256_1015115 | Ga0268256_10151153 | 272 |
| 1516 | 3300031247 | Ga0265340_10112303 | Ga0265340_101123032 | 272 |
| 1517 | 3300031250 | Ga0265331_10164281 | Ga0265331_101642811 | 272 |
| 1518 | 3300031344 | Ga0265316_10009784 | Ga0265316_100097842 | 272 |
| 1519 | 3300031344 | Ga0265316_10116095 | Ga0265316_101160952 | 272 |
| 1520 | 3300031901 | Ga0307406_10012890 | Ga0307406_100128904 | 272 |
| 1521 | 3300031901 | Ga0307406_10129869 | Ga0307406_101298692 | 272 |
| 1522 | 3300035410 | Ga0373924_0060228 | Ga0373924_0060228_24_848 | 272 |
| 1523 | 3300035692 | Ga0373935_0019413 | Ga0373935_0019413_841_1665 | 272 |
| 1524 | 3300035695 | Ga0373927_0160967 | Ga0373927_0160967_300_1124 | 272 |
| 1525 | 3300035725 | Ga0373947_0082367 | Ga0373947_0082367_37_861 | 272 |
| 1526 | 3300037853 | Ga0436364_0161603 | Ga0436364_0161603_897_1721 | 272 |
| 1527 | 3300037853 | Ga0436364_0773514 | Ga0436364_0773514_345_1211 | 272 |
| 1528 | 3300037853 | Ga0436364_0774545 | Ga0436364_0774545_370_1194 | 272 |
| 1529 | 3300038443 | Ga0395901_0181108 | Ga0395901_0181108_131_955 | 272 |
| 1530 | 3300039437 | Ga0436365_0219019 | Ga0436365_0219019_305_1171 | 272 |
| 1531 | 3300039437 | Ga0436365_0934594 | Ga0436365_0934594_405_1229 | 272 |
| 1532 | 3300039453 | Ga0436362_0292983 | Ga0436362_0292983_1926_2903 | 272 |
| 1533 | 3300044765 | Ga0466970_0014361 | Ga0466970_0014361_1887_2750 | 272 |
| 1534 | 3300046476 | Ga0495662_0016685 | Ga0495662_0016685_1006_1866 | 272 |
| 1535 | 3300046517 | Ga0495630_0196499 | Ga0495630_0196499_175_999 | 272 |
| 1536 | 3300046518 | Ga0495631_0090472 | Ga0495631_0090472_434_1279 | 272 |
| 1537 | 3300046522 | Ga0495643_0045214 | Ga0495643_0045214_249_1103 | 272 |
| 1538 | 3300046533 | Ga0495640_0021850 | Ga0495640_0021850_2966_3790 | 272 |
| 1539 | 3300046642 | Ga0495634_0059655 | Ga0495634_0059655_851_1675 | 272 |
| 1540 | 3300047319 | Ga0495674_0219464 | Ga0495674_0219464_307_1131 | 272 |
| 1541 | 3300047471 | Ga0495684_0256987 | Ga0495684_0256987_220_1044 | 272 |
| 1542 | 3300048907 | Ga0496104_0051175 | Ga0496104_0051175_794_1618 | 272 |
| 1543 | 3300048908 | Ga0496105_0027217 | Ga0496105_0027217_806_1630 | 272 |
| 1544 | 3300048911 | Ga0496108_0555650 | Ga0496108_0555650_98_922 | 272 |
| 1545 | 3300048913 | Ga0496110_0047098 | Ga0496110_0047098_852_1676 | 272 |
| 1546 | 3300048918 | Ga0496115_0082979 | Ga0496115_0082979_68_892 | 272 |
| 1547 | 3300048919 | Ga0496116_0010081 | Ga0496116_0010081_3495_4376 | 272 |
| 1548 | 3300048919 | Ga0496116_0068414 | Ga0496116_0068414_218_1144 | 272 |
| 1549 | 3300048921 | Ga0496118_0049811 | Ga0496118_0049811_1056_1904 | 272 |
| 1550 | 3300048922 | Ga0496119_0060646 | Ga0496119_0060646_483_1346 | 272 |
| 1551 | 3300048924 | Ga0496121_0064770 | Ga0496121_0064770_794_1657 | 272 |
| 1552 | 3300048924 | Ga0496121_0235180 | Ga0496121_0235180_42_923 | 272 |
| 1553 | 3300048925 | Ga0496122_0026337 | Ga0496122_0026337_2605_3453 | 272 |
| 1554 | 3300048925 | Ga0496122_0037582 | Ga0496122_0037582_1994_2857 | 272 |
| 1555 | 3300048925 | Ga0496122_0104427 | Ga0496122_0104427_436_1317 | 272 |
| 1556 | 3300048926 | Ga0496123_0010783 | Ga0496123_0010783_679_1527 | 272 |
| 1557 | 3300048926 | Ga0496123_0029237 | Ga0496123_0029237_1656_2537 | 272 |
| 1558 | 3300048926 | Ga0496123_0041064 | Ga0496123_0041064_1853_2701 | 272 |
| 1559 | 3300048926 | Ga0496123_0046657 | Ga0496123_0046657_1496_2359 | 272 |
| 1560 | 3300048927 | Ga0496124_0003528 | Ga0496124_0003528_7393_8241 | 272 |
| 1561 | 3300048927 | Ga0496124_0018233 | Ga0496124_0018233_3532_4413 | 272 |
| 1562 | 3300048927 | Ga0496124_0126394 | Ga0496124_0126394_990_1853 | 272 |
| 1563 | 3300048928 | Ga0496125_0029434 | Ga0496125_0029434_2271_3125 | 272 |
| 1564 | 3300048928 | Ga0496125_0054611 | Ga0496125_0054611_1326_2207 | 272 |
| 1565 | 3300049575 | Ga0501039_0366127 | Ga0501039_0366127_265_1083 | 272 |
| 1566 | 3300049587 | Ga0501071_0053053 | Ga0501071_0053053_223_1062 | 272 |
| 1567 | 3300049588 | Ga0501072_0226065 | Ga0501072_0226065_635_1480 | 272 |
| 1568 | 3300049592 | Ga0501076_0046862 | Ga0501076_0046862_1389_2234 | 272 |
| 1569 | 3300049593 | Ga0501077_0023941 | Ga0501077_0023941_1881_2726 | 272 |
| 1570 | 3300049741 | Ga0501079_0052582 | Ga0501079_0052582_1254_2099 | 272 |
| 1571 | 3300049742 | Ga0501080_0202934 | Ga0501080_0202934_75_920 | 272 |
| 1572 | 3300049743 | Ga0501081_0045755 | Ga0501081_0045755_1305_2150 | 272 |
| 1573 | 3300049743 | Ga0501081_0048305 | Ga0501081_0048305_38_877 | 272 |
| 1574 | 3300049743 | Ga0501081_0224396 | Ga0501081_0224396_392_1231 | 272 |
| 1575 | 3300049824 | Ga0501045_0067502 | Ga0501045_0067502_771_1589 | 272 |
| 1576 | 3300050493 | nmdc:mga0k408_165436_c1 | nmdc:mga0k408_165436_c1_75_896 | 272 |
| 1577 | 3300050494 | nmdc:mga06z11_85042_c1 | nmdc:mga06z11_85042_c1_18_839 | 272 |
| 1578 | 3300050496 | nmdc:mga07m45_125816_c1 | nmdc:mga07m45_125816_c1_451_1272 | 272 |
| 1579 | 3300050516 | nmdc:mga0sz30_44938_c1 | nmdc:mga0sz30_44938_c1_666_1520 | 272 |
| 1580 | 3300053077 | Ga0495601_0110667 | Ga0495601_0110667_863_1687 | 272 |
| 1581 | 3300053125 | Ga0500618_007452 | Ga0500618_007452_1051_1899 | 272 |
| 1582 | 3300053130 | Ga0500642_0019592 | Ga0500642_0019592_1513_2334 | 272 |
| 1583 | 3300053156 | Ga0500622_0037417 | Ga0500622_0037417_402_1256 | 272 |
| 1584 | 3300053160 | Ga0500633_0085919 | Ga0500633_0085919_51_905 | 272 |
| 1585 | 3300054114 | Ga0501084_0021997 | Ga0501084_0021997_1572_2417 | 272 |
| 1586 | 3300060353 | Ga0501082_0008268 | Ga0501082_0008268_5322_6167 | 272 |
| 1587 | 3300060353 | Ga0501082_0190013 | Ga0501082_0190013_205_1044 | 272 |
| 1588 | 3300002077 | JGI24744J21845_10001857 | JGI24744J21845_100018573 | 273 |
| 1589 | 3300002244 | JGI24742J22300_10004158 | JGI24742J22300_100041582 | 273 |
| 1590 | 3300003203 | JGI25406J46586_10019430 | JGI25406J46586_100194302 | 273 |
| 1591 | 3300005331 | Ga0070670_100019541 | Ga0070670_1000195416 | 273 |
| 1592 | 3300005334 | Ga0068869_100184823 | Ga0068869_1001848231 | 273 |
| 1593 | 3300005334 | Ga0068869_100405698 | Ga0068869_1004056981 | 273 |
| 1594 | 3300005335 | Ga0070666_10070448 | Ga0070666_100704482 | 273 |
| 1595 | 3300005337 | Ga0070682_100029709 | Ga0070682_1000297093 | 273 |
| 1596 | 3300005338 | Ga0068868_100007943 | Ga0068868_1000079436 | 273 |
| 1597 | 3300005339 | Ga0070660_100128962 | Ga0070660_1001289622 | 273 |
| 1598 | 3300005340 | Ga0070689_100013840 | Ga0070689_1000138403 | 273 |
| 1599 | 3300005343 | Ga0070687_100070357 | Ga0070687_1000703571 | 273 |
| 1600 | 3300005344 | Ga0070661_100070495 | Ga0070661_1000704953 | 273 |
| 1601 | 3300005353 | Ga0070669_100008764 | Ga0070669_1000087647 | 273 |
| 1602 | 3300005353 | Ga0070669_100190994 | Ga0070669_1001909942 | 273 |
| 1603 | 3300005354 | Ga0070675_100012558 | Ga0070675_1000125589 | 273 |
| 1604 | 3300005355 | Ga0070671_100021863 | Ga0070671_1000218636 | 273 |
| 1605 | 3300005356 | Ga0070674_100016878 | Ga0070674_1000168783 | 273 |
| 1606 | 3300005364 | Ga0070673_100075828 | Ga0070673_1000758283 | 273 |
| 1607 | 3300005366 | Ga0070659_100085461 | Ga0070659_1000854612 | 273 |
| 1608 | 3300005367 | Ga0070667_100107168 | Ga0070667_1001071682 | 273 |
| 1609 | 3300005436 | Ga0070713_100041195 | Ga0070713_1000411952 | 273 |
| 1610 | 3300005436 | Ga0070713_100147078 | Ga0070713_1001470782 | 273 |
| 1611 | 3300005437 | Ga0070710_10282888 | Ga0070710_102828881 | 273 |
| 1612 | 3300005438 | Ga0070701_10016555 | Ga0070701_100165555 | 273 |
| 1613 | 3300005439 | Ga0070711_100134867 | Ga0070711_1001348672 | 273 |
| 1614 | 3300005455 | Ga0070663_100106845 | Ga0070663_1001068451 | 273 |
| 1615 | 3300005456 | Ga0070678_100029543 | Ga0070678_1000295433 | 273 |
| 1616 | 3300005466 | Ga0070685_10014503 | Ga0070685_100145035 | 273 |
| 1617 | 3300005518 | Ga0070699_100010135 | Ga0070699_1000101356 | 273 |
| 1618 | 3300005518 | Ga0070699_100068823 | Ga0070699_1000688232 | 273 |
| 1619 | 3300005535 | Ga0070684_100050925 | Ga0070684_1000509251 | 273 |
| 1620 | 3300005535 | Ga0070684_100396772 | Ga0070684_1003967721 | 273 |
| 1621 | 3300005536 | Ga0070697_100132361 | Ga0070697_1001323612 | 273 |
| 1622 | 3300005539 | Ga0068853_100030677 | Ga0068853_1000306774 | 273 |
| 1623 | 3300005543 | Ga0070672_100002417 | Ga0070672_1000024177 | 273 |
| 1624 | 3300005544 | Ga0070686_100027342 | Ga0070686_1000273422 | 273 |
| 1625 | 3300005548 | Ga0070665_100134505 | Ga0070665_1001345051 | 273 |
| 1626 | 3300005563 | Ga0068855_100168322 | Ga0068855_1001683222 | 273 |
| 1627 | 3300005564 | Ga0070664_100017176 | Ga0070664_1000171763 | 273 |
| 1628 | 3300005578 | Ga0068854_100087720 | Ga0068854_1000877203 | 273 |
| 1629 | 3300005616 | Ga0068852_100026811 | Ga0068852_1000268115 | 273 |
| 1630 | 3300005617 | Ga0068859_100434766 | Ga0068859_1004347663 | 273 |
| 1631 | 3300005618 | Ga0068864_100005352 | Ga0068864_10000535210 | 273 |
| 1632 | 3300005618 | Ga0068864_100300817 | Ga0068864_1003008173 | 273 |
| 1633 | 3300005718 | Ga0068866_10031643 | Ga0068866_100316432 | 273 |
| 1634 | 3300005719 | Ga0068861_100011934 | Ga0068861_1000119343 | 273 |
| 1635 | 3300005840 | Ga0068870_10001565 | Ga0068870_100015657 | 273 |
| 1636 | 3300005841 | Ga0068863_100029430 | Ga0068863_1000294307 | 273 |
| 1637 | 3300005842 | Ga0068858_100025387 | Ga0068858_1000253877 | 273 |
| 1638 | 3300005843 | Ga0068860_100004828 | Ga0068860_10000482813 | 273 |
| 1639 | 3300005844 | Ga0068862_100028014 | Ga0068862_1000280142 | 273 |
| 1640 | 3300005937 | Ga0081455_10003815 | Ga0081455_1000381515 | 273 |
| 1641 | 3300005937 | Ga0081455_10010610 | Ga0081455_100106108 | 273 |
| 1642 | 3300005981 | Ga0081538_10102101 | Ga0081538_101021012 | 273 |
| 1643 | 3300005985 | Ga0081539_10001525 | Ga0081539_1000152527 | 273 |
| 1644 | 3300006028 | Ga0070717_10060695 | Ga0070717_100606952 | 273 |
| 1645 | 3300006038 | Ga0075365_10027441 | Ga0075365_100274415 | 273 |
| 1646 | 3300006051 | Ga0075364_10049304 | Ga0075364_100493042 | 273 |
| 1647 | 3300006173 | Ga0070716_100045849 | Ga0070716_1000458492 | 273 |
| 1648 | 3300006175 | Ga0070712_100445290 | Ga0070712_1004452902 | 273 |
| 1649 | 3300006178 | Ga0075367_10180884 | Ga0075367_101808842 | 273 |
| 1650 | 3300006237 | Ga0097621_100032153 | Ga0097621_1000321532 | 273 |
| 1651 | 3300006358 | Ga0068871_100081145 | Ga0068871_1000811453 | 273 |
| 1652 | 3300006844 | Ga0075428_100031023 | Ga0075428_1000310233 | 273 |
| 1653 | 3300006844 | Ga0075428_100076394 | Ga0075428_1000763942 | 273 |
| 1654 | 3300006844 | Ga0075428_100091914 | Ga0075428_1000919143 | 273 |
| 1655 | 3300006844 | Ga0075428_100191811 | Ga0075428_1001918112 | 273 |
| 1656 | 3300006847 | Ga0075431_100041304 | Ga0075431_1000413043 | 273 |
| 1657 | 3300006871 | Ga0075434_100377181 | Ga0075434_1003771811 | 273 |
| 1658 | 3300006871 | Ga0075434_100481160 | Ga0075434_1004811602 | 273 |
| 1659 | 3300006881 | Ga0068865_100034380 | Ga0068865_1000343803 | 273 |
| 1660 | 3300006931 | Ga0097620_100434796 | Ga0097620_1004347961 | 273 |
| 1661 | 3300007265 | Ga0099794_10047033 | Ga0099794_100470333 | 273 |
| 1662 | 3300009094 | Ga0111539_10079050 | Ga0111539_100790501 | 273 |
| 1663 | 3300009094 | Ga0111539_10149561 | Ga0111539_101495614 | 273 |
| 1664 | 3300009094 | Ga0111539_10699248 | Ga0111539_106992482 | 273 |
| 1665 | 3300009098 | Ga0105245_10106909 | Ga0105245_101069093 | 273 |
| 1666 | 3300009098 | Ga0105245_10303236 | Ga0105245_103032362 | 273 |
| 1667 | 3300009101 | Ga0105247_10023791 | Ga0105247_100237913 | 273 |
| 1668 | 3300009147 | Ga0114129_10006403 | Ga0114129_1000640311 | 273 |
| 1669 | 3300009147 | Ga0114129_10190167 | Ga0114129_101901672 | 273 |
| 1670 | 3300009147 | Ga0114129_10224348 | Ga0114129_102243482 | 273 |
| 1671 | 3300009148 | Ga0105243_10015073 | Ga0105243_100150736 | 273 |
| 1672 | 3300009174 | Ga0105241_10048051 | Ga0105241_100480513 | 273 |
| 1673 | 3300009176 | Ga0105242_10025069 | Ga0105242_100250695 | 273 |
| 1674 | 3300009177 | Ga0105248_10027024 | Ga0105248_100270243 | 273 |
| 1675 | 3300009551 | Ga0105238_10091427 | Ga0105238_100914273 | 273 |
| 1676 | 3300009553 | Ga0105249_10067118 | Ga0105249_100671183 | 273 |
| 1677 | 3300011119 | Ga0105246_10299844 | Ga0105246_102998442 | 273 |
| 1678 | 3300013296 | Ga0157374_10105303 | Ga0157374_101053032 | 273 |
| 1679 | 3300013306 | Ga0163162_10128458 | Ga0163162_101284583 | 273 |
| 1680 | 3300013308 | Ga0157375_10039237 | Ga0157375_100392374 | 273 |
| 1681 | 3300014325 | Ga0163163_10017489 | Ga0163163_100174896 | 273 |
| 1682 | 3300014325 | Ga0163163_10046941 | Ga0163163_100469413 | 273 |
| 1683 | 3300014326 | Ga0157380_10022136 | Ga0157380_100221366 | 273 |
| 1684 | 3300014968 | Ga0157379_10272658 | Ga0157379_102726581 | 273 |
| 1685 | 3300014968 | Ga0157379_10483455 | Ga0157379_104834552 | 273 |
| 1686 | 3300014969 | Ga0157376_10278371 | Ga0157376_102783712 | 273 |
| 1687 | 3300017792 | Ga0163161_10039168 | Ga0163161_100391685 | 273 |
| 1688 | 3300021384 | Ga0213876_10042285 | Ga0213876_100422853 | 273 |
| 1689 | 3300025321 | Ga0207656_10019037 | Ga0207656_100190371 | 273 |
| 1690 | 3300025900 | Ga0207710_10017802 | Ga0207710_100178024 | 273 |
| 1691 | 3300025901 | Ga0207688_10000881 | Ga0207688_1000088115 | 273 |
| 1692 | 3300025901 | Ga0207688_10170247 | Ga0207688_101702472 | 273 |
| 1693 | 3300025903 | Ga0207680_10003962 | Ga0207680_100039625 | 273 |
| 1694 | 3300025904 | Ga0207647_10047610 | Ga0207647_100476103 | 273 |
| 1695 | 3300025908 | Ga0207643_10044142 | Ga0207643_100441421 | 273 |
| 1696 | 3300025911 | Ga0207654_10157774 | Ga0207654_101577742 | 273 |
| 1697 | 3300025915 | Ga0207693_10051743 | Ga0207693_100517434 | 273 |
| 1698 | 3300025916 | Ga0207663_10125232 | Ga0207663_101252322 | 273 |
| 1699 | 3300025918 | Ga0207662_10000948 | Ga0207662_1000094813 | 273 |
| 1700 | 3300025918 | Ga0207662_10081795 | Ga0207662_100817951 | 273 |
| 1701 | 3300025919 | Ga0207657_10067846 | Ga0207657_100678463 | 273 |
| 1702 | 3300025919 | Ga0207657_10089414 | Ga0207657_100894143 | 273 |
| 1703 | 3300025920 | Ga0207649_10036183 | Ga0207649_100361832 | 273 |
| 1704 | 3300025923 | Ga0207681_10183774 | Ga0207681_101837742 | 273 |
| 1705 | 3300025923 | Ga0207681_10475094 | Ga0207681_104750941 | 273 |
| 1706 | 3300025924 | Ga0207694_10136436 | Ga0207694_101364363 | 273 |
| 1707 | 3300025925 | Ga0207650_10167415 | Ga0207650_101674153 | 273 |
| 1708 | 3300025925 | Ga0207650_10352665 | Ga0207650_103526652 | 273 |
| 1709 | 3300025926 | Ga0207659_10109562 | Ga0207659_101095621 | 273 |
| 1710 | 3300025927 | Ga0207687_10008125 | Ga0207687_100081251 | 273 |
| 1711 | 3300025927 | Ga0207687_10477608 | Ga0207687_104776082 | 273 |
| 1712 | 3300025928 | Ga0207700_10184038 | Ga0207700_101840381 | 273 |
| 1713 | 3300025932 | Ga0207690_10070123 | Ga0207690_100701233 | 273 |
| 1714 | 3300025933 | Ga0207706_10016119 | Ga0207706_100161196 | 273 |
| 1715 | 3300025934 | Ga0207686_10076834 | Ga0207686_100768341 | 273 |
| 1716 | 3300025935 | Ga0207709_10017540 | Ga0207709_100175402 | 273 |
| 1717 | 3300025936 | Ga0207670_10102406 | Ga0207670_101024062 | 273 |
| 1718 | 3300025936 | Ga0207670_10148665 | Ga0207670_101486651 | 273 |
| 1719 | 3300025937 | Ga0207669_10045017 | Ga0207669_100450172 | 273 |
| 1720 | 3300025938 | Ga0207704_10048507 | Ga0207704_100485071 | 273 |
| 1721 | 3300025940 | Ga0207691_10002396 | Ga0207691_100023967 | 273 |
| 1722 | 3300025941 | Ga0207711_10004447 | Ga0207711_100044473 | 273 |
| 1723 | 3300025942 | Ga0207689_10002971 | Ga0207689_1000297115 | 273 |
| 1724 | 3300025945 | Ga0207679_10012758 | Ga0207679_100127583 | 273 |
| 1725 | 3300025960 | Ga0207651_10032914 | Ga0207651_100329145 | 273 |
| 1726 | 3300025961 | Ga0207712_10126556 | Ga0207712_101265562 | 273 |
| 1727 | 3300025972 | Ga0207668_10092027 | Ga0207668_100920272 | 273 |
| 1728 | 3300025981 | Ga0207640_10124525 | Ga0207640_101245252 | 273 |
| 1729 | 3300026023 | Ga0207677_10015387 | Ga0207677_100153871 | 273 |
| 1730 | 3300026035 | Ga0207703_10007803 | Ga0207703_100078034 | 273 |
| 1731 | 3300026035 | Ga0207703_10369561 | Ga0207703_103695612 | 273 |
| 1732 | 3300026041 | Ga0207639_10210546 | Ga0207639_102105463 | 273 |
| 1733 | 3300026067 | Ga0207678_10032254 | Ga0207678_100322545 | 273 |
| 1734 | 3300026075 | Ga0207708_10021777 | Ga0207708_100217773 | 273 |
| 1735 | 3300026088 | Ga0207641_10116629 | Ga0207641_101166292 | 273 |
| 1736 | 3300026089 | Ga0207648_10005710 | Ga0207648_100057107 | 273 |
| 1737 | 3300026095 | Ga0207676_10002836 | Ga0207676_100028368 | 273 |
| 1738 | 3300026095 | Ga0207676_10246476 | Ga0207676_102464762 | 273 |
| 1739 | 3300026118 | Ga0207675_100004191 | Ga0207675_1000041914 | 273 |
| 1740 | 3300026142 | Ga0207698_10206254 | Ga0207698_102062541 | 273 |
| 1741 | 3300027907 | Ga0207428_10355749 | Ga0207428_103557491 | 273 |
| 1742 | 3300028379 | Ga0268266_10061600 | Ga0268266_100616003 | 273 |
| 1743 | 3300028379 | Ga0268266_10542742 | Ga0268266_105427422 | 273 |
| 1744 | 3300028380 | Ga0268265_10302611 | Ga0268265_103026112 | 273 |
| 1745 | 3300028381 | Ga0268264_10019150 | Ga0268264_100191502 | 273 |
| 1746 | 3300031238 | Ga0265332_10000910 | Ga0265332_1000091016 | 273 |
| 1747 | 3300031249 | Ga0265339_10012275 | Ga0265339_100122754 | 273 |
| 1748 | 3300031711 | Ga0265314_10036923 | Ga0265314_100369233 | 273 |
| 1749 | 3300031712 | Ga0265342_10000146 | Ga0265342_1000014667 | 273 |
| 1750 | 3300035084 | Ga0373928_0047100 | Ga0373928_0047100_133_960 | 273 |
| 1751 | 3300035089 | Ga0373944_0011106 | Ga0373944_0011106_1084_1914 | 273 |
| 1752 | 3300035113 | Ga0373936_0021334 | Ga0373936_0021334_1051_1881 | 273 |
| 1753 | 3300035116 | Ga0373945_0005613 | Ga0373945_0005613_528_1358 | 273 |
| 1754 | 3300035170 | Ga0373943_0000209 | Ga0373943_0000209_16660_17490 | 273 |
| 1755 | 3300035171 | Ga0373946_0000216 | Ga0373946_0000216_13677_14507 | 273 |
| 1756 | 3300035242 | Ga0373962_0100762 | Ga0373962_0100762_11_838 | 273 |
| 1757 | 3300035691 | Ga0373931_0271151 | Ga0373931_0271151_181_1002 | 273 |
| 1758 | 3300035692 | Ga0373935_0037058 | Ga0373935_0037058_1502_2332 | 273 |
| 1759 | 3300035692 | Ga0373935_0042240 | Ga0373935_0042240_404_1234 | 273 |
| 1760 | 3300035695 | Ga0373927_0003567 | Ga0373927_0003567_7045_7875 | 273 |
| 1761 | 3300035695 | Ga0373927_0011896 | Ga0373927_0011896_3461_4291 | 273 |
| 1762 | 3300035725 | Ga0373947_0000365 | Ga0373947_0000365_15016_15846 | 273 |
| 1763 | 3300035725 | Ga0373947_0023554 | Ga0373947_0023554_1681_2511 | 273 |
| 1764 | 3300035725 | Ga0373947_0045411 | Ga0373947_0045411_390_1217 | 273 |
| 1765 | 3300037068 | Ga0373925_0001465 | Ga0373925_0001465_13723_14553 | 273 |
| 1766 | 3300037068 | Ga0373925_0142520 | Ga0373925_0142520_1011_1838 | 273 |
| 1767 | 3300037418 | Ga0395900_0146307 | Ga0395900_0146307_936_1757 | 273 |
| 1768 | 3300038443 | Ga0395901_0120912 | Ga0395901_0120912_1194_2015 | 273 |
| 1769 | 3300039437 | Ga0436365_1689635 | Ga0436365_1689635_234_1055 | 273 |
| 1770 | 3300046454 | Ga0495592_0296730 | Ga0495592_0296730_31_873 | 273 |
| 1771 | 3300046460 | Ga0495638_0014704 | Ga0495638_0014704_37_858 | 273 |
| 1772 | 3300046472 | Ga0495580_0002900 | Ga0495580_0002900_2204_3034 | 273 |
| 1773 | 3300046473 | Ga0495582_0087153 | Ga0495582_0087153_207_1028 | 273 |
| 1774 | 3300046474 | Ga0495605_0121668 | Ga0495605_0121668_328_1170 | 273 |
| 1775 | 3300046475 | Ga0495639_0069438 | Ga0495639_0069438_585_1415 | 273 |
| 1776 | 3300046476 | Ga0495662_0028884 | Ga0495662_0028884_862_1692 | 273 |
| 1777 | 3300046476 | Ga0495662_0169166 | Ga0495662_0169166_160_987 | 273 |
| 1778 | 3300046477 | Ga0495664_0000814 | Ga0495664_0000814_6301_7131 | 273 |
| 1779 | 3300046514 | Ga0495618_0000996 | Ga0495618_0000996_17341_18171 | 273 |
| 1780 | 3300046514 | Ga0495618_0339685 | Ga0495618_0339685_44_874 | 273 |
| 1781 | 3300046516 | Ga0495628_0155210 | Ga0495628_0155210_176_1006 | 273 |
| 1782 | 3300046517 | Ga0495630_0003083 | Ga0495630_0003083_8164_8994 | 273 |
| 1783 | 3300046517 | Ga0495630_0042458 | Ga0495630_0042458_1252_2082 | 273 |
| 1784 | 3300046517 | Ga0495630_0100353 | Ga0495630_0100353_376_1197 | 273 |
| 1785 | 3300046520 | Ga0495637_0069554 | Ga0495637_0069554_514_1356 | 273 |
| 1786 | 3300046526 | Ga0495666_0156427 | Ga0495666_0156427_28_858 | 273 |
| 1787 | 3300046529 | Ga0495652_0019698 | Ga0495652_0019698_910_1740 | 273 |
| 1788 | 3300046531 | Ga0495665_0003072 | Ga0495665_0003072_1715_2545 | 273 |
| 1789 | 3300046531 | Ga0495665_0054702 | Ga0495665_0054702_522_1352 | 273 |
| 1790 | 3300046531 | Ga0495665_0058547 | Ga0495665_0058547_1101_1931 | 273 |
| 1791 | 3300046533 | Ga0495640_0007360 | Ga0495640_0007360_5502_6332 | 273 |
| 1792 | 3300046533 | Ga0495640_0032197 | Ga0495640_0032197_2879_3709 | 273 |
| 1793 | 3300046535 | Ga0495586_0020580 | Ga0495586_0020580_989_1819 | 273 |
| 1794 | 3300046539 | Ga0495621_0043196 | Ga0495621_0043196_519_1361 | 273 |
| 1795 | 3300046543 | Ga0495645_0027733 | Ga0495645_0027733_2348_3178 | 273 |
| 1796 | 3300046559 | Ga0495667_0088532 | Ga0495667_0088532_862_1689 | 273 |
| 1797 | 3300046642 | Ga0495634_0005439 | Ga0495634_0005439_6971_7801 | 273 |
| 1798 | 3300046642 | Ga0495634_0006407 | Ga0495634_0006407_5365_6195 | 273 |
| 1799 | 3300046648 | Ga0495611_0091944 | Ga0495611_0091944_490_1332 | 273 |
| 1800 | 3300046663 | Ga0495635_0008986 | Ga0495635_0008986_1513_2343 | 273 |
| 1801 | 3300046663 | Ga0495635_0145957 | Ga0495635_0145957_164_991 | 273 |
| 1802 | 3300046683 | Ga0495658_0329953 | Ga0495658_0329953_52_882 | 273 |
| 1803 | 3300046684 | Ga0495669_0044918 | Ga0495669_0044918_563_1405 | 273 |
| 1804 | 3300046689 | Ga0495613_0037492 | Ga0495613_0037492_1376_2203 | 273 |
| 1805 | 3300046689 | Ga0495613_0042847 | Ga0495613_0042847_1025_1855 | 273 |
| 1806 | 3300046690 | Ga0495624_0004405 | Ga0495624_0004405_4610_5440 | 273 |
| 1807 | 3300047315 | Ga0495581_0007762 | Ga0495581_0007762_1438_2268 | 273 |
| 1808 | 3300047315 | Ga0495581_0022637 | Ga0495581_0022637_2639_3469 | 273 |
| 1809 | 3300047315 | Ga0495581_0060666 | Ga0495581_0060666_1308_2129 | 273 |
| 1810 | 3300047317 | Ga0495604_0164754 | Ga0495604_0164754_461_1291 | 273 |
| 1811 | 3300047319 | Ga0495674_0000267 | Ga0495674_0000267_4049_4879 | 273 |
| 1812 | 3300047319 | Ga0495674_0149677 | Ga0495674_0149677_922_1749 | 273 |
| 1813 | 3300047320 | Ga0495672_0132500 | Ga0495672_0132500_146_967 | 273 |
| 1814 | 3300047321 | Ga0495676_0091423 | Ga0495676_0091423_1085_1915 | 273 |
| 1815 | 3300047471 | Ga0495684_0005380 | Ga0495684_0005380_7424_8254 | 273 |
| 1816 | 3300047471 | Ga0495684_0097564 | Ga0495684_0097564_212_1042 | 273 |
| 1817 | 3300047673 | Ga0495593_0006737 | Ga0495593_0006737_4447_5277 | 273 |
| 1818 | 3300048903 | Ga0496100_0006540 | Ga0496100_0006540_2221_3105 | 273 |
| 1819 | 3300048904 | Ga0496101_0001315 | Ga0496101_0001315_2903_3787 | 273 |
| 1820 | 3300048905 | Ga0496102_0058141 | Ga0496102_0058141_2525_3409 | 273 |
| 1821 | 3300048905 | Ga0496102_0058840 | Ga0496102_0058840_129_956 | 273 |
| 1822 | 3300048906 | Ga0496103_0002582 | Ga0496103_0002582_3580_4464 | 273 |
| 1823 | 3300048906 | Ga0496103_0051744 | Ga0496103_0051744_1034_1855 | 273 |
| 1824 | 3300048907 | Ga0496104_0002038 | Ga0496104_0002038_13835_14662 | 273 |
| 1825 | 3300048907 | Ga0496104_0032924 | Ga0496104_0032924_3130_4014 | 273 |
| 1826 | 3300048908 | Ga0496105_0003200 | Ga0496105_0003200_8041_8925 | 273 |
| 1827 | 3300048908 | Ga0496105_0012407 | Ga0496105_0012407_5720_6547 | 273 |
| 1828 | 3300048909 | Ga0496106_0006158 | Ga0496106_0006158_6019_6903 | 273 |
| 1829 | 3300048910 | Ga0496107_0000537 | Ga0496107_0000537_8098_8982 | 273 |
| 1830 | 3300048910 | Ga0496107_0091491 | Ga0496107_0091491_135_956 | 273 |
| 1831 | 3300048911 | Ga0496108_0018111 | Ga0496108_0018111_4631_5515 | 273 |
| 1832 | 3300048911 | Ga0496108_0025662 | Ga0496108_0025662_2533_3360 | 273 |
| 1833 | 3300048912 | Ga0496109_0007320 | Ga0496109_0007320_7191_8075 | 273 |
| 1834 | 3300048912 | Ga0496109_0055426 | Ga0496109_0055426_178_1005 | 273 |
| 1835 | 3300048913 | Ga0496110_0005109 | Ga0496110_0005109_948_1784 | 273 |
| 1836 | 3300048913 | Ga0496110_0047695 | Ga0496110_0047695_2620_3504 | 273 |
| 1837 | 3300048913 | Ga0496110_0387450 | Ga0496110_0387450_103_924 | 273 |
| 1838 | 3300048914 | Ga0496111_0000797 | Ga0496111_0000797_1372_2256 | 273 |
| 1839 | 3300048915 | Ga0496112_0005033 | Ga0496112_0005033_11_838 | 273 |
| 1840 | 3300048915 | Ga0496112_0010105 | Ga0496112_0010105_5265_6149 | 273 |
| 1841 | 3300048916 | Ga0496113_0000104 | Ga0496113_0000104_33236_34063 | 273 |
| 1842 | 3300048916 | Ga0496113_0004791 | Ga0496113_0004791_891_1775 | 273 |
| 1843 | 3300048917 | Ga0496114_0238901 | Ga0496114_0238901_186_1013 | 273 |
| 1844 | 3300048917 | Ga0496114_0279228 | Ga0496114_0279228_361_1203 | 273 |
| 1845 | 3300048918 | Ga0496115_0011629 | Ga0496115_0011629_4957_5841 | 273 |
| 1846 | 3300048918 | Ga0496115_0377426 | Ga0496115_0377426_284_1111 | 273 |
| 1847 | 3300049569 | Ga0501032_0031972 | Ga0501032_0031972_732_1553 | 273 |
| 1848 | 3300049569 | Ga0501032_0159647 | Ga0501032_0159647_639_1460 | 273 |
| 1849 | 3300049570 | Ga0501033_0020232 | Ga0501033_0020232_343_1167 | 273 |
| 1850 | 3300049570 | Ga0501033_0062652 | Ga0501033_0062652_270_1091 | 273 |
| 1851 | 3300049570 | Ga0501033_0274779 | Ga0501033_0274779_74_895 | 273 |
| 1852 | 3300049571 | Ga0501034_0008639 | Ga0501034_0008639_7488_8312 | 273 |
| 1853 | 3300049571 | Ga0501034_0136543 | Ga0501034_0136543_98_922 | 273 |
| 1854 | 3300049571 | Ga0501034_0187086 | Ga0501034_0187086_1060_1881 | 273 |
| 1855 | 3300049571 | Ga0501034_0196037 | Ga0501034_0196037_662_1483 | 273 |
| 1856 | 3300049571 | Ga0501034_0211117 | Ga0501034_0211117_191_1012 | 273 |
| 1857 | 3300049572 | Ga0501036_0003373 | Ga0501036_0003373_8112_8936 | 273 |
| 1858 | 3300049572 | Ga0501036_0017490 | Ga0501036_0017490_4455_5276 | 273 |
| 1859 | 3300049572 | Ga0501036_0087633 | Ga0501036_0087633_157_981 | 273 |
| 1860 | 3300049573 | Ga0501037_0048981 | Ga0501037_0048981_1744_2565 | 273 |
| 1861 | 3300049573 | Ga0501037_0100601 | Ga0501037_0100601_122_946 | 273 |
| 1862 | 3300049573 | Ga0501037_0119962 | Ga0501037_0119962_917_1738 | 273 |
| 1863 | 3300049574 | Ga0501038_0012909 | Ga0501038_0012909_6739_7560 | 273 |
| 1864 | 3300049574 | Ga0501038_0026739 | Ga0501038_0026739_1456_2277 | 273 |
| 1865 | 3300049574 | Ga0501038_0108493 | Ga0501038_0108493_314_1135 | 273 |
| 1866 | 3300049574 | Ga0501038_0260926 | Ga0501038_0260926_13_837 | 273 |
| 1867 | 3300049574 | Ga0501038_0437177 | Ga0501038_0437177_83_904 | 273 |
| 1868 | 3300049576 | Ga0501040_0096153 | Ga0501040_0096153_783_1604 | 273 |
| 1869 | 3300049576 | Ga0501040_0120120 | Ga0501040_0120120_309_1130 | 273 |
| 1870 | 3300049579 | Ga0501043_0009122 | Ga0501043_0009122_5128_5949 | 273 |
| 1871 | 3300049580 | Ga0501046_0010978 | Ga0501046_0010978_2016_2837 | 273 |
| 1872 | 3300049580 | Ga0501046_0073455 | Ga0501046_0073455_438_1259 | 273 |
| 1873 | 3300049581 | Ga0501047_0000228 | Ga0501047_0000228_45899_46723 | 273 |
| 1874 | 3300049581 | Ga0501047_0025685 | Ga0501047_0025685_2749_3573 | 273 |
| 1875 | 3300049582 | Ga0501048_0000331 | Ga0501048_0000331_13925_14749 | 273 |
| 1876 | 3300049584 | Ga0501068_0003377 | Ga0501068_0003377_1936_2757 | 273 |
| 1877 | 3300049584 | Ga0501068_0003420 | Ga0501068_0003420_907_1728 | 273 |
| 1878 | 3300049586 | Ga0501070_0012830 | Ga0501070_0012830_3458_4282 | 273 |
| 1879 | 3300049586 | Ga0501070_0014246 | Ga0501070_0014246_3143_3967 | 273 |
| 1880 | 3300049586 | Ga0501070_0071103 | Ga0501070_0071103_398_1219 | 273 |
| 1881 | 3300049586 | Ga0501070_0131097 | Ga0501070_0131097_41_862 | 273 |
| 1882 | 3300049586 | Ga0501070_0549747 | Ga0501070_0549747_83_907 | 273 |
| 1883 | 3300049587 | Ga0501071_0098601 | Ga0501071_0098601_400_1245 | 273 |
| 1884 | 3300049588 | Ga0501072_0074478 | Ga0501072_0074478_1779_2600 | 273 |
| 1885 | 3300049589 | Ga0501073_0018457 | Ga0501073_0018457_3796_4617 | 273 |
| 1886 | 3300049590 | Ga0501074_0102810 | Ga0501074_0102810_1071_1892 | 273 |
| 1887 | 3300049591 | Ga0501075_0171507 | Ga0501075_0171507_16_837 | 273 |
| 1888 | 3300049593 | Ga0501077_0033066 | Ga0501077_0033066_1076_1897 | 273 |
| 1889 | 3300049741 | Ga0501079_0084729 | Ga0501079_0084729_502_1323 | 273 |
| 1890 | 3300049741 | Ga0501079_0310709 | Ga0501079_0310709_342_1163 | 273 |
| 1891 | 3300049741 | Ga0501079_0383821 | Ga0501079_0383821_48_869 | 273 |
| 1892 | 3300049742 | Ga0501080_0001137 | Ga0501080_0001137_3431_4255 | 273 |
| 1893 | 3300049742 | Ga0501080_0015938 | Ga0501080_0015938_885_1706 | 273 |
| 1894 | 3300049742 | Ga0501080_0267177 | Ga0501080_0267177_203_1024 | 273 |
| 1895 | 3300049744 | Ga0501083_0025094 | Ga0501083_0025094_119_943 | 273 |
| 1896 | 3300049822 | Ga0501035_0034511 | Ga0501035_0034511_1564_2385 | 273 |
| 1897 | 3300049823 | Ga0501044_0006495 | Ga0501044_0006495_8741_9565 | 273 |
| 1898 | 3300049823 | Ga0501044_0010842 | Ga0501044_0010842_6177_7001 | 273 |
| 1899 | 3300049823 | Ga0501044_0606439 | Ga0501044_0606439_60_884 | 273 |
| 1900 | 3300050489 | nmdc:mga03683_17711_c1 | nmdc:mga03683_17711_c1_144_965 | 273 |
| 1901 | 3300050491 | nmdc:mga00v17_22699_c1 | nmdc:mga00v17_22699_c1_2231_3052 | 273 |
| 1902 | 3300050491 | nmdc:mga00v17_95613_c1 | nmdc:mga00v17_95613_c1_819_1661 | 273 |
| 1903 | 3300050492 | nmdc:mga0yw44_10927_c1 | nmdc:mga0yw44_10927_c1_2883_3704 | 273 |
| 1904 | 3300050492 | nmdc:mga0yw44_15015_c1 | nmdc:mga0yw44_15015_c1_2602_3444 | 273 |
| 1905 | 3300050492 | nmdc:mga0yw44_86857_c1 | nmdc:mga0yw44_86857_c1_896_1738 | 273 |
| 1906 | 3300050496 | nmdc:mga07m45_101116_c1 | nmdc:mga07m45_101116_c1_315_1136 | 273 |
| 1907 | 3300050507 | nmdc:mga05p37_131667_c1 | nmdc:mga05p37_131667_c1_1051_1872 | 273 |
| 1908 | 3300050507 | nmdc:mga05p37_183765_c1 | nmdc:mga05p37_183765_c1_1542_2363 | 273 |
| 1909 | 3300050507 | nmdc:mga05p37_4180_c1 | nmdc:mga05p37_4180_c1_7993_8820 | 273 |
| 1910 | 3300050510 | nmdc:mga06r32_232775_c1 | nmdc:mga06r32_232775_c1_438_1265 | 273 |
| 1911 | 3300050510 | nmdc:mga06r32_234900_c1 | nmdc:mga06r32_234900_c1_366_1187 | 273 |
| 1912 | 3300050512 | nmdc:mga0n895_76894_c1 | nmdc:mga0n895_76894_c1_233_1060 | 273 |
| 1913 | 3300050513 | nmdc:mga0rr50_193567_c1 | nmdc:mga0rr50_193567_c1_501_1337 | 273 |
| 1914 | 3300053077 | Ga0495601_0005176 | Ga0495601_0005176_5652_6482 | 273 |
| 1915 | 3300053078 | Ga0495612_0000306 | Ga0495612_0000306_18741_19571 | 273 |
| 1916 | 3300053079 | Ga0500610_0104204 | Ga0500610_0104204_520_1341 | 273 |
| 1917 | 3300053084 | Ga0495595_0033968 | Ga0495595_0033968_404_1231 | 273 |
| 1918 | 3300053084 | Ga0495595_0110988 | Ga0495595_0110988_478_1308 | 273 |
| 1919 | 3300053085 | Ga0495619_0049686 | Ga0495619_0049686_609_1436 | 273 |
| 1920 | 3300053085 | Ga0495619_0056407 | Ga0495619_0056407_664_1494 | 273 |
| 1921 | 3300053085 | Ga0495619_0062165 | Ga0495619_0062165_1144_1974 | 273 |
| 1922 | 3300053085 | Ga0495619_0106556 | Ga0495619_0106556_291_1121 | 273 |
| 1923 | 3300060353 | Ga0501082_0155204 | Ga0501082_0155204_195_1016 | 273 |
| 1924 | 3300060353 | Ga0501082_0332185 | Ga0501082_0332185_159_980 | 273 |
| 1925 | 3300060353 | Ga0501082_0526761 | Ga0501082_0526761_96_917 | 273 |
| 1926 | 3300003203 | JGI25406J46586_10000165 | JGI25406J46586_1000016511 | 274 |
| 1927 | 3300003203 | JGI25406J46586_10000169 | JGI25406J46586_100001698 | 274 |
| 1928 | 3300005340 | Ga0070689_100087092 | Ga0070689_1000870922 | 274 |
| 1929 | 3300005353 | Ga0070669_100287215 | Ga0070669_1002872151 | 274 |
| 1930 | 3300005356 | Ga0070674_100147701 | Ga0070674_1001477012 | 274 |
| 1931 | 3300005367 | Ga0070667_100307003 | Ga0070667_1003070032 | 274 |
| 1932 | 3300005435 | Ga0070714_100032451 | Ga0070714_1000324518 | 274 |
| 1933 | 3300005437 | Ga0070710_10126217 | Ga0070710_101262172 | 274 |
| 1934 | 3300005466 | Ga0070685_10062381 | Ga0070685_100623812 | 274 |
| 1935 | 3300005530 | Ga0070679_100097897 | Ga0070679_1000978973 | 274 |
| 1936 | 3300005544 | Ga0070686_100332265 | Ga0070686_1003322651 | 274 |
| 1937 | 3300005549 | Ga0070704_100021004 | Ga0070704_1000210044 | 274 |
| 1938 | 3300005618 | Ga0068864_100075961 | Ga0068864_1000759611 | 274 |
| 1939 | 3300005844 | Ga0068862_100213878 | Ga0068862_1002138782 | 274 |
| 1940 | 3300005937 | Ga0081455_10004892 | Ga0081455_1000489214 | 274 |
| 1941 | 3300005937 | Ga0081455_10317684 | Ga0081455_103176841 | 274 |
| 1942 | 3300005985 | Ga0081539_10000255 | Ga0081539_1000025555 | 274 |
| 1943 | 3300006051 | Ga0075364_10091084 | Ga0075364_100910842 | 274 |
| 1944 | 3300006163 | Ga0070715_10021216 | Ga0070715_100212163 | 274 |
| 1945 | 3300006175 | Ga0070712_100113042 | Ga0070712_1001130422 | 274 |
| 1946 | 3300006844 | Ga0075428_100011698 | Ga0075428_10001169812 | 274 |
| 1947 | 3300006844 | Ga0075428_100487337 | Ga0075428_1004873371 | 274 |
| 1948 | 3300006844 | Ga0075428_100697007 | Ga0075428_1006970071 | 274 |
| 1949 | 3300006846 | Ga0075430_100040340 | Ga0075430_1000403403 | 274 |
| 1950 | 3300006846 | Ga0075430_100061692 | Ga0075430_1000616923 | 274 |
| 1951 | 3300006846 | Ga0075430_100387236 | Ga0075430_1003872362 | 274 |
| 1952 | 3300006847 | Ga0075431_100000053 | Ga0075431_10000005353 | 274 |
| 1953 | 3300006847 | Ga0075431_100014358 | Ga0075431_1000143586 | 274 |
| 1954 | 3300006847 | Ga0075431_100270486 | Ga0075431_1002704862 | 274 |
| 1955 | 3300006871 | Ga0075434_100081291 | Ga0075434_1000812913 | 274 |
| 1956 | 3300006880 | Ga0075429_100006001 | Ga0075429_10000600113 | 274 |
| 1957 | 3300006914 | Ga0075436_100138309 | Ga0075436_1001383091 | 274 |
| 1958 | 3300007076 | Ga0075435_100052351 | Ga0075435_1000523513 | 274 |
| 1959 | 3300007265 | Ga0099794_10135576 | Ga0099794_101355762 | 274 |
| 1960 | 3300007788 | Ga0099795_10017225 | Ga0099795_100172253 | 274 |
| 1961 | 3300009094 | Ga0111539_10018523 | Ga0111539_1001852310 | 274 |
| 1962 | 3300009094 | Ga0111539_10058480 | Ga0111539_100584802 | 274 |
| 1963 | 3300009094 | Ga0111539_11058000 | Ga0111539_110580001 | 274 |
| 1964 | 3300009147 | Ga0114129_10000237 | Ga0114129_100002374 | 274 |
| 1965 | 3300009147 | Ga0114129_10197471 | Ga0114129_101974713 | 274 |
| 1966 | 3300009147 | Ga0114129_10662038 | Ga0114129_106620382 | 274 |
| 1967 | 3300009148 | Ga0105243_10245424 | Ga0105243_102454242 | 274 |
| 1968 | 3300011119 | Ga0105246_10058128 | Ga0105246_100581281 | 274 |
| 1969 | 3300013105 | Ga0157369_10223031 | Ga0157369_102230312 | 274 |
| 1970 | 3300013306 | Ga0163162_10360712 | Ga0163162_103607122 | 274 |
| 1971 | 3300014325 | Ga0163163_10439922 | Ga0163163_104399222 | 274 |
| 1972 | 3300025297 | Ga0209758_1002012 | Ga0209758_100201213 | 274 |
| 1973 | 3300025911 | Ga0207654_10355604 | Ga0207654_103556041 | 274 |
| 1974 | 3300025927 | Ga0207687_10344062 | Ga0207687_103440621 | 274 |
| 1975 | 3300025933 | Ga0207706_10167736 | Ga0207706_101677362 | 274 |
| 1976 | 3300025935 | Ga0207709_10173341 | Ga0207709_101733412 | 274 |
| 1977 | 3300025937 | Ga0207669_10017820 | Ga0207669_100178203 | 274 |
| 1978 | 3300025937 | Ga0207669_10163585 | Ga0207669_101635852 | 274 |
| 1979 | 3300025940 | Ga0207691_10025977 | Ga0207691_100259776 | 274 |
| 1980 | 3300025941 | Ga0207711_10289889 | Ga0207711_102898891 | 274 |
| 1981 | 3300025961 | Ga0207712_10151793 | Ga0207712_101517932 | 274 |
| 1982 | 3300025961 | Ga0207712_10188288 | Ga0207712_101882882 | 274 |
| 1983 | 3300026041 | Ga0207639_10265413 | Ga0207639_102654132 | 274 |
| 1984 | 3300026088 | Ga0207641_10466644 | Ga0207641_104666442 | 274 |
| 1985 | 3300026121 | Ga0207683_10005386 | Ga0207683_100053862 | 274 |
| 1986 | 3300027512 | Ga0209179_1001507 | Ga0209179_10015073 | 274 |
| 1987 | 3300027907 | Ga0207428_10017874 | Ga0207428_100178747 | 274 |
| 1988 | 3300027907 | Ga0207428_10049144 | Ga0207428_100491442 | 274 |
| 1989 | 3300028380 | Ga0268265_10191916 | Ga0268265_101919162 | 274 |
| 1990 | 3300031238 | Ga0265332_10014182 | Ga0265332_100141823 | 274 |
| 1991 | 3300031238 | Ga0265332_10028016 | Ga0265332_100280163 | 274 |
| 1992 | 3300031240 | Ga0265320_10004204 | Ga0265320_1000420414 | 274 |
| 1993 | 3300031241 | Ga0265325_10000697 | Ga0265325_100006978 | 274 |
| 1994 | 3300031241 | Ga0265325_10067784 | Ga0265325_100677841 | 274 |
| 1995 | 3300031242 | Ga0265329_10009039 | Ga0265329_100090395 | 274 |
| 1996 | 3300031249 | Ga0265339_10038245 | Ga0265339_100382453 | 274 |
| 1997 | 3300031507 | Ga0307509_10306767 | Ga0307509_103067671 | 274 |
| 1998 | 3300031595 | Ga0265313_10000041 | Ga0265313_10000041103 | 274 |
| 1999 | 3300031595 | Ga0265313_10072741 | Ga0265313_100727412 | 274 |
| 2000 | 3300031595 | Ga0265313_10105050 | Ga0265313_101050502 | 274 |
| 2001 | 3300031712 | Ga0265342_10059087 | Ga0265342_100590872 | 274 |
| 2002 | 3300031712 | Ga0265342_10068900 | Ga0265342_100689002 | 274 |
| 2003 | 3300033180 | Ga0307510_10068963 | Ga0307510_100689634 | 274 |
| 2004 | 3300035113 | Ga0373936_0000315 | Ga0373936_0000315_14060_14899 | 274 |
| 2005 | 3300035118 | Ga0373954_0043269 | Ga0373954_0043269_933_1772 | 274 |
| 2006 | 3300035119 | Ga0373956_0018744 | Ga0373956_0018744_204_1043 | 274 |
| 2007 | 3300035170 | Ga0373943_0007527 | Ga0373943_0007527_2856_3695 | 274 |
| 2008 | 3300035171 | Ga0373946_0001244 | Ga0373946_0001244_5325_6164 | 274 |
| 2009 | 3300035172 | Ga0373955_0042929 | Ga0373955_0042929_1438_2277 | 274 |
| 2010 | 3300035410 | Ga0373924_0000349 | Ga0373924_0000349_66_905 | 274 |
| 2011 | 3300035691 | Ga0373931_0230123 | Ga0373931_0230123_14_838 | 274 |
| 2012 | 3300035692 | Ga0373935_0000292 | Ga0373935_0000292_4543_5382 | 274 |
| 2013 | 3300035695 | Ga0373927_0020628 | Ga0373927_0020628_1239_2078 | 274 |
| 2014 | 3300035695 | Ga0373927_0105441 | Ga0373927_0105441_501_1328 | 274 |
| 2015 | 3300035724 | Ga0373933_0000518 | Ga0373933_0000518_5032_5871 | 274 |
| 2016 | 3300035725 | Ga0373947_0000379 | Ga0373947_0000379_10402_11241 | 274 |
| 2017 | 3300036401 | Ga0373937_0001710 | Ga0373937_0001710_8526_9365 | 274 |
| 2018 | 3300036401 | Ga0373937_0627728 | Ga0373937_0627728_26_862 | 274 |
| 2019 | 3300037068 | Ga0373925_0000018 | Ga0373925_0000018_171267_172106 | 274 |
| 2020 | 3300037068 | Ga0373925_0041952 | Ga0373925_0041952_1998_2825 | 274 |
| 2021 | 3300039437 | Ga0436365_0000552 | Ga0436365_0000552_440_1264 | 274 |
| 2022 | 3300039437 | Ga0436365_0780547 | Ga0436365_0780547_655_1479 | 274 |
| 2023 | 3300039450 | Ga0436363_0575052 | Ga0436363_0575052_645_1469 | 274 |
| 2024 | 3300039453 | Ga0436362_0838148 | Ga0436362_0838148_15_839 | 274 |
| 2025 | 3300041408 | Ga0439453_0003170 | Ga0439453_0003170_426_1250 | 274 |
| 2026 | 3300042003 | Ga0439443_017300 | Ga0439443_017300_170_994 | 274 |
| 2027 | 3300042436 | Ga0439435_0001488 | Ga0439435_0001488_924_1748 | 274 |
| 2028 | 3300046454 | Ga0495592_0000001 | Ga0495592_0000001_36292_37131 | 274 |
| 2029 | 3300046455 | Ga0495603_0030937 | Ga0495603_0030937_275_1102 | 274 |
| 2030 | 3300046459 | Ga0495629_0024988 | Ga0495629_0024988_2662_3501 | 274 |
| 2031 | 3300046462 | Ga0495651_0002430 | Ga0495651_0002430_10255_11094 | 274 |
| 2032 | 3300046463 | Ga0495653_0000092 | Ga0495653_0000092_51291_52130 | 274 |
| 2033 | 3300046473 | Ga0495582_0025155 | Ga0495582_0025155_1977_2816 | 274 |
| 2034 | 3300046476 | Ga0495662_0014931 | Ga0495662_0014931_1027_1866 | 274 |
| 2035 | 3300046477 | Ga0495664_0000001 | Ga0495664_0000001_279230_280069 | 274 |
| 2036 | 3300046491 | Ga0495584_0126197 | Ga0495584_0126197_348_1172 | 274 |
| 2037 | 3300046507 | Ga0495606_0002491 | Ga0495606_0002491_7405_8232 | 274 |
| 2038 | 3300046511 | Ga0495608_0000109 | Ga0495608_0000109_4654_5493 | 274 |
| 2039 | 3300046514 | Ga0495618_0000064 | Ga0495618_0000064_22652_23491 | 274 |
| 2040 | 3300046516 | Ga0495628_0000003 | Ga0495628_0000003_110287_111126 | 274 |
| 2041 | 3300046517 | Ga0495630_0000850 | Ga0495630_0000850_13473_14312 | 274 |
| 2042 | 3300046523 | Ga0495644_0074383 | Ga0495644_0074383_145_969 | 274 |
| 2043 | 3300046529 | Ga0495652_0000001 | Ga0495652_0000001_547096_547935 | 274 |
| 2044 | 3300046533 | Ga0495640_0000012 | Ga0495640_0000012_189388_190227 | 274 |
| 2045 | 3300046536 | Ga0495587_0000028 | Ga0495587_0000028_53709_54548 | 274 |
| 2046 | 3300046543 | Ga0495645_0000004 | Ga0495645_0000004_172736_173575 | 274 |
| 2047 | 3300046559 | Ga0495667_0000001 | Ga0495667_0000001_387088_387927 | 274 |
| 2048 | 3300046642 | Ga0495634_0000075 | Ga0495634_0000075_66470_67309 | 274 |
| 2049 | 3300046663 | Ga0495635_0000015 | Ga0495635_0000015_189580_190419 | 274 |
| 2050 | 3300046675 | Ga0495657_0000155 | Ga0495657_0000155_38576_39415 | 274 |
| 2051 | 3300046678 | Ga0495599_0000029 | Ga0495599_0000029_22681_23520 | 274 |
| 2052 | 3300046679 | Ga0495623_0000012 | Ga0495623_0000012_4466_5305 | 274 |
| 2053 | 3300046680 | Ga0495646_0000006 | Ga0495646_0000006_234982_235821 | 274 |
| 2054 | 3300046683 | Ga0495658_0054538 | Ga0495658_0054538_1328_2155 | 274 |
| 2055 | 3300046689 | Ga0495613_0180831 | Ga0495613_0180831_424_1263 | 274 |
| 2056 | 3300046809 | Ga0495600_0000286 | Ga0495600_0000286_1167_2006 | 274 |
| 2057 | 3300047317 | Ga0495604_0000091 | Ga0495604_0000091_22748_23587 | 274 |
| 2058 | 3300047319 | Ga0495674_0000001 | Ga0495674_0000001_479167_480006 | 274 |
| 2059 | 3300047320 | Ga0495672_0178828 | Ga0495672_0178828_88_924 | 274 |
| 2060 | 3300047322 | Ga0495680_0000489 | Ga0495680_0000489_26507_27346 | 274 |
| 2061 | 3300047444 | Ga0495675_0000113 | Ga0495675_0000113_3827_4666 | 274 |
| 2062 | 3300047471 | Ga0495684_0000055 | Ga0495684_0000055_53774_54613 | 274 |
| 2063 | 3300047673 | Ga0495593_0003290 | Ga0495593_0003290_4608_5447 | 274 |
| 2064 | 3300048088 | Ga0495602_0000002 | Ga0495602_0000002_22710_23549 | 274 |
| 2065 | 3300048915 | Ga0496112_0000016 | Ga0496112_0000016_144572_145399 | 274 |
| 2066 | 3300048920 | Ga0496117_0174387 | Ga0496117_0174387_317_1144 | 274 |
| 2067 | 3300048921 | Ga0496118_0049303 | Ga0496118_0049303_98_925 | 274 |
| 2068 | 3300048921 | Ga0496118_0148090 | Ga0496118_0148090_133_960 | 274 |
| 2069 | 3300048922 | Ga0496119_0075211 | Ga0496119_0075211_476_1303 | 274 |
| 2070 | 3300048924 | Ga0496121_0002834 | Ga0496121_0002834_20779_21606 | 274 |
| 2071 | 3300048928 | Ga0496125_0000092 | Ga0496125_0000092_119373_120200 | 274 |
| 2072 | 3300048928 | Ga0496125_0001341 | Ga0496125_0001341_32713_33540 | 274 |
| 2073 | 3300049569 | Ga0501032_0142313 | Ga0501032_0142313_678_1502 | 274 |
| 2074 | 3300049570 | Ga0501033_0030642 | Ga0501033_0030642_1381_2205 | 274 |
| 2075 | 3300049571 | Ga0501034_0082818 | Ga0501034_0082818_728_1552 | 274 |
| 2076 | 3300049572 | Ga0501036_0051586 | Ga0501036_0051586_867_1691 | 274 |
| 2077 | 3300049573 | Ga0501037_0016929 | Ga0501037_0016929_3823_4647 | 274 |
| 2078 | 3300049574 | Ga0501038_0009517 | Ga0501038_0009517_4011_4835 | 274 |
| 2079 | 3300049581 | Ga0501047_0009086 | Ga0501047_0009086_3724_4548 | 274 |
| 2080 | 3300049586 | Ga0501070_0019565 | Ga0501070_0019565_2254_3078 | 274 |
| 2081 | 3300049586 | Ga0501070_0229724 | Ga0501070_0229724_415_1239 | 274 |
| 2082 | 3300049588 | Ga0501072_0001711 | Ga0501072_0001711_11335_12159 | 274 |
| 2083 | 3300049741 | Ga0501079_0531435 | Ga0501079_0531435_72_896 | 274 |
| 2084 | 3300049744 | Ga0501083_0101911 | Ga0501083_0101911_17_841 | 274 |
| 2085 | 3300049823 | Ga0501044_0094692 | Ga0501044_0094692_528_1352 | 274 |
| 2086 | 3300049823 | Ga0501044_0180971 | Ga0501044_0180971_696_1520 | 274 |
| 2087 | 3300049823 | Ga0501044_0590499 | Ga0501044_0590499_82_906 | 274 |
| 2088 | 3300050493 | nmdc:mga0k408_115448_c1 | nmdc:mga0k408_115448_c1_325_1149 | 274 |
| 2089 | 3300050507 | nmdc:mga05p37_635_c1 | nmdc:mga05p37_635_c1_17114_17938 | 274 |
| 2090 | 3300050508 | nmdc:mga09592_135018_c1 | nmdc:mga09592_135018_c1_1147_1971 | 274 |
| 2091 | 3300050508 | nmdc:mga09592_4975_c1 | nmdc:mga09592_4975_c1_9903_10727 | 274 |
| 2092 | 3300050508 | nmdc:mga09592_542116_c1 | nmdc:mga09592_542116_c1_96_920 | 274 |
| 2093 | 3300050509 | nmdc:mga0qj67_4711_c1 | nmdc:mga0qj67_4711_c1_8735_9559 | 274 |
| 2094 | 3300050509 | nmdc:mga0qj67_57496_c1 | nmdc:mga0qj67_57496_c1_1301_2125 | 274 |
| 2095 | 3300050510 | nmdc:mga06r32_249043_c1 | nmdc:mga06r32_249043_c1_413_1240 | 274 |
| 2096 | 3300050510 | nmdc:mga06r32_566_c1 | nmdc:mga06r32_566_c1_5959_6783 | 274 |
| 2097 | 3300050511 | nmdc:mga08y16_134_c1 | nmdc:mga08y16_134_c1_54044_54868 | 274 |
| 2098 | 3300050511 | nmdc:mga08y16_17037_c1 | nmdc:mga08y16_17037_c1_5892_6716 | 274 |
| 2099 | 3300050511 | nmdc:mga08y16_199269_c1 | nmdc:mga08y16_199269_c1_755_1582 | 274 |
| 2100 | 3300050512 | nmdc:mga0n895_109586_c1 | nmdc:mga0n895_109586_c1_31_858 | 274 |
| 2101 | 3300050512 | nmdc:mga0n895_86278_c1 | nmdc:mga0n895_86278_c1_1144_1971 | 274 |
| 2102 | 3300050513 | nmdc:mga0rr50_21706_c1 | nmdc:mga0rr50_21706_c1_2907_3734 | 274 |
| 2103 | 3300050513 | nmdc:mga0rr50_515938_c1 | nmdc:mga0rr50_515938_c1_50_874 | 274 |
| 2104 | 3300050515 | nmdc:mga0a205_15686_c1 | nmdc:mga0a205_15686_c1_2487_3314 | 274 |
| 2105 | 3300053077 | Ga0495601_0000006 | Ga0495601_0000006_319217_320056 | 274 |
| 2106 | 3300053078 | Ga0495612_0000007 | Ga0495612_0000007_4628_5467 | 274 |
| 2107 | 3300053080 | Ga0500635_0006227 | Ga0500635_0006227_474_1301 | 274 |
| 2108 | 3300053084 | Ga0495595_0000051 | Ga0495595_0000051_17275_18114 | 274 |
| 2109 | 3300053085 | Ga0495619_0000027 | Ga0495619_0000027_110475_111314 | 274 |
| 2110 | 3300053102 | Ga0500554_012124 | Ga0500554_012124_62_889 | 274 |
| 2111 | 3300053116 | Ga0500592_014781 | Ga0500592_014781_62_889 | 274 |
| 2112 | 3300053119 | Ga0500595_016023 | Ga0500595_016023_73_900 | 274 |
| 2113 | 3300053119 | Ga0500595_022555 | Ga0500595_022555_618_1445 | 274 |
| 2114 | 3300053140 | Ga0500573_0001363 | Ga0500573_0001363_1898_2734 | 274 |
| 2115 | 3300053140 | Ga0500573_0004799 | Ga0500573_0004799_1221_2072 | 274 |
| 2116 | 3300053142 | Ga0500577_0000183 | Ga0500577_0000183_10703_11530 | 274 |
| 2117 | 3300053150 | Ga0500603_000278 | Ga0500603_000278_841_1668 | 274 |
| 2118 | 3300053158 | Ga0500627_0126281 | Ga0500627_0126281_193_1020 | 274 |
| 2119 | 3300053178 | Ga0500637_0067505 | Ga0500637_0067505_56_883 | 274 |
| 2120 | 3300054114 | Ga0501084_0403331 | Ga0501084_0403331_61_885 | 274 |
| 2121 | 3300060353 | Ga0501082_0000008 | Ga0501082_0000008_37718_38542 | 274 |
| 2122 | 3300025261 | Ga0209233_1017822 | Ga0209233_10178223 | 275 |
| 2123 | 3300037853 | Ga0436364_0410618 | Ga0436364_0410618_14268_15107 | 275 |
| 2124 | 3300048913 | Ga0496110_0042808 | Ga0496110_0042808_459_1310 | 275 |
| 2125 | 3300049572 | Ga0501036_0032301 | Ga0501036_0032301_1008_1850 | 275 |
| 2126 | 3300049579 | Ga0501043_0107704 | Ga0501043_0107704_370_1212 | 275 |
| 2127 | 3300049579 | Ga0501043_0364252 | Ga0501043_0364252_221_1048 | 275 |
| 2128 | 3300049581 | Ga0501047_0130434 | Ga0501047_0130434_511_1353 | 275 |
| 2129 | 3300049586 | Ga0501070_0074251 | Ga0501070_0074251_1425_2267 | 275 |
| 2130 | 3300049586 | Ga0501070_0287393 | Ga0501070_0287393_443_1285 | 275 |
| 2131 | 3300049589 | Ga0501073_0382526 | Ga0501073_0382526_43_885 | 275 |
| 2132 | 3300049822 | Ga0501035_0063571 | Ga0501035_0063571_348_1190 | 275 |
| 2133 | 3300049823 | Ga0501044_0152045 | Ga0501044_0152045_290_1132 | 275 |
| 2134 | 3300049823 | Ga0501044_0450393 | Ga0501044_0450393_264_1091 | 275 |
| 2135 | 2209111006 | 2214911870 | 2213970504 | 276 |
| 2136 | 3300000041 | ARcpr5oldR_c000058 | ARcpr5oldR_00005813 | 276 |
| 2137 | 3300000042 | ARSoilYngRDRAFT_c00199 | ARSoilYngRDRAFT_001993 | 276 |
| 2138 | 3300000043 | ARcpr5yngRDRAFT_c000188 | ARcpr5yngRDRAFT_0001883 | 276 |
| 2139 | 3300000044 | ARSoilOldRDRAFT_c000028 | ARSoilOldRDRAFT_00002824 | 276 |
| 2140 | 3300000045 | ARCol0oldRDRAFT_c00565 | ARCol0oldRDRAFT_005653 | 276 |
| 2141 | 3300000652 | ARCol0yngRDRAFT_1000057 | ARCol0yngRDRAFT_100005712 | 276 |
| 2142 | 3300001430 | JGI24032J14994_100133 | JGI24032J14994_1001333 | 276 |
| 2143 | 3300001976 | JGI24752J21851_1001260 | JGI24752J21851_10012603 | 276 |
| 2144 | 3300001977 | JGI24746J21847_1000137 | JGI24746J21847_10001378 | 276 |
| 2145 | 3300001978 | JGI24747J21853_1000013 | JGI24747J21853_10000133 | 276 |
| 2146 | 3300001989 | JGI24739J22299_10000400 | JGI24739J22299_1000040011 | 276 |
| 2147 | 3300001990 | JGI24737J22298_10000531 | JGI24737J22298_100005318 | 276 |
| 2148 | 3300001990 | JGI24737J22298_10002432 | JGI24737J22298_100024325 | 276 |
| 2149 | 3300002070 | JGI24750J21931_1000240 | JGI24750J21931_10002409 | 276 |
| 2150 | 3300002073 | JGI24745J21846_1000114 | JGI24745J21846_10001147 | 276 |
| 2151 | 3300002074 | JGI24748J21848_1000264 | JGI24748J21848_10002644 | 276 |
| 2152 | 3300002075 | JGI24738J21930_10002058 | JGI24738J21930_100020582 | 276 |
| 2153 | 3300002076 | JGI24749J21850_1003004 | JGI24749J21850_10030042 | 276 |
| 2154 | 3300002076 | JGI24749J21850_1007729 | JGI24749J21850_10077291 | 276 |
| 2155 | 3300002077 | JGI24744J21845_10006387 | JGI24744J21845_100063872 | 276 |
| 2156 | 3300002126 | JGI24035J26624_1000224 | JGI24035J26624_10002244 | 276 |
| 2157 | 3300002155 | JGI24033J26618_1000662 | JGI24033J26618_10006623 | 276 |
| 2158 | 3300002239 | JGI24034J26672_10001369 | JGI24034J26672_100013693 | 276 |
| 2159 | 3300002244 | JGI24742J22300_10000135 | JGI24742J22300_100001358 | 276 |
| 2160 | 3300003911 | JGI25405J52794_10002890 | JGI25405J52794_100028903 | 276 |
| 2161 | 3300005276 | Ga0065717_1002161 | Ga0065717_10021611 | 276 |
| 2162 | 3300005277 | Ga0065716_1002870 | Ga0065716_10028702 | 276 |
| 2163 | 3300005290 | Ga0065712_10001072 | Ga0065712_100010727 | 276 |
| 2164 | 3300005290 | Ga0065712_10006568 | Ga0065712_100065683 | 276 |
| 2165 | 3300005293 | Ga0065715_10000559 | Ga0065715_1000055911 | 276 |
| 2166 | 3300005293 | Ga0065715_10000988 | Ga0065715_100009886 | 276 |
| 2167 | 3300005327 | Ga0070658_10003419 | Ga0070658_1000341913 | 276 |
| 2168 | 3300005327 | Ga0070658_10052232 | Ga0070658_100522323 | 276 |
| 2169 | 3300005327 | Ga0070658_10072315 | Ga0070658_100723155 | 276 |
| 2170 | 3300005328 | Ga0070676_10000174 | Ga0070676_1000017421 | 276 |
| 2171 | 3300005328 | Ga0070676_10091025 | Ga0070676_100910252 | 276 |
| 2172 | 3300005329 | Ga0070683_100055976 | Ga0070683_1000559763 | 276 |
| 2173 | 3300005329 | Ga0070683_100179465 | Ga0070683_1001794652 | 276 |
| 2174 | 3300005329 | Ga0070683_100770555 | Ga0070683_1007705551 | 276 |
| 2175 | 3300005330 | Ga0070690_100000898 | Ga0070690_10000089813 | 276 |
| 2176 | 3300005330 | Ga0070690_100017757 | Ga0070690_1000177571 | 276 |
| 2177 | 3300005331 | Ga0070670_100035365 | Ga0070670_1000353651 | 276 |
| 2178 | 3300005331 | Ga0070670_100073543 | Ga0070670_1000735433 | 276 |
| 2179 | 3300005333 | Ga0070677_10000194 | Ga0070677_100001947 | 276 |
| 2180 | 3300005334 | Ga0068869_100000260 | Ga0068869_10000026022 | 276 |
| 2181 | 3300005335 | Ga0070666_10011624 | Ga0070666_100116247 | 276 |
| 2182 | 3300005335 | Ga0070666_10011732 | Ga0070666_100117324 | 276 |
| 2183 | 3300005335 | Ga0070666_10053643 | Ga0070666_100536433 | 276 |
| 2184 | 3300005336 | Ga0070680_100013955 | Ga0070680_1000139558 | 276 |
| 2185 | 3300005336 | Ga0070680_100016957 | Ga0070680_1000169573 | 276 |
| 2186 | 3300005336 | Ga0070680_100081515 | Ga0070680_1000815152 | 276 |
| 2187 | 3300005336 | Ga0070680_100124092 | Ga0070680_1001240922 | 276 |
| 2188 | 3300005336 | Ga0070680_100182287 | Ga0070680_1001822872 | 276 |
| 2189 | 3300005337 | Ga0070682_100000141 | Ga0070682_10000014151 | 276 |
| 2190 | 3300005337 | Ga0070682_100029121 | Ga0070682_1000291213 | 276 |
| 2191 | 3300005338 | Ga0068868_100004211 | Ga0068868_1000042117 | 276 |
| 2192 | 3300005338 | Ga0068868_100098559 | Ga0068868_1000985593 | 276 |
| 2193 | 3300005339 | Ga0070660_100000408 | Ga0070660_10000040831 | 276 |
| 2194 | 3300005339 | Ga0070660_100032982 | Ga0070660_1000329825 | 276 |
| 2195 | 3300005339 | Ga0070660_100150819 | Ga0070660_1001508192 | 276 |
| 2196 | 3300005339 | Ga0070660_100152049 | Ga0070660_1001520492 | 276 |
| 2197 | 3300005340 | Ga0070689_100000179 | Ga0070689_10000017935 | 276 |
| 2198 | 3300005340 | Ga0070689_100037080 | Ga0070689_1000370802 | 276 |
| 2199 | 3300005341 | Ga0070691_10000381 | Ga0070691_1000038112 | 276 |
| 2200 | 3300005341 | Ga0070691_10059778 | Ga0070691_100597783 | 276 |
| 2201 | 3300005341 | Ga0070691_10117334 | Ga0070691_101173342 | 276 |
| 2202 | 3300005343 | Ga0070687_100006870 | Ga0070687_1000068704 | 276 |
| 2203 | 3300005343 | Ga0070687_100113502 | Ga0070687_1001135021 | 276 |
| 2204 | 3300005344 | Ga0070661_100000898 | Ga0070661_1000008986 | 276 |
| 2205 | 3300005344 | Ga0070661_100037633 | Ga0070661_1000376335 | 276 |
| 2206 | 3300005344 | Ga0070661_100043723 | Ga0070661_1000437233 | 276 |
| 2207 | 3300005345 | Ga0070692_10000075 | Ga0070692_1000007515 | 276 |
| 2208 | 3300005347 | Ga0070668_100007936 | Ga0070668_1000079365 | 276 |
| 2209 | 3300005347 | Ga0070668_100380748 | Ga0070668_1003807482 | 276 |
| 2210 | 3300005353 | Ga0070669_100002705 | Ga0070669_1000027057 | 276 |
| 2211 | 3300005354 | Ga0070675_100000650 | Ga0070675_10000065011 | 276 |
| 2212 | 3300005355 | Ga0070671_100000690 | Ga0070671_1000006906 | 276 |
| 2213 | 3300005355 | Ga0070671_100006037 | Ga0070671_10000603711 | 276 |
| 2214 | 3300005355 | Ga0070671_100025121 | Ga0070671_1000251212 | 276 |
| 2215 | 3300005356 | Ga0070674_100001356 | Ga0070674_10000135612 | 276 |
| 2216 | 3300005356 | Ga0070674_100288010 | Ga0070674_1002880102 | 276 |
| 2217 | 3300005364 | Ga0070673_100000140 | Ga0070673_10000014018 | 276 |
| 2218 | 3300005364 | Ga0070673_100044060 | Ga0070673_1000440602 | 276 |
| 2219 | 3300005365 | Ga0070688_100001252 | Ga0070688_10000125212 | 276 |
| 2220 | 3300005365 | Ga0070688_100030387 | Ga0070688_1000303872 | 276 |
| 2221 | 3300005366 | Ga0070659_100003666 | Ga0070659_1000036664 | 276 |
| 2222 | 3300005366 | Ga0070659_100099191 | Ga0070659_1000991912 | 276 |
| 2223 | 3300005366 | Ga0070659_100203664 | Ga0070659_1002036642 | 276 |
| 2224 | 3300005366 | Ga0070659_100231999 | Ga0070659_1002319992 | 276 |
| 2225 | 3300005366 | Ga0070659_100346405 | Ga0070659_1003464052 | 276 |
| 2226 | 3300005367 | Ga0070667_100004745 | Ga0070667_1000047454 | 276 |
| 2227 | 3300005367 | Ga0070667_100107509 | Ga0070667_1001075092 | 276 |
| 2228 | 3300005367 | Ga0070667_100144438 | Ga0070667_1001444382 | 276 |
| 2229 | 3300005406 | Ga0070703_10002730 | Ga0070703_100027303 | 276 |
| 2230 | 3300005434 | Ga0070709_10022303 | Ga0070709_100223032 | 276 |
| 2231 | 3300005435 | Ga0070714_100002352 | Ga0070714_1000023525 | 276 |
| 2232 | 3300005435 | Ga0070714_100100977 | Ga0070714_1001009771 | 276 |
| 2233 | 3300005435 | Ga0070714_100120538 | Ga0070714_1001205383 | 276 |
| 2234 | 3300005436 | Ga0070713_100012353 | Ga0070713_1000123532 | 276 |
| 2235 | 3300005436 | Ga0070713_100061871 | Ga0070713_1000618713 | 276 |
| 2236 | 3300005436 | Ga0070713_100293961 | Ga0070713_1002939611 | 276 |
| 2237 | 3300005437 | Ga0070710_10034907 | Ga0070710_100349073 | 276 |
| 2238 | 3300005438 | Ga0070701_10000625 | Ga0070701_100006254 | 276 |
| 2239 | 3300005438 | Ga0070701_10064481 | Ga0070701_100644811 | 276 |
| 2240 | 3300005439 | Ga0070711_100112398 | Ga0070711_1001123981 | 276 |
| 2241 | 3300005440 | Ga0070705_100004136 | Ga0070705_1000041367 | 276 |
| 2242 | 3300005441 | Ga0070700_100013930 | Ga0070700_1000139301 | 276 |
| 2243 | 3300005441 | Ga0070700_100128649 | Ga0070700_1001286492 | 276 |
| 2244 | 3300005444 | Ga0070694_100000797 | Ga0070694_10000079714 | 276 |
| 2245 | 3300005444 | Ga0070694_100003678 | Ga0070694_1000036786 | 276 |
| 2246 | 3300005445 | Ga0070708_100453291 | Ga0070708_1004532911 | 276 |
| 2247 | 3300005455 | Ga0070663_100003209 | Ga0070663_1000032097 | 276 |
| 2248 | 3300005455 | Ga0070663_100014800 | Ga0070663_1000148005 | 276 |
| 2249 | 3300005456 | Ga0070678_100000125 | Ga0070678_10000012512 | 276 |
| 2250 | 3300005457 | Ga0070662_100006627 | Ga0070662_1000066273 | 276 |
| 2251 | 3300005457 | Ga0070662_100046587 | Ga0070662_1000465873 | 276 |
| 2252 | 3300005457 | Ga0070662_100143060 | Ga0070662_1001430601 | 276 |
| 2253 | 3300005458 | Ga0070681_10003210 | Ga0070681_1000321011 | 276 |
| 2254 | 3300005458 | Ga0070681_10070283 | Ga0070681_100702833 | 276 |
| 2255 | 3300005458 | Ga0070681_10232697 | Ga0070681_102326972 | 276 |
| 2256 | 3300005459 | Ga0068867_100000260 | Ga0068867_10000026025 | 276 |
| 2257 | 3300005459 | Ga0068867_100134170 | Ga0068867_1001341702 | 276 |
| 2258 | 3300005466 | Ga0070685_10000957 | Ga0070685_1000095720 | 276 |
| 2259 | 3300005530 | Ga0070679_100001673 | Ga0070679_1000016733 | 276 |
| 2260 | 3300005530 | Ga0070679_100066377 | Ga0070679_1000663774 | 276 |
| 2261 | 3300005530 | Ga0070679_100077347 | Ga0070679_1000773474 | 276 |
| 2262 | 3300005530 | Ga0070679_100152198 | Ga0070679_1001521983 | 276 |
| 2263 | 3300005530 | Ga0070679_100201165 | Ga0070679_1002011653 | 276 |
| 2264 | 3300005530 | Ga0070679_100322291 | Ga0070679_1003222911 | 276 |
| 2265 | 3300005530 | Ga0070679_100421267 | Ga0070679_1004212672 | 276 |
| 2266 | 3300005530 | Ga0070679_100505135 | Ga0070679_1005051351 | 276 |
| 2267 | 3300005535 | Ga0070684_100000145 | Ga0070684_10000014534 | 276 |
| 2268 | 3300005535 | Ga0070684_100074969 | Ga0070684_1000749693 | 276 |
| 2269 | 3300005535 | Ga0070684_100807923 | Ga0070684_1008079231 | 276 |
| 2270 | 3300005536 | Ga0070697_100430363 | Ga0070697_1004303631 | 276 |
| 2271 | 3300005539 | Ga0068853_100002655 | Ga0068853_10000265514 | 276 |
| 2272 | 3300005539 | Ga0068853_100638603 | Ga0068853_1006386031 | 276 |
| 2273 | 3300005543 | Ga0070672_100000307 | Ga0070672_10000030713 | 276 |
| 2274 | 3300005543 | Ga0070672_100071053 | Ga0070672_1000710532 | 276 |
| 2275 | 3300005544 | Ga0070686_100001373 | Ga0070686_10000137311 | 276 |
| 2276 | 3300005544 | Ga0070686_100018296 | Ga0070686_1000182966 | 276 |
| 2277 | 3300005544 | Ga0070686_100077584 | Ga0070686_1000775842 | 276 |
| 2278 | 3300005545 | Ga0070695_100004808 | Ga0070695_1000048085 | 276 |
| 2279 | 3300005545 | Ga0070695_100007987 | Ga0070695_1000079874 | 276 |
| 2280 | 3300005545 | Ga0070695_100154710 | Ga0070695_1001547102 | 276 |
| 2281 | 3300005546 | Ga0070696_100016423 | Ga0070696_1000164234 | 276 |
| 2282 | 3300005546 | Ga0070696_100242783 | Ga0070696_1002427832 | 276 |
| 2283 | 3300005547 | Ga0070693_100004447 | Ga0070693_1000044476 | 276 |
| 2284 | 3300005547 | Ga0070693_100010465 | Ga0070693_1000104655 | 276 |
| 2285 | 3300005547 | Ga0070693_100063637 | Ga0070693_1000636372 | 276 |
| 2286 | 3300005548 | Ga0070665_100105556 | Ga0070665_1001055564 | 276 |
| 2287 | 3300005548 | Ga0070665_100266074 | Ga0070665_1002660742 | 276 |
| 2288 | 3300005549 | Ga0070704_100000971 | Ga0070704_10000097114 | 276 |
| 2289 | 3300005549 | Ga0070704_100003196 | Ga0070704_1000031967 | 276 |
| 2290 | 3300005549 | Ga0070704_100127670 | Ga0070704_1001276702 | 276 |
| 2291 | 3300005563 | Ga0068855_100010074 | Ga0068855_1000100748 | 276 |
| 2292 | 3300005563 | Ga0068855_100045548 | Ga0068855_1000455484 | 276 |
| 2293 | 3300005563 | Ga0068855_100232873 | Ga0068855_1002328733 | 276 |
| 2294 | 3300005564 | Ga0070664_100001196 | Ga0070664_10000119618 | 276 |
| 2295 | 3300005564 | Ga0070664_100035333 | Ga0070664_1000353335 | 276 |
| 2296 | 3300005564 | Ga0070664_100058190 | Ga0070664_1000581902 | 276 |
| 2297 | 3300005564 | Ga0070664_100184368 | Ga0070664_1001843682 | 276 |
| 2298 | 3300005577 | Ga0068857_100007702 | Ga0068857_10000770212 | 276 |
| 2299 | 3300005577 | Ga0068857_100298575 | Ga0068857_1002985752 | 276 |
| 2300 | 3300005578 | Ga0068854_100019924 | Ga0068854_1000199245 | 276 |
| 2301 | 3300005578 | Ga0068854_100148738 | Ga0068854_1001487381 | 276 |
| 2302 | 3300005614 | Ga0068856_100001970 | Ga0068856_10000197020 | 276 |
| 2303 | 3300005614 | Ga0068856_100126899 | Ga0068856_1001268992 | 276 |
| 2304 | 3300005614 | Ga0068856_100164389 | Ga0068856_1001643892 | 276 |
| 2305 | 3300005614 | Ga0068856_100539635 | Ga0068856_1005396351 | 276 |
| 2306 | 3300005615 | Ga0070702_100000318 | Ga0070702_10000031814 | 276 |
| 2307 | 3300005616 | Ga0068852_100014756 | Ga0068852_1000147567 | 276 |
| 2308 | 3300005616 | Ga0068852_100034218 | Ga0068852_1000342182 | 276 |
| 2309 | 3300005616 | Ga0068852_100043249 | Ga0068852_1000432492 | 276 |
| 2310 | 3300005616 | Ga0068852_100214745 | Ga0068852_1002147452 | 276 |
| 2311 | 3300005617 | Ga0068859_100008171 | Ga0068859_1000081715 | 276 |
| 2312 | 3300005617 | Ga0068859_100029050 | Ga0068859_1000290503 | 276 |
| 2313 | 3300005617 | Ga0068859_100172295 | Ga0068859_1001722953 | 276 |
| 2314 | 3300005618 | Ga0068864_100005535 | Ga0068864_1000055353 | 276 |
| 2315 | 3300005618 | Ga0068864_100025377 | Ga0068864_1000253777 | 276 |
| 2316 | 3300005718 | Ga0068866_10002714 | Ga0068866_100027144 | 276 |
| 2317 | 3300005719 | Ga0068861_100007326 | Ga0068861_1000073262 | 276 |
| 2318 | 3300005719 | Ga0068861_100253136 | Ga0068861_1002531363 | 276 |
| 2319 | 3300005834 | Ga0068851_10030836 | Ga0068851_100308364 | 276 |
| 2320 | 3300005834 | Ga0068851_10053995 | Ga0068851_100539952 | 276 |
| 2321 | 3300005840 | Ga0068870_10000114 | Ga0068870_1000011421 | 276 |
| 2322 | 3300005841 | Ga0068863_100052497 | Ga0068863_1000524976 | 276 |
| 2323 | 3300005841 | Ga0068863_100367217 | Ga0068863_1003672172 | 276 |
| 2324 | 3300005842 | Ga0068858_100002190 | Ga0068858_1000021905 | 276 |
| 2325 | 3300005842 | Ga0068858_100081088 | Ga0068858_1000810883 | 276 |
| 2326 | 3300005843 | Ga0068860_100000550 | Ga0068860_10000055023 | 276 |
| 2327 | 3300005843 | Ga0068860_100051781 | Ga0068860_1000517812 | 276 |
| 2328 | 3300005843 | Ga0068860_100122832 | Ga0068860_1001228323 | 276 |
| 2329 | 3300005843 | Ga0068860_100126507 | Ga0068860_1001265072 | 276 |
| 2330 | 3300005844 | Ga0068862_100007745 | Ga0068862_1000077456 | 276 |
| 2331 | 3300005844 | Ga0068862_100068662 | Ga0068862_1000686624 | 276 |
| 2332 | 3300005937 | Ga0081455_10000237 | Ga0081455_1000023730 | 276 |
| 2333 | 3300005937 | Ga0081455_10001351 | Ga0081455_100013516 | 276 |
| 2334 | 3300005937 | Ga0081455_10044817 | Ga0081455_100448173 | 276 |
| 2335 | 3300005983 | Ga0081540_1057755 | Ga0081540_10577552 | 276 |
| 2336 | 3300006028 | Ga0070717_10003859 | Ga0070717_100038598 | 276 |
| 2337 | 3300006163 | Ga0070715_10037890 | Ga0070715_100378903 | 276 |
| 2338 | 3300006175 | Ga0070712_100071741 | Ga0070712_1000717412 | 276 |
| 2339 | 3300006175 | Ga0070712_100095593 | Ga0070712_1000955933 | 276 |
| 2340 | 3300006178 | Ga0075367_10007767 | Ga0075367_100077677 | 276 |
| 2341 | 3300006194 | Ga0075427_10000718 | Ga0075427_100007184 | 276 |
| 2342 | 3300006237 | Ga0097621_100000010 | Ga0097621_1000000103 | 276 |
| 2343 | 3300006358 | Ga0068871_100000034 | Ga0068871_10000003468 | 276 |
| 2344 | 3300006358 | Ga0068871_100025867 | Ga0068871_1000258676 | 276 |
| 2345 | 3300006358 | Ga0068871_100027389 | Ga0068871_1000273895 | 276 |
| 2346 | 3300006844 | Ga0075428_100372214 | Ga0075428_1003722143 | 276 |
| 2347 | 3300006846 | Ga0075430_100005198 | Ga0075430_1000051989 | 276 |
| 2348 | 3300006847 | Ga0075431_100024458 | Ga0075431_1000244584 | 276 |
| 2349 | 3300006852 | Ga0075433_10010531 | Ga0075433_100105317 | 276 |
| 2350 | 3300006871 | Ga0075434_100000565 | Ga0075434_10000056532 | 276 |
| 2351 | 3300006871 | Ga0075434_100016837 | Ga0075434_1000168376 | 276 |
| 2352 | 3300006871 | Ga0075434_100059853 | Ga0075434_1000598536 | 276 |
| 2353 | 3300006871 | Ga0075434_100123199 | Ga0075434_1001231994 | 276 |
| 2354 | 3300006871 | Ga0075434_100162138 | Ga0075434_1001621381 | 276 |
| 2355 | 3300006880 | Ga0075429_100004570 | Ga0075429_10000457010 | 276 |
| 2356 | 3300006881 | Ga0068865_100000258 | Ga0068865_1000002584 | 276 |
| 2357 | 3300006881 | Ga0068865_100012087 | Ga0068865_1000120878 | 276 |
| 2358 | 3300006881 | Ga0068865_100156784 | Ga0068865_1001567842 | 276 |
| 2359 | 3300006914 | Ga0075436_100068030 | Ga0075436_1000680303 | 276 |
| 2360 | 3300006914 | Ga0075436_100227166 | Ga0075436_1002271661 | 276 |
| 2361 | 3300006914 | Ga0075436_100336677 | Ga0075436_1003366772 | 276 |
| 2362 | 3300006931 | Ga0097620_100008171 | Ga0097620_10000817111 | 276 |
| 2363 | 3300006931 | Ga0097620_100029052 | Ga0097620_1000290523 | 276 |
| 2364 | 3300006931 | Ga0097620_100172302 | Ga0097620_1001723023 | 276 |
| 2365 | 3300007076 | Ga0075435_100029577 | Ga0075435_1000295777 | 276 |
| 2366 | 3300009011 | Ga0105251_10029443 | Ga0105251_100294433 | 276 |
| 2367 | 3300009092 | Ga0105250_10036422 | Ga0105250_100364222 | 276 |
| 2368 | 3300009093 | Ga0105240_10139463 | Ga0105240_101394633 | 276 |
| 2369 | 3300009094 | Ga0111539_10000500 | Ga0111539_100005004 | 276 |
| 2370 | 3300009094 | Ga0111539_10001486 | Ga0111539_1000148613 | 276 |
| 2371 | 3300009094 | Ga0111539_10003625 | Ga0111539_1000362518 | 276 |
| 2372 | 3300009098 | Ga0105245_10003131 | Ga0105245_1000313110 | 276 |
| 2373 | 3300009098 | Ga0105245_10256166 | Ga0105245_102561661 | 276 |
| 2374 | 3300009101 | Ga0105247_10002505 | Ga0105247_100025051 | 276 |
| 2375 | 3300009101 | Ga0105247_10010561 | Ga0105247_100105615 | 276 |
| 2376 | 3300009101 | Ga0105247_10099429 | Ga0105247_100994292 | 276 |
| 2377 | 3300009147 | Ga0114129_10033328 | Ga0114129_100333286 | 276 |
| 2378 | 3300009148 | Ga0105243_10016989 | Ga0105243_100169894 | 276 |
| 2379 | 3300009148 | Ga0105243_10088180 | Ga0105243_100881803 | 276 |
| 2380 | 3300009148 | Ga0105243_10169275 | Ga0105243_101692752 | 276 |
| 2381 | 3300009174 | Ga0105241_10001911 | Ga0105241_100019118 | 276 |
| 2382 | 3300009174 | Ga0105241_10370202 | Ga0105241_103702021 | 276 |
| 2383 | 3300009176 | Ga0105242_10000037 | Ga0105242_1000003721 | 276 |
| 2384 | 3300009176 | Ga0105242_10155344 | Ga0105242_101553442 | 276 |
| 2385 | 3300009177 | Ga0105248_10002195 | Ga0105248_1000219512 | 276 |
| 2386 | 3300009545 | Ga0105237_10063301 | Ga0105237_100633012 | 276 |
| 2387 | 3300009551 | Ga0105238_10023052 | Ga0105238_100230528 | 276 |
| 2388 | 3300009551 | Ga0105238_10096421 | Ga0105238_100964213 | 276 |
| 2389 | 3300009551 | Ga0105238_10124656 | Ga0105238_101246563 | 276 |
| 2390 | 3300009551 | Ga0105238_10129451 | Ga0105238_101294513 | 276 |
| 2391 | 3300009553 | Ga0105249_10000209 | Ga0105249_1000020912 | 276 |
| 2392 | 3300009553 | Ga0105249_10033836 | Ga0105249_100338366 | 276 |
| 2393 | 3300009553 | Ga0105249_10240650 | Ga0105249_102406503 | 276 |
| 2394 | 3300009553 | Ga0105249_10304666 | Ga0105249_103046662 | 276 |
| 2395 | 3300010375 | Ga0105239_10006977 | Ga0105239_1000697710 | 276 |
| 2396 | 3300010375 | Ga0105239_10009869 | Ga0105239_100098699 | 276 |
| 2397 | 3300010375 | Ga0105239_10028131 | Ga0105239_100281315 | 276 |
| 2398 | 3300010375 | Ga0105239_10194863 | Ga0105239_101948632 | 276 |
| 2399 | 3300010375 | Ga0105239_10358720 | Ga0105239_103587202 | 276 |
| 2400 | 3300010375 | Ga0105239_10430800 | Ga0105239_104308001 | 276 |
| 2401 | 3300011119 | Ga0105246_10000614 | Ga0105246_1000061416 | 276 |
| 2402 | 3300011119 | Ga0105246_10328221 | Ga0105246_103282211 | 276 |
| 2403 | 3300012515 | Ga0157338_1001045 | Ga0157338_10010452 | 276 |
| 2404 | 3300013100 | Ga0157373_10030942 | Ga0157373_100309424 | 276 |
| 2405 | 3300013102 | Ga0157371_10015657 | Ga0157371_100156575 | 276 |
| 2406 | 3300013102 | Ga0157371_10121499 | Ga0157371_101214993 | 276 |
| 2407 | 3300013104 | Ga0157370_10238146 | Ga0157370_102381461 | 276 |
| 2408 | 3300013105 | Ga0157369_10306067 | Ga0157369_103060672 | 276 |
| 2409 | 3300013105 | Ga0157369_10405496 | Ga0157369_104054962 | 276 |
| 2410 | 3300013105 | Ga0157369_10623480 | Ga0157369_106234801 | 276 |
| 2411 | 3300013296 | Ga0157374_10019131 | Ga0157374_100191316 | 276 |
| 2412 | 3300013297 | Ga0157378_10000566 | Ga0157378_1000056625 | 276 |
| 2413 | 3300013306 | Ga0163162_10000896 | Ga0163162_1000089612 | 276 |
| 2414 | 3300013306 | Ga0163162_10005353 | Ga0163162_100053539 | 276 |
| 2415 | 3300013306 | Ga0163162_10023128 | Ga0163162_100231283 | 276 |
| 2416 | 3300013307 | Ga0157372_10118899 | Ga0157372_101188993 | 276 |
| 2417 | 3300013307 | Ga0157372_10219645 | Ga0157372_102196452 | 276 |
| 2418 | 3300013307 | Ga0157372_10653491 | Ga0157372_106534912 | 276 |
| 2419 | 3300013307 | Ga0157372_10834172 | Ga0157372_108341721 | 276 |
| 2420 | 3300013308 | Ga0157375_10000263 | Ga0157375_1000026316 | 276 |
| 2421 | 3300013308 | Ga0157375_10040699 | Ga0157375_100406995 | 276 |
| 2422 | 3300014325 | Ga0163163_10052731 | Ga0163163_100527311 | 276 |
| 2423 | 3300014325 | Ga0163163_10299537 | Ga0163163_102995372 | 276 |
| 2424 | 3300014325 | Ga0163163_10497105 | Ga0163163_104971052 | 276 |
| 2425 | 3300014326 | Ga0157380_10001922 | Ga0157380_1000192210 | 276 |
| 2426 | 3300014745 | Ga0157377_10000214 | Ga0157377_1000021429 | 276 |
| 2427 | 3300014745 | Ga0157377_10106629 | Ga0157377_101066292 | 276 |
| 2428 | 3300014968 | Ga0157379_10000666 | Ga0157379_1000066625 | 276 |
| 2429 | 3300014968 | Ga0157379_10271196 | Ga0157379_102711961 | 276 |
| 2430 | 3300014969 | Ga0157376_10000879 | Ga0157376_100008798 | 276 |
| 2431 | 3300017792 | Ga0163161_10003116 | Ga0163161_100031166 | 276 |
| 2432 | 3300017792 | Ga0163161_10118372 | Ga0163161_101183723 | 276 |
| 2433 | 3300017792 | Ga0163161_10205959 | Ga0163161_102059592 | 276 |
| 2434 | 3300020069 | Ga0197907_10374128 | Ga0197907_103741281 | 276 |
| 2435 | 3300020070 | Ga0206356_10019253 | Ga0206356_100192532 | 276 |
| 2436 | 3300020070 | Ga0206356_11744201 | Ga0206356_117442012 | 276 |
| 2437 | 3300022467 | Ga0224712_10074973 | Ga0224712_100749732 | 276 |
| 2438 | 3300025271 | Ga0207666_1000010 | Ga0207666_100001046 | 276 |
| 2439 | 3300025271 | Ga0207666_1000379 | Ga0207666_10003793 | 276 |
| 2440 | 3300025290 | Ga0207673_1000091 | Ga0207673_10000919 | 276 |
| 2441 | 3300025315 | Ga0207697_10000424 | Ga0207697_1000042410 | 276 |
| 2442 | 3300025315 | Ga0207697_10005789 | Ga0207697_100057896 | 276 |
| 2443 | 3300025321 | Ga0207656_10082012 | Ga0207656_100820122 | 276 |
| 2444 | 3300025711 | Ga0207696_1023741 | Ga0207696_10237413 | 276 |
| 2445 | 3300025885 | Ga0207653_10007266 | Ga0207653_100072663 | 276 |
| 2446 | 3300025893 | Ga0207682_10000035 | Ga0207682_1000003525 | 276 |
| 2447 | 3300025898 | Ga0207692_10001776 | Ga0207692_100017763 | 276 |
| 2448 | 3300025898 | Ga0207692_10034699 | Ga0207692_100346991 | 276 |
| 2449 | 3300025898 | Ga0207692_10117796 | Ga0207692_101177961 | 276 |
| 2450 | 3300025899 | Ga0207642_10002311 | Ga0207642_100023113 | 276 |
| 2451 | 3300025901 | Ga0207688_10002888 | Ga0207688_100028884 | 276 |
| 2452 | 3300025901 | Ga0207688_10124428 | Ga0207688_101244282 | 276 |
| 2453 | 3300025903 | Ga0207680_10024905 | Ga0207680_100249053 | 276 |
| 2454 | 3300025903 | Ga0207680_10025139 | Ga0207680_100251393 | 276 |
| 2455 | 3300025903 | Ga0207680_10138629 | Ga0207680_101386293 | 276 |
| 2456 | 3300025904 | Ga0207647_10005370 | Ga0207647_100053704 | 276 |
| 2457 | 3300025904 | Ga0207647_10017164 | Ga0207647_100171643 | 276 |
| 2458 | 3300025905 | Ga0207685_10011259 | Ga0207685_100112593 | 276 |
| 2459 | 3300025905 | Ga0207685_10221766 | Ga0207685_102217661 | 276 |
| 2460 | 3300025906 | Ga0207699_10000837 | Ga0207699_1000083716 | 276 |
| 2461 | 3300025906 | Ga0207699_10288406 | Ga0207699_102884061 | 276 |
| 2462 | 3300025907 | Ga0207645_10005339 | Ga0207645_1000533910 | 276 |
| 2463 | 3300025907 | Ga0207645_10048611 | Ga0207645_100486112 | 276 |
| 2464 | 3300025907 | Ga0207645_10162128 | Ga0207645_101621281 | 276 |
| 2465 | 3300025908 | Ga0207643_10000147 | Ga0207643_1000014721 | 276 |
| 2466 | 3300025911 | Ga0207654_10001288 | Ga0207654_1000128811 | 276 |
| 2467 | 3300025912 | Ga0207707_10009366 | Ga0207707_100093666 | 276 |
| 2468 | 3300025912 | Ga0207707_10039324 | Ga0207707_100393243 | 276 |
| 2469 | 3300025912 | Ga0207707_10080096 | Ga0207707_100800962 | 276 |
| 2470 | 3300025913 | Ga0207695_10163070 | Ga0207695_101630703 | 276 |
| 2471 | 3300025914 | Ga0207671_10017241 | Ga0207671_100172416 | 276 |
| 2472 | 3300025915 | Ga0207693_10002714 | Ga0207693_1000271418 | 276 |
| 2473 | 3300025915 | Ga0207693_10005189 | Ga0207693_1000518910 | 276 |
| 2474 | 3300025915 | Ga0207693_10016626 | Ga0207693_100166262 | 276 |
| 2475 | 3300025915 | Ga0207693_10129901 | Ga0207693_101299013 | 276 |
| 2476 | 3300025916 | Ga0207663_10021096 | Ga0207663_100210962 | 276 |
| 2477 | 3300025916 | Ga0207663_10092998 | Ga0207663_100929983 | 276 |
| 2478 | 3300025916 | Ga0207663_10189864 | Ga0207663_101898642 | 276 |
| 2479 | 3300025917 | Ga0207660_10001257 | Ga0207660_1000125710 | 276 |
| 2480 | 3300025917 | Ga0207660_10055630 | Ga0207660_100556302 | 276 |
| 2481 | 3300025917 | Ga0207660_10121584 | Ga0207660_101215842 | 276 |
| 2482 | 3300025917 | Ga0207660_10125900 | Ga0207660_101259002 | 276 |
| 2483 | 3300025917 | Ga0207660_10190343 | Ga0207660_101903432 | 276 |
| 2484 | 3300025918 | Ga0207662_10006511 | Ga0207662_100065114 | 276 |
| 2485 | 3300025918 | Ga0207662_10036523 | Ga0207662_100365232 | 276 |
| 2486 | 3300025919 | Ga0207657_10007742 | Ga0207657_1000774211 | 276 |
| 2487 | 3300025919 | Ga0207657_10032905 | Ga0207657_100329052 | 276 |
| 2488 | 3300025919 | Ga0207657_10043825 | Ga0207657_100438255 | 276 |
| 2489 | 3300025920 | Ga0207649_10000585 | Ga0207649_1000058520 | 276 |
| 2490 | 3300025920 | Ga0207649_10349266 | Ga0207649_103492662 | 276 |
| 2491 | 3300025921 | Ga0207652_10006627 | Ga0207652_100066272 | 276 |
| 2492 | 3300025921 | Ga0207652_10047555 | Ga0207652_100475552 | 276 |
| 2493 | 3300025921 | Ga0207652_10085671 | Ga0207652_100856714 | 276 |
| 2494 | 3300025921 | Ga0207652_10145164 | Ga0207652_101451642 | 276 |
| 2495 | 3300025921 | Ga0207652_10168657 | Ga0207652_101686573 | 276 |
| 2496 | 3300025921 | Ga0207652_10409805 | Ga0207652_104098051 | 276 |
| 2497 | 3300025921 | Ga0207652_10545141 | Ga0207652_105451411 | 276 |
| 2498 | 3300025923 | Ga0207681_10002111 | Ga0207681_1000211112 | 276 |
| 2499 | 3300025924 | Ga0207694_10015318 | Ga0207694_100153187 | 276 |
| 2500 | 3300025924 | Ga0207694_10074045 | Ga0207694_100740453 | 276 |
| 2501 | 3300025924 | Ga0207694_10101058 | Ga0207694_101010583 | 276 |
| 2502 | 3300025924 | Ga0207694_10196832 | Ga0207694_101968322 | 276 |
| 2503 | 3300025925 | Ga0207650_10012089 | Ga0207650_100120899 | 276 |
| 2504 | 3300025925 | Ga0207650_10360305 | Ga0207650_103603052 | 276 |
| 2505 | 3300025925 | Ga0207650_10427307 | Ga0207650_104273072 | 276 |
| 2506 | 3300025926 | Ga0207659_10002165 | Ga0207659_1000216510 | 276 |
| 2507 | 3300025927 | Ga0207687_10000373 | Ga0207687_100003733 | 276 |
| 2508 | 3300025927 | Ga0207687_10005010 | Ga0207687_100050102 | 276 |
| 2509 | 3300025928 | Ga0207700_10000775 | Ga0207700_100007751 | 276 |
| 2510 | 3300025929 | Ga0207664_10003741 | Ga0207664_100037419 | 276 |
| 2511 | 3300025929 | Ga0207664_10209220 | Ga0207664_102092203 | 276 |
| 2512 | 3300025929 | Ga0207664_10306496 | Ga0207664_103064961 | 276 |
| 2513 | 3300025931 | Ga0207644_10009611 | Ga0207644_100096115 | 276 |
| 2514 | 3300025931 | Ga0207644_10055330 | Ga0207644_100553303 | 276 |
| 2515 | 3300025931 | Ga0207644_10217076 | Ga0207644_102170762 | 276 |
| 2516 | 3300025932 | Ga0207690_10021242 | Ga0207690_100212424 | 276 |
| 2517 | 3300025932 | Ga0207690_10038897 | Ga0207690_100388972 | 276 |
| 2518 | 3300025933 | Ga0207706_10008770 | Ga0207706_1000877010 | 276 |
| 2519 | 3300025933 | Ga0207706_10020035 | Ga0207706_100200354 | 276 |
| 2520 | 3300025933 | Ga0207706_10026140 | Ga0207706_100261403 | 276 |
| 2521 | 3300025933 | Ga0207706_10047431 | Ga0207706_100474313 | 276 |
| 2522 | 3300025934 | Ga0207686_10009442 | Ga0207686_100094427 | 276 |
| 2523 | 3300025934 | Ga0207686_10168759 | Ga0207686_101687592 | 276 |
| 2524 | 3300025935 | Ga0207709_10000374 | Ga0207709_1000037440 | 276 |
| 2525 | 3300025935 | Ga0207709_10021587 | Ga0207709_100215873 | 276 |
| 2526 | 3300025935 | Ga0207709_10125408 | Ga0207709_101254082 | 276 |
| 2527 | 3300025936 | Ga0207670_10007805 | Ga0207670_100078053 | 276 |
| 2528 | 3300025936 | Ga0207670_10128852 | Ga0207670_101288522 | 276 |
| 2529 | 3300025937 | Ga0207669_10000587 | Ga0207669_1000058710 | 276 |
| 2530 | 3300025938 | Ga0207704_10000119 | Ga0207704_1000011913 | 276 |
| 2531 | 3300025938 | Ga0207704_10114392 | Ga0207704_101143922 | 276 |
| 2532 | 3300025939 | Ga0207665_10000654 | Ga0207665_1000065410 | 276 |
| 2533 | 3300025940 | Ga0207691_10009502 | Ga0207691_1000950210 | 276 |
| 2534 | 3300025940 | Ga0207691_10047431 | Ga0207691_100474315 | 276 |
| 2535 | 3300025941 | Ga0207711_10004053 | Ga0207711_100040532 | 276 |
| 2536 | 3300025941 | Ga0207711_10006173 | Ga0207711_100061733 | 276 |
| 2537 | 3300025941 | Ga0207711_10240675 | Ga0207711_102406753 | 276 |
| 2538 | 3300025941 | Ga0207711_10292550 | Ga0207711_102925502 | 276 |
| 2539 | 3300025942 | Ga0207689_10002861 | Ga0207689_1000286110 | 276 |
| 2540 | 3300025942 | Ga0207689_10026454 | Ga0207689_100264545 | 276 |
| 2541 | 3300025942 | Ga0207689_10094496 | Ga0207689_100944962 | 276 |
| 2542 | 3300025944 | Ga0207661_10001255 | Ga0207661_1000125511 | 276 |
| 2543 | 3300025944 | Ga0207661_10153493 | Ga0207661_101534933 | 276 |
| 2544 | 3300025944 | Ga0207661_10709749 | Ga0207661_107097491 | 276 |
| 2545 | 3300025945 | Ga0207679_10000224 | Ga0207679_100002249 | 276 |
| 2546 | 3300025945 | Ga0207679_10125973 | Ga0207679_101259731 | 276 |
| 2547 | 3300025945 | Ga0207679_10334582 | Ga0207679_103345821 | 276 |
| 2548 | 3300025949 | Ga0207667_10053003 | Ga0207667_100530035 | 276 |
| 2549 | 3300025949 | Ga0207667_10075762 | Ga0207667_100757622 | 276 |
| 2550 | 3300025949 | Ga0207667_10132526 | Ga0207667_101325264 | 276 |
| 2551 | 3300025949 | Ga0207667_10393999 | Ga0207667_103939991 | 276 |
| 2552 | 3300025960 | Ga0207651_10000400 | Ga0207651_1000040020 | 276 |
| 2553 | 3300025960 | Ga0207651_10065661 | Ga0207651_100656613 | 276 |
| 2554 | 3300025961 | Ga0207712_10002420 | Ga0207712_1000242010 | 276 |
| 2555 | 3300025961 | Ga0207712_10072600 | Ga0207712_100726002 | 276 |
| 2556 | 3300025961 | Ga0207712_10102636 | Ga0207712_101026362 | 276 |
| 2557 | 3300025972 | Ga0207668_10000698 | Ga0207668_1000069821 | 276 |
| 2558 | 3300025972 | Ga0207668_10034833 | Ga0207668_100348334 | 276 |
| 2559 | 3300025972 | Ga0207668_10081745 | Ga0207668_100817453 | 276 |
| 2560 | 3300025972 | Ga0207668_10085169 | Ga0207668_100851692 | 276 |
| 2561 | 3300025981 | Ga0207640_10002531 | Ga0207640_100025318 | 276 |
| 2562 | 3300025981 | Ga0207640_10068098 | Ga0207640_100680982 | 276 |
| 2563 | 3300025986 | Ga0207658_10010812 | Ga0207658_100108123 | 276 |
| 2564 | 3300025986 | Ga0207658_10077886 | Ga0207658_100778863 | 276 |
| 2565 | 3300026023 | Ga0207677_10001410 | Ga0207677_1000141011 | 276 |
| 2566 | 3300026035 | Ga0207703_10001072 | Ga0207703_1000107219 | 276 |
| 2567 | 3300026035 | Ga0207703_10011414 | Ga0207703_100114141 | 276 |
| 2568 | 3300026035 | Ga0207703_10126880 | Ga0207703_101268801 | 276 |
| 2569 | 3300026041 | Ga0207639_10000756 | Ga0207639_1000075617 | 276 |
| 2570 | 3300026041 | Ga0207639_10132081 | Ga0207639_101320812 | 276 |
| 2571 | 3300026067 | Ga0207678_10002752 | Ga0207678_1000275212 | 276 |
| 2572 | 3300026067 | Ga0207678_10019314 | Ga0207678_100193148 | 276 |
| 2573 | 3300026067 | Ga0207678_10033690 | Ga0207678_100336906 | 276 |
| 2574 | 3300026067 | Ga0207678_10054803 | Ga0207678_100548033 | 276 |
| 2575 | 3300026075 | Ga0207708_10004096 | Ga0207708_100040965 | 276 |
| 2576 | 3300026075 | Ga0207708_10009115 | Ga0207708_100091156 | 276 |
| 2577 | 3300026078 | Ga0207702_10065778 | Ga0207702_100657783 | 276 |
| 2578 | 3300026088 | Ga0207641_10002800 | Ga0207641_100028007 | 276 |
| 2579 | 3300026088 | Ga0207641_10213424 | Ga0207641_102134242 | 276 |
| 2580 | 3300026088 | Ga0207641_10272044 | Ga0207641_102720442 | 276 |
| 2581 | 3300026089 | Ga0207648_10009523 | Ga0207648_100095234 | 276 |
| 2582 | 3300026095 | Ga0207676_10000347 | Ga0207676_100003474 | 276 |
| 2583 | 3300026095 | Ga0207676_10045167 | Ga0207676_100451672 | 276 |
| 2584 | 3300026095 | Ga0207676_10717307 | Ga0207676_107173071 | 276 |
| 2585 | 3300026116 | Ga0207674_10000608 | Ga0207674_1000060846 | 276 |
| 2586 | 3300026116 | Ga0207674_10203368 | Ga0207674_102033682 | 276 |
| 2587 | 3300026116 | Ga0207674_10277790 | Ga0207674_102777902 | 276 |
| 2588 | 3300026116 | Ga0207674_10315933 | Ga0207674_103159332 | 276 |
| 2589 | 3300026118 | Ga0207675_100003249 | Ga0207675_10000324912 | 276 |
| 2590 | 3300026118 | Ga0207675_100027599 | Ga0207675_1000275994 | 276 |
| 2591 | 3300026121 | Ga0207683_10000082 | Ga0207683_1000008284 | 276 |
| 2592 | 3300026121 | Ga0207683_10001639 | Ga0207683_1000163923 | 276 |
| 2593 | 3300026121 | Ga0207683_10008081 | Ga0207683_1000808112 | 276 |
| 2594 | 3300026142 | Ga0207698_10004048 | Ga0207698_100040483 | 276 |
| 2595 | 3300026142 | Ga0207698_10030646 | Ga0207698_100306465 | 276 |
| 2596 | 3300026142 | Ga0207698_10149564 | Ga0207698_101495643 | 276 |
| 2597 | 3300026142 | Ga0207698_10318487 | Ga0207698_103184872 | 276 |
| 2598 | 3300027617 | Ga0210002_1001110 | Ga0210002_10011102 | 276 |
| 2599 | 3300027665 | Ga0209983_1002766 | Ga0209983_10027663 | 276 |
| 2600 | 3300027682 | Ga0209971_1013067 | Ga0209971_10130671 | 276 |
| 2601 | 3300027695 | Ga0209966_1004480 | Ga0209966_10044802 | 276 |
| 2602 | 3300027717 | Ga0209998_10001378 | Ga0209998_100013786 | 276 |
| 2603 | 3300027717 | Ga0209998_10002981 | Ga0209998_100029816 | 276 |
| 2604 | 3300027876 | Ga0209974_10001218 | Ga0209974_100012184 | 276 |
| 2605 | 3300027907 | Ga0207428_10000256 | Ga0207428_1000025625 | 276 |
| 2606 | 3300027907 | Ga0207428_10000338 | Ga0207428_1000033814 | 276 |
| 2607 | 3300027907 | Ga0207428_10000804 | Ga0207428_1000080420 | 276 |
| 2608 | 3300028379 | Ga0268266_10680030 | Ga0268266_106800301 | 276 |
| 2609 | 3300028380 | Ga0268265_10003525 | Ga0268265_1000352512 | 276 |
| 2610 | 3300028380 | Ga0268265_10123681 | Ga0268265_101236813 | 276 |
| 2611 | 3300028380 | Ga0268265_10145857 | Ga0268265_101458572 | 276 |
| 2612 | 3300028381 | Ga0268264_10000762 | Ga0268264_100007623 | 276 |
| 2613 | 3300028381 | Ga0268264_10054648 | Ga0268264_100546482 | 276 |
| 2614 | 3300028381 | Ga0268264_10057752 | Ga0268264_100577523 | 276 |
| 2615 | 3300028556 | Ga0265337_1003113 | Ga0265337_10031135 | 276 |
| 2616 | 3300028666 | Ga0265336_10039639 | Ga0265336_100396392 | 276 |
| 2617 | 3300028800 | Ga0265338_10022745 | Ga0265338_100227453 | 276 |
| 2618 | 3300031235 | Ga0265330_10007596 | Ga0265330_100075964 | 276 |
| 2619 | 3300031235 | Ga0265330_10036189 | Ga0265330_100361893 | 276 |
| 2620 | 3300031241 | Ga0265325_10000105 | Ga0265325_100001059 | 276 |
| 2621 | 3300031241 | Ga0265325_10018514 | Ga0265325_100185143 | 276 |
| 2622 | 3300031241 | Ga0265325_10021929 | Ga0265325_100219293 | 276 |
| 2623 | 3300031247 | Ga0265340_10030315 | Ga0265340_100303154 | 276 |
| 2624 | 3300031247 | Ga0265340_10084741 | Ga0265340_100847412 | 276 |
| 2625 | 3300031249 | Ga0265339_10041543 | Ga0265339_100415434 | 276 |
| 2626 | 3300031249 | Ga0265339_10106439 | Ga0265339_101064392 | 276 |
| 2627 | 3300031249 | Ga0265339_10160008 | Ga0265339_101600082 | 276 |
| 2628 | 3300031344 | Ga0265316_10114960 | Ga0265316_101149603 | 276 |
| 2629 | 3300031344 | Ga0265316_10116690 | Ga0265316_101166902 | 276 |
| 2630 | 3300031595 | Ga0265313_10040269 | Ga0265313_100402693 | 276 |
| 2631 | 3300031665 | Ga0316575_10030297 | Ga0316575_100302972 | 276 |
| 2632 | 3300031711 | Ga0265314_10020944 | Ga0265314_100209446 | 276 |
| 2633 | 3300031711 | Ga0265314_10081817 | Ga0265314_100818172 | 276 |
| 2634 | 3300031712 | Ga0265342_10002975 | Ga0265342_100029757 | 276 |
| 2635 | 3300031712 | Ga0265342_10012876 | Ga0265342_100128765 | 276 |
| 2636 | 3300034816 | Ga0373930_0000013 | Ga0373930_0000013_12002_12832 | 276 |
| 2637 | 3300034817 | Ga0373948_0000118 | Ga0373948_0000118_2987_3817 | 276 |
| 2638 | 3300034817 | Ga0373948_0000496 | Ga0373948_0000496_2588_3418 | 276 |
| 2639 | 3300034817 | Ga0373948_0009819 | Ga0373948_0009819_26_856 | 276 |
| 2640 | 3300034818 | Ga0373950_0000691 | Ga0373950_0000691_2019_2849 | 276 |
| 2641 | 3300034819 | Ga0373958_0000188 | Ga0373958_0000188_2320_3150 | 276 |
| 2642 | 3300034820 | Ga0373959_0035136 | Ga0373959_0035136_155_985 | 276 |
| 2643 | 3300034957 | Ga0373938_0000083 | Ga0373938_0000083_8954_9784 | 276 |
| 2644 | 3300034957 | Ga0373938_0002057 | Ga0373938_0002057_1264_2094 | 276 |
| 2645 | 3300035084 | Ga0373928_0003067 | Ga0373928_0003067_2232_3062 | 276 |
| 2646 | 3300035085 | Ga0373929_0000068 | Ga0373929_0000068_5352_6182 | 276 |
| 2647 | 3300035085 | Ga0373929_0013157 | Ga0373929_0013157_646_1476 | 276 |
| 2648 | 3300035086 | Ga0373934_0001326 | Ga0373934_0001326_1477_2307 | 276 |
| 2649 | 3300035086 | Ga0373934_0043029 | Ga0373934_0043029_141_971 | 276 |
| 2650 | 3300035089 | Ga0373944_0012539 | Ga0373944_0012539_1114_1944 | 276 |
| 2651 | 3300035089 | Ga0373944_0104831 | Ga0373944_0104831_36_866 | 276 |
| 2652 | 3300035090 | Ga0373949_0000934 | Ga0373949_0000934_1995_2825 | 276 |
| 2653 | 3300035090 | Ga0373949_0002952 | Ga0373949_0002952_2907_3737 | 276 |
| 2654 | 3300035090 | Ga0373949_0010566 | Ga0373949_0010566_388_1218 | 276 |
| 2655 | 3300035091 | Ga0373951_0001301 | Ga0373951_0001301_4753_5583 | 276 |
| 2656 | 3300035091 | Ga0373951_0001345 | Ga0373951_0001345_2799_3629 | 276 |
| 2657 | 3300035092 | Ga0373952_0000414 | Ga0373952_0000414_6447_7277 | 276 |
| 2658 | 3300035092 | Ga0373952_0001711 | Ga0373952_0001711_3014_3844 | 276 |
| 2659 | 3300035111 | Ga0373923_0009654 | Ga0373923_0009654_2180_3010 | 276 |
| 2660 | 3300035112 | Ga0373932_0001138 | Ga0373932_0001138_1290_2120 | 276 |
| 2661 | 3300035112 | Ga0373932_0003121 | Ga0373932_0003121_3013_3843 | 276 |
| 2662 | 3300035113 | Ga0373936_0001160 | Ga0373936_0001160_2188_3018 | 276 |
| 2663 | 3300035113 | Ga0373936_0067954 | Ga0373936_0067954_553_1383 | 276 |
| 2664 | 3300035114 | Ga0373939_0002139 | Ga0373939_0002139_2211_3041 | 276 |
| 2665 | 3300035114 | Ga0373939_0009952 | Ga0373939_0009952_648_1478 | 276 |
| 2666 | 3300035114 | Ga0373939_0027034 | Ga0373939_0027034_613_1449 | 276 |
| 2667 | 3300035114 | Ga0373939_0045484 | Ga0373939_0045484_335_1165 | 276 |
| 2668 | 3300035114 | Ga0373939_0059491 | Ga0373939_0059491_234_1064 | 276 |
| 2669 | 3300035115 | Ga0373941_0000938 | Ga0373941_0000938_3287_4117 | 276 |
| 2670 | 3300035115 | Ga0373941_0003446 | Ga0373941_0003446_390_1220 | 276 |
| 2671 | 3300035115 | Ga0373941_0020523 | Ga0373941_0020523_100_930 | 276 |
| 2672 | 3300035116 | Ga0373945_0001093 | Ga0373945_0001093_3487_4317 | 276 |
| 2673 | 3300035116 | Ga0373945_0021656 | Ga0373945_0021656_621_1451 | 276 |
| 2674 | 3300035117 | Ga0373953_0020595 | Ga0373953_0020595_1593_2423 | 276 |
| 2675 | 3300035118 | Ga0373954_0006830 | Ga0373954_0006830_1482_2312 | 276 |
| 2676 | 3300035118 | Ga0373954_0087135 | Ga0373954_0087135_506_1336 | 276 |
| 2677 | 3300035119 | Ga0373956_0007620 | Ga0373956_0007620_3212_4042 | 276 |
| 2678 | 3300035120 | Ga0373957_0069156 | Ga0373957_0069156_459_1289 | 276 |
| 2679 | 3300035121 | Ga0373960_0002307 | Ga0373960_0002307_1971_2801 | 276 |
| 2680 | 3300035121 | Ga0373960_0003157 | Ga0373960_0003157_2235_3065 | 276 |
| 2681 | 3300035121 | Ga0373960_0008174 | Ga0373960_0008174_94_924 | 276 |
| 2682 | 3300035121 | Ga0373960_0021877 | Ga0373960_0021877_600_1430 | 276 |
| 2683 | 3300035170 | Ga0373943_0000945 | Ga0373943_0000945_7905_8735 | 276 |
| 2684 | 3300035170 | Ga0373943_0012663 | Ga0373943_0012663_2668_3498 | 276 |
| 2685 | 3300035170 | Ga0373943_0108447 | Ga0373943_0108447_507_1337 | 276 |
| 2686 | 3300035171 | Ga0373946_0005866 | Ga0373946_0005866_1093_1923 | 276 |
| 2687 | 3300035172 | Ga0373955_0006553 | Ga0373955_0006553_745_1575 | 276 |
| 2688 | 3300035172 | Ga0373955_0017381 | Ga0373955_0017381_1875_2705 | 276 |
| 2689 | 3300035172 | Ga0373955_0041393 | Ga0373955_0041393_905_1735 | 276 |
| 2690 | 3300035207 | Ga0373942_0000520 | Ga0373942_0000520_7609_8439 | 276 |
| 2691 | 3300035207 | Ga0373942_0002511 | Ga0373942_0002511_1929_2759 | 276 |
| 2692 | 3300035241 | Ga0373961_0001414 | Ga0373961_0001414_5003_5833 | 276 |
| 2693 | 3300035242 | Ga0373962_0000558 | Ga0373962_0000558_3343_4173 | 276 |
| 2694 | 3300035242 | Ga0373962_0003426 | Ga0373962_0003426_1244_2074 | 276 |
| 2695 | 3300035242 | Ga0373962_0041721 | Ga0373962_0041721_194_1024 | 276 |
| 2696 | 3300035410 | Ga0373924_0025289 | Ga0373924_0025289_589_1419 | 276 |
| 2697 | 3300035410 | Ga0373924_0042730 | Ga0373924_0042730_613_1443 | 276 |
| 2698 | 3300035410 | Ga0373924_0044770 | Ga0373924_0044770_749_1579 | 276 |
| 2699 | 3300035691 | Ga0373931_0007905 | Ga0373931_0007905_2892_3722 | 276 |
| 2700 | 3300035691 | Ga0373931_0008996 | Ga0373931_0008996_1971_2801 | 276 |
| 2701 | 3300035691 | Ga0373931_0050128 | Ga0373931_0050128_497_1327 | 276 |
| 2702 | 3300035692 | Ga0373935_0185649 | Ga0373935_0185649_24_854 | 276 |
| 2703 | 3300035695 | Ga0373927_0060108 | Ga0373927_0060108_621_1451 | 276 |
| 2704 | 3300035724 | Ga0373933_0004901 | Ga0373933_0004901_2012_2842 | 276 |
| 2705 | 3300035724 | Ga0373933_0030508 | Ga0373933_0030508_2000_2830 | 276 |
| 2706 | 3300035725 | Ga0373947_0001671 | Ga0373947_0001671_11860_12690 | 276 |
| 2707 | 3300036401 | Ga0373937_0005614 | Ga0373937_0005614_4171_5001 | 276 |
| 2708 | 3300036401 | Ga0373937_0008148 | Ga0373937_0008148_6509_7339 | 276 |
| 2709 | 3300036401 | Ga0373937_0034353 | Ga0373937_0034353_3580_4410 | 276 |
| 2710 | 3300036401 | Ga0373937_0155498 | Ga0373937_0155498_1113_1943 | 276 |
| 2711 | 3300036401 | Ga0373937_0175585 | Ga0373937_0175585_409_1239 | 276 |
| 2712 | 3300037068 | Ga0373925_0015007 | Ga0373925_0015007_1659_2489 | 276 |
| 2713 | 3300037312 | Ga0395899_0008003 | Ga0395899_0008003_7188_8018 | 276 |
| 2714 | 3300037418 | Ga0395900_0002888 | Ga0395900_0002888_10631_11461 | 276 |
| 2715 | 3300037418 | Ga0395900_0012043 | Ga0395900_0012043_7719_8549 | 276 |
| 2716 | 3300037418 | Ga0395900_0490698 | Ga0395900_0490698_83_913 | 276 |
| 2717 | 3300037466 | Ga0395898_0007773 | Ga0395898_0007773_10477_11307 | 276 |
| 2718 | 3300037466 | Ga0395898_0046567 | Ga0395898_0046567_867_1697 | 276 |
| 2719 | 3300038443 | Ga0395901_0021727 | Ga0395901_0021727_3111_3941 | 276 |
| 2720 | 3300042008 | Ga0439450_014888 | Ga0439450_014888_240_1070 | 276 |
| 2721 | 3300042012 | Ga0439455_0022392 | Ga0439455_0022392_177_1007 | 276 |
| 2722 | 3300042439 | Ga0439464_0007232 | Ga0439464_0007232_902_1732 | 276 |
| 2723 | 3300042461 | Ga0439460_0068028 | Ga0439460_0068028_212_1042 | 276 |
| 2724 | 3300044719 | Ga0466971_0154350 | Ga0466971_0154350_120_950 | 276 |
| 2725 | 3300044719 | Ga0466971_0231736 | Ga0466971_0231736_31_861 | 276 |
| 2726 | 3300045051 | Ga0451576_0105599 | Ga0451576_0105599_623_1453 | 276 |
| 2727 | 3300045836 | Ga0466958_0012605 | Ga0466958_0012605_1647_2483 | 276 |
| 2728 | 3300045976 | Ga0466967_0159662 | Ga0466967_0159662_375_1205 | 276 |
| 2729 | 3300046454 | Ga0495592_0002225 | Ga0495592_0002225_6925_7755 | 276 |
| 2730 | 3300046454 | Ga0495592_0117157 | Ga0495592_0117157_884_1714 | 276 |
| 2731 | 3300046454 | Ga0495592_0139526 | Ga0495592_0139526_142_972 | 276 |
| 2732 | 3300046455 | Ga0495603_0026838 | Ga0495603_0026838_2191_3021 | 276 |
| 2733 | 3300046459 | Ga0495629_0000440 | Ga0495629_0000440_5911_6741 | 276 |
| 2734 | 3300046459 | Ga0495629_0023211 | Ga0495629_0023211_1984_2814 | 276 |
| 2735 | 3300046459 | Ga0495629_0054577 | Ga0495629_0054577_1552_2382 | 276 |
| 2736 | 3300046461 | Ga0495641_0043238 | Ga0495641_0043238_566_1396 | 276 |
| 2737 | 3300046461 | Ga0495641_0138510 | Ga0495641_0138510_230_1060 | 276 |
| 2738 | 3300046462 | Ga0495651_0004059 | Ga0495651_0004059_9923_10753 | 276 |
| 2739 | 3300046462 | Ga0495651_0011906 | Ga0495651_0011906_1953_2783 | 276 |
| 2740 | 3300046462 | Ga0495651_0013966 | Ga0495651_0013966_2513_3343 | 276 |
| 2741 | 3300046463 | Ga0495653_0006947 | Ga0495653_0006947_6663_7493 | 276 |
| 2742 | 3300046463 | Ga0495653_0008183 | Ga0495653_0008183_7355_8185 | 276 |
| 2743 | 3300046463 | Ga0495653_0048455 | Ga0495653_0048455_1264_2094 | 276 |
| 2744 | 3300046463 | Ga0495653_0173739 | Ga0495653_0173739_476_1306 | 276 |
| 2745 | 3300046472 | Ga0495580_0037929 | Ga0495580_0037929_532_1362 | 276 |
| 2746 | 3300046472 | Ga0495580_0311624 | Ga0495580_0311624_171_1001 | 276 |
| 2747 | 3300046473 | Ga0495582_0000914 | Ga0495582_0000914_4949_5779 | 276 |
| 2748 | 3300046475 | Ga0495639_0006388 | Ga0495639_0006388_3106_3936 | 276 |
| 2749 | 3300046475 | Ga0495639_0050853 | Ga0495639_0050853_514_1344 | 276 |
| 2750 | 3300046476 | Ga0495662_0026739 | Ga0495662_0026739_1167_1997 | 276 |
| 2751 | 3300046477 | Ga0495664_0004525 | Ga0495664_0004525_4425_5255 | 276 |
| 2752 | 3300046477 | Ga0495664_0031813 | Ga0495664_0031813_779_1609 | 276 |
| 2753 | 3300046491 | Ga0495584_0022280 | Ga0495584_0022280_2302_3132 | 276 |
| 2754 | 3300046492 | Ga0495585_0017347 | Ga0495585_0017347_1485_2315 | 276 |
| 2755 | 3300046499 | Ga0495594_0022816 | Ga0495594_0022816_2042_2872 | 276 |
| 2756 | 3300046499 | Ga0495594_0138575 | Ga0495594_0138575_239_1069 | 276 |
| 2757 | 3300046501 | Ga0495607_0006526 | Ga0495607_0006526_70_900 | 276 |
| 2758 | 3300046511 | Ga0495608_0010975 | Ga0495608_0010975_5028_5858 | 276 |
| 2759 | 3300046511 | Ga0495608_0031649 | Ga0495608_0031649_2383_3213 | 276 |
| 2760 | 3300046511 | Ga0495608_0061907 | Ga0495608_0061907_904_1734 | 276 |
| 2761 | 3300046511 | Ga0495608_0069457 | Ga0495608_0069457_377_1207 | 276 |
| 2762 | 3300046513 | Ga0495616_0038046 | Ga0495616_0038046_350_1180 | 276 |
| 2763 | 3300046514 | Ga0495618_0005449 | Ga0495618_0005449_395_1225 | 276 |
| 2764 | 3300046514 | Ga0495618_0014942 | Ga0495618_0014942_3386_4216 | 276 |
| 2765 | 3300046516 | Ga0495628_0027928 | Ga0495628_0027928_3279_4109 | 276 |
| 2766 | 3300046517 | Ga0495630_0018564 | Ga0495630_0018564_668_1498 | 276 |
| 2767 | 3300046517 | Ga0495630_0085916 | Ga0495630_0085916_711_1541 | 276 |
| 2768 | 3300046517 | Ga0495630_0121039 | Ga0495630_0121039_761_1591 | 276 |
| 2769 | 3300046520 | Ga0495637_0075845 | Ga0495637_0075845_188_1018 | 276 |
| 2770 | 3300046523 | Ga0495644_0010408 | Ga0495644_0010408_1346_2176 | 276 |
| 2771 | 3300046526 | Ga0495666_0000884 | Ga0495666_0000884_7921_8751 | 276 |
| 2772 | 3300046526 | Ga0495666_0059754 | Ga0495666_0059754_146_976 | 276 |
| 2773 | 3300046529 | Ga0495652_0022381 | Ga0495652_0022381_502_1332 | 276 |
| 2774 | 3300046529 | Ga0495652_0073360 | Ga0495652_0073360_289_1119 | 276 |
| 2775 | 3300046529 | Ga0495652_0126898 | Ga0495652_0126898_621_1451 | 276 |
| 2776 | 3300046529 | Ga0495652_0147745 | Ga0495652_0147745_988_1818 | 276 |
| 2777 | 3300046531 | Ga0495665_0001249 | Ga0495665_0001249_6289_7119 | 276 |
| 2778 | 3300046533 | Ga0495640_0012226 | Ga0495640_0012226_2964_3794 | 276 |
| 2779 | 3300046533 | Ga0495640_0176938 | Ga0495640_0176938_58_888 | 276 |
| 2780 | 3300046536 | Ga0495587_0013126 | Ga0495587_0013126_3955_4785 | 276 |
| 2781 | 3300046536 | Ga0495587_0026760 | Ga0495587_0026760_2516_3346 | 276 |
| 2782 | 3300046537 | Ga0495598_0015426 | Ga0495598_0015426_524_1354 | 276 |
| 2783 | 3300046538 | Ga0495609_0058060 | Ga0495609_0058060_33_863 | 276 |
| 2784 | 3300046543 | Ga0495645_0011912 | Ga0495645_0011912_350_1180 | 276 |
| 2785 | 3300046543 | Ga0495645_0030621 | Ga0495645_0030621_763_1593 | 276 |
| 2786 | 3300046543 | Ga0495645_0157794 | Ga0495645_0157794_235_1065 | 276 |
| 2787 | 3300046543 | Ga0495645_0206217 | Ga0495645_0206217_195_1025 | 276 |
| 2788 | 3300046557 | Ga0495622_0003618 | Ga0495622_0003618_3015_3845 | 276 |
| 2789 | 3300046558 | Ga0495633_0014580 | Ga0495633_0014580_1698_2528 | 276 |
| 2790 | 3300046559 | Ga0495667_0003492 | Ga0495667_0003492_6402_7232 | 276 |
| 2791 | 3300046559 | Ga0495667_0007691 | Ga0495667_0007691_6308_7138 | 276 |
| 2792 | 3300046559 | Ga0495667_0021620 | Ga0495667_0021620_1680_2510 | 276 |
| 2793 | 3300046559 | Ga0495667_0158711 | Ga0495667_0158711_589_1419 | 276 |
| 2794 | 3300046615 | Ga0495656_0003231 | Ga0495656_0003231_2757_3587 | 276 |
| 2795 | 3300046642 | Ga0495634_0036161 | Ga0495634_0036161_24_854 | 276 |
| 2796 | 3300046648 | Ga0495611_0046289 | Ga0495611_0046289_864_1694 | 276 |
| 2797 | 3300046663 | Ga0495635_0001695 | Ga0495635_0001695_7984_8814 | 276 |
| 2798 | 3300046663 | Ga0495635_0010473 | Ga0495635_0010473_3110_3940 | 276 |
| 2799 | 3300046663 | Ga0495635_0044745 | Ga0495635_0044745_245_1075 | 276 |
| 2800 | 3300046663 | Ga0495635_0157681 | Ga0495635_0157681_693_1523 | 276 |
| 2801 | 3300046663 | Ga0495635_0248499 | Ga0495635_0248499_299_1129 | 276 |
| 2802 | 3300046664 | Ga0495659_0000755 | Ga0495659_0000755_9619_10449 | 276 |
| 2803 | 3300046674 | Ga0495588_0009671 | Ga0495588_0009671_1881_2711 | 276 |
| 2804 | 3300046674 | Ga0495588_0092886 | Ga0495588_0092886_617_1447 | 276 |
| 2805 | 3300046675 | Ga0495657_0015245 | Ga0495657_0015245_3523_4353 | 276 |
| 2806 | 3300046678 | Ga0495599_0044357 | Ga0495599_0044357_546_1376 | 276 |
| 2807 | 3300046678 | Ga0495599_0103005 | Ga0495599_0103005_132_962 | 276 |
| 2808 | 3300046679 | Ga0495623_0063995 | Ga0495623_0063995_875_1705 | 276 |
| 2809 | 3300046680 | Ga0495646_0007172 | Ga0495646_0007172_5285_6115 | 276 |
| 2810 | 3300046680 | Ga0495646_0115273 | Ga0495646_0115273_593_1423 | 276 |
| 2811 | 3300046681 | Ga0495647_0003008 | Ga0495647_0003008_2923_3753 | 276 |
| 2812 | 3300046681 | Ga0495647_0146994 | Ga0495647_0146994_76_906 | 276 |
| 2813 | 3300046683 | Ga0495658_0000200 | Ga0495658_0000200_15667_16497 | 276 |
| 2814 | 3300046683 | Ga0495658_0023078 | Ga0495658_0023078_2318_3148 | 276 |
| 2815 | 3300046683 | Ga0495658_0037694 | Ga0495658_0037694_229_1059 | 276 |
| 2816 | 3300046684 | Ga0495669_0039593 | Ga0495669_0039593_728_1558 | 276 |
| 2817 | 3300046684 | Ga0495669_0057334 | Ga0495669_0057334_296_1126 | 276 |
| 2818 | 3300046689 | Ga0495613_0012563 | Ga0495613_0012563_4938_5768 | 276 |
| 2819 | 3300046689 | Ga0495613_0105367 | Ga0495613_0105367_198_1028 | 276 |
| 2820 | 3300046690 | Ga0495624_0025399 | Ga0495624_0025399_335_1165 | 276 |
| 2821 | 3300046691 | Ga0495670_0003961 | Ga0495670_0003961_1702_2532 | 276 |
| 2822 | 3300046692 | Ga0495671_0067481 | Ga0495671_0067481_71_901 | 276 |
| 2823 | 3300046692 | Ga0495671_0158040 | Ga0495671_0158040_63_893 | 276 |
| 2824 | 3300046794 | Ga0495589_0071238 | Ga0495589_0071238_691_1521 | 276 |
| 2825 | 3300046809 | Ga0495600_0000769 | Ga0495600_0000769_10003_10833 | 276 |
| 2826 | 3300046809 | Ga0495600_0081137 | Ga0495600_0081137_469_1299 | 276 |
| 2827 | 3300046809 | Ga0495600_0081880 | Ga0495600_0081880_1093_1923 | 276 |
| 2828 | 3300047315 | Ga0495581_0011638 | Ga0495581_0011638_2740_3570 | 276 |
| 2829 | 3300047315 | Ga0495581_0019388 | Ga0495581_0019388_1063_1893 | 276 |
| 2830 | 3300047315 | Ga0495581_0019773 | Ga0495581_0019773_2797_3627 | 276 |
| 2831 | 3300047317 | Ga0495604_0000625 | Ga0495604_0000625_3773_4603 | 276 |
| 2832 | 3300047317 | Ga0495604_0003181 | Ga0495604_0003181_9162_9992 | 276 |
| 2833 | 3300047317 | Ga0495604_0079809 | Ga0495604_0079809_889_1719 | 276 |
| 2834 | 3300047317 | Ga0495604_0091311 | Ga0495604_0091311_1383_2213 | 276 |
| 2835 | 3300047319 | Ga0495674_0019582 | Ga0495674_0019582_4661_5491 | 276 |
| 2836 | 3300047319 | Ga0495674_0167520 | Ga0495674_0167520_632_1462 | 276 |
| 2837 | 3300047321 | Ga0495676_0046479 | Ga0495676_0046479_2516_3346 | 276 |
| 2838 | 3300047321 | Ga0495676_0053351 | Ga0495676_0053351_1237_2067 | 276 |
| 2839 | 3300047321 | Ga0495676_0062782 | Ga0495676_0062782_1350_2180 | 276 |
| 2840 | 3300047322 | Ga0495680_0003110 | Ga0495680_0003110_4383_5213 | 276 |
| 2841 | 3300047322 | Ga0495680_0004500 | Ga0495680_0004500_7333_8163 | 276 |
| 2842 | 3300047322 | Ga0495680_0006435 | Ga0495680_0006435_7957_8787 | 276 |
| 2843 | 3300047322 | Ga0495680_0019890 | Ga0495680_0019890_3841_4671 | 276 |
| 2844 | 3300047322 | Ga0495680_0027736 | Ga0495680_0027736_780_1610 | 276 |
| 2845 | 3300047322 | Ga0495680_0246100 | Ga0495680_0246100_249_1079 | 276 |
| 2846 | 3300047444 | Ga0495675_0142951 | Ga0495675_0142951_387_1217 | 276 |
| 2847 | 3300047471 | Ga0495684_0002895 | Ga0495684_0002895_9092_9922 | 276 |
| 2848 | 3300047471 | Ga0495684_0097659 | Ga0495684_0097659_58_888 | 276 |
| 2849 | 3300047471 | Ga0495684_0251304 | Ga0495684_0251304_293_1123 | 276 |
| 2850 | 3300047471 | Ga0495684_0253360 | Ga0495684_0253360_385_1215 | 276 |
| 2851 | 3300047673 | Ga0495593_0012654 | Ga0495593_0012654_2796_3626 | 276 |
| 2852 | 3300047673 | Ga0495593_0018562 | Ga0495593_0018562_640_1470 | 276 |
| 2853 | 3300047673 | Ga0495593_0103443 | Ga0495593_0103443_203_1033 | 276 |
| 2854 | 3300048088 | Ga0495602_0003565 | Ga0495602_0003565_11307_12137 | 276 |
| 2855 | 3300048088 | Ga0495602_0070734 | Ga0495602_0070734_1744_2574 | 276 |
| 2856 | 3300048088 | Ga0495602_0074406 | Ga0495602_0074406_333_1163 | 276 |
| 2857 | 3300048089 | Ga0495614_0028398 | Ga0495614_0028398_270_1100 | 276 |
| 2858 | 3300048089 | Ga0495614_0042245 | Ga0495614_0042245_846_1676 | 276 |
| 2859 | 3300048903 | Ga0496100_0000380 | Ga0496100_0000380_1137_1967 | 276 |
| 2860 | 3300048904 | Ga0496101_0022384 | Ga0496101_0022384_3086_3916 | 276 |
| 2861 | 3300048904 | Ga0496101_0023194 | Ga0496101_0023194_625_1455 | 276 |
| 2862 | 3300048904 | Ga0496101_0082737 | Ga0496101_0082737_1477_2307 | 276 |
| 2863 | 3300048905 | Ga0496102_0010977 | Ga0496102_0010977_497_1327 | 276 |
| 2864 | 3300048905 | Ga0496102_0047316 | Ga0496102_0047316_1290_2120 | 276 |
| 2865 | 3300048906 | Ga0496103_0028308 | Ga0496103_0028308_882_1712 | 276 |
| 2866 | 3300048906 | Ga0496103_0103633 | Ga0496103_0103633_26_856 | 276 |
| 2867 | 3300048906 | Ga0496103_0110200 | Ga0496103_0110200_106_936 | 276 |
| 2868 | 3300048907 | Ga0496104_0001998 | Ga0496104_0001998_5717_6547 | 276 |
| 2869 | 3300048907 | Ga0496104_0012321 | Ga0496104_0012321_6131_6961 | 276 |
| 2870 | 3300048907 | Ga0496104_0109318 | Ga0496104_0109318_1763_2593 | 276 |
| 2871 | 3300048907 | Ga0496104_0125209 | Ga0496104_0125209_1379_2209 | 276 |
| 2872 | 3300048908 | Ga0496105_0000273 | Ga0496105_0000273_26784_27614 | 276 |
| 2873 | 3300048908 | Ga0496105_0162780 | Ga0496105_0162780_654_1484 | 276 |
| 2874 | 3300048909 | Ga0496106_0005034 | Ga0496106_0005034_5737_6567 | 276 |
| 2875 | 3300048909 | Ga0496106_0011013 | Ga0496106_0011013_4040_4870 | 276 |
| 2876 | 3300048909 | Ga0496106_0017277 | Ga0496106_0017277_3171_4001 | 276 |
| 2877 | 3300048910 | Ga0496107_0006365 | Ga0496107_0006365_1816_2646 | 276 |
| 2878 | 3300048910 | Ga0496107_0013024 | Ga0496107_0013024_112_942 | 276 |
| 2879 | 3300048910 | Ga0496107_0063558 | Ga0496107_0063558_1591_2421 | 276 |
| 2880 | 3300048911 | Ga0496108_0065272 | Ga0496108_0065272_243_1073 | 276 |
| 2881 | 3300048911 | Ga0496108_0129129 | Ga0496108_0129129_1119_1949 | 276 |
| 2882 | 3300048911 | Ga0496108_0273172 | Ga0496108_0273172_354_1184 | 276 |
| 2883 | 3300048912 | Ga0496109_0000211 | Ga0496109_0000211_19258_20088 | 276 |
| 2884 | 3300048912 | Ga0496109_0004878 | Ga0496109_0004878_1361_2191 | 276 |
| 2885 | 3300048912 | Ga0496109_0010746 | Ga0496109_0010746_5379_6209 | 276 |
| 2886 | 3300048913 | Ga0496110_0025892 | Ga0496110_0025892_1369_2199 | 276 |
| 2887 | 3300048913 | Ga0496110_0057725 | Ga0496110_0057725_673_1503 | 276 |
| 2888 | 3300048913 | Ga0496110_0088234 | Ga0496110_0088234_1657_2487 | 276 |
| 2889 | 3300048914 | Ga0496111_0141877 | Ga0496111_0141877_630_1460 | 276 |
| 2890 | 3300048915 | Ga0496112_0003979 | Ga0496112_0003979_1786_2616 | 276 |
| 2891 | 3300048915 | Ga0496112_0035820 | Ga0496112_0035820_975_1805 | 276 |
| 2892 | 3300048916 | Ga0496113_0025017 | Ga0496113_0025017_1563_2393 | 276 |
| 2893 | 3300048916 | Ga0496113_0126942 | Ga0496113_0126942_26_856 | 276 |
| 2894 | 3300048917 | Ga0496114_0003482 | Ga0496114_0003482_4863_5693 | 276 |
| 2895 | 3300048917 | Ga0496114_0009535 | Ga0496114_0009535_5953_6783 | 276 |
| 2896 | 3300048918 | Ga0496115_0008441 | Ga0496115_0008441_1408_2238 | 276 |
| 2897 | 3300048918 | Ga0496115_0278816 | Ga0496115_0278816_355_1185 | 276 |
| 2898 | 3300048918 | Ga0496115_0342901 | Ga0496115_0342901_52_882 | 276 |
| 2899 | 3300049571 | Ga0501034_0005514 | Ga0501034_0005514_7472_8302 | 276 |
| 2900 | 3300049580 | Ga0501046_0377812 | Ga0501046_0377812_110_940 | 276 |
| 2901 | 3300049581 | Ga0501047_0014702 | Ga0501047_0014702_5198_6028 | 276 |
| 2902 | 3300049586 | Ga0501070_0014944 | Ga0501070_0014944_1403_2233 | 276 |
| 2903 | 3300049593 | Ga0501077_0003071 | Ga0501077_0003071_5413_6243 | 276 |
| 2904 | 3300049593 | Ga0501077_0235801 | Ga0501077_0235801_63_893 | 276 |
| 2905 | 3300049823 | Ga0501044_0174070 | Ga0501044_0174070_68_898 | 276 |
| 2906 | 3300050494 | nmdc:mga06z11_23090_c1 | nmdc:mga06z11_23090_c1_795_1625 | 276 |
| 2907 | 3300050507 | nmdc:mga05p37_24117_c1 | nmdc:mga05p37_24117_c1_3810_4640 | 276 |
| 2908 | 3300050507 | nmdc:mga05p37_9055_c1 | nmdc:mga05p37_9055_c1_8063_8992 | 276 |
| 2909 | 3300050508 | nmdc:mga09592_1455_c1 | nmdc:mga09592_1455_c1_6581_7510 | 276 |
| 2910 | 3300050509 | nmdc:mga0qj67_5882_c1 | nmdc:mga0qj67_5882_c1_790_1719 | 276 |
| 2911 | 3300050510 | nmdc:mga06r32_27182_c1 | nmdc:mga06r32_27182_c1_2293_3222 | 276 |
| 2912 | 3300050511 | nmdc:mga08y16_11723_c1 | nmdc:mga08y16_11723_c1_5090_5920 | 276 |
| 2913 | 3300050511 | nmdc:mga08y16_1227_c1 | nmdc:mga08y16_1227_c1_7768_8598 | 276 |
| 2914 | 3300050511 | nmdc:mga08y16_6892_c1 | nmdc:mga08y16_6892_c1_4405_5334 | 276 |
| 2915 | 3300050512 | nmdc:mga0n895_146006_c1 | nmdc:mga0n895_146006_c1_1373_2203 | 276 |
| 2916 | 3300050512 | nmdc:mga0n895_171_c1 | nmdc:mga0n895_171_c1_37043_37873 | 276 |
| 2917 | 3300050512 | nmdc:mga0n895_21574_c1 | nmdc:mga0n895_21574_c1_2421_3350 | 276 |
| 2918 | 3300050512 | nmdc:mga0n895_24501_c1 | nmdc:mga0n895_24501_c1_913_1743 | 276 |
| 2919 | 3300050513 | nmdc:mga0rr50_12842_c1 | nmdc:mga0rr50_12842_c1_3237_4166 | 276 |
| 2920 | 3300050514 | nmdc:mga08x19_140706_c1 | nmdc:mga08x19_140706_c1_37_867 | 276 |
| 2921 | 3300050514 | nmdc:mga08x19_270120_c1 | nmdc:mga08x19_270120_c1_115_1044 | 276 |
| 2922 | 3300050514 | nmdc:mga08x19_88581_c1 | nmdc:mga08x19_88581_c1_35_865 | 276 |
| 2923 | 3300050515 | nmdc:mga0a205_2563_c1 | nmdc:mga0a205_2563_c1_7904_8734 | 276 |
| 2924 | 3300050515 | nmdc:mga0a205_3394_c1 | nmdc:mga0a205_3394_c1_5145_6074 | 276 |
| 2925 | 3300053077 | Ga0495601_0000379 | Ga0495601_0000379_6718_7548 | 276 |
| 2926 | 3300053077 | Ga0495601_0001291 | Ga0495601_0001291_1653_2483 | 276 |
| 2927 | 3300053077 | Ga0495601_0006296 | Ga0495601_0006296_5493_6323 | 276 |
| 2928 | 3300053077 | Ga0495601_0167917 | Ga0495601_0167917_400_1230 | 276 |
| 2929 | 3300053077 | Ga0495601_0181384 | Ga0495601_0181384_396_1226 | 276 |
| 2930 | 3300053078 | Ga0495612_0001697 | Ga0495612_0001697_5169_5999 | 276 |
| 2931 | 3300053078 | Ga0495612_0005818 | Ga0495612_0005818_2862_3692 | 276 |
| 2932 | 3300053078 | Ga0495612_0007362 | Ga0495612_0007362_2319_3149 | 276 |
| 2933 | 3300053078 | Ga0495612_0042536 | Ga0495612_0042536_347_1177 | 276 |
| 2934 | 3300053083 | Ga0495655_0016429 | Ga0495655_0016429_349_1203 | 276 |
| 2935 | 3300053084 | Ga0495595_0001512 | Ga0495595_0001512_1029_1859 | 276 |
| 2936 | 3300053084 | Ga0495595_0003018 | Ga0495595_0003018_5769_6599 | 276 |
| 2937 | 3300053084 | Ga0495595_0003071 | Ga0495595_0003071_4683_5513 | 276 |
| 2938 | 3300053085 | Ga0495619_0000105 | Ga0495619_0000105_31138_31968 | 276 |
| 2939 | 3300053085 | Ga0495619_0004472 | Ga0495619_0004472_1898_2728 | 276 |
| 2940 | 3300053085 | Ga0495619_0005762 | Ga0495619_0005762_1697_2527 | 276 |
| 2941 | 3300053085 | Ga0495619_0021807 | Ga0495619_0021807_2867_3697 | 276 |
| 2942 | 3300053085 | Ga0495619_0051507 | Ga0495619_0051507_454_1284 | 276 |
| 2943 | 3300053090 | Ga0500646_0067705 | Ga0500646_0067705_131_961 | 276 |
| 2944 | 3300053093 | Ga0500651_0012851 | Ga0500651_0012851_1115_1945 | 276 |
| 2945 | 3300053153 | Ga0500616_0000006 | Ga0500616_0000006_467627_468457 | 276 |
| 2946 | 3300053730 | Ga0500645_002247 | Ga0500645_002247_7774_8619 | 276 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4hzc-assembly1.cif.gz_E | crystal structure of serine acetyltransferase from brucella abortus strain s19 | 0.9922 | 15 | 258 |
| 4hzc-assembly2.cif.gz_G | crystal structure of serine acetyltransferase from brucella abortus strain s19 | 0.9911 | 15 | 258 |
| 3mc4-assembly2.cif.gz_B | crystal structure of ww/rsp5/wwp domain: bacterial transferase hexapeptide repeat: serine o-acetyltransferase from brucella melitensis | 0.9905 | 16 | 257 |
| 1ssq-assembly1.cif.gz_A | serine acetyltransferase- complex with cysteine | 0.9891 | 18 | 254 |
| 3mc4-assembly1.cif.gz_A | crystal structure of ww/rsp5/wwp domain: bacterial transferase hexapeptide repeat: serine o-acetyltransferase from brucella melitensis | 0.9887 | 11 | 257 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4n6bB02 | Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins | 0.9931 | 152 | 253 | 2.160.10.10 |
| 4n6bB02 | Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins | 0.9831 | 152 | 253 | 2.160.10.10 |
| 1s80A01 | Mainly Alpha;Orthogonal Bundle;serine acetyltransferase, domain 1;serine acetyltransferase, domain 1 | 0.9824 | 18 | 150 | 1.10.3130.10 |
| 3mc4A01 | Mainly Alpha;Orthogonal Bundle;serine acetyltransferase, domain 1;serine acetyltransferase, domain 1 | 0.9757 | 11 | 150 | 1.10.3130.10 |
| 4n6bC01 | Mainly Alpha;Orthogonal Bundle;serine acetyltransferase, domain 1;serine acetyltransferase, domain 1 | 0.9716 | 18 | 150 | 1.10.3130.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6M1HW22-F1-model_v4 | deleted | 0.9919 | 60 | 232 |
|
| AF-A0A844VWN9-F1-model_v4 | deleted | 0.9901 | 38 | 216 |
|
| AF-A0A7R8WWD6-F1-model_v4 | serine O-acetyltransferase (EC 2.3.1.30) | 0.99 | 80 | 268 |
GO:0005737
GO:0006535 GO:0009001 |
| AF-A0A376VDA1-F1-model_v4 | Serine acetyltransferase (EC 2.3.1.30) | 0.9897 | 36 | 257 |
GO:0005737
GO:0006535 GO:0009001 |
| AF-A0A3C0KYY1-F1-model_v4 | Serine acetyltransferase (EC 2.3.1.30) | 0.9894 | 23 | 255 |
GO:0005737
GO:0006535 GO:0009001 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar