F496999

General Info

Members Datasets Scaffolds Average Seq Length
2685 838 2386 489

Family's Representative Sequence

Representative Sequence 3300031250|Ga0265331_10020058|Ga0265331_100200582
Length 476
Sequence MMYSTDPFDDDKLKEECGVFGILGVDSAAAMVTLGLHALQHRGQEAAGIVSFDGEQFHAHHALGHVGENFNSEAVIKRLLGSAAVGHTRYSTSGETALRNVQPLFADFDFGGFAIAHNGNLTNAHTLRKQLVKRGCLFRSTSDTESIIHLMAMARGGSVIDRMIEALRQIEGAYSLVALAKDLLIGVRDPNGVRPLVLGKLDDAYVLASETCALDIIGAAFVRDIEPGEMVVIDAANIHSLRPFGKTESKFCVFEYIYFARPDSSVEGRSVYEMRKNIGVELAKESGVPADIVVPVPDSGVPSAIGYGIIRNHYVGRTFIQPTDRIRHLGVKLKHNANRRFIEGKRVILIDDSIVRGTTSTKIVEMVRAAGAKEVHMRISSPPTKHSCFYGIDTPQPEKLLAHNYTVDQMCRFIGADSLAFISLDGLYRAVGENKRNAEQPQFCDACFSGDYPIKLTDLNSTDTQTQMSLLARASE

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
3 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
4 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
5 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
6 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
7 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
8 2512875024 Mesorhizobium loti R88b Isolate Nodule
9 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
10 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
11 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
12 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
13 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
14 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
15 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
16 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
17 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
18 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
19 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
20 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
21 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
22 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
23 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
24 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
25 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
26 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
27 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
28 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
29 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
30 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
31 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
32 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
33 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
34 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
35 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
36 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
37 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
38 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
39 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
40 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
41 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
42 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
43 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
44 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
45 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
46 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
47 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
48 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
49 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
50 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
51 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
52 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
53 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
54 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
55 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
56 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
57 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
58 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
59 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
60 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
61 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
62 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
63 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
64 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
65 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
66 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
67 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
68 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
69 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
70 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
71 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
72 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
73 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
74 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
75 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
76 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
77 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
78 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
79 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
80 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
81 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
82 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
83 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
84 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
85 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
86 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
87 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
88 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
89 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
90 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
91 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
92 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
93 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
94 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
95 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
96 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
97 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
98 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
99 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
100 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
101 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
102 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
103 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
104 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
105 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
106 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
107 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
108 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
109 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
110 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
111 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
112 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
113 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
114 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
115 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
116 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
117 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
118 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
119 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
120 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
121 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
122 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
123 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
124 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
125 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
126 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
127 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
128 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
129 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
130 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
131 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
132 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
133 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
134 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
135 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
136 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
137 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
138 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
139 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
140 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
141 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
142 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
143 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
144 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
145 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
146 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
147 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
148 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
149 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
150 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
151 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
152 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
153 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
154 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
155 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
156 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
157 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
158 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
159 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
160 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
161 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
162 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
163 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
164 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
165 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
166 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
167 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
168 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
169 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
170 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
171 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
172 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
173 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
174 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
175 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
176 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
177 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
178 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
179 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
180 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
181 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
182 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
183 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
184 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
185 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
186 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
187 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
188 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
189 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
190 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
191 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
192 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
193 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
194 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
195 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
196 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
197 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
198 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
199 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
200 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
201 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
202 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
203 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
204 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
205 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
206 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
207 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
208 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
209 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
210 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
211 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
212 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
213 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
214 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
215 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
216 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
217 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
218 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
219 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
220 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
221 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
222 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
223 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
224 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
225 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
226 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
227 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
228 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
229 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
230 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
231 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
232 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
233 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
234 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
235 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
236 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
237 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
238 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
239 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
240 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
241 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
242 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
243 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
244 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
245 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
246 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
247 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
248 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
249 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
250 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
251 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
252 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
253 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
254 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
255 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
256 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
257 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
258 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
259 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
260 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
261 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
262 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
263 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
264 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
265 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
266 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
267 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
268 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
269 3004167301 Mesorhizobium loti 582 Isolate Unclassified
270 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
271 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
272 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
273 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
274 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
275 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
276 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
277 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
278 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
279 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
280 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
281 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
282 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
283 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
284 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
285 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
286 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
287 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
288 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
289 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
290 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
291 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
292 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
293 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
294 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
295 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
296 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
297 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
298 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
299 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
300 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
301 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
302 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
303 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
304 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
305 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
306 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
307 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
308 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
309 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
310 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
311 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
312 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
313 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
314 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
315 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
316 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
317 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
318 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
319 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
320 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
321 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
322 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
323 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
324 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
325 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
326 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
327 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
328 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
329 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
330 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
331 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
332 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
333 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
334 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
335 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
336 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
337 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
338 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
339 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
340 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
341 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
342 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
343 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
344 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
345 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
346 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
347 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
348 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
349 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
350 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
351 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
352 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
353 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
354 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
355 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
356 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
357 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
358 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
359 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
360 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
361 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
362 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
363 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
364 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
365 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
366 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
367 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
368 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
369 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
370 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
371 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
372 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
373 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
374 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
375 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
376 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
377 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
378 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
379 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
380 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
381 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
382 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
383 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
384 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
385 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
386 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
387 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
388 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
389 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
390 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
391 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
392 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
393 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
394 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
395 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
396 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
397 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
398 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
399 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
400 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
401 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
402 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
403 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
404 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
405 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
406 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
407 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
408 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
409 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
410 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
411 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
412 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
413 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
414 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
415 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
416 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
417 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
418 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
419 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
420 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
421 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
422 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
423 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
424 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
425 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
426 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
427 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
428 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
429 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
430 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
431 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
432 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
433 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
434 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
435 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
436 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
437 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
438 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
439 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
440 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
441 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
442 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
443 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
444 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
445 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
446 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
447 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
448 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
449 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
450 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
451 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
452 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
453 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
454 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
455 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
456 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
457 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
458 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
459 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
460 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
461 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
462 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
463 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
464 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
465 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
466 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
467 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
468 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
469 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
470 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
471 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
472 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
473 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
474 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
475 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
476 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
477 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
478 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
479 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
480 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
481 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
482 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
483 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
484 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
485 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
486 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
487 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
488 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
489 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
490 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
491 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
492 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
493 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
494 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
495 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
496 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
497 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
498 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
499 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
500 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
501 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
502 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
503 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
504 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
505 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
506 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
507 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
508 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
509 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
510 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
511 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
512 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
513 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
514 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
515 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
516 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
517 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
518 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
519 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
520 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
521 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
522 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
523 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
524 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
525 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
526 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
527 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
528 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
529 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
530 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
531 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
532 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
533 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
534 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
535 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
536 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
537 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
538 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
539 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
540 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
541 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
542 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
543 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
544 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
545 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
546 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
547 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
548 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
549 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
550 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
551 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
552 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
553 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
554 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
555 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
556 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
557 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
558 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
559 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
560 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
561 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
562 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
563 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
564 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
565 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
566 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
567 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
568 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
569 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
570 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
571 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
572 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
573 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
574 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
575 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
576 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
577 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
578 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
579 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
580 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
581 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
582 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
583 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
584 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
585 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
586 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
587 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
588 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
589 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
590 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
591 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
592 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
593 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
594 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
595 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
596 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
597 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
598 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
599 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
600 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
601 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
602 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
603 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
604 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
605 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
606 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
607 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
608 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
609 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
610 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
611 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
612 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
613 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
614 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
615 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
616 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
617 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
618 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
619 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
620 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
621 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
622 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
623 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
624 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
625 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
626 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
627 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
628 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
629 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
630 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
631 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
632 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
633 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
634 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
635 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
636 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
637 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
638 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
639 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
640 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
641 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
642 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
643 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
644 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
645 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
646 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
647 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
648 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
649 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
650 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
651 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
652 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
653 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
654 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
655 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
656 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
657 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
658 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
659 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
660 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
661 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
662 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
663 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
664 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
665 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
666 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
667 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
668 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
669 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
670 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
671 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
672 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
673 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
674 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
675 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
676 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
677 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
678 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
679 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
680 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
681 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
682 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
683 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
684 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
685 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
686 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
687 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
688 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
689 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
690 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
691 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
692 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
693 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
694 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
695 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
696 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
697 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
698 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
699 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
700 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
701 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
702 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
703 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
704 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
705 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
706 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
707 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
708 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
709 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
710 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
711 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
712 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
713 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
714 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
715 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
716 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
717 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
718 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
719 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
720 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
721 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
722 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
723 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
724 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
725 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
726 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
727 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
728 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
729 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
730 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
731 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
732 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
733 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
734 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
735 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
736 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
737 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
738 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
739 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
740 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
741 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
742 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
743 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
744 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
745 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
746 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
747 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
748 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
749 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
750 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
751 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
752 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
753 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
754 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
755 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
756 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
757 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
758 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
759 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
760 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
761 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
762 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
763 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
764 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
765 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
766 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
767 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
768 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
769 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
770 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
771 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
772 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
773 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
774 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
775 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
776 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
777 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
778 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
779 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
780 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
781 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
782 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
783 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
784 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
785 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
786 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
787 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
788 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
789 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
790 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
791 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
792 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
793 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
794 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
795 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
796 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
797 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
798 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
799 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
800 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
801 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
802 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
803 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
804 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
805 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
806 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
807 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
808 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
809 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
810 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
811 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
812 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
813 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
814 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
815 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
816 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
817 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
818 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
819 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
820 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
821 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
822 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
823 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
824 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
825 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
826 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
827 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
828 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
829 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
830 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
831 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
832 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
833 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
834 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
835 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
836 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
837 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
838 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.79
Metatranscriptomes 0.07
Isolates 11.14

Biome Distribution

Category Percentage (%)
Aerial Root 0.19
Bulb 0
Endosphere 5.4
Nodule 8.53
Rhizoplane 5.03
Rhizosphere 76.5
Stem 0
Stem Tuber 0.04
Unclassified 4.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1000044 3300001904 Bacteria 20553
2 JGI24736J21556_1000338 3300001904 Bacteria 8767
3 JGI24741J21665_1004521 3300001915 Bacteria 3065
4 JGI24741J21665_1009272 3300001915 Bacteria 1815
5 JGI24752J21851_1000034 3300001976 Bacteria 16370
6 JGI24746J21847_1003631 3300001977 Bacteria 2429
7 JGI24740J21852_10001128 3300001979 Bacteria 12095
8 JGI24740J21852_10005359 3300001979 Bacteria 5435
9 JGI24740J21852_10007731 3300001979 Bacteria 4345
10 JGI24740J21852_10013503 3300001979 Bacteria 3042
11 JGI24739J22299_10006470 3300001989 Bacteria 4419
12 JGI24739J22299_10011579 3300001989 Bacteria 3255
13 JGI24739J22299_10023285 3300001989 Bacteria 2191
14 JGI24739J22299_10024353 3300001989 Bacteria 2134
15 JGI24737J22298_10002933 3300001990 Bacteria 6043
16 JGI24737J22298_10005307 3300001990 Bacteria 4458
17 JGI24737J22298_10005904 3300001990 Bacteria 4214
18 JGI24737J22298_10007664 3300001990 Bacteria 3637
19 JGI24737J22298_10008831 3300001990 Bacteria 3364
20 JGI24737J22298_10011968 3300001990 Bacteria 2834
21 JGI24737J22298_10023118 3300001990 Bacteria 1973
22 JGI24743J22301_10000285 3300001991 Bacteria 5485
23 JGI24735J21928_10005173 3300002067 Bacteria 4341
24 JGI24735J21928_10013532 3300002067 Bacteria 2563
25 JGI24735J21928_10015462 3300002067 Bacteria 2381
26 JGI24735J21928_10019505 3300002067 Bacteria 2084
27 JGI24750J21931_1000349 3300002070 Bacteria 7844
28 JGI24748J21848_1000032 3300002074 Bacteria 79791
29 JGI24738J21930_10000184 3300002075 Bacteria 16152
30 JGI24738J21930_10001238 3300002075 Bacteria 7177
31 JGI24738J21930_10001952 3300002075 Bacteria 5560
32 JGI24738J21930_10002751 3300002075 Bacteria 4520
33 JGI24749J21850_1000583 3300002076 Bacteria 5313
34 JGI24033J26618_1002266 3300002155 Bacteria 1954
35 JGI24034J26672_10000022 3300002239 Bacteria 116342
36 JGI24751J29686_10000055 3300002459 Bacteria 64731
37 JGI25150J39212_1000285 3300002774 Bacteria 26336
38 JGI25151J46595_10029309 3300003187 Bacteria 2181
39 JGI25165J46597_1000028 3300003214 Bacteria 325146
40 JGI25165J46597_1000043 3300003214 Bacteria 264515
41 JGI25165J46597_1000573 3300003214 Bacteria 32867
42 JGI25153J46596_10000044 3300003215 Bacteria 154263
43 JGI25153J46596_10000113 3300003215 Bacteria 92345
44 JGI25153J46596_10001297 3300003215 Bacteria 14964
45 JGI25153J46596_10014266 3300003215 Bacteria 3313
46 Ga0055525_1000051 3300003759 Bacteria 240942
47 Ga0055542_1000020 3300003762 Bacteria 335745
48 Ga0055542_1001199 3300003762 Bacteria 14738
49 Ga0055542_1001275 3300003762 Bacteria 13593
50 Ga0055542_1001390 3300003762 Bacteria 12269
51 Ga0055529_1000016 3300003763 Bacteria 364775
52 Ga0055526_1000860 3300003771 Bacteria 22629
53 Ga0055526_1000889 3300003771 Bacteria 22242
54 Ga0055537_1001353 3300003773 Bacteria 9903
55 Ga0055524_1000088 3300003775 Bacteria 116065
56 Ga0055536_1000643 3300003781 Bacteria 23754
57 Ga0055536_1003738 3300003781 Bacteria 8061
58 Ga0055536_1005185 3300003781 Bacteria 6437
59 Ga0055530_10000035 3300003791 Bacteria 117598
60 Ga0055530_10012785 3300003791 Bacteria 2906
61 Ga0055531_10000016 3300003794 Bacteria 181898
62 Ga0055531_10008646 3300003794 Bacteria 5329
63 Ga0055531_10014014 3300003794 Bacteria 3646
64 Ga0055543_1007157 3300004625 Bacteria 2609
65 Ga0065165_1020337 3300005262 Bacteria 2338
66 Ga0065712_10075642 3300005290 Bacteria 3818
67 Ga0065712_10083209 3300005290 Bacteria 2853
68 Ga0065707_10081716 3300005295 Bacteria 73074
69 Ga0065707_10086469 3300005295 Bacteria 5445
70 Ga0070658_10000001 3300005327 Bacteria 856789
71 Ga0070658_10000305 3300005327 Bacteria 42490
72 Ga0070658_10000379 3300005327 Bacteria 38762
73 Ga0070658_10000479 3300005327 Bacteria 34657
74 Ga0070658_10000850 3300005327 Bacteria 26066
75 Ga0070658_10005651 3300005327 Bacteria 10140
76 Ga0070658_10006525 3300005327 Bacteria 9464
77 Ga0070658_10008752 3300005327 Bacteria 8131
78 Ga0070658_10014485 3300005327 Bacteria 6328
79 Ga0070658_10051304 3300005327 Bacteria 3344
80 Ga0070658_10053035 3300005327 Bacteria 3290
81 Ga0070658_10113895 3300005327 Bacteria 2242
82 Ga0070658_10115961 3300005327 Bacteria 2222
83 Ga0070676_10000230 3300005328 Bacteria 23872
84 Ga0070676_10000684 3300005328 Bacteria 16604
85 Ga0070676_10016127 3300005328 Bacteria 4127
86 Ga0070683_100000872 3300005329 Bacteria 22349
87 Ga0070683_100001218 3300005329 Bacteria 19546
88 Ga0070683_100005194 3300005329 Bacteria 10837
89 Ga0070683_100019193 3300005329 Bacteria 6071
90 Ga0070683_100025315 3300005329 Bacteria 5328
91 Ga0070683_100090141 3300005329 Bacteria 2878
92 Ga0070690_100000056 3300005330 Bacteria 54517
93 Ga0070690_100018174 3300005330 Bacteria 4241
94 Ga0070690_100084547 3300005330 Bacteria 2080
95 Ga0070670_100000051 3300005331 Bacteria 131351
96 Ga0070670_100000082 3300005331 Bacteria 91524
97 Ga0070670_100000943 3300005331 Bacteria 22839
98 Ga0070670_100002485 3300005331 Bacteria 15200
99 Ga0070670_100004196 3300005331 Bacteria 12063
100 Ga0070670_100004537 3300005331 Bacteria 11642
101 Ga0070670_100006073 3300005331 Bacteria 10216
102 Ga0070670_100131295 3300005331 Bacteria 2163
103 Ga0070677_10000280 3300005333 Bacteria 17866
104 Ga0070677_10000313 3300005333 Bacteria 16902
105 Ga0070677_10003195 3300005333 Bacteria 5273
106 Ga0070677_10030438 3300005333 Bacteria 2055
107 Ga0068869_100000200 3300005334 Bacteria 31213
108 Ga0068869_100014247 3300005334 Bacteria 5307
109 Ga0068869_100064085 3300005334 Bacteria 2703
110 Ga0068869_100166989 3300005334 Bacteria 1717
111 Ga0068869_100177760 3300005334 Bacteria 1667
112 Ga0070666_10000002 3300005335 Bacteria 478684
113 Ga0070666_10000788 3300005335 Bacteria 19216
114 Ga0070666_10003797 3300005335 Bacteria 9162
115 Ga0070666_10020684 3300005335 Bacteria 4257
116 Ga0070666_10025876 3300005335 Bacteria 3827
117 Ga0070666_10080961 3300005335 Bacteria 2220
118 Ga0070680_100000600 3300005336 Bacteria 24915
119 Ga0070680_100000616 3300005336 Bacteria 24670
120 Ga0070680_100004470 3300005336 Bacteria 10532
121 Ga0070680_100004642 3300005336 Bacteria 10330
122 Ga0070680_100008845 3300005336 Bacteria 7720
123 Ga0070680_100010475 3300005336 Bacteria 7149
124 Ga0070680_100010643 3300005336 Bacteria 7095
125 Ga0070680_100071155 3300005336 Bacteria 2857
126 Ga0070680_100120398 3300005336 Bacteria 2191
127 Ga0070682_100010648 3300005337 Bacteria 5225
128 Ga0070682_100030569 3300005337 Bacteria 3252
129 Ga0070682_100067986 3300005337 Bacteria 2270
130 Ga0068868_100000211 3300005338 Bacteria 39269
131 Ga0068868_100001398 3300005338 Bacteria 16647
132 Ga0068868_100004543 3300005338 Bacteria 9742
133 Ga0068868_100011949 3300005338 Bacteria 6334
134 Ga0068868_100019655 3300005338 Bacteria 5064
135 Ga0070660_100000129 3300005339 Bacteria 47402
136 Ga0070660_100000681 3300005339 Bacteria 22460
137 Ga0070660_100001859 3300005339 Bacteria 14533
138 Ga0070660_100002066 3300005339 Bacteria 13865
139 Ga0070660_100004583 3300005339 Bacteria 9552
140 Ga0070660_100005957 3300005339 Bacteria 8426
141 Ga0070660_100014573 3300005339 Bacteria 5670
142 Ga0070660_100019096 3300005339 Bacteria 5017
143 Ga0070660_100028562 3300005339 Bacteria 4174
144 Ga0070660_100031328 3300005339 Bacteria 3993
145 Ga0070660_100033386 3300005339 Bacteria 3880
146 Ga0070660_100037771 3300005339 Bacteria 3661
147 Ga0070660_100040066 3300005339 Bacteria 3563
148 Ga0070660_100048163 3300005339 Bacteria 3272
149 Ga0070660_100057048 3300005339 Bacteria 3024
150 Ga0070660_100096948 3300005339 Bacteria 2332
151 Ga0070660_100154036 3300005339 Bacteria 1849
152 Ga0070689_100012764 3300005340 Bacteria 6063
153 Ga0070689_100039939 3300005340 Bacteria 3595
154 Ga0070689_100059567 3300005340 Bacteria 2968
155 Ga0070689_100093709 3300005340 Bacteria 2370
156 Ga0070689_100125604 3300005340 Bacteria 2053
157 Ga0070691_10005745 3300005341 Bacteria 5657
158 Ga0070661_100000033 3300005344 Bacteria 111757
159 Ga0070661_100002017 3300005344 Bacteria 14045
160 Ga0070661_100004224 3300005344 Bacteria 9907
161 Ga0070661_100009916 3300005344 Bacteria 6608
162 Ga0070661_100012238 3300005344 Bacteria 5999
163 Ga0070661_100014188 3300005344 Bacteria 5612
164 Ga0070661_100014229 3300005344 Bacteria 5604
165 Ga0070661_100018362 3300005344 Bacteria 4973
166 Ga0070661_100021239 3300005344 Bacteria 4634
167 Ga0070661_100024993 3300005344 Bacteria 4289
168 Ga0070661_100055470 3300005344 Bacteria 2902
169 Ga0070661_100132468 3300005344 Bacteria 1873
170 Ga0070692_10002933 3300005345 Bacteria 6772
171 Ga0070692_10013735 3300005345 Bacteria 3783
172 Ga0070692_10017251 3300005345 Bacteria 3448
173 Ga0070692_10056377 3300005345 Bacteria 2057
174 Ga0070668_100000123 3300005347 Bacteria 48192
175 Ga0070668_100000239 3300005347 Bacteria 36109
176 Ga0070668_100002657 3300005347 Bacteria 13141
177 Ga0070668_100012835 3300005347 Bacteria 6237
178 Ga0070668_100027078 3300005347 Bacteria 4350
179 Ga0070668_100033344 3300005347 Bacteria 3921
180 Ga0070668_100141107 3300005347 Bacteria 1941
181 Ga0070669_100000015 3300005353 Bacteria 197597
182 Ga0070669_100000170 3300005353 Bacteria 57161
183 Ga0070669_100002555 3300005353 Bacteria 13158
184 Ga0070669_100036391 3300005353 Bacteria 3567
185 Ga0070669_100062916 3300005353 Bacteria 2730
186 Ga0070669_100097082 3300005353 Bacteria 2217
187 Ga0070675_100002924 3300005354 Bacteria 12880
188 Ga0070675_100003598 3300005354 Bacteria 11795
189 Ga0070675_100006627 3300005354 Bacteria 8902
190 Ga0070675_100013571 3300005354 Bacteria 6407
191 Ga0070675_100017003 3300005354 Bacteria 5779
192 Ga0070675_100028636 3300005354 Bacteria 4484
193 Ga0070671_100000752 3300005355 Bacteria 23230
194 Ga0070671_100000800 3300005355 Bacteria 22726
195 Ga0070671_100001276 3300005355 Bacteria 18894
196 Ga0070671_100001537 3300005355 Bacteria 17332
197 Ga0070671_100001615 3300005355 Bacteria 16981
198 Ga0070671_100001659 3300005355 Bacteria 16838
199 Ga0070671_100003305 3300005355 Bacteria 12584
200 Ga0070671_100003888 3300005355 Bacteria 11741
201 Ga0070671_100005392 3300005355 Bacteria 10196
202 Ga0070671_100008209 3300005355 Bacteria 8356
203 Ga0070671_100012222 3300005355 Bacteria 6908
204 Ga0070671_100013565 3300005355 Bacteria 6570
205 Ga0070671_100014111 3300005355 Bacteria 6451
206 Ga0070671_100045632 3300005355 Bacteria 3644
207 Ga0070671_100048329 3300005355 Bacteria 3538
208 Ga0070671_100053502 3300005355 Bacteria 3356
209 Ga0070671_100081778 3300005355 Bacteria 2701
210 Ga0070671_100097127 3300005355 Bacteria 2470
211 Ga0070671_100108398 3300005355 Bacteria 2332
212 Ga0070671_100129176 3300005355 Bacteria 2128
213 Ga0070674_100000718 3300005356 Bacteria 16912
214 Ga0070674_100000748 3300005356 Bacteria 16655
215 Ga0070674_100001371 3300005356 Bacteria 12872
216 Ga0070674_100015430 3300005356 Bacteria 4768
217 Ga0070674_100020407 3300005356 Bacteria 4233
218 Ga0070674_100105869 3300005356 Bacteria 2057
219 Ga0070673_100000006 3300005364 Bacteria 184299
220 Ga0070673_100002363 3300005364 Bacteria 11472
221 Ga0070673_100009873 3300005364 Bacteria 6430
222 Ga0070673_100044036 3300005364 Bacteria 3453
223 Ga0070673_100051154 3300005364 Bacteria 3233
224 Ga0070673_100063482 3300005364 Bacteria 2939
225 Ga0070673_100111879 3300005364 Bacteria 2266
226 Ga0070673_100157431 3300005364 Bacteria 1929
227 Ga0070673_100189082 3300005364 Bacteria 1767
228 Ga0070688_100003372 3300005365 Bacteria 8200
229 Ga0070688_100005608 3300005365 Bacteria 6624
230 Ga0070659_100000142 3300005366 Bacteria 55216
231 Ga0070659_100005145 3300005366 Bacteria 9377
232 Ga0070659_100009365 3300005366 Bacteria 7193
233 Ga0070659_100010150 3300005366 Bacteria 6929
234 Ga0070659_100012774 3300005366 Bacteria 6234
235 Ga0070659_100017956 3300005366 Bacteria 5331
236 Ga0070659_100018877 3300005366 Bacteria 5209
237 Ga0070659_100024936 3300005366 Bacteria 4588
238 Ga0070659_100031664 3300005366 Bacteria 4097
239 Ga0070659_100040883 3300005366 Bacteria 3624
240 Ga0070659_100048252 3300005366 Bacteria 3344
241 Ga0070659_100057384 3300005366 Bacteria 3070
242 Ga0070659_100078933 3300005366 Bacteria 2627
243 Ga0070659_100087077 3300005366 Bacteria 2500
244 Ga0070659_100152871 3300005366 Bacteria 1883
245 Ga0070667_100000003 3300005367 Bacteria 447715
246 Ga0070667_100000302 3300005367 Bacteria 55150
247 Ga0070667_100000368 3300005367 Bacteria 49069
248 Ga0070667_100000822 3300005367 Bacteria 28877
249 Ga0070667_100001727 3300005367 Bacteria 19525
250 Ga0070667_100002988 3300005367 Bacteria 14531
251 Ga0070667_100003689 3300005367 Bacteria 13031
252 Ga0070667_100003956 3300005367 Bacteria 12572
253 Ga0070667_100005056 3300005367 Bacteria 11037
254 Ga0070667_100006137 3300005367 Bacteria 9981
255 Ga0070667_100013924 3300005367 Bacteria 6650
256 Ga0070667_100028536 3300005367 Bacteria 4647
257 Ga0070667_100029435 3300005367 Bacteria 4575
258 Ga0070667_100052745 3300005367 Bacteria 3432
259 Ga0070667_100073314 3300005367 Bacteria 2919
260 Ga0070667_100090631 3300005367 Bacteria 2628
261 Ga0070703_10003989 3300005406 Bacteria 4172
262 Ga0070709_10003261 3300005434 Bacteria 8717
263 Ga0070709_10007053 3300005434 Bacteria 6144
264 Ga0070714_100002983 3300005435 Bacteria 12537
265 Ga0070714_100073499 3300005435 Bacteria 2962
266 Ga0070714_100099322 3300005435 Bacteria 2562
267 Ga0070714_100109792 3300005435 Bacteria 2441
268 Ga0070713_100003651 3300005436 Bacteria 10185
269 Ga0070713_100004268 3300005436 Bacteria 9565
270 Ga0070713_100014792 3300005436 Bacteria 5807
271 Ga0070713_100025686 3300005436 Bacteria 4610
272 Ga0070713_100034688 3300005436 Bacteria 4057
273 Ga0070713_100083522 3300005436 Bacteria 2730
274 Ga0070713_100260187 3300005436 Bacteria 1585
275 Ga0070710_10000852 3300005437 Bacteria 14636
276 Ga0070710_10003754 3300005437 Bacteria 7179
277 Ga0070710_10026755 3300005437 Bacteria 3069
278 Ga0070701_10009044 3300005438 Bacteria 4346
279 Ga0070711_100000579 3300005439 Bacteria 19103
280 Ga0070711_100004246 3300005439 Bacteria 8426
281 Ga0070711_100031096 3300005439 Bacteria 3540
282 Ga0070711_100039533 3300005439 Bacteria 3178
283 Ga0070711_100072929 3300005439 Bacteria 2424
284 Ga0070705_100000184 3300005440 Bacteria 36475
285 Ga0070700_100004078 3300005441 Bacteria 7603
286 Ga0070700_100008627 3300005441 Bacteria 5555
287 Ga0070700_100083333 3300005441 Bacteria 2070
288 Ga0070708_100015866 3300005445 Bacteria 6231
289 Ga0070708_100107810 3300005445 Bacteria 2557
290 Ga0070663_100002670 3300005455 Bacteria 10104
291 Ga0070663_100003557 3300005455 Bacteria 8997
292 Ga0070663_100005172 3300005455 Bacteria 7724
293 Ga0070663_100005966 3300005455 Bacteria 7293
294 Ga0070663_100016951 3300005455 Bacteria 4742
295 Ga0070663_100088654 3300005455 Bacteria 2288
296 Ga0070663_100096565 3300005455 Bacteria 2198
297 Ga0070678_100000174 3300005456 Bacteria 27635
298 Ga0070678_100002723 3300005456 Bacteria 9748
299 Ga0070678_100016924 3300005456 Bacteria 4677
300 Ga0070678_100026940 3300005456 Bacteria 3894
301 Ga0070678_100044590 3300005456 Bacteria 3167
302 Ga0070662_100000021 3300005457 Bacteria 93909
303 Ga0070662_100003529 3300005457 Bacteria 9754
304 Ga0070662_100004787 3300005457 Bacteria 8574
305 Ga0070662_100007108 3300005457 Bacteria 7246
306 Ga0070662_100007293 3300005457 Bacteria 7163
307 Ga0070662_100009507 3300005457 Bacteria 6359
308 Ga0070662_100010773 3300005457 Bacteria 6018
309 Ga0070662_100012137 3300005457 Bacteria 5704
310 Ga0070662_100017938 3300005457 Bacteria 4778
311 Ga0070662_100018756 3300005457 Bacteria 4685
312 Ga0070662_100020888 3300005457 Bacteria 4465
313 Ga0070662_100032534 3300005457 Bacteria 3665
314 Ga0070662_100121128 3300005457 Bacteria 2005
315 Ga0070662_100128986 3300005457 Bacteria 1947
316 Ga0070681_10000213 3300005458 Bacteria 45271
317 Ga0070681_10016990 3300005458 Bacteria 7271
318 Ga0070681_10041495 3300005458 Bacteria 4612
319 Ga0070681_10054387 3300005458 Bacteria 3988
320 Ga0070681_10063330 3300005458 Bacteria 3670
321 Ga0070681_10080191 3300005458 Bacteria 3220
322 Ga0070681_10086329 3300005458 Bacteria 3091
323 Ga0070681_10087020 3300005458 Bacteria 3078
324 Ga0070681_10191434 3300005458 Bacteria 1965
325 Ga0068867_100000001 3300005459 Bacteria 427563
326 Ga0068867_100002865 3300005459 Bacteria 12138
327 Ga0068867_100013035 3300005459 Bacteria 5883
328 Ga0068867_100033175 3300005459 Bacteria 3737
329 Ga0068867_100037400 3300005459 Bacteria 3527
330 Ga0070685_10001714 3300005466 Bacteria 11505
331 Ga0070685_10007722 3300005466 Bacteria 5506
332 Ga0070685_10072331 3300005466 Bacteria 2046
333 Ga0070706_100044073 3300005467 Bacteria 4121
334 Ga0070706_100072698 3300005467 Bacteria 3182
335 Ga0070698_100003229 3300005471 Bacteria 17957
336 Ga0070698_100006503 3300005471 Bacteria 12674
337 Ga0070699_100010191 3300005518 Bacteria 8129
338 Ga0070679_100001596 3300005530 Bacteria 20324
339 Ga0070679_100035868 3300005530 Bacteria 4920
340 Ga0070679_100036042 3300005530 Bacteria 4908
341 Ga0070679_100115263 3300005530 Bacteria 2672
342 Ga0070679_100124122 3300005530 Bacteria 2565
343 Ga0070684_100003221 3300005535 Bacteria 12209
344 Ga0070684_100009141 3300005535 Bacteria 7792
345 Ga0070684_100040425 3300005535 Bacteria 4015
346 Ga0070697_100056836 3300005536 Bacteria 3183
347 Ga0068853_100000377 3300005539 Bacteria 30591
348 Ga0068853_100019914 3300005539 Bacteria 5572
349 Ga0068853_100050078 3300005539 Bacteria 3592
350 Ga0068853_100063299 3300005539 Bacteria 3204
351 Ga0068853_100066697 3300005539 Bacteria 3126
352 Ga0068853_100126802 3300005539 Bacteria 2281
353 Ga0068853_100128477 3300005539 Bacteria 2266
354 Ga0068853_100171074 3300005539 Bacteria 1965
355 Ga0070672_100001912 3300005543 Bacteria 13063
356 Ga0070672_100004199 3300005543 Bacteria 9412
357 Ga0070672_100010078 3300005543 Bacteria 6543
358 Ga0070672_100045817 3300005543 Bacteria 3385
359 Ga0070672_100087536 3300005543 Bacteria 2507
360 Ga0070686_100000335 3300005544 Bacteria 30423
361 Ga0070686_100007369 3300005544 Bacteria 6135
362 Ga0070695_100004130 3300005545 Bacteria 8481
363 Ga0070695_100012697 3300005545 Bacteria 5057
364 Ga0070695_100042561 3300005545 Bacteria 2884
365 Ga0070696_100001650 3300005546 Bacteria 14632
366 Ga0070696_100002429 3300005546 Bacteria 12345
367 Ga0070696_100005022 3300005546 Bacteria 8845
368 Ga0070693_100000142 3300005547 Bacteria 32335
369 Ga0070693_100001485 3300005547 Bacteria 10562
370 Ga0070693_100015393 3300005547 Bacteria 3937
371 Ga0070693_100039835 3300005547 Bacteria 2634
372 Ga0070693_100096547 3300005547 Bacteria 1792
373 Ga0070665_100000036 3300005548 Bacteria 314603
374 Ga0070665_100000044 3300005548 Bacteria 276702
375 Ga0070665_100000511 3300005548 Bacteria 55709
376 Ga0070665_100007138 3300005548 Bacteria 11360
377 Ga0070665_100009401 3300005548 Bacteria 9894
378 Ga0070665_100012240 3300005548 Bacteria 8647
379 Ga0070665_100026945 3300005548 Bacteria 5787
380 Ga0070665_100035413 3300005548 Bacteria 5019
381 Ga0070665_100042559 3300005548 Bacteria 4566
382 Ga0070665_100060657 3300005548 Bacteria 3791
383 Ga0070665_100097616 3300005548 Bacteria 2942
384 Ga0070665_100135763 3300005548 Bacteria 2462
385 Ga0070704_100000206 3300005549 Bacteria 24525
386 Ga0068855_100000023 3300005563 Bacteria 190440
387 Ga0068855_100000300 3300005563 Bacteria 61687
388 Ga0068855_100000745 3300005563 Bacteria 40001
389 Ga0068855_100001693 3300005563 Bacteria 27587
390 Ga0068855_100012583 3300005563 Bacteria 10211
391 Ga0068855_100013523 3300005563 Bacteria 9841
392 Ga0068855_100018695 3300005563 Bacteria 8334
393 Ga0068855_100021428 3300005563 Bacteria 7750
394 Ga0068855_100024176 3300005563 Bacteria 7273
395 Ga0068855_100063456 3300005563 Bacteria 4311
396 Ga0068855_100110416 3300005563 Bacteria 3157
397 Ga0068855_100127278 3300005563 Bacteria 2912
398 Ga0068855_100226415 3300005563 Bacteria 2095
399 Ga0068855_100231531 3300005563 Bacteria 2068
400 Ga0068855_100267088 3300005563 Bacteria 1904
401 Ga0070664_100000153 3300005564 Bacteria 47344
402 Ga0070664_100001180 3300005564 Bacteria 20792
403 Ga0070664_100001693 3300005564 Bacteria 17666
404 Ga0070664_100003525 3300005564 Bacteria 12637
405 Ga0070664_100005876 3300005564 Bacteria 9906
406 Ga0070664_100006228 3300005564 Bacteria 9635
407 Ga0070664_100007149 3300005564 Bacteria 9000
408 Ga0070664_100007605 3300005564 Bacteria 8749
409 Ga0070664_100036433 3300005564 Bacteria 4133
410 Ga0070664_100039466 3300005564 Bacteria 3979
411 Ga0070664_100068165 3300005564 Bacteria 3042
412 Ga0070664_100084767 3300005564 Bacteria 2736
413 Ga0070664_100131359 3300005564 Bacteria 2200
414 Ga0070664_100141286 3300005564 Bacteria 2120
415 Ga0068857_100005521 3300005577 Bacteria 10789
416 Ga0068857_100014306 3300005577 Bacteria 6915
417 Ga0068857_100018102 3300005577 Bacteria 6180
418 Ga0068857_100020750 3300005577 Bacteria 5781
419 Ga0068857_100025988 3300005577 Bacteria 5157
420 Ga0068857_100038230 3300005577 Bacteria 4250
421 Ga0068857_100040798 3300005577 Bacteria 4115
422 Ga0068857_100058339 3300005577 Bacteria 3427
423 Ga0068857_100107960 3300005577 Bacteria 2500
424 Ga0068857_100129928 3300005577 Bacteria 2271
425 Ga0068854_100000728 3300005578 Bacteria 19507
426 Ga0068854_100002199 3300005578 Bacteria 11994
427 Ga0068854_100003807 3300005578 Bacteria 9437
428 Ga0068854_100004330 3300005578 Bacteria 8946
429 Ga0068854_100021800 3300005578 Bacteria 4353
430 Ga0068854_100057719 3300005578 Bacteria 2800
431 Ga0068854_100074671 3300005578 Bacteria 2487
432 Ga0068854_100082051 3300005578 Bacteria 2383
433 Ga0068854_100102502 3300005578 Bacteria 2147
434 Ga0068856_100000177 3300005614 Bacteria 66207
435 Ga0068856_100003591 3300005614 Bacteria 15606
436 Ga0068856_100004105 3300005614 Bacteria 14555
437 Ga0068856_100004652 3300005614 Bacteria 13634
438 Ga0068856_100028489 3300005614 Bacteria 5454
439 Ga0068856_100131609 3300005614 Bacteria 2506
440 Ga0068856_100264555 3300005614 Bacteria 1735
441 Ga0070702_100023939 3300005615 Bacteria 3251
442 Ga0070702_100029297 3300005615 Bacteria 2992
443 Ga0068852_100000831 3300005616 Bacteria 20424
444 Ga0068852_100001121 3300005616 Bacteria 17696
445 Ga0068852_100003329 3300005616 Bacteria 11220
446 Ga0068852_100007771 3300005616 Bacteria 7849
447 Ga0068852_100009207 3300005616 Bacteria 7317
448 Ga0068852_100009998 3300005616 Bacteria 7059
449 Ga0068852_100011601 3300005616 Bacteria 6645
450 Ga0068852_100014916 3300005616 Bacteria 6004
451 Ga0068852_100018310 3300005616 Bacteria 5518
452 Ga0068852_100019159 3300005616 Bacteria 5409
453 Ga0068852_100082978 3300005616 Bacteria 2849
454 Ga0068852_100086196 3300005616 Bacteria 2799
455 Ga0068852_100137015 3300005616 Bacteria 2261
456 Ga0068859_100000221 3300005617 Bacteria 56589
457 Ga0068859_100006416 3300005617 Bacteria 11934
458 Ga0068859_100008575 3300005617 Bacteria 10336
459 Ga0068859_100011388 3300005617 Bacteria 8944
460 Ga0068859_100011473 3300005617 Bacteria 8908
461 Ga0068859_100011617 3300005617 Bacteria 8856
462 Ga0068859_100018178 3300005617 Bacteria 7065
463 Ga0068859_100019163 3300005617 Bacteria 6872
464 Ga0068859_100022785 3300005617 Bacteria 6279
465 Ga0068859_100045506 3300005617 Bacteria 4409
466 Ga0068859_100082988 3300005617 Bacteria 3247
467 Ga0068859_100231383 3300005617 Bacteria 1936
468 Ga0068864_100000004 3300005618 Bacteria 489341
469 Ga0068864_100000177 3300005618 Bacteria 58504
470 Ga0068864_100000261 3300005618 Bacteria 47015
471 Ga0068864_100000324 3300005618 Bacteria 42149
472 Ga0068864_100007209 3300005618 Bacteria 9136
473 Ga0068864_100007278 3300005618 Bacteria 9101
474 Ga0068864_100009088 3300005618 Bacteria 8191
475 Ga0068864_100013433 3300005618 Bacteria 6789
476 Ga0068864_100024970 3300005618 Bacteria 5029
477 Ga0068864_100025411 3300005618 Bacteria 4987
478 Ga0068864_100027191 3300005618 Bacteria 4829
479 Ga0068864_100038262 3300005618 Bacteria 4096
480 Ga0068864_100043160 3300005618 Bacteria 3860
481 Ga0068864_100052275 3300005618 Bacteria 3521
482 Ga0068864_100074408 3300005618 Bacteria 2964
483 Ga0068864_100136533 3300005618 Bacteria 2209
484 Ga0068864_100148040 3300005618 Bacteria 2124
485 Ga0068866_10035464 3300005718 Bacteria 2437
486 Ga0068861_100001270 3300005719 Bacteria 15759
487 Ga0068861_100039311 3300005719 Bacteria 3529
488 Ga0068861_100085604 3300005719 Bacteria 2476
489 Ga0068851_10009967 3300005834 Bacteria 4424
490 Ga0068851_10030749 3300005834 Bacteria 2664
491 Ga0068870_10008588 3300005840 Bacteria 4601
492 Ga0068863_100000002 3300005841 Bacteria 489510
493 Ga0068863_100000020 3300005841 Bacteria 198519
494 Ga0068863_100000095 3300005841 Bacteria 96080
495 Ga0068863_100001640 3300005841 Bacteria 22143
496 Ga0068863_100001823 3300005841 Bacteria 21161
497 Ga0068863_100003774 3300005841 Bacteria 14981
498 Ga0068863_100008644 3300005841 Bacteria 9949
499 Ga0068863_100012046 3300005841 Bacteria 8356
500 Ga0068863_100015353 3300005841 Bacteria 7361
501 Ga0068863_100019074 3300005841 Bacteria 6566
502 Ga0068863_100020697 3300005841 Bacteria 6283
503 Ga0068863_100025080 3300005841 Bacteria 5686
504 Ga0068863_100029577 3300005841 Bacteria 5229
505 Ga0068863_100050697 3300005841 Bacteria 3934
506 Ga0068858_100000629 3300005842 Bacteria 36674
507 Ga0068858_100000919 3300005842 Bacteria 30552
508 Ga0068858_100002032 3300005842 Bacteria 20627
509 Ga0068858_100002740 3300005842 Bacteria 17718
510 Ga0068858_100004134 3300005842 Bacteria 14284
511 Ga0068858_100023221 3300005842 Bacteria 5783
512 Ga0068858_100029876 3300005842 Bacteria 5063
513 Ga0068858_100056546 3300005842 Bacteria 3625
514 Ga0068858_100106184 3300005842 Bacteria 2621
515 Ga0068860_100000001 3300005843 Bacteria 703043
516 Ga0068860_100000068 3300005843 Bacteria 179208
517 Ga0068860_100000416 3300005843 Bacteria 55156
518 Ga0068860_100000437 3300005843 Bacteria 52907
519 Ga0068860_100001066 3300005843 Bacteria 30262
520 Ga0068860_100003216 3300005843 Bacteria 16847
521 Ga0068860_100012537 3300005843 Bacteria 8346
522 Ga0068860_100012929 3300005843 Bacteria 8201
523 Ga0068860_100034664 3300005843 Bacteria 4842
524 Ga0068860_100103508 3300005843 Bacteria 2717
525 Ga0068860_100147920 3300005843 Bacteria 2261
526 Ga0068860_100194923 3300005843 Bacteria 1962
527 Ga0068862_100000002 3300005844 Bacteria 489341
528 Ga0068862_100000006 3300005844 Bacteria 346828
529 Ga0068862_100000135 3300005844 Bacteria 85248
530 Ga0068862_100000157 3300005844 Bacteria 76001
531 Ga0068862_100000350 3300005844 Bacteria 49916
532 Ga0068862_100001068 3300005844 Bacteria 26256
533 Ga0068862_100005895 3300005844 Bacteria 10205
534 Ga0068862_100007386 3300005844 Bacteria 9113
535 Ga0068862_100010180 3300005844 Bacteria 7761
536 Ga0068862_100017312 3300005844 Bacteria 6000
537 Ga0068862_100033433 3300005844 Bacteria 4347
538 Ga0068862_100065008 3300005844 Bacteria 3141
539 Ga0081455_10000009 3300005937 Bacteria 249885
540 Ga0081455_10000255 3300005937 Bacteria 69927
541 Ga0081455_10000888 3300005937 Bacteria 38587
542 Ga0081455_10004048 3300005937 Bacteria 16614
543 Ga0081455_10027074 3300005937 Bacteria 5259
544 Ga0081455_10030375 3300005937 Bacteria 4907
545 Ga0081455_10070836 3300005937 Bacteria 2893
546 Ga0081455_10117778 3300005937 Bacteria 2098
547 Ga0081538_10023100 3300005981 Bacteria 4480
548 Ga0081538_10023134 3300005981 Bacteria 4476
549 Ga0081540_1001876 3300005983 Bacteria 17587
550 Ga0081540_1037558 3300005983 Bacteria 2565
551 Ga0081539_10001657 3300005985 Bacteria 36110
552 Ga0081539_10001888 3300005985 Bacteria 32580
553 Ga0081539_10004963 3300005985 Bacteria 14096
554 Ga0081539_10012146 3300005985 Bacteria 6687
555 Ga0081539_10022108 3300005985 Bacteria 4220
556 Ga0070717_10002352 3300006028 Bacteria 13323
557 Ga0070717_10004598 3300006028 Bacteria 9994
558 Ga0070717_10049188 3300006028 Bacteria 3460
559 Ga0070717_10075667 3300006028 Bacteria 2816
560 Ga0075365_10008773 3300006038 Bacteria 5766
561 Ga0075365_10056498 3300006038 Bacteria 2609
562 Ga0075365_10104685 3300006038 Bacteria 1940
563 Ga0075364_10005189 3300006051 Bacteria 7556
564 Ga0075364_10042922 3300006051 Bacteria 2939
565 Ga0070715_10000204 3300006163 Bacteria 13962
566 Ga0070715_10011011 3300006163 Bacteria 3242
567 Ga0070716_100002258 3300006173 Bacteria 8883
568 Ga0070716_100003372 3300006173 Bacteria 7517
569 Ga0070712_100017962 3300006175 Bacteria 4585
570 Ga0070712_100033163 3300006175 Bacteria 3492
571 Ga0070712_100088701 3300006175 Bacteria 2260
572 Ga0075362_10007222 3300006177 Bacteria 4192
573 Ga0075366_10011090 3300006195 Bacteria 5078
574 Ga0075366_10040273 3300006195 Bacteria 2763
575 Ga0097621_100001076 3300006237 Bacteria 19102
576 Ga0097621_100010249 3300006237 Bacteria 6846
577 Ga0097621_100036752 3300006237 Bacteria 3919
578 Ga0097621_100064364 3300006237 Bacteria 3015
579 Ga0097621_100073644 3300006237 Bacteria 2828
580 Ga0097621_100247478 3300006237 Bacteria 1560
581 Ga0068871_100002906 3300006358 Bacteria 11746
582 Ga0068871_100041487 3300006358 Bacteria 3690
583 Ga0068871_100097453 3300006358 Bacteria 2458
584 Ga0075428_100001209 3300006844 Bacteria 27601
585 Ga0075428_100030788 3300006844 Bacteria 5933
586 Ga0075430_100145246 3300006846 Bacteria 1976
587 Ga0075431_100000698 3300006847 Bacteria 28955
588 Ga0075431_100002361 3300006847 Bacteria 18126
589 Ga0075431_100019933 3300006847 Bacteria 6848
590 Ga0075431_100147081 3300006847 Bacteria 2428
591 Ga0075434_100066457 3300006871 Bacteria 3591
592 Ga0075434_100118519 3300006871 Bacteria 2661
593 Ga0075429_100004139 3300006880 Bacteria 12411
594 Ga0075429_100129752 3300006880 Bacteria 2205
595 Ga0075429_100196797 3300006880 Bacteria 1765
596 Ga0068865_100000003 3300006881 Bacteria 231761
597 Ga0068865_100017616 3300006881 Bacteria 4597
598 Ga0068865_100076170 3300006881 Bacteria 2394
599 Ga0068865_100081124 3300006881 Bacteria 2329
600 Ga0097620_100000221 3300006931 Bacteria 56589
601 Ga0097620_100006416 3300006931 Bacteria 11934
602 Ga0097620_100008575 3300006931 Bacteria 10336
603 Ga0097620_100011389 3300006931 Bacteria 8944
604 Ga0097620_100011473 3300006931 Bacteria 8908
605 Ga0097620_100011616 3300006931 Bacteria 8856
606 Ga0097620_100018178 3300006931 Bacteria 7065
607 Ga0097620_100019162 3300006931 Bacteria 6872
608 Ga0097620_100022785 3300006931 Bacteria 6279
609 Ga0097620_100045506 3300006931 Bacteria 4409
610 Ga0097620_100082989 3300006931 Bacteria 3247
611 Ga0097620_100231380 3300006931 Bacteria 1936
612 Ga0075435_100083168 3300007076 Bacteria 2631
613 Ga0075435_100142170 3300007076 Bacteria 2014
614 Ga0099795_10015594 3300007788 Bacteria 2385
615 Ga0099795_10027040 3300007788 Bacteria 1938
616 Ga0105240_10006013 3300009093 Bacteria 17942
617 Ga0105240_10021655 3300009093 Bacteria 8546
618 Ga0105240_10103868 3300009093 Bacteria 3451
619 Ga0111539_10000100 3300009094 Bacteria 91427
620 Ga0111539_10022638 3300009094 Bacteria 7719
621 Ga0111539_10030494 3300009094 Bacteria 6554
622 Ga0111539_10082976 3300009094 Bacteria 3770
623 Ga0111539_10112144 3300009094 Bacteria 3199
624 Ga0111539_10130667 3300009094 Bacteria 2941
625 Ga0105245_10000113 3300009098 Bacteria 78545
626 Ga0105245_10000829 3300009098 Bacteria 28128
627 Ga0105245_10018068 3300009098 Bacteria 6161
628 Ga0105245_10021410 3300009098 Bacteria 5671
629 Ga0105245_10022147 3300009098 Bacteria 5580
630 Ga0105245_10030661 3300009098 Bacteria 4756
631 Ga0105245_10031501 3300009098 Bacteria 4693
632 Ga0105245_10043739 3300009098 Bacteria 3995
633 Ga0105247_10003366 3300009101 Bacteria 10460
634 Ga0105247_10014973 3300009101 Bacteria 4649
635 Ga0105247_10022433 3300009101 Bacteria 3802
636 Ga0105247_10074775 3300009101 Bacteria 2125
637 Ga0114129_10000571 3300009147 Bacteria 45368
638 Ga0114129_10003089 3300009147 Bacteria 23361
639 Ga0114129_10007283 3300009147 Bacteria 15749
640 Ga0114129_10119172 3300009147 Bacteria 3635
641 Ga0105243_10000373 3300009148 Bacteria 48115
642 Ga0105243_10175802 3300009148 Bacteria 1858
643 Ga0105243_10178619 3300009148 Bacteria 1844
644 Ga0105241_10003211 3300009174 Bacteria 12167
645 Ga0105241_10027086 3300009174 Bacteria 4267
646 Ga0105241_10038519 3300009174 Bacteria 3604
647 Ga0105242_10000165 3300009176 Bacteria 49974
648 Ga0105242_10003245 3300009176 Bacteria 12685
649 Ga0105242_10054054 3300009176 Bacteria 3281
650 Ga0105242_10116791 3300009176 Bacteria 2283
651 Ga0105248_10000010 3300009177 Bacteria 344314
652 Ga0105248_10000066 3300009177 Bacteria 121254
653 Ga0105248_10000442 3300009177 Bacteria 47089
654 Ga0105248_10000502 3300009177 Bacteria 44596
655 Ga0105248_10000604 3300009177 Bacteria 40877
656 Ga0105248_10000801 3300009177 Bacteria 35327
657 Ga0105248_10003885 3300009177 Bacteria 16517
658 Ga0105248_10007245 3300009177 Bacteria 12168
659 Ga0105248_10015860 3300009177 Bacteria 8303
660 Ga0105248_10016200 3300009177 Bacteria 8204
661 Ga0105248_10017490 3300009177 Bacteria 7906
662 Ga0105248_10022518 3300009177 Bacteria 6989
663 Ga0105248_10023426 3300009177 Bacteria 6859
664 Ga0105248_10026377 3300009177 Bacteria 6463
665 Ga0105248_10030051 3300009177 Bacteria 6063
666 Ga0105248_10030322 3300009177 Bacteria 6038
667 Ga0105248_10035428 3300009177 Bacteria 5582
668 Ga0105248_10042951 3300009177 Bacteria 5069
669 Ga0105248_10055955 3300009177 Bacteria 4425
670 Ga0105248_10063137 3300009177 Bacteria 4157
671 Ga0105248_10092035 3300009177 Bacteria 3415
672 Ga0105248_10163756 3300009177 Bacteria 2508
673 Ga0105248_10208927 3300009177 Bacteria 2199
674 Ga0105237_10013106 3300009545 Bacteria 8704
675 Ga0105237_10035190 3300009545 Bacteria 5069
676 Ga0105237_10059304 3300009545 Bacteria 3829
677 Ga0105237_10068625 3300009545 Bacteria 3539
678 Ga0105237_10109878 3300009545 Bacteria 2749
679 Ga0105237_10138109 3300009545 Bacteria 2432
680 Ga0105237_10235766 3300009545 Bacteria 1831
681 Ga0105237_10243249 3300009545 Bacteria 1801
682 Ga0105238_10005606 3300009551 Bacteria 12408
683 Ga0105238_10019905 3300009551 Bacteria 6831
684 Ga0105238_10032741 3300009551 Bacteria 5291
685 Ga0105238_10044294 3300009551 Bacteria 4499
686 Ga0105238_10180123 3300009551 Bacteria 2090
687 Ga0105238_10184042 3300009551 Bacteria 2066
688 Ga0105249_10000026 3300009553 Bacteria 232053
689 Ga0105249_10000041 3300009553 Bacteria 195999
690 Ga0105249_10000097 3300009553 Bacteria 120886
691 Ga0105249_10005822 3300009553 Bacteria 10663
692 Ga0105249_10006086 3300009553 Bacteria 10459
693 Ga0105249_10013760 3300009553 Bacteria 7145
694 Ga0105249_10040810 3300009553 Bacteria 4217
695 Ga0105249_10063536 3300009553 Bacteria 3392
696 Ga0105249_10132355 3300009553 Bacteria 2382
697 Ga0105239_10000216 3300010375 Bacteria 85418
698 Ga0105239_10037042 3300010375 Bacteria 5350
699 Ga0105239_10105403 3300010375 Bacteria 3122
700 Ga0105239_10216884 3300010375 Bacteria 2145
701 Ga0105246_10001620 3300011119 Bacteria 13399
702 Ga0105246_10039556 3300011119 Bacteria 3177
703 Ga0157326_1000195 3300012513 Bacteria 6841
704 Ga0157373_10008235 3300013100 Bacteria 7750
705 Ga0157373_10009132 3300013100 Bacteria 7332
706 Ga0157373_10010145 3300013100 Bacteria 6939
707 Ga0157373_10010212 3300013100 Bacteria 6916
708 Ga0157373_10012780 3300013100 Bacteria 6168
709 Ga0157373_10021820 3300013100 Bacteria 4646
710 Ga0157373_10024952 3300013100 Bacteria 4328
711 Ga0157373_10028202 3300013100 Bacteria 4051
712 Ga0157373_10028291 3300013100 Bacteria 4043
713 Ga0157373_10029331 3300013100 Bacteria 3962
714 Ga0157373_10065047 3300013100 Bacteria 2581
715 Ga0157373_10077967 3300013100 Bacteria 2337
716 Ga0157371_10000146 3300013102 Bacteria 103290
717 Ga0157371_10000895 3300013102 Bacteria 33562
718 Ga0157371_10002883 3300013102 Bacteria 16081
719 Ga0157371_10003905 3300013102 Bacteria 13277
720 Ga0157371_10005716 3300013102 Bacteria 10429
721 Ga0157371_10007603 3300013102 Bacteria 8742
722 Ga0157371_10013741 3300013102 Bacteria 6139
723 Ga0157371_10052623 3300013102 Bacteria 2891
724 Ga0157370_10000069 3300013104 Bacteria 112889
725 Ga0157370_10007343 3300013104 Bacteria 12022
726 Ga0157370_10008105 3300013104 Bacteria 11369
727 Ga0157370_10012095 3300013104 Bacteria 8979
728 Ga0157370_10021219 3300013104 Bacteria 6474
729 Ga0157370_10029253 3300013104 Bacteria 5411
730 Ga0157370_10042552 3300013104 Bacteria 4376
731 Ga0157370_10050230 3300013104 Bacteria 3987
732 Ga0157370_10051440 3300013104 Bacteria 3935
733 Ga0157370_10075832 3300013104 Bacteria 3169
734 Ga0157370_10116679 3300013104 Bacteria 2494
735 Ga0157369_10001743 3300013105 Bacteria 26402
736 Ga0157369_10008003 3300013105 Bacteria 12139
737 Ga0157369_10012108 3300013105 Bacteria 9794
738 Ga0157369_10016431 3300013105 Bacteria 8323
739 Ga0157369_10017379 3300013105 Bacteria 8084
740 Ga0157369_10337497 3300013105 Bacteria 1566
741 Ga0157374_10003127 3300013296 Bacteria 13908
742 Ga0157374_10006361 3300013296 Bacteria 10021
743 Ga0157374_10011569 3300013296 Bacteria 7648
744 Ga0157374_10019669 3300013296 Bacteria 5979
745 Ga0157374_10102501 3300013296 Bacteria 2745
746 Ga0157378_10002300 3300013297 Bacteria 16976
747 Ga0157378_10024953 3300013297 Bacteria 5265
748 Ga0157378_10054431 3300013297 Bacteria 3562
749 Ga0157378_10062626 3300013297 Bacteria 3322
750 Ga0157378_10089031 3300013297 Bacteria 2802
751 Ga0157378_10092060 3300013297 Bacteria 2758
752 Ga0157378_10096585 3300013297 Bacteria 2693
753 Ga0157378_10104322 3300013297 Bacteria 2591
754 Ga0157378_10113869 3300013297 Bacteria 2484
755 Ga0163162_10037737 3300013306 Bacteria 4822
756 Ga0163162_10134502 3300013306 Bacteria 2583
757 Ga0163162_10281485 3300013306 Bacteria 1795
758 Ga0157372_10080701 3300013307 Bacteria 3681
759 Ga0157372_10121515 3300013307 Bacteria 3000
760 Ga0157372_10126413 3300013307 Bacteria 2939
761 Ga0157372_10253570 3300013307 Bacteria 2043
762 Ga0157375_10009067 3300013308 Bacteria 8710
763 Ga0157375_10012994 3300013308 Bacteria 7396
764 Ga0157375_10013582 3300013308 Bacteria 7253
765 Ga0157375_10025658 3300013308 Bacteria 5481
766 Ga0157375_10041491 3300013308 Bacteria 4443
767 Ga0157375_10074230 3300013308 Bacteria 3422
768 Ga0157375_10339171 3300013308 Bacteria 1668
769 Ga0163163_10000164 3300014325 Bacteria 69244
770 Ga0163163_10001448 3300014325 Bacteria 20044
771 Ga0163163_10004133 3300014325 Bacteria 12362
772 Ga0163163_10006190 3300014325 Bacteria 10435
773 Ga0163163_10013626 3300014325 Bacteria 7445
774 Ga0163163_10164724 3300014325 Bacteria 2263
775 Ga0163163_10190423 3300014325 Bacteria 2100
776 Ga0157380_10000114 3300014326 Bacteria 44326
777 Ga0157380_10001342 3300014326 Bacteria 16023
778 Ga0157380_10001740 3300014326 Bacteria 14356
779 Ga0157380_10053860 3300014326 Bacteria 3191
780 Ga0157379_10007033 3300014968 Bacteria 9724
781 Ga0157379_10020107 3300014968 Bacteria 5901
782 Ga0157379_10040472 3300014968 Bacteria 4160
783 Ga0157379_10047981 3300014968 Bacteria 3811
784 Ga0157376_10000089 3300014969 Bacteria 69351
785 Ga0182005_1003002 3300015265 Bacteria 5837
786 Ga0163161_10000008 3300017792 Bacteria 294642
787 Ga0163161_10001335 3300017792 Bacteria 18330
788 Ga0163161_10019426 3300017792 Bacteria 4767
789 Ga0206353_10764760 3300020082 Bacteria 4021
790 Ga0206353_11719759 3300020082 Bacteria 2519
791 Ga0213873_10000007 3300021358 Bacteria 309961
792 Ga0213874_10020297 3300021377 Bacteria 1820
793 Ga0213876_10000005 3300021384 Bacteria 727326
794 Ga0213876_10009789 3300021384 Bacteria 5157
795 Ga0213876_10014546 3300021384 Bacteria 4170
796 Ga0213875_10000105 3300021388 Bacteria 96051
797 Ga0213875_10000132 3300021388 Bacteria 82929
798 Ga0213875_10003519 3300021388 Bacteria 8897
799 Ga0213875_10024723 3300021388 Bacteria 2863
800 Ga0213871_10004065 3300021441 Bacteria 2889
801 Ga0228598_1001227 3300024227 Bacteria 5663
802 Ga0209563_100019 3300025230 Bacteria 697828
803 Ga0207427_101450 3300025231 Bacteria 8548
804 Ga0207425_1000026 3300025245 Bacteria 301303
805 Ga0209026_1000120 3300025250 Bacteria 130091
806 Ga0209148_1000017 3300025254 Bacteria 787064
807 Ga0209148_1000056 3300025254 Bacteria 363380
808 Ga0209148_1000238 3300025254 Bacteria 87836
809 Ga0209148_1001034 3300025254 Bacteria 17391
810 Ga0209759_1000368 3300025256 Bacteria 56484
811 Ga0209129_1000578 3300025258 Bacteria 25249
812 Ga0209233_1000079 3300025261 Bacteria 346944
813 Ga0209233_1000087 3300025261 Bacteria 325225
814 Ga0209233_1000414 3300025261 Bacteria 32922
815 Ga0209565_1000010 3300025263 Bacteria 687724
816 Ga0209565_1000064 3300025263 Bacteria 180732
817 Ga0207666_1000644 3300025271 Bacteria 4180
818 Ga0209455_1000005 3300025272 Bacteria 1416756
819 Ga0209455_1000137 3300025272 Bacteria 142099
820 Ga0209455_1000952 3300025272 Bacteria 14767
821 Ga0209673_1001854 3300025273 Bacteria 17208
822 Ga0207673_1005129 3300025290 Bacteria 1590
823 Ga0209675_1000076 3300025291 Bacteria 159428
824 Ga0209676_1000065 3300025292 Bacteria 318605
825 Ga0209676_1000070 3300025292 Bacteria 312074
826 Ga0209676_1000454 3300025292 Bacteria 69136
827 Ga0209676_1000637 3300025292 Bacteria 50380
828 Ga0209676_1012990 3300025292 Bacteria 3230
829 Ga0209676_1014351 3300025292 Bacteria 2982
830 Ga0209025_1000726 3300025294 Bacteria 55863
831 Ga0209025_1008274 3300025294 Bacteria 7511
832 Ga0209025_1019381 3300025294 Bacteria 3785
833 Ga0209564_1000105 3300025295 Bacteria 218124
834 Ga0209564_1004288 3300025295 Bacteria 8840
835 Ga0209564_1005028 3300025295 Bacteria 7743
836 Ga0209758_1000004 3300025297 Bacteria 1375322
837 Ga0209758_1000035 3300025297 Bacteria 448190
838 Ga0209758_1000119 3300025297 Bacteria 195545
839 Ga0209758_1000252 3300025297 Bacteria 108214
840 Ga0209758_1019205 3300025297 Bacteria 3309
841 Ga0209050_1000001 3300025298 Bacteria 3563507
842 Ga0209050_1000026 3300025298 Bacteria 499134
843 Ga0209050_1000042 3300025298 Bacteria 402842
844 Ga0209050_1002869 3300025298 Bacteria 13640
845 Ga0209050_1008083 3300025298 Bacteria 5713
846 Ga0209050_1011937 3300025298 Bacteria 4050
847 Ga0209050_1017219 3300025298 Bacteria 2897
848 Ga0209256_1000034 3300025299 Bacteria 388475
849 Ga0209256_1001169 3300025299 Bacteria 29578
850 Ga0209051_1000793 3300025303 Bacteria 33269
851 Ga0209257_1000009 3300025304 Bacteria 1205047
852 Ga0209257_1000285 3300025304 Bacteria 112113
853 Ga0209257_1000562 3300025304 Bacteria 63202
854 Ga0209257_1000617 3300025304 Bacteria 57694
855 Ga0209257_1000633 3300025304 Bacteria 56365
856 Ga0209257_1002745 3300025304 Bacteria 16681
857 Ga0209257_1002873 3300025304 Bacteria 16051
858 Ga0209257_1013885 3300025304 Bacteria 3524
859 Ga0207697_10000296 3300025315 Bacteria 27773
860 Ga0207697_10002172 3300025315 Bacteria 10270
861 Ga0207656_10002037 3300025321 Bacteria 6748
862 Ga0207656_10007248 3300025321 Bacteria 4029
863 Ga0207653_10000869 3300025885 Bacteria 10029
864 Ga0207682_10000362 3300025893 Bacteria 20847
865 Ga0207682_10001774 3300025893 Bacteria 9901
866 Ga0207682_10004604 3300025893 Bacteria 5741
867 Ga0207682_10006767 3300025893 Bacteria 4602
868 Ga0207692_10001696 3300025898 Bacteria 8327
869 Ga0207692_10002954 3300025898 Bacteria 6584
870 Ga0207692_10003138 3300025898 Bacteria 6411
871 Ga0207692_10013772 3300025898 Bacteria 3517
872 Ga0207692_10033697 3300025898 Bacteria 2474
873 Ga0207710_10026401 3300025900 Bacteria 2510
874 Ga0207688_10000048 3300025901 Bacteria 42501
875 Ga0207688_10002751 3300025901 Bacteria 9526
876 Ga0207688_10004134 3300025901 Bacteria 7911
877 Ga0207688_10006915 3300025901 Bacteria 6175
878 Ga0207688_10071028 3300025901 Bacteria 1976
879 Ga0207688_10075489 3300025901 Bacteria 1918
880 Ga0207680_10000004 3300025903 Bacteria 827324
881 Ga0207680_10001981 3300025903 Bacteria 9583
882 Ga0207680_10002390 3300025903 Bacteria 8743
883 Ga0207680_10016304 3300025903 Bacteria 3898
884 Ga0207680_10027353 3300025903 Bacteria 3174
885 Ga0207647_10000352 3300025904 Bacteria 37248
886 Ga0207647_10000697 3300025904 Bacteria 26310
887 Ga0207647_10001325 3300025904 Bacteria 19003
888 Ga0207647_10001811 3300025904 Bacteria 16396
889 Ga0207647_10002647 3300025904 Bacteria 13526
890 Ga0207647_10003634 3300025904 Bacteria 11545
891 Ga0207647_10003782 3300025904 Bacteria 11317
892 Ga0207647_10004712 3300025904 Bacteria 10097
893 Ga0207647_10011193 3300025904 Bacteria 6304
894 Ga0207647_10026990 3300025904 Bacteria 3748
895 Ga0207647_10058302 3300025904 Bacteria 2365
896 Ga0207685_10005166 3300025905 Bacteria 3413
897 Ga0207685_10012838 3300025905 Bacteria 2571
898 Ga0207699_10009706 3300025906 Bacteria 4804
899 Ga0207699_10014726 3300025906 Bacteria 4041
900 Ga0207645_10001931 3300025907 Bacteria 16729
901 Ga0207645_10003616 3300025907 Bacteria 11690
902 Ga0207645_10008890 3300025907 Bacteria 6976
903 Ga0207645_10012843 3300025907 Bacteria 5669
904 Ga0207645_10015870 3300025907 Bacteria 4990
905 Ga0207645_10020944 3300025907 Bacteria 4271
906 Ga0207643_10000346 3300025908 Bacteria 31303
907 Ga0207705_10000002 3300025909 Bacteria 2046852
908 Ga0207705_10000060 3300025909 Bacteria 152576
909 Ga0207705_10000121 3300025909 Bacteria 86649
910 Ga0207705_10000174 3300025909 Bacteria 68260
911 Ga0207705_10000220 3300025909 Bacteria 56835
912 Ga0207705_10000365 3300025909 Bacteria 41098
913 Ga0207705_10000429 3300025909 Bacteria 36649
914 Ga0207705_10000779 3300025909 Bacteria 26154
915 Ga0207705_10005626 3300025909 Bacteria 9359
916 Ga0207705_10007191 3300025909 Bacteria 8199
917 Ga0207705_10010399 3300025909 Bacteria 6766
918 Ga0207705_10012947 3300025909 Bacteria 6020
919 Ga0207705_10013373 3300025909 Bacteria 5919
920 Ga0207705_10020277 3300025909 Bacteria 4754
921 Ga0207705_10020495 3300025909 Bacteria 4723
922 Ga0207705_10024693 3300025909 Bacteria 4289
923 Ga0207705_10030279 3300025909 Bacteria 3861
924 Ga0207705_10038560 3300025909 Bacteria 3421
925 Ga0207705_10047244 3300025909 Bacteria 3095
926 Ga0207705_10049693 3300025909 Bacteria 3018
927 Ga0207705_10051439 3300025909 Bacteria 2965
928 Ga0207705_10063728 3300025909 Bacteria 2663
929 Ga0207684_10058948 3300025910 Bacteria 3259
930 Ga0207684_10078477 3300025910 Bacteria 2808
931 Ga0207684_10087178 3300025910 Bacteria 2659
932 Ga0207654_10001743 3300025911 Bacteria 11302
933 Ga0207654_10006493 3300025911 Bacteria 5887
934 Ga0207707_10025116 3300025912 Bacteria 5211
935 Ga0207707_10094099 3300025912 Bacteria 2618
936 Ga0207707_10099884 3300025912 Bacteria 2536
937 Ga0207707_10148033 3300025912 Bacteria 2053
938 Ga0207707_10171397 3300025912 Bacteria 1897
939 Ga0207695_10001723 3300025913 Bacteria 34990
940 Ga0207695_10001996 3300025913 Bacteria 31509
941 Ga0207695_10010506 3300025913 Bacteria 11324
942 Ga0207695_10019426 3300025913 Bacteria 7826
943 Ga0207695_10037507 3300025913 Bacteria 5228
944 Ga0207695_10093409 3300025913 Bacteria 3018
945 Ga0207671_10003257 3300025914 Bacteria 16330
946 Ga0207671_10092444 3300025914 Bacteria 2281
947 Ga0207693_10001587 3300025915 Bacteria 20102
948 Ga0207693_10002346 3300025915 Bacteria 16445
949 Ga0207693_10003499 3300025915 Bacteria 13401
950 Ga0207693_10035981 3300025915 Bacteria 3901
951 Ga0207693_10039664 3300025915 Bacteria 3708
952 Ga0207693_10046003 3300025915 Bacteria 3429
953 Ga0207693_10098791 3300025915 Bacteria 2289
954 Ga0207663_10005526 3300025916 Bacteria 6375
955 Ga0207663_10015942 3300025916 Bacteria 4157
956 Ga0207663_10031224 3300025916 Bacteria 3150
957 Ga0207663_10120189 3300025916 Bacteria 1798
958 Ga0207660_10001449 3300025917 Bacteria 15925
959 Ga0207660_10004293 3300025917 Bacteria 9299
960 Ga0207660_10005195 3300025917 Bacteria 8464
961 Ga0207660_10008226 3300025917 Bacteria 6750
962 Ga0207660_10009882 3300025917 Bacteria 6181
963 Ga0207660_10013245 3300025917 Bacteria 5402
964 Ga0207660_10024393 3300025917 Bacteria 4095
965 Ga0207660_10032322 3300025917 Bacteria 3611
966 Ga0207660_10054092 3300025917 Bacteria 2864
967 Ga0207660_10071973 3300025917 Bacteria 2517
968 Ga0207660_10167200 3300025917 Bacteria 1700
969 Ga0207657_10000173 3300025919 Bacteria 66220
970 Ga0207657_10000631 3300025919 Bacteria 37345
971 Ga0207657_10001159 3300025919 Bacteria 28049
972 Ga0207657_10001954 3300025919 Bacteria 22243
973 Ga0207657_10002129 3300025919 Bacteria 21446
974 Ga0207657_10004219 3300025919 Bacteria 15225
975 Ga0207657_10004601 3300025919 Bacteria 14580
976 Ga0207657_10005022 3300025919 Bacteria 13885
977 Ga0207657_10006872 3300025919 Bacteria 11740
978 Ga0207657_10009008 3300025919 Bacteria 10079
979 Ga0207657_10009095 3300025919 Bacteria 10021
980 Ga0207657_10009109 3300025919 Bacteria 10013
981 Ga0207657_10009143 3300025919 Bacteria 9999
982 Ga0207657_10020224 3300025919 Bacteria 6297
983 Ga0207657_10021622 3300025919 Bacteria 6048
984 Ga0207657_10023317 3300025919 Bacteria 5765
985 Ga0207657_10023825 3300025919 Bacteria 5689
986 Ga0207657_10029826 3300025919 Bacteria 4959
987 Ga0207657_10034308 3300025919 Bacteria 4566
988 Ga0207657_10037540 3300025919 Bacteria 4324
989 Ga0207657_10038141 3300025919 Bacteria 4282
990 Ga0207657_10044515 3300025919 Bacteria 3901
991 Ga0207657_10046637 3300025919 Bacteria 3795
992 Ga0207657_10076439 3300025919 Bacteria 2825
993 Ga0207657_10087348 3300025919 Bacteria 2609
994 Ga0207657_10093303 3300025919 Bacteria 2507
995 Ga0207649_10000014 3300025920 Bacteria 255001
996 Ga0207649_10000365 3300025920 Bacteria 33919
997 Ga0207649_10000702 3300025920 Bacteria 21959
998 Ga0207649_10008251 3300025920 Bacteria 5674
999 Ga0207649_10014529 3300025920 Bacteria 4410
1000 Ga0207649_10024355 3300025920 Bacteria 3517
1001 Ga0207649_10049254 3300025920 Bacteria 2601
1002 Ga0207649_10056099 3300025920 Bacteria 2458
1003 Ga0207649_10062341 3300025920 Bacteria 2350
1004 Ga0207649_10100805 3300025920 Bacteria 1911
1005 Ga0207649_10133344 3300025920 Bacteria 1690
1006 Ga0207649_10157032 3300025920 Bacteria 1573
1007 Ga0207652_10004551 3300025921 Bacteria 11254
1008 Ga0207652_10018830 3300025921 Bacteria 5667
1009 Ga0207652_10036043 3300025921 Bacteria 4180
1010 Ga0207652_10151012 3300025921 Bacteria 2080
1011 Ga0207652_10179708 3300025921 Bacteria 1901
1012 Ga0207652_10217432 3300025921 Bacteria 1721
1013 Ga0207646_10064288 3300025922 Bacteria 3275
1014 Ga0207681_10000001 3300025923 Bacteria 1105841
1015 Ga0207681_10000297 3300025923 Bacteria 36667
1016 Ga0207681_10010134 3300025923 Bacteria 5768
1017 Ga0207681_10038492 3300025923 Bacteria 3169
1018 Ga0207681_10113859 3300025923 Bacteria 1972
1019 Ga0207694_10008563 3300025924 Bacteria 7725
1020 Ga0207694_10015718 3300025924 Bacteria 5709
1021 Ga0207694_10015766 3300025924 Bacteria 5702
1022 Ga0207694_10031171 3300025924 Bacteria 4072
1023 Ga0207694_10040302 3300025924 Bacteria 3595
1024 Ga0207694_10162896 3300025924 Bacteria 1802
1025 Ga0207650_10000050 3300025925 Bacteria 169589
1026 Ga0207650_10000083 3300025925 Bacteria 127270
1027 Ga0207650_10000818 3300025925 Bacteria 23885
1028 Ga0207650_10001577 3300025925 Bacteria 16270
1029 Ga0207650_10011612 3300025925 Bacteria 6067
1030 Ga0207650_10012588 3300025925 Bacteria 5838
1031 Ga0207650_10024048 3300025925 Bacteria 4326
1032 Ga0207650_10035092 3300025925 Bacteria 3640
1033 Ga0207650_10036885 3300025925 Bacteria 3558
1034 Ga0207650_10056076 3300025925 Bacteria 2927
1035 Ga0207650_10060299 3300025925 Bacteria 2831
1036 Ga0207650_10088475 3300025925 Bacteria 2362
1037 Ga0207650_10113917 3300025925 Bacteria 2097
1038 Ga0207650_10122873 3300025925 Bacteria 2023
1039 Ga0207659_10028870 3300025926 Bacteria 3774
1040 Ga0207659_10032848 3300025926 Bacteria 3565
1041 Ga0207659_10033900 3300025926 Bacteria 3517
1042 Ga0207659_10129680 3300025926 Bacteria 1944
1043 Ga0207659_10157383 3300025926 Bacteria 1780
1044 Ga0207687_10000225 3300025927 Bacteria 38523
1045 Ga0207687_10000601 3300025927 Bacteria 24416
1046 Ga0207687_10011569 3300025927 Bacteria 5768
1047 Ga0207687_10018262 3300025927 Bacteria 4627
1048 Ga0207687_10029526 3300025927 Bacteria 3689
1049 Ga0207700_10032491 3300025928 Bacteria 3723
1050 Ga0207700_10173307 3300025928 Bacteria 1801
1051 Ga0207664_10014967 3300025929 Bacteria 5617
1052 Ga0207664_10015174 3300025929 Bacteria 5583
1053 Ga0207664_10018330 3300025929 Bacteria 5150
1054 Ga0207664_10035382 3300025929 Bacteria 3853
1055 Ga0207664_10043101 3300025929 Bacteria 3527
1056 Ga0207644_10000061 3300025931 Bacteria 79079
1057 Ga0207644_10000530 3300025931 Bacteria 24696
1058 Ga0207644_10000755 3300025931 Bacteria 20528
1059 Ga0207644_10000919 3300025931 Bacteria 18675
1060 Ga0207644_10001396 3300025931 Bacteria 15576
1061 Ga0207644_10002341 3300025931 Bacteria 12242
1062 Ga0207644_10002604 3300025931 Bacteria 11620
1063 Ga0207644_10004475 3300025931 Bacteria 9075
1064 Ga0207644_10008961 3300025931 Bacteria 6555
1065 Ga0207644_10010251 3300025931 Bacteria 6175
1066 Ga0207644_10017814 3300025931 Bacteria 4803
1067 Ga0207644_10020871 3300025931 Bacteria 4456
1068 Ga0207644_10022986 3300025931 Bacteria 4265
1069 Ga0207644_10025173 3300025931 Bacteria 4091
1070 Ga0207644_10040377 3300025931 Bacteria 3297
1071 Ga0207644_10068768 3300025931 Bacteria 2584
1072 Ga0207644_10112748 3300025931 Bacteria 2058
1073 Ga0207644_10122683 3300025931 Bacteria 1980
1074 Ga0207644_10166219 3300025931 Bacteria 1719
1075 Ga0207690_10000051 3300025932 Bacteria 107367
1076 Ga0207690_10000150 3300025932 Bacteria 55157
1077 Ga0207690_10001575 3300025932 Bacteria 14260
1078 Ga0207690_10004110 3300025932 Bacteria 8597
1079 Ga0207690_10006736 3300025932 Bacteria 6809
1080 Ga0207690_10014783 3300025932 Bacteria 4721
1081 Ga0207690_10016579 3300025932 Bacteria 4486
1082 Ga0207690_10020805 3300025932 Bacteria 4060
1083 Ga0207690_10050815 3300025932 Bacteria 2769
1084 Ga0207690_10076032 3300025932 Bacteria 2330
1085 Ga0207690_10083744 3300025932 Bacteria 2234
1086 Ga0207690_10106114 3300025932 Bacteria 2015
1087 Ga0207690_10148519 3300025932 Bacteria 1735
1088 Ga0207706_10000358 3300025933 Bacteria 49357
1089 Ga0207706_10000405 3300025933 Bacteria 46320
1090 Ga0207706_10000951 3300025933 Bacteria 29599
1091 Ga0207706_10001130 3300025933 Bacteria 27174
1092 Ga0207706_10001397 3300025933 Bacteria 24118
1093 Ga0207706_10002282 3300025933 Bacteria 18704
1094 Ga0207706_10002783 3300025933 Bacteria 16997
1095 Ga0207706_10004849 3300025933 Bacteria 12596
1096 Ga0207706_10008805 3300025933 Bacteria 9291
1097 Ga0207706_10014280 3300025933 Bacteria 7199
1098 Ga0207706_10021084 3300025933 Bacteria 5854
1099 Ga0207706_10030146 3300025933 Bacteria 4840
1100 Ga0207706_10037548 3300025933 Bacteria 4300
1101 Ga0207706_10045794 3300025933 Bacteria 3874
1102 Ga0207706_10054859 3300025933 Bacteria 3516
1103 Ga0207706_10065767 3300025933 Bacteria 3192
1104 Ga0207706_10066417 3300025933 Bacteria 3174
1105 Ga0207706_10071627 3300025933 Bacteria 3049
1106 Ga0207706_10098609 3300025933 Bacteria 2570
1107 Ga0207706_10103356 3300025933 Bacteria 2506
1108 Ga0207706_10120500 3300025933 Bacteria 2307
1109 Ga0207686_10001878 3300025934 Bacteria 11648
1110 Ga0207686_10004365 3300025934 Bacteria 7580
1111 Ga0207686_10012154 3300025934 Bacteria 4730
1112 Ga0207686_10023025 3300025934 Bacteria 3593
1113 Ga0207709_10000031 3300025935 Bacteria 329046
1114 Ga0207709_10000173 3300025935 Bacteria 86350
1115 Ga0207670_10081227 3300025936 Bacteria 2268
1116 Ga0207670_10108281 3300025936 Bacteria 1997
1117 Ga0207669_10000057 3300025937 Bacteria 56270
1118 Ga0207669_10002114 3300025937 Bacteria 8422
1119 Ga0207669_10006974 3300025937 Bacteria 5197
1120 Ga0207669_10022647 3300025937 Bacteria 3341
1121 Ga0207669_10024295 3300025937 Bacteria 3255
1122 Ga0207669_10028778 3300025937 Bacteria 3062
1123 Ga0207704_10000001 3300025938 Bacteria 716296
1124 Ga0207704_10003077 3300025938 Bacteria 7537
1125 Ga0207704_10006150 3300025938 Bacteria 5571
1126 Ga0207704_10007096 3300025938 Bacteria 5270
1127 Ga0207704_10013390 3300025938 Bacteria 4102
1128 Ga0207704_10046383 3300025938 Bacteria 2590
1129 Ga0207665_10001084 3300025939 Bacteria 18353
1130 Ga0207665_10002995 3300025939 Bacteria 11337
1131 Ga0207665_10011367 3300025939 Bacteria 5846
1132 Ga0207665_10023939 3300025939 Bacteria 4023
1133 Ga0207665_10026616 3300025939 Bacteria 3818
1134 Ga0207665_10081476 3300025939 Bacteria 2228
1135 Ga0207691_10000700 3300025940 Bacteria 33173
1136 Ga0207691_10001051 3300025940 Bacteria 27433
1137 Ga0207691_10003613 3300025940 Bacteria 15028
1138 Ga0207691_10007490 3300025940 Bacteria 10508
1139 Ga0207691_10008185 3300025940 Bacteria 10041
1140 Ga0207691_10009162 3300025940 Bacteria 9499
1141 Ga0207691_10011831 3300025940 Bacteria 8376
1142 Ga0207691_10014685 3300025940 Bacteria 7465
1143 Ga0207691_10026918 3300025940 Bacteria 5395
1144 Ga0207691_10075590 3300025940 Bacteria 3037
1145 Ga0207711_10000035 3300025941 Bacteria 177223
1146 Ga0207711_10000042 3300025941 Bacteria 158782
1147 Ga0207711_10000526 3300025941 Bacteria 39259
1148 Ga0207711_10001694 3300025941 Bacteria 20284
1149 Ga0207711_10001832 3300025941 Bacteria 19379
1150 Ga0207711_10004897 3300025941 Bacteria 11367
1151 Ga0207711_10005428 3300025941 Bacteria 10783
1152 Ga0207711_10006011 3300025941 Bacteria 10259
1153 Ga0207711_10008051 3300025941 Bacteria 8822
1154 Ga0207711_10023856 3300025941 Bacteria 5121
1155 Ga0207711_10026379 3300025941 Bacteria 4875
1156 Ga0207711_10026899 3300025941 Bacteria 4829
1157 Ga0207711_10031542 3300025941 Bacteria 4475
1158 Ga0207711_10031610 3300025941 Bacteria 4470
1159 Ga0207711_10038748 3300025941 Bacteria 4053
1160 Ga0207711_10040182 3300025941 Bacteria 3979
1161 Ga0207711_10083436 3300025941 Bacteria 2795
1162 Ga0207711_10090753 3300025941 Bacteria 2686
1163 Ga0207711_10134330 3300025941 Bacteria 2221
1164 Ga0207689_10000744 3300025942 Bacteria 31242
1165 Ga0207689_10002260 3300025942 Bacteria 18054
1166 Ga0207689_10015144 3300025942 Bacteria 6537
1167 Ga0207689_10018013 3300025942 Bacteria 5964
1168 Ga0207689_10057405 3300025942 Bacteria 3203
1169 Ga0207689_10065278 3300025942 Bacteria 2994
1170 Ga0207689_10076813 3300025942 Bacteria 2745
1171 Ga0207661_10006512 3300025944 Bacteria 8256
1172 Ga0207661_10007589 3300025944 Bacteria 7712
1173 Ga0207661_10012319 3300025944 Bacteria 6212
1174 Ga0207661_10014534 3300025944 Bacteria 5774
1175 Ga0207661_10074609 3300025944 Bacteria 2781
1176 Ga0207679_10002186 3300025945 Bacteria 12094
1177 Ga0207679_10004129 3300025945 Bacteria 9019
1178 Ga0207679_10012859 3300025945 Bacteria 5474
1179 Ga0207679_10034815 3300025945 Bacteria 3557
1180 Ga0207679_10041305 3300025945 Bacteria 3306
1181 Ga0207679_10043311 3300025945 Bacteria 3241
1182 Ga0207679_10045352 3300025945 Bacteria 3178
1183 Ga0207679_10066546 3300025945 Bacteria 2700
1184 Ga0207679_10075673 3300025945 Bacteria 2555
1185 Ga0207667_10000016 3300025949 Bacteria 391466
1186 Ga0207667_10000187 3300025949 Bacteria 90766
1187 Ga0207667_10000552 3300025949 Bacteria 49276
1188 Ga0207667_10005712 3300025949 Bacteria 15175
1189 Ga0207667_10007828 3300025949 Bacteria 12772
1190 Ga0207667_10009187 3300025949 Bacteria 11678
1191 Ga0207667_10013328 3300025949 Bacteria 9414
1192 Ga0207667_10013952 3300025949 Bacteria 9180
1193 Ga0207667_10014472 3300025949 Bacteria 8991
1194 Ga0207667_10040741 3300025949 Bacteria 4945
1195 Ga0207667_10051145 3300025949 Bacteria 4357
1196 Ga0207667_10052291 3300025949 Bacteria 4303
1197 Ga0207667_10083718 3300025949 Bacteria 3303
1198 Ga0207651_10000002 3300025960 Bacteria 427663
1199 Ga0207651_10001053 3300025960 Bacteria 12220
1200 Ga0207651_10003606 3300025960 Bacteria 7627
1201 Ga0207651_10007712 3300025960 Bacteria 5753
1202 Ga0207651_10023431 3300025960 Bacteria 3797
1203 Ga0207651_10077751 3300025960 Bacteria 2377
1204 Ga0207651_10087397 3300025960 Bacteria 2269
1205 Ga0207651_10139052 3300025960 Bacteria 1873
1206 Ga0207651_10146398 3300025960 Bacteria 1832
1207 Ga0207651_10177216 3300025960 Bacteria 1687
1208 Ga0207712_10000001 3300025961 Bacteria 750309
1209 Ga0207712_10000074 3300025961 Bacteria 120822
1210 Ga0207712_10000460 3300025961 Bacteria 34444
1211 Ga0207712_10001308 3300025961 Bacteria 17062
1212 Ga0207712_10002722 3300025961 Bacteria 11291
1213 Ga0207712_10017843 3300025961 Bacteria 4616
1214 Ga0207712_10018214 3300025961 Bacteria 4571
1215 Ga0207712_10030107 3300025961 Bacteria 3647
1216 Ga0207712_10052438 3300025961 Bacteria 2857
1217 Ga0207712_10112944 3300025961 Bacteria 2041
1218 Ga0207668_10000045 3300025972 Bacteria 103160
1219 Ga0207668_10000085 3300025972 Bacteria 70401
1220 Ga0207668_10000129 3300025972 Bacteria 53619
1221 Ga0207668_10000729 3300025972 Bacteria 20122
1222 Ga0207668_10006162 3300025972 Bacteria 7073
1223 Ga0207668_10040278 3300025972 Bacteria 3151
1224 Ga0207668_10098521 3300025972 Bacteria 2166
1225 Ga0207640_10000063 3300025981 Bacteria 87065
1226 Ga0207640_10000830 3300025981 Bacteria 17599
1227 Ga0207640_10005615 3300025981 Bacteria 6840
1228 Ga0207640_10015330 3300025981 Bacteria 4435
1229 Ga0207640_10016159 3300025981 Bacteria 4335
1230 Ga0207640_10020546 3300025981 Bacteria 3922
1231 Ga0207640_10026318 3300025981 Bacteria 3530
1232 Ga0207640_10027192 3300025981 Bacteria 3483
1233 Ga0207640_10044401 3300025981 Bacteria 2847
1234 Ga0207640_10051871 3300025981 Bacteria 2669
1235 Ga0207640_10072008 3300025981 Bacteria 2330
1236 Ga0207640_10087081 3300025981 Bacteria 2152
1237 Ga0207658_10000002 3300025986 Bacteria 1364188
1238 Ga0207658_10000263 3300025986 Bacteria 55175
1239 Ga0207658_10000388 3300025986 Bacteria 42759
1240 Ga0207658_10001750 3300025986 Bacteria 16338
1241 Ga0207658_10002256 3300025986 Bacteria 14273
1242 Ga0207658_10004920 3300025986 Bacteria 9214
1243 Ga0207658_10010806 3300025986 Bacteria 6210
1244 Ga0207658_10010837 3300025986 Bacteria 6203
1245 Ga0207658_10011393 3300025986 Bacteria 6052
1246 Ga0207658_10022285 3300025986 Bacteria 4409
1247 Ga0207658_10029106 3300025986 Bacteria 3897
1248 Ga0207658_10031213 3300025986 Bacteria 3782
1249 Ga0207658_10083663 3300025986 Bacteria 2453
1250 Ga0207658_10100613 3300025986 Bacteria 2263
1251 Ga0207677_10000013 3300026023 Bacteria 186519
1252 Ga0207677_10000030 3300026023 Bacteria 120692
1253 Ga0207677_10001135 3300026023 Bacteria 14530
1254 Ga0207677_10001443 3300026023 Bacteria 12627
1255 Ga0207677_10005714 3300026023 Bacteria 6765
1256 Ga0207677_10085573 3300026023 Bacteria 2276
1257 Ga0207677_10118061 3300026023 Bacteria 1989
1258 Ga0207703_10000248 3300026035 Bacteria 60765
1259 Ga0207703_10000484 3300026035 Bacteria 41489
1260 Ga0207703_10001677 3300026035 Bacteria 19921
1261 Ga0207703_10002018 3300026035 Bacteria 17909
1262 Ga0207703_10002526 3300026035 Bacteria 15808
1263 Ga0207703_10002744 3300026035 Bacteria 15084
1264 Ga0207703_10004770 3300026035 Bacteria 11057
1265 Ga0207703_10006187 3300026035 Bacteria 9579
1266 Ga0207703_10018103 3300026035 Bacteria 5503
1267 Ga0207703_10020439 3300026035 Bacteria 5178
1268 Ga0207703_10067766 3300026035 Bacteria 2938
1269 Ga0207703_10091434 3300026035 Bacteria 2559
1270 Ga0207639_10000393 3300026041 Bacteria 30170
1271 Ga0207639_10000740 3300026041 Bacteria 22283
1272 Ga0207639_10007563 3300026041 Bacteria 7409
1273 Ga0207639_10038463 3300026041 Bacteria 3559
1274 Ga0207639_10039474 3300026041 Bacteria 3518
1275 Ga0207639_10076334 3300026041 Bacteria 2638
1276 Ga0207639_10083986 3300026041 Bacteria 2529
1277 Ga0207639_10103443 3300026041 Bacteria 2307
1278 Ga0207678_10000843 3300026067 Bacteria 28136
1279 Ga0207678_10001160 3300026067 Bacteria 24130
1280 Ga0207678_10001499 3300026067 Bacteria 21399
1281 Ga0207678_10001793 3300026067 Bacteria 19669
1282 Ga0207678_10002870 3300026067 Bacteria 15645
1283 Ga0207678_10003603 3300026067 Bacteria 13923
1284 Ga0207678_10006065 3300026067 Bacteria 10751
1285 Ga0207678_10006189 3300026067 Bacteria 10637
1286 Ga0207678_10015911 3300026067 Bacteria 6609
1287 Ga0207678_10016516 3300026067 Bacteria 6481
1288 Ga0207678_10016599 3300026067 Bacteria 6468
1289 Ga0207678_10026494 3300026067 Bacteria 5056
1290 Ga0207678_10041939 3300026067 Bacteria 3967
1291 Ga0207678_10055882 3300026067 Bacteria 3400
1292 Ga0207678_10108899 3300026067 Bacteria 2363
1293 Ga0207708_10001897 3300026075 Bacteria 15449
1294 Ga0207708_10002506 3300026075 Bacteria 13514
1295 Ga0207708_10013208 3300026075 Bacteria 6165
1296 Ga0207708_10071409 3300026075 Bacteria 2659
1297 Ga0207702_10000335 3300026078 Bacteria 53978
1298 Ga0207702_10001185 3300026078 Bacteria 26479
1299 Ga0207702_10002945 3300026078 Bacteria 15895
1300 Ga0207702_10003419 3300026078 Bacteria 14519
1301 Ga0207702_10020334 3300026078 Bacteria 5498
1302 Ga0207702_10033063 3300026078 Bacteria 4317
1303 Ga0207702_10033355 3300026078 Bacteria 4300
1304 Ga0207702_10035513 3300026078 Bacteria 4168
1305 Ga0207702_10047040 3300026078 Bacteria 3634
1306 Ga0207702_10047958 3300026078 Bacteria 3601
1307 Ga0207702_10086096 3300026078 Bacteria 2740
1308 Ga0207702_10129838 3300026078 Bacteria 2266
1309 Ga0207702_10141698 3300026078 Bacteria 2176
1310 Ga0207702_10152717 3300026078 Bacteria 2102
1311 Ga0207641_10000001 3300026088 Bacteria 1180841
1312 Ga0207641_10000002 3300026088 Bacteria 981004
1313 Ga0207641_10000148 3300026088 Bacteria 99601
1314 Ga0207641_10000415 3300026088 Bacteria 49760
1315 Ga0207641_10001679 3300026088 Bacteria 21542
1316 Ga0207641_10002174 3300026088 Bacteria 18463
1317 Ga0207641_10008012 3300026088 Bacteria 8757
1318 Ga0207641_10009229 3300026088 Bacteria 8135
1319 Ga0207641_10021715 3300026088 Bacteria 5276
1320 Ga0207641_10021857 3300026088 Bacteria 5260
1321 Ga0207641_10033020 3300026088 Bacteria 4299
1322 Ga0207641_10042968 3300026088 Bacteria 3793
1323 Ga0207641_10115154 3300026088 Bacteria 2390
1324 Ga0207641_10185475 3300026088 Bacteria 1908
1325 Ga0207648_10000001 3300026089 Bacteria 427499
1326 Ga0207648_10002240 3300026089 Bacteria 20939
1327 Ga0207648_10003071 3300026089 Bacteria 17645
1328 Ga0207648_10007248 3300026089 Bacteria 10935
1329 Ga0207648_10014998 3300026089 Bacteria 7137
1330 Ga0207648_10034652 3300026089 Bacteria 4450
1331 Ga0207648_10046425 3300026089 Bacteria 3808
1332 Ga0207648_10092097 3300026089 Bacteria 2650
1333 Ga0207676_10000004 3300026095 Bacteria 725417
1334 Ga0207676_10000005 3300026095 Bacteria 698744
1335 Ga0207676_10000456 3300026095 Bacteria 34458
1336 Ga0207676_10000895 3300026095 Bacteria 23119
1337 Ga0207676_10002207 3300026095 Bacteria 14055
1338 Ga0207676_10005125 3300026095 Bacteria 9273
1339 Ga0207676_10014753 3300026095 Bacteria 5629
1340 Ga0207676_10036002 3300026095 Bacteria 3762
1341 Ga0207676_10041964 3300026095 Bacteria 3516
1342 Ga0207676_10045939 3300026095 Bacteria 3376
1343 Ga0207676_10119988 3300026095 Bacteria 2215
1344 Ga0207676_10176742 3300026095 Bacteria 1865
1345 Ga0207674_10000283 3300026116 Bacteria 64153
1346 Ga0207674_10000632 3300026116 Bacteria 45854
1347 Ga0207674_10001013 3300026116 Bacteria 36709
1348 Ga0207674_10002478 3300026116 Bacteria 23285
1349 Ga0207674_10003717 3300026116 Bacteria 18632
1350 Ga0207674_10006840 3300026116 Bacteria 13373
1351 Ga0207674_10006984 3300026116 Bacteria 13212
1352 Ga0207674_10025784 3300026116 Bacteria 6261
1353 Ga0207674_10030412 3300026116 Bacteria 5677
1354 Ga0207674_10037687 3300026116 Bacteria 5025
1355 Ga0207674_10055096 3300026116 Bacteria 4046
1356 Ga0207674_10060487 3300026116 Bacteria 3830
1357 Ga0207674_10089373 3300026116 Bacteria 3073
1358 Ga0207674_10134310 3300026116 Bacteria 2437
1359 Ga0207674_10141877 3300026116 Bacteria 2361
1360 Ga0207675_100000295 3300026118 Bacteria 48065
1361 Ga0207675_100000671 3300026118 Bacteria 33681
1362 Ga0207675_100000754 3300026118 Bacteria 32245
1363 Ga0207675_100001093 3300026118 Bacteria 26859
1364 Ga0207675_100006751 3300026118 Bacteria 10854
1365 Ga0207675_100028373 3300026118 Bacteria 5212
1366 Ga0207675_100069331 3300026118 Bacteria 3296
1367 Ga0207683_10002230 3300026121 Bacteria 17045
1368 Ga0207683_10006746 3300026121 Bacteria 9822
1369 Ga0207683_10014363 3300026121 Bacteria 6745
1370 Ga0207683_10015034 3300026121 Bacteria 6587
1371 Ga0207683_10015525 3300026121 Bacteria 6485
1372 Ga0207683_10032644 3300026121 Bacteria 4523
1373 Ga0207683_10037370 3300026121 Bacteria 4228
1374 Ga0207683_10072810 3300026121 Bacteria 3039
1375 Ga0207698_10000130 3300026142 Bacteria 47043
1376 Ga0207698_10000457 3300026142 Bacteria 23684
1377 Ga0207698_10001077 3300026142 Bacteria 15878
1378 Ga0207698_10002158 3300026142 Bacteria 11623
1379 Ga0207698_10003402 3300026142 Bacteria 9578
1380 Ga0207698_10006883 3300026142 Bacteria 7115
1381 Ga0207698_10007426 3300026142 Bacteria 6868
1382 Ga0207698_10009005 3300026142 Bacteria 6339
1383 Ga0207698_10009573 3300026142 Bacteria 6187
1384 Ga0207698_10010670 3300026142 Bacteria 5922
1385 Ga0207698_10012607 3300026142 Bacteria 5539
1386 Ga0207698_10015443 3300026142 Bacteria 5113
1387 Ga0207698_10019150 3300026142 Bacteria 4679
1388 Ga0207698_10050996 3300026142 Bacteria 3161
1389 Ga0207698_10051392 3300026142 Bacteria 3151
1390 Ga0207698_10062444 3300026142 Bacteria 2909
1391 Ga0209966_1001446 3300027695 Bacteria 4119
1392 Ga0209998_10002379 3300027717 Bacteria 4333
1393 Ga0209974_10001664 3300027876 Bacteria 8047
1394 Ga0209974_10010996 3300027876 Bacteria 3046
1395 Ga0207428_10000096 3300027907 Bacteria 123081
1396 Ga0207428_10030348 3300027907 Bacteria 4469
1397 Ga0207428_10097492 3300027907 Bacteria 2275
1398 Ga0265357_1000090 3300028023 Bacteria 3419
1399 Ga0268266_10000002 3300028379 Bacteria 3059047
1400 Ga0268266_10000042 3300028379 Bacteria 316826
1401 Ga0268266_10000187 3300028379 Bacteria 110229
1402 Ga0268266_10002204 3300028379 Bacteria 21316
1403 Ga0268266_10003658 3300028379 Bacteria 15192
1404 Ga0268266_10004591 3300028379 Bacteria 13183
1405 Ga0268266_10013955 3300028379 Bacteria 6917
1406 Ga0268266_10018298 3300028379 Bacteria 5974
1407 Ga0268266_10023957 3300028379 Bacteria 5194
1408 Ga0268266_10026789 3300028379 Bacteria 4905
1409 Ga0268266_10042643 3300028379 Bacteria 3876
1410 Ga0268266_10047798 3300028379 Bacteria 3667
1411 Ga0268266_10087467 3300028379 Bacteria 2726
1412 Ga0268265_10000002 3300028380 Bacteria 1035381
1413 Ga0268265_10000003 3300028380 Bacteria 949201
1414 Ga0268265_10000152 3300028380 Bacteria 85229
1415 Ga0268265_10000481 3300028380 Bacteria 41838
1416 Ga0268265_10000946 3300028380 Bacteria 26688
1417 Ga0268265_10001958 3300028380 Bacteria 16342
1418 Ga0268265_10003775 3300028380 Bacteria 10745
1419 Ga0268265_10004310 3300028380 Bacteria 9919
1420 Ga0268265_10007351 3300028380 Bacteria 7438
1421 Ga0268265_10021856 3300028380 Bacteria 4488
1422 Ga0268265_10026561 3300028380 Bacteria 4121
1423 Ga0268265_10030468 3300028380 Bacteria 3885
1424 Ga0268265_10188048 3300028380 Bacteria 1781
1425 Ga0268264_10000006 3300028381 Bacteria 827324
1426 Ga0268264_10000103 3300028381 Bacteria 222439
1427 Ga0268264_10000184 3300028381 Bacteria 131402
1428 Ga0268264_10000710 3300028381 Bacteria 38345
1429 Ga0268264_10001443 3300028381 Bacteria 22239
1430 Ga0268264_10001849 3300028381 Bacteria 19271
1431 Ga0268264_10002392 3300028381 Bacteria 16539
1432 Ga0268264_10003045 3300028381 Bacteria 14529
1433 Ga0268264_10012745 3300028381 Bacteria 6919
1434 Ga0268264_10015184 3300028381 Bacteria 6317
1435 Ga0268264_10023991 3300028381 Bacteria 4977
1436 Ga0268264_10051286 3300028381 Bacteria 3438
1437 Ga0268264_10052244 3300028381 Bacteria 3407
1438 Ga0268264_10074838 3300028381 Bacteria 2878
1439 Ga0268264_10081926 3300028381 Bacteria 2759
1440 Ga0265318_10010436 3300028577 Bacteria 4046
1441 Ga0307517_10022587 3300028786 Bacteria 7876
1442 Ga0265338_10042019 3300028800 Bacteria 4265
1443 Ga0265330_10059384 3300031235 Bacteria 1665
1444 Ga0265320_10005692 3300031240 Bacteria 7952
1445 Ga0265325_10000029 3300031241 Bacteria 103942
1446 Ga0265325_10004697 3300031241 Bacteria 8558
1447 Ga0265325_10077889 3300031241 Bacteria 1652
1448 Ga0265329_10023582 3300031242 Bacteria 2048
1449 Ga0265340_10001702 3300031247 Bacteria 12625
1450 Ga0265340_10020431 3300031247 Bacteria 3403
1451 Ga0265340_10034720 3300031247 Bacteria 2507
1452 Ga0265340_10074699 3300031247 Bacteria 1602
1453 Ga0265339_10000465 3300031249 Bacteria 31657
1454 Ga0265339_10003856 3300031249 Bacteria 10408
1455 Ga0265339_10004124 3300031249 Bacteria 10016
1456 Ga0265331_10012471 3300031250 Bacteria 4603
1457 Ga0265331_10020058 3300031250 Bacteria 3438
1458 Ga0265331_10030513 3300031250 Bacteria 2684
1459 Ga0265327_10013944 3300031251 Bacteria 5297
1460 Ga0265316_10015638 3300031344 Bacteria 6625
1461 Ga0265316_10027060 3300031344 Bacteria 4757
1462 Ga0265316_10041823 3300031344 Bacteria 3665
1463 Ga0265316_10067960 3300031344 Bacteria 2755
1464 Ga0265316_10096847 3300031344 Bacteria 2246
1465 Ga0307513_10052637 3300031456 Bacteria 4382
1466 Ga0307513_10089023 3300031456 Bacteria 3153
1467 Ga0307513_10105246 3300031456 Bacteria 2832
1468 Ga0307408_100005051 3300031548 Bacteria 8852
1469 Ga0307408_100020384 3300031548 Bacteria 4474
1470 Ga0265313_10000006 3300031595 Bacteria 183184
1471 Ga0265313_10000183 3300031595 Bacteria 66629
1472 Ga0265313_10000225 3300031595 Bacteria 60933
1473 Ga0265313_10020752 3300031595 Bacteria 3615
1474 Ga0307508_10000479 3300031616 Bacteria 48265
1475 Ga0307508_10108470 3300031616 Bacteria 2376
1476 Ga0316579_10019507 3300031691 Bacteria 2997
1477 Ga0265314_10097242 3300031711 Bacteria 1902
1478 Ga0265342_10012486 3300031712 Bacteria 5751
1479 Ga0316578_10077353 3300031728 Bacteria 1976
1480 Ga0307405_10008142 3300031731 Bacteria 5297
1481 Ga0307405_10010455 3300031731 Bacteria 4810
1482 Ga0307405_10011827 3300031731 Bacteria 4593
1483 Ga0307405_10038922 3300031731 Bacteria 2870
1484 Ga0307405_10065585 3300031731 Bacteria 2312
1485 Ga0307405_10127734 3300031731 Bacteria 1751
1486 Ga0307413_10001109 3300031824 Bacteria 9841
1487 Ga0307413_10003856 3300031824 Bacteria 6404
1488 Ga0307413_10003892 3300031824 Bacteria 6385
1489 Ga0307413_10015023 3300031824 Bacteria 3956
1490 Ga0307413_10017918 3300031824 Bacteria 3701
1491 Ga0307413_10054008 3300031824 Bacteria 2435
1492 Ga0307413_10055275 3300031824 Bacteria 2414
1493 Ga0307413_10115352 3300031824 Bacteria 1807
1494 Ga0307413_10127328 3300031824 Bacteria 1736
1495 Ga0307413_10134229 3300031824 Bacteria 1699
1496 Ga0307410_10000510 3300031852 Bacteria 15775
1497 Ga0307410_10001592 3300031852 Bacteria 10403
1498 Ga0307410_10005778 3300031852 Bacteria 6595
1499 Ga0307410_10007507 3300031852 Bacteria 5974
1500 Ga0307410_10009548 3300031852 Bacteria 5447
1501 Ga0307410_10012417 3300031852 Bacteria 4925
1502 Ga0307410_10024597 3300031852 Bacteria 3765
1503 Ga0307410_10042633 3300031852 Bacteria 3001
1504 Ga0307410_10058901 3300031852 Bacteria 2620
1505 Ga0307410_10073113 3300031852 Bacteria 2383
1506 Ga0307410_10098141 3300031852 Bacteria 2094
1507 Ga0307406_10005891 3300031901 Bacteria 6726
1508 Ga0307406_10011121 3300031901 Bacteria 5099
1509 Ga0307406_10034911 3300031901 Bacteria 3088
1510 Ga0307406_10079184 3300031901 Bacteria 2179
1511 Ga0307406_10116639 3300031901 Bacteria 1848
1512 Ga0307406_10117478 3300031901 Bacteria 1842
1513 Ga0307407_10021686 3300031903 Bacteria 3319
1514 Ga0307407_10022864 3300031903 Bacteria 3252
1515 Ga0307407_10023235 3300031903 Bacteria 3232
1516 Ga0307412_10005692 3300031911 Bacteria 7005
1517 Ga0307412_10007474 3300031911 Bacteria 6199
1518 Ga0307412_10020763 3300031911 Bacteria 4002
1519 Ga0307412_10022884 3300031911 Bacteria 3837
1520 Ga0307412_10023001 3300031911 Bacteria 3829
1521 Ga0307412_10044728 3300031911 Bacteria 2890
1522 Ga0307412_10047404 3300031911 Bacteria 2822
1523 Ga0307412_10055822 3300031911 Bacteria 2629
1524 Ga0307412_10074188 3300031911 Bacteria 2330
1525 Ga0307409_100006035 3300031995 Bacteria 7068
1526 Ga0307409_100010810 3300031995 Bacteria 5706
1527 Ga0307409_100014001 3300031995 Bacteria 5194
1528 Ga0307409_100018666 3300031995 Bacteria 4671
1529 Ga0307409_100020861 3300031995 Bacteria 4477
1530 Ga0307409_100023075 3300031995 Bacteria 4303
1531 Ga0307409_100027007 3300031995 Bacteria 4060
1532 Ga0307409_100028711 3300031995 Bacteria 3968
1533 Ga0307409_100031412 3300031995 Bacteria 3832
1534 Ga0307409_100031572 3300031995 Bacteria 3826
1535 Ga0307409_100055481 3300031995 Bacteria 3059
1536 Ga0307409_100077271 3300031995 Bacteria 2673
1537 Ga0307409_100078132 3300031995 Bacteria 2661
1538 Ga0307409_100080003 3300031995 Bacteria 2635
1539 Ga0307409_100103069 3300031995 Bacteria 2372
1540 Ga0307409_100107322 3300031995 Bacteria 2332
1541 Ga0307409_100107745 3300031995 Bacteria 2328
1542 Ga0307409_100149559 3300031995 Bacteria 2025
1543 Ga0307416_100011384 3300032002 Bacteria 5928
1544 Ga0307416_100013083 3300032002 Bacteria 5626
1545 Ga0307416_100019720 3300032002 Bacteria 4789
1546 Ga0307416_100037914 3300032002 Bacteria 3714
1547 Ga0307416_100061090 3300032002 Bacteria 3073
1548 Ga0307416_100095063 3300032002 Bacteria 2572
1549 Ga0307416_100187960 3300032002 Bacteria 1944
1550 Ga0307414_10002419 3300032004 Bacteria 9773
1551 Ga0307414_10014565 3300032004 Bacteria 4720
1552 Ga0307414_10018820 3300032004 Bacteria 4264
1553 Ga0307414_10019990 3300032004 Bacteria 4163
1554 Ga0307414_10021883 3300032004 Bacteria 4024
1555 Ga0307414_10023113 3300032004 Bacteria 3935
1556 Ga0307414_10050490 3300032004 Bacteria 2881
1557 Ga0307414_10151623 3300032004 Bacteria 1829
1558 Ga0307411_10012113 3300032005 Bacteria 4687
1559 Ga0307411_10018473 3300032005 Bacteria 4000
1560 Ga0307411_10026435 3300032005 Bacteria 3495
1561 Ga0307411_10034806 3300032005 Bacteria 3138
1562 Ga0307411_10049123 3300032005 Bacteria 2739
1563 Ga0307411_10051734 3300032005 Bacteria 2681
1564 Ga0307411_10078736 3300032005 Bacteria 2260
1565 Ga0307411_10118475 3300032005 Bacteria 1910
1566 Ga0307411_10174909 3300032005 Bacteria 1623
1567 Ga0307415_100002637 3300032126 Bacteria 8939
1568 Ga0307415_100008661 3300032126 Bacteria 5656
1569 Ga0307415_100012704 3300032126 Bacteria 4880
1570 Ga0307415_100041635 3300032126 Bacteria 3051
1571 Ga0307415_100089195 3300032126 Bacteria 2227
1572 Ga0307415_100093202 3300032126 Bacteria 2186
1573 Ga0307415_100098839 3300032126 Bacteria 2134
1574 Ga0307415_100102578 3300032126 Bacteria 2102
1575 Ga0307510_10042552 3300033180 Bacteria 4948
1576 Ga0307510_10062575 3300033180 Bacteria 3801
1577 Ga0373948_0001629 3300034817 Bacteria 3165
1578 Ga0373926_0003211 3300035083 Bacteria 5249
1579 Ga0373926_0007834 3300035083 Bacteria 3560
1580 Ga0373940_0011193 3300035088 Bacteria 2127
1581 Ga0373944_0005383 3300035089 Bacteria 3369
1582 Ga0373944_0016261 3300035089 Bacteria 2095
1583 Ga0373923_0000770 3300035111 Bacteria 8324
1584 Ga0373932_0004279 3300035112 Bacteria 3388
1585 Ga0373936_0011986 3300035113 Bacteria 3290
1586 Ga0373945_0000820 3300035116 Bacteria 9125
1587 Ga0373945_0029332 3300035116 Bacteria 1932
1588 Ga0373954_0023614 3300035118 Bacteria 2798
1589 Ga0373957_0049201 3300035120 Bacteria 1608
1590 Ga0373943_0009911 3300035170 Bacteria 4268
1591 Ga0373943_0011309 3300035170 Bacteria 4016
1592 Ga0373943_0019173 3300035170 Bacteria 3145
1593 Ga0373946_0008895 3300035171 Bacteria 3690
1594 Ga0373946_0010095 3300035171 Bacteria 3491
1595 Ga0373946_0014669 3300035171 Bacteria 2958
1596 Ga0373946_0018506 3300035171 Bacteria 2675
1597 Ga0373955_0008373 3300035172 Bacteria 4801
1598 Ga0373955_0023588 3300035172 Bacteria 3136
1599 Ga0373942_0010875 3300035207 Bacteria 2148
1600 Ga0373931_0006062 3300035691 Bacteria 5630
1601 Ga0373935_0003114 3300035692 Bacteria 9576
1602 Ga0373935_0009737 3300035692 Bacteria 5755
1603 Ga0373935_0016336 3300035692 Bacteria 4491
1604 Ga0373935_0056971 3300035692 Bacteria 2492
1605 Ga0373927_0077460 3300035695 Bacteria 2153
1606 Ga0373933_0003240 3300035724 Bacteria 9087
1607 Ga0373933_0003450 3300035724 Bacteria 8799
1608 Ga0373947_0000967 3300035725 Bacteria 17537
1609 Ga0373947_0029695 3300035725 Bacteria 3209
1610 Ga0373937_0004429 3300036401 Bacteria 11938
1611 Ga0373937_0009649 3300036401 Bacteria 8404
1612 Ga0373937_0023996 3300036401 Bacteria 5499
1613 Ga0373937_0025035 3300036401 Bacteria 5387
1614 Ga0373937_0053522 3300036401 Bacteria 3702
1615 Ga0373937_0101707 3300036401 Bacteria 2667
1616 Ga0373937_0202240 3300036401 Bacteria 1867
1617 Ga0316582_0053792 3300036647 Bacteria 2562
1618 Ga0373925_0017471 3300037068 Bacteria 5199
1619 Ga0373925_0030685 3300037068 Bacteria 3946
1620 Ga0395899_0000112 3300037312 Bacteria 138389
1621 Ga0395899_0000416 3300037312 Bacteria 49361
1622 Ga0395899_0000691 3300037312 Bacteria 33969
1623 Ga0395899_0002095 3300037312 Bacteria 16380
1624 Ga0395899_0004509 3300037312 Bacteria 10857
1625 Ga0395899_0006041 3300037312 Bacteria 9401
1626 Ga0395899_0006191 3300037312 Bacteria 9269
1627 Ga0395899_0010397 3300037312 Bacteria 7130
1628 Ga0395899_0010953 3300037312 Bacteria 6947
1629 Ga0395899_0011706 3300037312 Bacteria 6715
1630 Ga0395899_0016252 3300037312 Bacteria 5673
1631 Ga0395899_0020531 3300037312 Bacteria 5006
1632 Ga0395899_0041463 3300037312 Bacteria 3439
1633 Ga0395899_0057906 3300037312 Bacteria 2859
1634 Ga0395899_0064169 3300037312 Bacteria 2701
1635 Ga0395899_0067482 3300037312 Bacteria 2624
1636 Ga0395899_0075562 3300037312 Bacteria 2460
1637 Ga0395900_0000126 3300037418 Bacteria 127586
1638 Ga0395900_0000316 3300037418 Bacteria 71497
1639 Ga0395900_0000862 3300037418 Bacteria 40012
1640 Ga0395900_0002554 3300037418 Bacteria 19956
1641 Ga0395900_0006489 3300037418 Bacteria 12195
1642 Ga0395900_0006829 3300037418 Bacteria 11843
1643 Ga0395900_0009816 3300037418 Bacteria 9808
1644 Ga0395900_0012046 3300037418 Bacteria 8840
1645 Ga0395900_0012307 3300037418 Bacteria 8752
1646 Ga0395900_0013117 3300037418 Bacteria 8468
1647 Ga0395900_0014269 3300037418 Bacteria 8110
1648 Ga0395900_0018641 3300037418 Bacteria 7077
1649 Ga0395900_0023614 3300037418 Bacteria 6291
1650 Ga0395900_0025079 3300037418 Bacteria 6103
1651 Ga0395900_0033500 3300037418 Bacteria 5286
1652 Ga0395900_0033578 3300037418 Bacteria 5280
1653 Ga0395900_0039358 3300037418 Bacteria 4871
1654 Ga0395900_0053703 3300037418 Bacteria 4147
1655 Ga0395900_0060275 3300037418 Bacteria 3905
1656 Ga0395900_0064409 3300037418 Bacteria 3766
1657 Ga0395900_0067116 3300037418 Bacteria 3685
1658 Ga0395900_0069053 3300037418 Bacteria 3631
1659 Ga0395900_0075423 3300037418 Bacteria 3467
1660 Ga0395900_0076122 3300037418 Bacteria 3449
1661 Ga0395900_0079703 3300037418 Bacteria 3365
1662 Ga0395900_0081617 3300037418 Bacteria 3322
1663 Ga0395900_0128276 3300037418 Bacteria 2600
1664 Ga0395900_0132690 3300037418 Bacteria 2552
1665 Ga0395900_0133896 3300037418 Bacteria 2539
1666 Ga0395900_0134560 3300037418 Bacteria 2532
1667 Ga0395900_0150413 3300037418 Bacteria 2378
1668 Ga0395900_0170176 3300037418 Bacteria 2218
1669 Ga0395900_0192575 3300037418 Bacteria 2067
1670 Ga0395900_0259479 3300037418 Bacteria 1736
1671 Ga0395898_0000192 3300037466 Bacteria 156121
1672 Ga0395898_0001190 3300037466 Bacteria 39469
1673 Ga0395898_0002752 3300037466 Bacteria 20261
1674 Ga0395898_0004549 3300037466 Bacteria 15138
1675 Ga0395898_0006460 3300037466 Bacteria 12522
1676 Ga0395898_0007693 3300037466 Bacteria 11440
1677 Ga0395898_0023423 3300037466 Bacteria 6241
1678 Ga0395898_0037634 3300037466 Bacteria 4798
1679 Ga0395898_0043183 3300037466 Bacteria 4443
1680 Ga0395898_0052883 3300037466 Bacteria 3967
1681 Ga0395898_0058566 3300037466 Bacteria 3749
1682 Ga0395898_0067460 3300037466 Bacteria 3463
1683 Ga0395898_0069154 3300037466 Bacteria 3416
1684 Ga0395898_0090997 3300037466 Bacteria 2935
1685 Ga0395898_0110151 3300037466 Bacteria 2639
1686 Ga0395898_0183087 3300037466 Bacteria 2002
1687 Ga0395898_0248300 3300037466 Bacteria 1697
1688 Ga0395905_0000066 3300037471 Bacteria 183121
1689 Ga0395905_0000501 3300037471 Bacteria 53793
1690 Ga0395905_0001949 3300037471 Bacteria 23650
1691 Ga0395905_0001950 3300037471 Bacteria 23641
1692 Ga0395905_0002085 3300037471 Bacteria 22730
1693 Ga0395905_0002298 3300037471 Bacteria 21443
1694 Ga0395905_0002354 3300037471 Bacteria 21056
1695 Ga0395905_0002529 3300037471 Bacteria 20173
1696 Ga0395905_0004344 3300037471 Bacteria 14757
1697 Ga0395905_0005775 3300037471 Bacteria 12578
1698 Ga0395905_0006447 3300037471 Bacteria 11813
1699 Ga0395905_0008941 3300037471 Bacteria 9834
1700 Ga0395905_0009820 3300037471 Bacteria 9328
1701 Ga0395905_0011431 3300037471 Bacteria 8578
1702 Ga0395905_0014026 3300037471 Bacteria 7662
1703 Ga0395905_0015211 3300037471 Bacteria 7317
1704 Ga0395905_0016136 3300037471 Bacteria 7100
1705 Ga0395905_0017758 3300037471 Bacteria 6756
1706 Ga0395905_0022215 3300037471 Bacteria 6002
1707 Ga0395905_0023342 3300037471 Bacteria 5847
1708 Ga0395905_0026896 3300037471 Bacteria 5426
1709 Ga0395905_0064714 3300037471 Bacteria 3422
1710 Ga0395905_0086140 3300037471 Bacteria 2944
1711 Ga0395905_0123114 3300037471 Bacteria 2438
1712 Ga0395905_0127483 3300037471 Bacteria 2393
1713 Ga0395905_0216561 3300037471 Bacteria 1793
1714 Ga0436364_0061163 3300037853 Bacteria 3985
1715 Ga0436364_0184827 3300037853 Bacteria 146498
1716 Ga0436364_0717863 3300037853 Bacteria 145182
1717 Ga0436364_0875825 3300037853 Bacteria 32110
1718 Ga0436364_0992577 3300037853 Bacteria 61189
1719 Ga0436364_1467667 3300037853 Bacteria 13726
1720 Ga0395901_0000203 3300038443 Bacteria 74605
1721 Ga0395901_0000249 3300038443 Bacteria 66993
1722 Ga0395901_0000468 3300038443 Bacteria 46939
1723 Ga0395901_0001835 3300038443 Bacteria 21949
1724 Ga0395901_0001922 3300038443 Bacteria 21389
1725 Ga0395901_0003662 3300038443 Bacteria 15497
1726 Ga0395901_0004933 3300038443 Bacteria 13467
1727 Ga0395901_0005835 3300038443 Bacteria 12464
1728 Ga0395901_0005896 3300038443 Bacteria 12398
1729 Ga0395901_0012944 3300038443 Bacteria 8463
1730 Ga0395901_0013600 3300038443 Bacteria 8275
1731 Ga0395901_0014884 3300038443 Bacteria 7903
1732 Ga0395901_0021085 3300038443 Bacteria 6675
1733 Ga0395901_0021790 3300038443 Bacteria 6567
1734 Ga0395901_0024237 3300038443 Bacteria 6226
1735 Ga0395901_0024645 3300038443 Bacteria 6177
1736 Ga0395901_0036995 3300038443 Bacteria 5047
1737 Ga0395901_0043000 3300038443 Bacteria 4686
1738 Ga0395901_0045097 3300038443 Bacteria 4574
1739 Ga0395901_0047933 3300038443 Bacteria 4436
1740 Ga0395901_0057114 3300038443 Bacteria 4059
1741 Ga0395901_0059474 3300038443 Bacteria 3975
1742 Ga0395901_0061025 3300038443 Bacteria 3924
1743 Ga0395901_0085182 3300038443 Bacteria 3304
1744 Ga0395901_0094287 3300038443 Bacteria 3135
1745 Ga0395901_0094647 3300038443 Bacteria 3130
1746 Ga0395901_0106522 3300038443 Bacteria 2942
1747 Ga0395901_0120186 3300038443 Bacteria 2761
1748 Ga0395901_0152849 3300038443 Bacteria 2424
1749 Ga0395901_0155740 3300038443 Bacteria 2400
1750 Ga0395901_0247438 3300038443 Bacteria 1858
1751 Ga0395901_0292186 3300038443 Bacteria 1691
1752 Ga0395901_0331390 3300038443 Bacteria 1573
1753 Ga0237819_00255 3300038705 Bacteria 19500
1754 Ga0436365_0009947 3300039437 Bacteria 10730
1755 Ga0436365_0320406 3300039437 Bacteria 3633
1756 Ga0436365_0393854 3300039437 Bacteria 34290
1757 Ga0436365_0578833 3300039437 Bacteria 16736
1758 Ga0436365_1089393 3300039437 Bacteria 2191
1759 Ga0436365_1223957 3300039437 Bacteria 5593
1760 Ga0436365_1750726 3300039437 Bacteria 12518
1761 Ga0436360_0682433 3300039438 Bacteria 12934
1762 Ga0436361_0190268 3300039447 Bacteria 1863
1763 Ga0436361_0424218 3300039447 Bacteria 4537
1764 Ga0436361_0466504 3300039447 Bacteria 2628
1765 Ga0436361_0488174 3300039447 Bacteria 24593
1766 Ga0436361_1020665 3300039447 Bacteria 12323
1767 Ga0436363_1210084 3300039450 Bacteria 2474
1768 Ga0436362_0976836 3300039453 Bacteria 135942
1769 Ga0439461_0001084 3300041410 Bacteria 4103
1770 Ga0439465_0002861 3300041413 Bacteria 5651
1771 Ga0439465_0041662 3300041413 Bacteria 1487
1772 Ga0439431_0000147 3300041997 Bacteria 12816
1773 Ga0439445_0001425 3300042004 Bacteria 5194
1774 Ga0439448_0002459 3300042005 Bacteria 5047
1775 Ga0439448_0004421 3300042005 Bacteria 3966
1776 Ga0439448_0013334 3300042005 Bacteria 2467
1777 Ga0439448_0013353 3300042005 Bacteria 2466
1778 Ga0439432_002908 3300042006 Bacteria 6379
1779 Ga0439449_0017869 3300042007 Bacteria 2662
1780 Ga0439449_0018892 3300042007 Bacteria 2584
1781 Ga0439455_0001428 3300042012 Bacteria 3992
1782 Ga0439462_0002656 3300042015 Bacteria 4193
1783 Ga0450889_000174 3300042144 Bacteria 6877
1784 Ga0439446_0003397 3300042156 Bacteria 3948
1785 Ga0439458_0000418 3300042157 Bacteria 10692
1786 Ga0439458_0000911 3300042157 Bacteria 7621
1787 Ga0439458_0003486 3300042157 Bacteria 3673
1788 Ga0439434_0002355 3300042435 Bacteria 5498
1789 Ga0439434_0005577 3300042435 Bacteria 3676
1790 Ga0439464_0007652 3300042439 Bacteria 2827
1791 Ga0439464_0020636 3300042439 Bacteria 1804
1792 Ga0466969_0001359 3300044656 Bacteria 13195
1793 Ga0466969_0018967 3300044656 Bacteria 3580
1794 Ga0466972_0000826 3300044658 Bacteria 14820
1795 Ga0466972_0014371 3300044658 Bacteria 3966
1796 Ga0466972_0027364 3300044658 Bacteria 2822
1797 Ga0466966_0005151 3300044684 Bacteria 8591
1798 Ga0466966_0008479 3300044684 Bacteria 6803
1799 Ga0466966_0018074 3300044684 Bacteria 4654
1800 Ga0466966_0057255 3300044684 Bacteria 2464
1801 Ga0466961_0004065 3300044693 Bacteria 9161
1802 Ga0466961_0054089 3300044693 Bacteria 2561
1803 Ga0466963_0003992 3300044694 Bacteria 8534
1804 Ga0466963_0005815 3300044694 Bacteria 7256
1805 Ga0466963_0006173 3300044694 Bacteria 7073
1806 Ga0466963_0006348 3300044694 Bacteria 6992
1807 Ga0466963_0049857 3300044694 Bacteria 2770
1808 Ga0466963_0078550 3300044694 Bacteria 2231
1809 Ga0466964_0000258 3300044706 Bacteria 15333
1810 Ga0453684_0207636 3300044712 Bacteria 2279
1811 Ga0466971_0004819 3300044719 Bacteria 5840
1812 Ga0466971_0026674 3300044719 Bacteria 2583
1813 Ga0466970_0002777 3300044765 Bacteria 8446
1814 Ga0466970_0075205 3300044765 Bacteria 1819
1815 Ga0466970_0079507 3300044765 Bacteria 1770
1816 Ga0466957_0001016 3300044842 Bacteria 14449
1817 Ga0466957_0009753 3300044842 Bacteria 5485
1818 Ga0466959_0022048 3300045049 Bacteria 4705
1819 Ga0466959_0109345 3300045049 Bacteria 1974
1820 Ga0451576_0013512 3300045051 Bacteria 9134
1821 Ga0466958_0001284 3300045836 Bacteria 11795
1822 Ga0466958_0028353 3300045836 Bacteria 3319
1823 Ga0466958_0047917 3300045836 Bacteria 2580
1824 Ga0466967_0006319 3300045976 Bacteria 8365
1825 Ga0466967_0006556 3300045976 Bacteria 8258
1826 Ga0466967_0010103 3300045976 Bacteria 7054
1827 Ga0466967_0046549 3300045976 Bacteria 3777
1828 Ga0466967_0056920 3300045976 Bacteria 3449
1829 Ga0466967_0099166 3300045976 Bacteria 2660
1830 Ga0466967_0204192 3300045976 Bacteria 1872
1831 Ga0466967_0248700 3300045976 Bacteria 1698
1832 Ga0495592_0010286 3300046454 Bacteria 7054
1833 Ga0495603_0016180 3300046455 Bacteria 4512
1834 Ga0495603_0073825 3300046455 Bacteria 2003
1835 Ga0495629_0000329 3300046459 Bacteria 40545
1836 Ga0495629_0102047 3300046459 Bacteria 2001
1837 Ga0495629_0110387 3300046459 Bacteria 1917
1838 Ga0495638_0000980 3300046460 Bacteria 28747
1839 Ga0495638_0046750 3300046460 Bacteria 2717
1840 Ga0495641_0009705 3300046461 Bacteria 5688
1841 Ga0495641_0035313 3300046461 Bacteria 2358
1842 Ga0495651_0004021 3300046462 Bacteria 11241
1843 Ga0495653_0014748 3300046463 Bacteria 6373
1844 Ga0495650_0000058 3300046471 Bacteria 302308
1845 Ga0495580_0037173 3300046472 Bacteria 3495
1846 Ga0495580_0072753 3300046472 Bacteria 2400
1847 Ga0495582_0003339 3300046473 Bacteria 9023
1848 Ga0495582_0004669 3300046473 Bacteria 7704
1849 Ga0495639_0006086 3300046475 Bacteria 5183
1850 Ga0495639_0007364 3300046475 Bacteria 4725
1851 Ga0495662_0022223 3300046476 Bacteria 3064
1852 Ga0495662_0022270 3300046476 Bacteria 3061
1853 Ga0495664_0006960 3300046477 Bacteria 6263
1854 Ga0495584_0025603 3300046491 Bacteria 2991
1855 Ga0495585_0001303 3300046492 Bacteria 19900
1856 Ga0495585_0006361 3300046492 Bacteria 7337
1857 Ga0495585_0071429 3300046492 Bacteria 1892
1858 Ga0495594_0012537 3300046499 Bacteria 4416
1859 Ga0495594_0035406 3300046499 Bacteria 2719
1860 Ga0495594_0060486 3300046499 Bacteria 2095
1861 Ga0495607_0021857 3300046501 Bacteria 4023
1862 Ga0495607_0041492 3300046501 Bacteria 2733
1863 Ga0495583_0002103 3300046506 Bacteria 17916
1864 Ga0495583_0004082 3300046506 Bacteria 10715
1865 Ga0495583_0044767 3300046506 Bacteria 2050
1866 Ga0495606_0001775 3300046507 Bacteria 27610
1867 Ga0495608_0005204 3300046511 Bacteria 9296
1868 Ga0495608_0019490 3300046511 Bacteria 4667
1869 Ga0495608_0039239 3300046511 Bacteria 3175
1870 Ga0495608_0097636 3300046511 Bacteria 1896
1871 Ga0495618_0017248 3300046514 Bacteria 4424
1872 Ga0495618_0104167 3300046514 Bacteria 1816
1873 Ga0495628_0033362 3300046516 Bacteria 4150
1874 Ga0495628_0033392 3300046516 Bacteria 4148
1875 Ga0495630_0008635 3300046517 Bacteria 7312
1876 Ga0495630_0036945 3300046517 Bacteria 3652
1877 Ga0495630_0082779 3300046517 Bacteria 2422
1878 Ga0495643_0002032 3300046522 Bacteria 16834
1879 Ga0495643_0009494 3300046522 Bacteria 6043
1880 Ga0495644_0000434 3300046523 Bacteria 18447
1881 Ga0495648_0000698 3300046524 Bacteria 35854
1882 Ga0495666_0012049 3300046526 Bacteria 4315
1883 Ga0495652_0084109 3300046529 Bacteria 2617
1884 Ga0495652_0117945 3300046529 Bacteria 2122
1885 Ga0495654_0000194 3300046530 Bacteria 59637
1886 Ga0495665_0003951 3300046531 Bacteria 8016
1887 Ga0495665_0070737 3300046531 Bacteria 1838
1888 Ga0495640_0098855 3300046533 Bacteria 1917
1889 Ga0495586_0047376 3300046535 Bacteria 2320
1890 Ga0495587_0019715 3300046536 Bacteria 4171
1891 Ga0495587_0025783 3300046536 Bacteria 3591
1892 Ga0495587_0029350 3300046536 Bacteria 3339
1893 Ga0495587_0064259 3300046536 Bacteria 2144
1894 Ga0495598_0006933 3300046537 Bacteria 2577
1895 Ga0495598_0010196 3300046537 Bacteria 2245
1896 Ga0495621_0000768 3300046539 Bacteria 8126
1897 Ga0495645_0004397 3300046543 Bacteria 9631
1898 Ga0495645_0044840 3300046543 Bacteria 3225
1899 Ga0495622_0003700 3300046557 Bacteria 7161
1900 Ga0495622_0010615 3300046557 Bacteria 4249
1901 Ga0495633_0000643 3300046558 Bacteria 32448
1902 Ga0495633_0001273 3300046558 Bacteria 20017
1903 Ga0495633_0017011 3300046558 Bacteria 3729
1904 Ga0495633_0043489 3300046558 Bacteria 2131
1905 Ga0495667_0004005 3300046559 Bacteria 9893
1906 Ga0495667_0015395 3300046559 Bacteria 5166
1907 Ga0495667_0064954 3300046559 Bacteria 2387
1908 Ga0495656_0001948 3300046615 Bacteria 6809
1909 Ga0495668_0000001 3300046616 Bacteria 1013420
1910 Ga0495668_0000007 3300046616 Bacteria 552902
1911 Ga0495668_0003497 3300046616 Bacteria 11713
1912 Ga0495668_0094790 3300046616 Bacteria 1634
1913 Ga0495611_0030009 3300046648 Bacteria 2388
1914 Ga0495625_0000237 3300046660 Bacteria 86257
1915 Ga0495625_0001988 3300046660 Bacteria 23072
1916 Ga0495625_0091035 3300046660 Bacteria 2109
1917 Ga0495635_0001379 3300046663 Bacteria 16201
1918 Ga0495635_0074398 3300046663 Bacteria 2327
1919 Ga0495659_0003909 3300046664 Bacteria 4725
1920 Ga0495588_0003248 3300046674 Bacteria 7051
1921 Ga0495657_0042792 3300046675 Bacteria 3090
1922 Ga0495599_0022815 3300046678 Bacteria 3909
1923 Ga0495599_0054617 3300046678 Bacteria 2502
1924 Ga0495623_0009670 3300046679 Bacteria 6259
1925 Ga0495646_0008370 3300046680 Bacteria 6575
1926 Ga0495647_0026524 3300046681 Bacteria 2123
1927 Ga0495658_0000930 3300046683 Bacteria 15630
1928 Ga0495658_0025132 3300046683 Bacteria 3181
1929 Ga0495658_0051463 3300046683 Bacteria 2333
1930 Ga0495669_0000110 3300046684 Bacteria 52962
1931 Ga0495669_0000413 3300046684 Bacteria 20774
1932 Ga0495669_0013834 3300046684 Bacteria 3445
1933 Ga0495669_0014360 3300046684 Bacteria 3386
1934 Ga0495669_0021039 3300046684 Bacteria 2828
1935 Ga0495669_0063074 3300046684 Bacteria 1681
1936 Ga0495613_0016485 3300046689 Bacteria 5503
1937 Ga0495613_0039121 3300046689 Bacteria 3516
1938 Ga0495624_0016957 3300046690 Bacteria 4898
1939 Ga0495670_0000009 3300046691 Bacteria 210956
1940 Ga0495670_0001695 3300046691 Bacteria 10830
1941 Ga0495670_0003751 3300046691 Bacteria 7477
1942 Ga0495670_0007826 3300046691 Bacteria 5256
1943 Ga0495670_0008504 3300046691 Bacteria 5051
1944 Ga0495670_0014349 3300046691 Bacteria 3895
1945 Ga0495670_0047786 3300046691 Bacteria 2139
1946 Ga0495671_0017287 3300046692 Bacteria 3840
1947 Ga0495649_0022001 3300046694 Bacteria 3571
1948 Ga0495589_0041442 3300046794 Bacteria 2298
1949 Ga0495600_0003611 3300046809 Bacteria 9119
1950 Ga0495600_0008652 3300046809 Bacteria 6262
1951 Ga0495604_0006295 3300047317 Bacteria 9420
1952 Ga0495674_0017914 3300047319 Bacteria 6595
1953 Ga0495672_0009403 3300047320 Bacteria 7086
1954 Ga0495676_0024428 3300047321 Bacteria 5231
1955 Ga0495676_0103476 3300047321 Bacteria 2102
1956 Ga0495680_0001729 3300047322 Bacteria 23181
1957 Ga0495680_0009851 3300047322 Bacteria 8566
1958 Ga0495680_0010215 3300047322 Bacteria 8381
1959 Ga0495680_0010928 3300047322 Bacteria 8067
1960 Ga0495683_0015077 3300047323 Bacteria 4025
1961 Ga0495687_000178 3300047443 Bacteria 93234
1962 Ga0495687_001431 3300047443 Bacteria 21965
1963 Ga0495675_0043629 3300047444 Bacteria 2857
1964 Ga0495677_0004211 3300047445 Bacteria 5546
1965 Ga0495681_0002869 3300047470 Bacteria 12180
1966 Ga0495684_0009501 3300047471 Bacteria 7503
1967 Ga0495684_0031512 3300047471 Bacteria 4071
1968 Ga0495686_0000057 3300047472 Bacteria 250088
1969 Ga0495686_0000191 3300047472 Bacteria 114738
1970 Ga0495686_0000254 3300047472 Bacteria 95907
1971 Ga0495686_0008475 3300047472 Bacteria 7540
1972 Ga0495593_0017149 3300047673 Bacteria 4075
1973 Ga0495593_0018147 3300047673 Bacteria 3956
1974 Ga0495602_0006038 3300048088 Bacteria 12713
1975 Ga0496100_0013522 3300048903 Bacteria 4710
1976 Ga0496100_0033539 3300048903 Bacteria 3213
1977 Ga0496100_0043356 3300048903 Bacteria 2877
1978 Ga0496100_0060456 3300048903 Bacteria 2493
1979 Ga0496100_0073255 3300048903 Bacteria 2292
1980 Ga0496100_0172016 3300048903 Bacteria 1561
1981 Ga0496101_0001067 3300048904 Bacteria 16219
1982 Ga0496101_0004772 3300048904 Bacteria 8596
1983 Ga0496101_0013954 3300048904 Bacteria 5395
1984 Ga0496101_0025224 3300048904 Bacteria 4122
1985 Ga0496101_0064682 3300048904 Bacteria 2665
1986 Ga0496101_0098358 3300048904 Bacteria 2186
1987 Ga0496101_0159795 3300048904 Bacteria 1728
1988 Ga0496102_0001521 3300048905 Bacteria 20463
1989 Ga0496102_0002312 3300048905 Bacteria 16290
1990 Ga0496102_0005444 3300048905 Bacteria 10795
1991 Ga0496102_0008737 3300048905 Bacteria 8692
1992 Ga0496102_0009819 3300048905 Bacteria 8228
1993 Ga0496102_0021428 3300048905 Bacteria 5715
1994 Ga0496102_0052570 3300048905 Bacteria 3712
1995 Ga0496102_0093611 3300048905 Bacteria 2784
1996 Ga0496102_0235132 3300048905 Bacteria 1728
1997 Ga0496102_0241256 3300048905 Bacteria 1704
1998 Ga0496102_0242602 3300048905 Bacteria 1699
1999 Ga0496103_0001417 3300048906 Bacteria 16094
2000 Ga0496103_0001692 3300048906 Bacteria 14419
2001 Ga0496103_0002569 3300048906 Bacteria 11380
2002 Ga0496103_0009626 3300048906 Bacteria 5721
2003 Ga0496104_0000145 3300048907 Bacteria 65454
2004 Ga0496104_0002150 3300048907 Bacteria 17114
2005 Ga0496104_0005127 3300048907 Bacteria 11438
2006 Ga0496104_0010566 3300048907 Bacteria 8245
2007 Ga0496104_0015313 3300048907 Bacteria 6944
2008 Ga0496104_0053594 3300048907 Bacteria 3811
2009 Ga0496104_0067851 3300048907 Bacteria 3389
2010 Ga0496104_0070597 3300048907 Bacteria 3320
2011 Ga0496104_0235546 3300048907 Bacteria 1742
2012 Ga0496105_0001119 3300048908 Bacteria 18680
2013 Ga0496105_0002007 3300048908 Bacteria 14681
2014 Ga0496105_0004704 3300048908 Bacteria 10293
2015 Ga0496105_0041918 3300048908 Bacteria 3772
2016 Ga0496105_0057440 3300048908 Bacteria 3213
2017 Ga0496106_0003383 3300048909 Bacteria 11886
2018 Ga0496106_0004182 3300048909 Bacteria 10758
2019 Ga0496106_0004576 3300048909 Bacteria 10258
2020 Ga0496106_0010389 3300048909 Bacteria 6878
2021 Ga0496106_0036330 3300048909 Bacteria 3686
2022 Ga0496106_0061478 3300048909 Bacteria 2849
2023 Ga0496106_0083220 3300048909 Bacteria 2461
2024 Ga0496106_0159291 3300048909 Bacteria 1784
2025 Ga0496107_0000289 3300048910 Bacteria 26789
2026 Ga0496107_0004715 3300048910 Bacteria 9265
2027 Ga0496107_0005659 3300048910 Bacteria 8555
2028 Ga0496107_0007113 3300048910 Bacteria 7708
2029 Ga0496107_0008885 3300048910 Bacteria 6961
2030 Ga0496107_0011905 3300048910 Bacteria 6075
2031 Ga0496107_0015391 3300048910 Bacteria 5360
2032 Ga0496107_0033404 3300048910 Bacteria 3680
2033 Ga0496107_0088486 3300048910 Bacteria 2261
2034 Ga0496108_0001325 3300048911 Bacteria 19461
2035 Ga0496108_0002014 3300048911 Bacteria 16270
2036 Ga0496108_0004348 3300048911 Bacteria 11394
2037 Ga0496108_0004596 3300048911 Bacteria 11117
2038 Ga0496108_0005992 3300048911 Bacteria 9848
2039 Ga0496108_0012933 3300048911 Bacteria 6800
2040 Ga0496108_0074706 3300048911 Bacteria 2862
2041 Ga0496108_0131299 3300048911 Bacteria 2153
2042 Ga0496109_0005139 3300048912 Bacteria 10924
2043 Ga0496109_0006697 3300048912 Bacteria 9700
2044 Ga0496109_0010584 3300048912 Bacteria 7888
2045 Ga0496109_0011548 3300048912 Bacteria 7597
2046 Ga0496109_0016687 3300048912 Bacteria 6424
2047 Ga0496109_0020575 3300048912 Bacteria 5828
2048 Ga0496109_0028813 3300048912 Bacteria 4970
2049 Ga0496109_0036224 3300048912 Bacteria 4453
2050 Ga0496109_0039714 3300048912 Bacteria 4260
2051 Ga0496109_0209421 3300048912 Bacteria 1833
2052 Ga0496110_0000304 3300048913 Bacteria 32429
2053 Ga0496110_0001396 3300048913 Bacteria 17445
2054 Ga0496110_0001652 3300048913 Bacteria 16361
2055 Ga0496110_0005164 3300048913 Bacteria 10208
2056 Ga0496110_0010787 3300048913 Bacteria 7446
2057 Ga0496110_0034920 3300048913 Bacteria 4358
2058 Ga0496110_0050431 3300048913 Bacteria 3654
2059 Ga0496110_0067559 3300048913 Bacteria 3163
2060 Ga0496110_0076726 3300048913 Bacteria 2971
2061 Ga0496110_0095887 3300048913 Bacteria 2657
2062 Ga0496110_0124002 3300048913 Bacteria 2330
2063 Ga0496111_0001290 3300048914 Bacteria 14039
2064 Ga0496111_0004756 3300048914 Bacteria 8616
2065 Ga0496111_0005184 3300048914 Bacteria 8307
2066 Ga0496111_0006534 3300048914 Bacteria 7580
2067 Ga0496111_0007993 3300048914 Bacteria 6975
2068 Ga0496111_0010979 3300048914 Bacteria 6093
2069 Ga0496111_0019705 3300048914 Bacteria 4690
2070 Ga0496111_0025743 3300048914 Bacteria 4151
2071 Ga0496111_0030244 3300048914 Bacteria 3851
2072 Ga0496111_0079597 3300048914 Bacteria 2391
2073 Ga0496111_0122061 3300048914 Bacteria 1924
2074 Ga0496112_0000602 3300048915 Bacteria 24773
2075 Ga0496112_0004530 3300048915 Bacteria 11806
2076 Ga0496112_0005334 3300048915 Bacteria 11099
2077 Ga0496112_0010372 3300048915 Bacteria 8448
2078 Ga0496112_0013270 3300048915 Bacteria 7606
2079 Ga0496112_0015016 3300048915 Bacteria 7210
2080 Ga0496112_0026958 3300048915 Bacteria 5538
2081 Ga0496112_0029553 3300048915 Bacteria 5300
2082 Ga0496112_0030210 3300048915 Bacteria 5243
2083 Ga0496112_0037155 3300048915 Bacteria 4754
2084 Ga0496112_0048327 3300048915 Bacteria 4171
2085 Ga0496112_0107262 3300048915 Bacteria 2763
2086 Ga0496112_0119077 3300048915 Bacteria 2610
2087 Ga0496112_0210890 3300048915 Bacteria 1900
2088 Ga0496113_0000443 3300048916 Bacteria 20164
2089 Ga0496113_0000672 3300048916 Bacteria 17368
2090 Ga0496113_0001600 3300048916 Bacteria 12735
2091 Ga0496113_0006907 3300048916 Bacteria 7246
2092 Ga0496113_0012073 3300048916 Bacteria 5794
2093 Ga0496113_0026195 3300048916 Bacteria 4166
2094 Ga0496113_0040018 3300048916 Bacteria 3453
2095 Ga0496113_0087552 3300048916 Bacteria 2395
2096 Ga0496113_0088853 3300048916 Bacteria 2377
2097 Ga0496113_0095611 3300048916 Bacteria 2296
2098 Ga0496113_0203090 3300048916 Bacteria 1575
2099 Ga0496114_0000006 3300048917 Bacteria 472921
2100 Ga0496114_0010274 3300048917 Bacteria 7449
2101 Ga0496114_0012266 3300048917 Bacteria 6858
2102 Ga0496114_0028053 3300048917 Bacteria 4617
2103 Ga0496114_0032503 3300048917 Bacteria 4295
2104 Ga0496114_0038872 3300048917 Bacteria 3938
2105 Ga0496114_0061979 3300048917 Bacteria 3129
2106 Ga0496115_0000579 3300048918 Bacteria 28224
2107 Ga0496115_0000979 3300048918 Bacteria 20699
2108 Ga0496115_0028051 3300048918 Bacteria 4409
2109 Ga0496116_0002615 3300048919 Bacteria 18706
2110 Ga0496116_0017644 3300048919 Bacteria 5531
2111 Ga0496117_0002852 3300048920 Bacteria 21027
2112 Ga0496117_0007680 3300048920 Bacteria 10443
2113 Ga0496117_0010697 3300048920 Bacteria 8302
2114 Ga0496117_0018746 3300048920 Bacteria 5715
2115 Ga0496117_0020493 3300048920 Bacteria 5386
2116 Ga0496118_0000580 3300048921 Bacteria 60421
2117 Ga0496118_0001620 3300048921 Bacteria 33243
2118 Ga0496118_0003742 3300048921 Bacteria 18808
2119 Ga0496118_0016661 3300048921 Bacteria 6732
2120 Ga0496118_0021282 3300048921 Bacteria 5715
2121 Ga0496118_0030710 3300048921 Bacteria 4475
2122 Ga0496118_0057100 3300048921 Bacteria 2929
2123 Ga0496118_0066307 3300048921 Bacteria 2636
2124 Ga0496119_0002655 3300048922 Bacteria 19361
2125 Ga0496120_0000781 3300048923 Bacteria 46067
2126 Ga0496120_0017843 3300048923 Bacteria 4586
2127 Ga0496121_0001577 3300048924 Bacteria 37973
2128 Ga0496121_0002895 3300048924 Bacteria 25241
2129 Ga0496121_0092906 3300048924 Bacteria 2351
2130 Ga0496122_0003251 3300048925 Bacteria 21563
2131 Ga0496122_0020198 3300048925 Bacteria 6036
2132 Ga0496122_0025938 3300048925 Bacteria 5073
2133 Ga0496122_0026134 3300048925 Bacteria 5047
2134 Ga0496123_0000577 3300048926 Bacteria 62448
2135 Ga0496123_0016388 3300048926 Bacteria 6021
2136 Ga0496123_0060616 3300048926 Bacteria 2438
2137 Ga0496124_0000626 3300048927 Bacteria 58823
2138 Ga0496124_0014484 3300048927 Bacteria 7624
2139 Ga0496124_0022909 3300048927 Bacteria 5715
2140 Ga0496124_0086896 3300048927 Bacteria 2558
2141 Ga0496125_0000638 3300048928 Bacteria 58580
2142 Ga0496125_0033431 3300048928 Bacteria 4551
2143 Ga0496126_0000752 3300048929 Bacteria 58828
2144 Ga0496126_0225207 3300048929 Bacteria 1573
2145 Ga0501292_000005 3300049515 Bacteria 147536
2146 Ga0501031_0000001 3300049568 Bacteria 219461
2147 Ga0501031_0001643 3300049568 Bacteria 14030
2148 Ga0501031_0031857 3300049568 Bacteria 3438
2149 Ga0501031_0032795 3300049568 Bacteria 3387
2150 Ga0501032_0000003 3300049569 Bacteria 317700
2151 Ga0501032_0000025 3300049569 Bacteria 138521
2152 Ga0501032_0005057 3300049569 Bacteria 9856
2153 Ga0501033_0000150 3300049570 Bacteria 67069
2154 Ga0501033_0000229 3300049570 Bacteria 54036
2155 Ga0501033_0005309 3300049570 Bacteria 10213
2156 Ga0501033_0009635 3300049570 Bacteria 7432
2157 Ga0501033_0016744 3300049570 Bacteria 5544
2158 Ga0501033_0054868 3300049570 Bacteria 2946
2159 Ga0501033_0067587 3300049570 Bacteria 2628
2160 Ga0501033_0112971 3300049570 Bacteria 1976
2161 Ga0501033_0140094 3300049570 Bacteria 1749
2162 Ga0501034_0000005 3300049571 Bacteria 367512
2163 Ga0501034_0001654 3300049571 Bacteria 28764
2164 Ga0501034_0010480 3300049571 Bacteria 9652
2165 Ga0501034_0013481 3300049571 Bacteria 8414
2166 Ga0501034_0049154 3300049571 Bacteria 4256
2167 Ga0501034_0071557 3300049571 Bacteria 3477
2168 Ga0501034_0079102 3300049571 Bacteria 3291
2169 Ga0501034_0082196 3300049571 Bacteria 3223
2170 Ga0501034_0199049 3300049571 Bacteria 1962
2171 Ga0501034_0224832 3300049571 Bacteria 1828
2172 Ga0501036_0000018 3300049572 Bacteria 121185
2173 Ga0501036_0000151 3300049572 Bacteria 45499
2174 Ga0501036_0021478 3300049572 Bacteria 5428
2175 Ga0501036_0062704 3300049572 Bacteria 3149
2176 Ga0501037_0000005 3300049573 Bacteria 219461
2177 Ga0501037_0000176 3300049573 Bacteria 60011
2178 Ga0501037_0000616 3300049573 Bacteria 27595
2179 Ga0501037_0001417 3300049573 Bacteria 17598
2180 Ga0501037_0087230 3300049573 Bacteria 2258
2181 Ga0501038_0000001 3300049574 Bacteria 375481
2182 Ga0501038_0000046 3300049574 Bacteria 106465
2183 Ga0501038_0009818 3300049574 Bacteria 8761
2184 Ga0501038_0029781 3300049574 Bacteria 4835
2185 Ga0501039_0000003 3300049575 Bacteria 357424
2186 Ga0501039_0000015 3300049575 Bacteria 219470
2187 Ga0501039_0061404 3300049575 Bacteria 2911
2188 Ga0501039_0099311 3300049575 Bacteria 2271
2189 Ga0501040_0002109 3300049576 Bacteria 12810
2190 Ga0501040_0004434 3300049576 Bacteria 9115
2191 Ga0501040_0066425 3300049576 Bacteria 2485
2192 Ga0501040_0072759 3300049576 Bacteria 2374
2193 Ga0501041_0016472 3300049577 Bacteria 4395
2194 Ga0501041_0037558 3300049577 Bacteria 2935
2195 Ga0501041_0082526 3300049577 Bacteria 1980
2196 Ga0501042_0004850 3300049578 Bacteria 8599
2197 Ga0501042_0038262 3300049578 Bacteria 3407
2198 Ga0501043_0000051 3300049579 Bacteria 106957
2199 Ga0501043_0000107 3300049579 Bacteria 77469
2200 Ga0501043_0000436 3300049579 Bacteria 37624
2201 Ga0501043_0031499 3300049579 Bacteria 4169
2202 Ga0501043_0058611 3300049579 Bacteria 3023
2203 Ga0501046_0021771 3300049580 Bacteria 5285
2204 Ga0501046_0023691 3300049580 Bacteria 5045
2205 Ga0501046_0134750 3300049580 Bacteria 1871
2206 Ga0501047_0001638 3300049581 Bacteria 21843
2207 Ga0501047_0018327 3300049581 Bacteria 6709
2208 Ga0501047_0021953 3300049581 Bacteria 6130
2209 Ga0501047_0093209 3300049581 Bacteria 2891
2210 Ga0501047_0185379 3300049581 Bacteria 1946
2211 Ga0501047_0212504 3300049581 Bacteria 1792
2212 Ga0501048_0000330 3300049582 Bacteria 32531
2213 Ga0501048_0012907 3300049582 Bacteria 6206
2214 Ga0501048_0031295 3300049582 Bacteria 3849
2215 Ga0501067_0000657 3300049583 Bacteria 18540
2216 Ga0501067_0012826 3300049583 Bacteria 4641
2217 Ga0501068_0010554 3300049584 Bacteria 5192
2218 Ga0501068_0075228 3300049584 Bacteria 2066
2219 Ga0501068_0120926 3300049584 Bacteria 1632
2220 Ga0501069_0000039 3300049585 Bacteria 82361
2221 Ga0501070_0000132 3300049586 Bacteria 67092
2222 Ga0501070_0000299 3300049586 Bacteria 46014
2223 Ga0501070_0002059 3300049586 Bacteria 17669
2224 Ga0501070_0105445 3300049586 Bacteria 2330
2225 Ga0501070_0131359 3300049586 Bacteria 2068
2226 Ga0501071_0004981 3300049587 Bacteria 8486
2227 Ga0501071_0011260 3300049587 Bacteria 6019
2228 Ga0501071_0018641 3300049587 Bacteria 4810
2229 Ga0501072_0075629 3300049588 Bacteria 2663
2230 Ga0501072_0082993 3300049588 Bacteria 2541
2231 Ga0501072_0127477 3300049588 Bacteria 2028
2232 Ga0501073_0010664 3300049589 Bacteria 6727
2233 Ga0501074_0001123 3300049590 Bacteria 17513
2234 Ga0501075_0001158 3300049591 Bacteria 17057
2235 Ga0501075_0011537 3300049591 Bacteria 6254
2236 Ga0501076_0003615 3300049592 Bacteria 10862
2237 Ga0501076_0190539 3300049592 Bacteria 1673
2238 Ga0501077_0023964 3300049593 Bacteria 3872
2239 Ga0501077_0044349 3300049593 Bacteria 2825
2240 Ga0501206_001344 3300049653 Bacteria 3071
2241 Ga0501223_003784 3300049663 Bacteria 3268
2242 Ga0501249_012773 3300049679 Bacteria 1778
2243 Ga0501259_000327 3300049688 Bacteria 7500
2244 Ga0501079_0008324 3300049741 Bacteria 7861
2245 Ga0501079_0013818 3300049741 Bacteria 6157
2246 Ga0501079_0108844 3300049741 Bacteria 2152
2247 Ga0501079_0156932 3300049741 Bacteria 1774
2248 Ga0501080_0001676 3300049742 Bacteria 18865
2249 Ga0501080_0012571 3300049742 Bacteria 7763
2250 Ga0501080_0033363 3300049742 Bacteria 4804
2251 Ga0501080_0077332 3300049742 Bacteria 3095
2252 Ga0501080_0105444 3300049742 Bacteria 2614
2253 Ga0501081_0006207 3300049743 Bacteria 7743
2254 Ga0501081_0165908 3300049743 Bacteria 1593
2255 Ga0501083_0000065 3300049744 Bacteria 73075
2256 Ga0501083_0070794 3300049744 Bacteria 2319
2257 Ga0501280_000025 3300049776 Bacteria 49396
2258 Ga0501282_000129 3300049778 Bacteria 9047
2259 Ga0501035_0000008 3300049822 Bacteria 313425
2260 Ga0501035_0000055 3300049822 Bacteria 139471
2261 Ga0501035_0000102 3300049822 Bacteria 106915
2262 Ga0501035_0009706 3300049822 Bacteria 8953
2263 Ga0501035_0016756 3300049822 Bacteria 6757
2264 Ga0501035_0017931 3300049822 Bacteria 6528
2265 Ga0501035_0044898 3300049822 Bacteria 3977
2266 Ga0501035_0045710 3300049822 Bacteria 3938
2267 Ga0501035_0067314 3300049822 Bacteria 3178
2268 Ga0501044_0000001 3300049823 Bacteria 418087
2269 Ga0501044_0000071 3300049823 Bacteria 124531
2270 Ga0501044_0001093 3300049823 Bacteria 32295
2271 Ga0501044_0018357 3300049823 Bacteria 7495
2272 Ga0501044_0023391 3300049823 Bacteria 6572
2273 Ga0501044_0059282 3300049823 Bacteria 3922
2274 Ga0501044_0063445 3300049823 Bacteria 3774
2275 Ga0501044_0080392 3300049823 Bacteria 3302
2276 Ga0501044_0098394 3300049823 Bacteria 2945
2277 Ga0501044_0121596 3300049823 Bacteria 2611
2278 Ga0501044_0161911 3300049823 Bacteria 2213
2279 Ga0501045_0007704 3300049824 Bacteria 7492
2280 Ga0501045_0087526 3300049824 Bacteria 2300
2281 Ga0501045_0129005 3300049824 Bacteria 1879
2282 nmdc:mga0yw44_51957_c1 3300050492 Bacteria 2483
2283 nmdc:mga0yw44_59079_c1 3300050492 Bacteria 2345
2284 nmdc:mga0yw44_64089_c1 3300050492 Bacteria 2261
2285 nmdc:mga0yw44_73960_c1 3300050492 Bacteria 2121
2286 nmdc:mga0k408_47712_c1 3300050493 Bacteria 2476
2287 nmdc:mga06z11_57112_c1 3300050494 Bacteria 2021
2288 nmdc:mga05p37_103970_c1 3300050507 Bacteria 3495
2289 nmdc:mga05p37_126394_c1 3300050507 Bacteria 3140
2290 nmdc:mga05p37_155759_c1 3300050507 Bacteria 2792
2291 nmdc:mga05p37_711_c1 3300050507 Bacteria 36985
2292 nmdc:mga09592_197675_c1 3300050508 Bacteria 1741
2293 nmdc:mga09592_3348_c1 3300050508 Bacteria 12960
2294 nmdc:mga09592_63793_c1 3300050508 Bacteria 3118
2295 nmdc:mga06r32_12656_c1 3300050510 Bacteria 7624
2296 nmdc:mga06r32_140423_c1 3300050510 Bacteria 2391
2297 nmdc:mga06r32_15930_c1 3300050510 Bacteria 6840
2298 nmdc:mga06r32_247_c1 3300050510 Bacteria 44416
2299 nmdc:mga06r32_8046_c1 3300050510 Bacteria 9486
2300 nmdc:mga06r32_91033_c1 3300050510 Bacteria 2980
2301 nmdc:mga08y16_24024_c1 3300050511 Bacteria 6437
2302 nmdc:mga08y16_47929_c1 3300050511 Bacteria 4472
2303 nmdc:mga0n895_159363_c1 3300050512 Bacteria 2288
2304 nmdc:mga0n895_64835_c1 3300050512 Bacteria 3614
2305 nmdc:mga08x19_64247_c1 3300050514 Bacteria 2382
2306 nmdc:mga0a205_96113_c2 3300050515 Bacteria 2358
2307 nmdc:mga0sz30_44974_c1 3300050516 Bacteria 1861
2308 nmdc:mga0sz30_717_c2 3300050516 Bacteria 5173
2309 Ga0495601_0000248 3300053077 Bacteria 28877
2310 Ga0495601_0000865 3300053077 Bacteria 16507
2311 Ga0495601_0002177 3300053077 Bacteria 11031
2312 Ga0495601_0075816 3300053077 Bacteria 2153
2313 Ga0495612_0000231 3300053078 Bacteria 23627
2314 Ga0495612_0009360 3300053078 Bacteria 3978
2315 Ga0500610_0002234 3300053079 Bacteria 7021
2316 Ga0495655_0018656 3300053083 Bacteria 1529
2317 Ga0495595_0007721 3300053084 Bacteria 4406
2318 Ga0495595_0008103 3300053084 Bacteria 4308
2319 Ga0495595_0022887 3300053084 Bacteria 2747
2320 Ga0495595_0024881 3300053084 Bacteria 2647
2321 Ga0495619_0002240 3300053085 Bacteria 12799
2322 Ga0495619_0007115 3300053085 Bacteria 7084
2323 Ga0495619_0008090 3300053085 Bacteria 6654
2324 Ga0495619_0044971 3300053085 Bacteria 2899
2325 Ga0495619_0070847 3300053085 Bacteria 2332
2326 Ga0500643_000129 3300053087 Bacteria 77787
2327 Ga0500643_000997 3300053087 Bacteria 17354
2328 Ga0500643_003115 3300053087 Bacteria 8131
2329 Ga0500643_008247 3300053087 Bacteria 4111
2330 Ga0500643_014850 3300053087 Bacteria 2689
2331 Ga0500651_0006447 3300053093 Bacteria 6770
2332 Ga0500641_0002743 3300053096 Bacteria 6218
2333 Ga0500641_0020084 3300053096 Bacteria 2532
2334 Ga0500562_000021 3300053108 Bacteria 112425
2335 Ga0500592_002520 3300053116 Bacteria 2943
2336 Ga0500595_000002 3300053119 Bacteria 1074388
2337 Ga0500595_000869 3300053119 Bacteria 17272
2338 Ga0500595_004812 3300053119 Bacteria 5977
2339 Ga0500595_016121 3300053119 Bacteria 2789
2340 Ga0500642_0000216 3300053130 Bacteria 22916
2341 Ga0500642_0000659 3300053130 Bacteria 10254
2342 Ga0500642_0004340 3300053130 Bacteria 4426
2343 Ga0500652_000270 3300053131 Bacteria 19397
2344 Ga0500655_000094 3300053133 Bacteria 23193
2345 Ga0500658_0000208 3300053134 Bacteria 27756
2346 Ga0500658_0002995 3300053134 Bacteria 6487
2347 Ga0500658_0006808 3300053134 Bacteria 4228
2348 Ga0500568_0000108 3300053139 Bacteria 77013
2349 Ga0500568_0000746 3300053139 Bacteria 23248
2350 Ga0500568_0034259 3300053139 Bacteria 2078
2351 Ga0500573_0000045 3300053140 Bacteria 98878
2352 Ga0500590_006053 3300053148 Bacteria 5865
2353 Ga0500604_0000003 3300053151 Bacteria 148800
2354 Ga0500616_0000002 3300053153 Bacteria 1611257
2355 Ga0500616_0000128 3300053153 Bacteria 134307
2356 Ga0500616_0000501 3300053153 Bacteria 50041
2357 Ga0500616_0003084 3300053153 Bacteria 13089
2358 Ga0500616_0007071 3300053153 Bacteria 7201
2359 Ga0500622_0032406 3300053156 Bacteria 2740
2360 Ga0500627_0000004 3300053158 Bacteria 174208
2361 Ga0500627_0000386 3300053158 Bacteria 11906
2362 Ga0500636_0001208 3300053177 Bacteria 13944
2363 Ga0500637_0006016 3300053178 Bacteria 5933
2364 Ga0500637_0008446 3300053178 Bacteria 5195
2365 Ga0500570_000135 3300053724 Bacteria 21948
2366 Ga0500645_000011 3300053730 Bacteria 169616
2367 Ga0500645_000864 3300053730 Bacteria 17683
2368 Ga0500645_001945 3300053730 Bacteria 9794
2369 Ga0500609_002252 3300053731 Bacteria 2749
2370 Ga0500596_000559 3300053735 Bacteria 7070
2371 Ga0500599_004057 3300053736 Bacteria 1802
2372 Ga0501084_0008002 3300054114 Bacteria 8704
2373 Ga0501084_0018429 3300054114 Bacteria 5811
2374 Ga0501084_0027757 3300054114 Bacteria 4730
2375 Ga0501084_0030241 3300054114 Bacteria 4529
2376 Ga0501084_0066656 3300054114 Bacteria 3013
2377 Ga0501084_0086080 3300054114 Bacteria 2639
2378 Ga0501084_0113270 3300054114 Bacteria 2280
2379 Ga0501084_0182121 3300054114 Bacteria 1773
2380 Ga0501082_0005139 3300060353 Bacteria 11392
2381 Ga0501082_0015165 3300060353 Bacteria 6638
2382 Ga0501082_0082634 3300060353 Bacteria 2771
2383 Ga0501082_0090880 3300060353 Bacteria 2636
2384 Ga0466962_0003266 3300061719 Bacteria 7701
2385 Ga0466962_0006762 3300061719 Bacteria 5501
2386 Ga0466962_0059021 3300061719 Bacteria 1831

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031250 Ga0265331_10020058 Ga0265331_100200582 475
2 iso_pu_bacteria 2597490356 2599101204 475
3 iso_pu_bacteria 2846952575 2846954076 475
4 iso_pu_bacteria 2848858292 2848859548 475
5 iso_pu_bacteria 2897803580 2897809153 475
6 iso_pu_bacteria 8054002106 8054004890 475
7 3300006847 Ga0075431_100019933 Ga0075431_1000199335 476
8 3300006880 Ga0075429_100129752 Ga0075429_1001297522 476
9 3300009147 Ga0114129_10003089 Ga0114129_1000308914 476
10 3300013297 Ga0157378_10096585 Ga0157378_100965852 476
11 3300037418 Ga0395900_0134560 Ga0395900_0134560_920_2359 476
12 3300038443 Ga0395901_0155740 Ga0395901_0155740_934_2373 476
13 3300048920 Ga0496117_0010697 Ga0496117_0010697_5605_7056 476
14 3300048921 Ga0496118_0030710 Ga0496118_0030710_179_1630 476
15 3300048925 Ga0496122_0026134 Ga0496122_0026134_2282_3733 476
16 3300048926 Ga0496123_0060616 Ga0496123_0060616_816_2267 476
17 3300050507 nmdc:mga05p37_103970_c1 nmdc:mga05p37_103970_c1_262_1710 476
18 3300050508 nmdc:mga09592_63793_c1 nmdc:mga09592_63793_c1_63_1511 476
19 3300050510 nmdc:mga06r32_12656_c1 nmdc:mga06r32_12656_c1_1173_2621 476
20 3300053096 Ga0500641_0020084 Ga0500641_0020084_51_1490 476
21 3300031824 Ga0307413_10055275 Ga0307413_100552752 477
22 3300031852 Ga0307410_10024597 Ga0307410_100245973 477
23 3300031995 Ga0307409_100027007 Ga0307409_1000270073 477
24 3300032005 Ga0307411_10174909 Ga0307411_101749091 477
25 3300032126 Ga0307415_100089195 Ga0307415_1000891952 477
26 iso_pu_bacteria 2896429255 2896429801 477
27 3300005337 Ga0070682_100067986 Ga0070682_1000679862 478
28 3300005339 Ga0070660_100057048 Ga0070660_1000570483 478
29 3300005355 Ga0070671_100048329 Ga0070671_1000483292 478
30 3300005456 Ga0070678_100016924 Ga0070678_1000169244 478
31 3300005457 Ga0070662_100018756 Ga0070662_1000187563 478
32 3300005539 Ga0068853_100126802 Ga0068853_1001268022 478
33 3300005615 Ga0070702_100029297 Ga0070702_1000292972 478
34 3300009545 Ga0105237_10109878 Ga0105237_101098783 478
35 3300013297 Ga0157378_10089031 Ga0157378_100890312 478
36 3300014325 Ga0163163_10164724 Ga0163163_101647242 478
37 3300025898 Ga0207692_10002954 Ga0207692_100029544 478
38 3300025915 Ga0207693_10035981 Ga0207693_100359813 478
39 3300025917 Ga0207660_10167200 Ga0207660_101672002 478
40 3300025921 Ga0207652_10151012 Ga0207652_101510122 478
41 3300025927 Ga0207687_10011569 Ga0207687_100115693 478
42 3300025932 Ga0207690_10148519 Ga0207690_101485191 478
43 3300025933 Ga0207706_10021084 Ga0207706_100210843 478
44 3300025938 Ga0207704_10046383 Ga0207704_100463832 478
45 3300025939 Ga0207665_10081476 Ga0207665_100814762 478
46 3300026067 Ga0207678_10026494 Ga0207678_100264942 478
47 3300026078 Ga0207702_10129838 Ga0207702_101298382 478
48 3300031250 Ga0265331_10012471 Ga0265331_100124712 478
49 3300035083 Ga0373926_0003211 Ga0373926_0003211_2121_3581 478
50 3300035083 Ga0373926_0007834 Ga0373926_0007834_1018_2478 478
51 3300035089 Ga0373944_0016261 Ga0373944_0016261_117_1577 478
52 3300035170 Ga0373943_0019173 Ga0373943_0019173_1615_3075 478
53 3300035171 Ga0373946_0018506 Ga0373946_0018506_198_1658 478
54 3300035695 Ga0373927_0077460 Ga0373927_0077460_461_1921 478
55 3300037466 Ga0395898_0023423 Ga0395898_0023423_3648_5135 478
56 3300046475 Ga0495639_0007364 Ga0495639_0007364_92_1552 478
57 3300046476 Ga0495662_0022223 Ga0495662_0022223_1105_2565 478
58 3300046477 Ga0495664_0006960 Ga0495664_0006960_4378_5838 478
59 3300046499 Ga0495594_0012537 Ga0495594_0012537_2925_4385 478
60 3300046514 Ga0495618_0104167 Ga0495618_0104167_232_1692 478
61 3300046517 Ga0495630_0082779 Ga0495630_0082779_818_2278 478
62 3300046526 Ga0495666_0012049 Ga0495666_0012049_2091_3551 478
63 3300046531 Ga0495665_0070737 Ga0495665_0070737_248_1708 478
64 3300046557 Ga0495622_0010615 Ga0495622_0010615_1803_3263 478
65 3300046681 Ga0495647_0026524 Ga0495647_0026524_201_1661 478
66 3300046683 Ga0495658_0025132 Ga0495658_0025132_408_1868 478
67 3300047321 Ga0495676_0024428 Ga0495676_0024428_2147_3607 478
68 3300048909 Ga0496106_0003383 Ga0496106_0003383_5353_6813 478
69 3300048910 Ga0496107_0007113 Ga0496107_0007113_317_1777 478
70 3300048916 Ga0496113_0087552 Ga0496113_0087552_23_1483 478
71 3300049582 Ga0501048_0000330 Ga0501048_0000330_20444_21934 478
72 3300050492 nmdc:mga0yw44_64089_c1 nmdc:mga0yw44_64089_c1_245_1699 478
73 3300050494 nmdc:mga06z11_57112_c1 nmdc:mga06z11_57112_c1_546_2006 478
74 3300053077 Ga0495601_0000865 Ga0495601_0000865_5303_6763 478
75 iso_pu_bacteria 2841917233 2841922398 478
76 iso_pu_bacteria 2906393657 2906401271 478
77 iso_pu_bacteria 2917699015 2917699444 478
78 iso_pu_bacteria 637000159 637079538 478
79 3300005345 Ga0070692_10017251 Ga0070692_100172513 479
80 3300005406 Ga0070703_10003989 Ga0070703_100039893 479
81 3300005440 Ga0070705_100000184 Ga0070705_1000001848 479
82 3300005441 Ga0070700_100008627 Ga0070700_1000086276 479
83 3300005518 Ga0070699_100010191 Ga0070699_1000101915 479
84 3300005536 Ga0070697_100056836 Ga0070697_1000568362 479
85 3300005546 Ga0070696_100001650 Ga0070696_1000016503 479
86 3300005547 Ga0070693_100015393 Ga0070693_1000153931 479
87 3300005549 Ga0070704_100000206 Ga0070704_1000002062 479
88 3300005617 Ga0068859_100018178 Ga0068859_1000181786 479
89 3300005844 Ga0068862_100000157 Ga0068862_10000015723 479
90 3300006931 Ga0097620_100018178 Ga0097620_1000181784 479
91 3300025885 Ga0207653_10000869 Ga0207653_100008693 479
92 3300025917 Ga0207660_10005195 Ga0207660_100051955 479
93 3300025922 Ga0207646_10064288 Ga0207646_100642883 479
94 3300025961 Ga0207712_10002722 Ga0207712_1000272211 479
95 3300026075 Ga0207708_10001897 Ga0207708_100018976 479
96 3300026095 Ga0207676_10041964 Ga0207676_100419643 479
97 3300026116 Ga0207674_10003717 Ga0207674_1000371719 479
98 3300028381 Ga0268264_10023991 Ga0268264_100239916 479
99 3300041413 Ga0439465_0041662 Ga0439465_0041662_20_1477 479
100 3300045051 Ga0451576_0013512 Ga0451576_0013512_3081_4547 479
101 3300046691 Ga0495670_0000009 Ga0495670_0000009_118144_119601 479
102 3300049575 Ga0501039_0061404 Ga0501039_0061404_458_1939 479
103 3300049576 Ga0501040_0072759 Ga0501040_0072759_452_1951 479
104 3300049577 Ga0501041_0016472 Ga0501041_0016472_2841_4340 479
105 3300049588 Ga0501072_0082993 Ga0501072_0082993_92_1573 479
106 3300049588 Ga0501072_0127477 Ga0501072_0127477_152_1651 479
107 3300049741 Ga0501079_0108844 Ga0501079_0108844_110_1609 479
108 3300049741 Ga0501079_0156932 Ga0501079_0156932_58_1557 479
109 3300049743 Ga0501081_0006207 Ga0501081_0006207_1704_3203 479
110 iso_pu_bacteria 2522572158 2523102602 479
111 iso_pu_bacteria 2842333319 2842333685 479
112 iso_pu_bacteria 2885427238 2885428718 479
113 iso_pu_bacteria 2928027323 2928027896 479
114 iso_pu_bacteria 2984555340 2984558728 479
115 iso_pu_bacteria 2984564862 2984566766 479
116 iso_pu_bacteria 2993356040 2993357954 479
117 3300005331 Ga0070670_100004537 Ga0070670_1000045378 480
118 3300005539 Ga0068853_100050078 Ga0068853_1000500782 480
119 3300005563 Ga0068855_100267088 Ga0068855_1002670882 480
120 3300006195 Ga0075366_10040273 Ga0075366_100402732 480
121 3300006847 Ga0075431_100147081 Ga0075431_1001470812 480
122 3300025925 Ga0207650_10001577 Ga0207650_100015779 480
123 3300026041 Ga0207639_10083986 Ga0207639_100839862 480
124 3300031824 Ga0307413_10134229 Ga0307413_101342292 480
125 3300031995 Ga0307409_100028711 Ga0307409_1000287113 480
126 3300032126 Ga0307415_100041635 Ga0307415_1000416353 480
127 3300036647 Ga0316582_0053792 Ga0316582_0053792_904_2367 480
128 3300037312 Ga0395899_0057906 Ga0395899_0057906_710_2182 480
129 3300037418 Ga0395900_0079703 Ga0395900_0079703_1054_2526 480
130 3300037466 Ga0395898_0043183 Ga0395898_0043183_1056_2528 480
131 3300038443 Ga0395901_0001835 Ga0395901_0001835_2798_4270 480
132 3300048903 Ga0496100_0033539 Ga0496100_0033539_1383_2861 480
133 3300048904 Ga0496101_0013954 Ga0496101_0013954_2135_3613 480
134 3300048910 Ga0496107_0088486 Ga0496107_0088486_96_1559 480
135 3300048917 Ga0496114_0010274 Ga0496114_0010274_1038_2516 480
136 3300049577 Ga0501041_0082526 Ga0501041_0082526_80_1567 480
137 3300049579 Ga0501043_0058611 Ga0501043_0058611_1307_2794 480
138 3300049587 Ga0501071_0004981 Ga0501071_0004981_2604_4073 480
139 3300049592 Ga0501076_0190539 Ga0501076_0190539_122_1609 480
140 3300053077 Ga0495601_0075816 Ga0495601_0075816_210_1688 480
141 3300053084 Ga0495595_0022887 Ga0495595_0022887_839_2317 480
142 3300053085 Ga0495619_0070847 Ga0495619_0070847_795_2273 480
143 3300053153 Ga0500616_0003084 Ga0500616_0003084_7854_9359 480
144 iso_pu_bacteria 2993693658 2993695493 480
145 iso_pu_bacteria 2996336353 2996340415 480
146 iso_pu_bacteria 8054563764 8054567881 480
147 3300001977 JGI24746J21847_1003631 JGI24746J21847_10036311 481
148 3300001990 JGI24737J22298_10005904 JGI24737J22298_100059044 481
149 3300001991 JGI24743J22301_10000285 JGI24743J22301_100002852 481
150 3300002155 JGI24033J26618_1002266 JGI24033J26618_10022661 481
151 3300003762 Ga0055542_1001199 Ga0055542_10011997 481
152 3300003762 Ga0055542_1001275 Ga0055542_100127514 481
153 3300003771 Ga0055526_1000889 Ga0055526_10008898 481
154 3300005290 Ga0065712_10083209 Ga0065712_100832092 481
155 3300005327 Ga0070658_10008752 Ga0070658_100087523 481
156 3300005333 Ga0070677_10000280 Ga0070677_1000028012 481
157 3300005334 Ga0068869_100064085 Ga0068869_1000640852 481
158 3300005336 Ga0070680_100000616 Ga0070680_1000006165 481
159 3300005336 Ga0070680_100010475 Ga0070680_1000104755 481
160 3300005338 Ga0068868_100004543 Ga0068868_1000045434 481
161 3300005340 Ga0070689_100012764 Ga0070689_1000127643 481
162 3300005340 Ga0070689_100039939 Ga0070689_1000399392 481
163 3300005344 Ga0070661_100055470 Ga0070661_1000554702 481
164 3300005345 Ga0070692_10056377 Ga0070692_100563771 481
165 3300005353 Ga0070669_100062916 Ga0070669_1000629162 481
166 3300005355 Ga0070671_100081778 Ga0070671_1000817782 481
167 3300005355 Ga0070671_100097127 Ga0070671_1000971272 481
168 3300005364 Ga0070673_100009873 Ga0070673_1000098735 481
169 3300005365 Ga0070688_100003372 Ga0070688_1000033725 481
170 3300005365 Ga0070688_100005608 Ga0070688_1000056085 481
171 3300005366 Ga0070659_100048252 Ga0070659_1000482522 481
172 3300005367 Ga0070667_100052745 Ga0070667_1000527453 481
173 3300005435 Ga0070714_100002983 Ga0070714_1000029833 481
174 3300005435 Ga0070714_100099322 Ga0070714_1000993222 481
175 3300005436 Ga0070713_100004268 Ga0070713_1000042683 481
176 3300005436 Ga0070713_100025686 Ga0070713_1000256863 481
177 3300005436 Ga0070713_100034688 Ga0070713_1000346882 481
178 3300005436 Ga0070713_100260187 Ga0070713_1002601871 481
179 3300005437 Ga0070710_10003754 Ga0070710_100037543 481
180 3300005438 Ga0070701_10009044 Ga0070701_100090442 481
181 3300005439 Ga0070711_100004246 Ga0070711_1000042466 481
182 3300005439 Ga0070711_100072929 Ga0070711_1000729292 481
183 3300005441 Ga0070700_100004078 Ga0070700_1000040785 481
184 3300005445 Ga0070708_100015866 Ga0070708_1000158662 481
185 3300005455 Ga0070663_100003557 Ga0070663_1000035574 481
186 3300005457 Ga0070662_100004787 Ga0070662_1000047873 481
187 3300005458 Ga0070681_10000213 Ga0070681_1000021341 481
188 3300005459 Ga0068867_100033175 Ga0068867_1000331752 481
189 3300005466 Ga0070685_10072331 Ga0070685_100723311 481
190 3300005530 Ga0070679_100001596 Ga0070679_10000159614 481
191 3300005530 Ga0070679_100036042 Ga0070679_1000360422 481
192 3300005539 Ga0068853_100063299 Ga0068853_1000632992 481
193 3300005543 Ga0070672_100010078 Ga0070672_1000100784 481
194 3300005545 Ga0070695_100004130 Ga0070695_1000041304 481
195 3300005548 Ga0070665_100007138 Ga0070665_1000071384 481
196 3300005563 Ga0068855_100001693 Ga0068855_10000169316 481
197 3300005564 Ga0070664_100039466 Ga0070664_1000394662 481
198 3300005564 Ga0070664_100141286 Ga0070664_1001412862 481
199 3300005578 Ga0068854_100074671 Ga0068854_1000746712 481
200 3300005615 Ga0070702_100023939 Ga0070702_1000239392 481
201 3300005617 Ga0068859_100019163 Ga0068859_1000191632 481
202 3300005617 Ga0068859_100022785 Ga0068859_1000227853 481
203 3300005618 Ga0068864_100024970 Ga0068864_1000249703 481
204 3300005719 Ga0068861_100039311 Ga0068861_1000393112 481
205 3300005840 Ga0068870_10008588 Ga0068870_100085883 481
206 3300005843 Ga0068860_100034664 Ga0068860_1000346642 481
207 3300005844 Ga0068862_100010180 Ga0068862_1000101803 481
208 3300005844 Ga0068862_100033433 Ga0068862_1000334333 481
209 3300005937 Ga0081455_10000009 Ga0081455_1000000961 481
210 3300005937 Ga0081455_10000888 Ga0081455_100008888 481
211 3300005937 Ga0081455_10027074 Ga0081455_100270745 481
212 3300006028 Ga0070717_10004598 Ga0070717_100045983 481
213 3300006028 Ga0070717_10049188 Ga0070717_100491882 481
214 3300006163 Ga0070715_10000204 Ga0070715_100002043 481
215 3300006173 Ga0070716_100002258 Ga0070716_1000022582 481
216 3300006175 Ga0070712_100088701 Ga0070712_1000887012 481
217 3300006358 Ga0068871_100097453 Ga0068871_1000974531 481
218 3300006844 Ga0075428_100001209 Ga0075428_10000120915 481
219 3300006844 Ga0075428_100030788 Ga0075428_1000307885 481
220 3300006846 Ga0075430_100145246 Ga0075430_1001452462 481
221 3300006847 Ga0075431_100000698 Ga0075431_10000069817 481
222 3300006847 Ga0075431_100002361 Ga0075431_10000236112 481
223 3300006871 Ga0075434_100066457 Ga0075434_1000664573 481
224 3300006880 Ga0075429_100004139 Ga0075429_1000041393 481
225 3300006931 Ga0097620_100019162 Ga0097620_1000191625 481
226 3300006931 Ga0097620_100022785 Ga0097620_1000227853 481
227 3300007076 Ga0075435_100083168 Ga0075435_1000831681 481
228 3300009094 Ga0111539_10112144 Ga0111539_101121442 481
229 3300009094 Ga0111539_10130667 Ga0111539_101306671 481
230 3300009098 Ga0105245_10031501 Ga0105245_100315012 481
231 3300009098 Ga0105245_10043739 Ga0105245_100437393 481
232 3300009147 Ga0114129_10007283 Ga0114129_100072832 481
233 3300009177 Ga0105248_10042951 Ga0105248_100429513 481
234 3300009177 Ga0105248_10055955 Ga0105248_100559553 481
235 3300009545 Ga0105237_10243249 Ga0105237_102432491 481
236 3300009553 Ga0105249_10005822 Ga0105249_100058229 481
237 3300013308 Ga0157375_10013582 Ga0157375_100135822 481
238 3300014325 Ga0163163_10006190 Ga0163163_100061906 481
239 3300014325 Ga0163163_10190423 Ga0163163_101904232 481
240 3300017792 Ga0163161_10001335 Ga0163161_100013354 481
241 3300024227 Ga0228598_1001227 Ga0228598_10012275 481
242 3300025254 Ga0209148_1000056 Ga0209148_1000056211 481
243 3300025271 Ga0207666_1000644 Ga0207666_10006444 481
244 3300025272 Ga0209455_1000137 Ga0209455_1000137106 481
245 3300025294 Ga0209025_1008274 Ga0209025_10082745 481
246 3300025295 Ga0209564_1000105 Ga0209564_1000105175 481
247 3300025297 Ga0209758_1000252 Ga0209758_100025232 481
248 3300025299 Ga0209256_1001169 Ga0209256_100116919 481
249 3300025898 Ga0207692_10001696 Ga0207692_100016966 481
250 3300025900 Ga0207710_10026401 Ga0207710_100264011 481
251 3300025901 Ga0207688_10000048 Ga0207688_1000004813 481
252 3300025905 Ga0207685_10012838 Ga0207685_100128382 481
253 3300025906 Ga0207699_10009706 Ga0207699_100097063 481
254 3300025907 Ga0207645_10020944 Ga0207645_100209442 481
255 3300025908 Ga0207643_10000346 Ga0207643_1000034626 481
256 3300025910 Ga0207684_10087178 Ga0207684_100871781 481
257 3300025912 Ga0207707_10025116 Ga0207707_100251161 481
258 3300025915 Ga0207693_10001587 Ga0207693_100015878 481
259 3300025915 Ga0207693_10003499 Ga0207693_1000349912 481
260 3300025915 Ga0207693_10046003 Ga0207693_100460033 481
261 3300025915 Ga0207693_10098791 Ga0207693_100987912 481
262 3300025916 Ga0207663_10031224 Ga0207663_100312243 481
263 3300025917 Ga0207660_10008226 Ga0207660_100082265 481
264 3300025919 Ga0207657_10009143 Ga0207657_100091433 481
265 3300025920 Ga0207649_10062341 Ga0207649_100623412 481
266 3300025933 Ga0207706_10000951 Ga0207706_100009512 481
267 3300025934 Ga0207686_10023025 Ga0207686_100230252 481
268 3300025936 Ga0207670_10081227 Ga0207670_100812272 481
269 3300025936 Ga0207670_10108281 Ga0207670_101082812 481
270 3300025938 Ga0207704_10007096 Ga0207704_100070962 481
271 3300025939 Ga0207665_10001084 Ga0207665_1000108410 481
272 3300025939 Ga0207665_10011367 Ga0207665_100113673 481
273 3300025939 Ga0207665_10026616 Ga0207665_100266162 481
274 3300025940 Ga0207691_10003613 Ga0207691_100036133 481
275 3300025940 Ga0207691_10008185 Ga0207691_100081854 481
276 3300025941 Ga0207711_10026899 Ga0207711_100268991 481
277 3300025942 Ga0207689_10065278 Ga0207689_100652782 481
278 3300025942 Ga0207689_10076813 Ga0207689_100768132 481
279 3300025949 Ga0207667_10052291 Ga0207667_100522914 481
280 3300025960 Ga0207651_10003606 Ga0207651_100036061 481
281 3300025961 Ga0207712_10030107 Ga0207712_100301073 481
282 3300025972 Ga0207668_10006162 Ga0207668_100061625 481
283 3300025986 Ga0207658_10083663 Ga0207658_100836632 481
284 3300026023 Ga0207677_10005714 Ga0207677_100057144 481
285 3300026035 Ga0207703_10067766 Ga0207703_100677662 481
286 3300026035 Ga0207703_10091434 Ga0207703_100914342 481
287 3300026041 Ga0207639_10038463 Ga0207639_100384631 481
288 3300026075 Ga0207708_10002506 Ga0207708_1000250611 481
289 3300026088 Ga0207641_10021715 Ga0207641_100217154 481
290 3300026088 Ga0207641_10115154 Ga0207641_101151542 481
291 3300026089 Ga0207648_10002240 Ga0207648_100022409 481
292 3300026118 Ga0207675_100000754 Ga0207675_1000007543 481
293 3300026121 Ga0207683_10032644 Ga0207683_100326442 481
294 3300026142 Ga0207698_10012607 Ga0207698_100126073 481
295 3300027695 Ga0209966_1001446 Ga0209966_10014463 481
296 3300027717 Ga0209998_10002379 Ga0209998_100023794 481
297 3300027876 Ga0209974_10001664 Ga0209974_100016646 481
298 3300027907 Ga0207428_10030348 Ga0207428_100303484 481
299 3300028023 Ga0265357_1000090 Ga0265357_10000903 481
300 3300028379 Ga0268266_10004591 Ga0268266_1000459110 481
301 3300028380 Ga0268265_10003775 Ga0268265_100037756 481
302 3300028380 Ga0268265_10021856 Ga0268265_100218563 481
303 3300028381 Ga0268264_10015184 Ga0268264_100151843 481
304 3300028381 Ga0268264_10052244 Ga0268264_100522442 481
305 3300031235 Ga0265330_10059384 Ga0265330_100593841 481
306 3300031240 Ga0265320_10005692 Ga0265320_100056923 481
307 3300031242 Ga0265329_10023582 Ga0265329_100235821 481
308 3300031247 Ga0265340_10034720 Ga0265340_100347202 481
309 3300031249 Ga0265339_10000465 Ga0265339_100004652 481
310 3300031249 Ga0265339_10004124 Ga0265339_100041247 481
311 3300031250 Ga0265331_10030513 Ga0265331_100305132 481
312 3300031344 Ga0265316_10041823 Ga0265316_100418233 481
313 3300031344 Ga0265316_10096847 Ga0265316_100968472 481
314 3300031548 Ga0307408_100005051 Ga0307408_1000050518 481
315 3300031595 Ga0265313_10000006 Ga0265313_10000006159 481
316 3300031595 Ga0265313_10000183 Ga0265313_1000018338 481
317 3300031595 Ga0265313_10020752 Ga0265313_100207523 481
318 3300031616 Ga0307508_10108470 Ga0307508_101084702 481
319 3300031728 Ga0316578_10077353 Ga0316578_100773532 481
320 3300031731 Ga0307405_10008142 Ga0307405_100081423 481
321 3300031824 Ga0307413_10001109 Ga0307413_100011097 481
322 3300031824 Ga0307413_10003892 Ga0307413_100038925 481
323 3300031824 Ga0307413_10017918 Ga0307413_100179183 481
324 3300031852 Ga0307410_10012417 Ga0307410_100124173 481
325 3300031852 Ga0307410_10058901 Ga0307410_100589013 481
326 3300031901 Ga0307406_10005891 Ga0307406_100058914 481
327 3300031901 Ga0307406_10011121 Ga0307406_100111214 481
328 3300031911 Ga0307412_10022884 Ga0307412_100228843 481
329 3300031995 Ga0307409_100010810 Ga0307409_1000108103 481
330 3300031995 Ga0307409_100055481 Ga0307409_1000554813 481
331 3300031995 Ga0307409_100107322 Ga0307409_1001073222 481
332 3300032002 Ga0307416_100013083 Ga0307416_1000130833 481
333 3300032002 Ga0307416_100095063 Ga0307416_1000950632 481
334 3300032004 Ga0307414_10151623 Ga0307414_101516232 481
335 3300032005 Ga0307411_10078736 Ga0307411_100787362 481
336 3300032126 Ga0307415_100008661 Ga0307415_1000086615 481
337 3300032126 Ga0307415_100012704 Ga0307415_1000127043 481
338 3300034817 Ga0373948_0001629 Ga0373948_0001629_1396_2880 481
339 3300035207 Ga0373942_0010875 Ga0373942_0010875_433_1890 481
340 3300037466 Ga0395898_0052883 Ga0395898_0052883_1897_3369 481
341 3300044694 Ga0466963_0049857 Ga0466963_0049857_695_2158 481
342 3300046476 Ga0495662_0022270 Ga0495662_0022270_787_2325 481
343 3300048905 Ga0496102_0093611 Ga0496102_0093611_697_2169 481
344 3300048905 Ga0496102_0241256 Ga0496102_0241256_143_1603 481
345 3300048907 Ga0496104_0002150 Ga0496104_0002150_3987_5459 481
346 3300048907 Ga0496104_0067851 Ga0496104_0067851_489_1973 481
347 3300048909 Ga0496106_0036330 Ga0496106_0036330_1570_3042 481
348 3300048909 Ga0496106_0083220 Ga0496106_0083220_546_2009 481
349 3300048910 Ga0496107_0015391 Ga0496107_0015391_1495_2940 481
350 3300048911 Ga0496108_0012933 Ga0496108_0012933_3475_5022 481
351 3300048911 Ga0496108_0074706 Ga0496108_0074706_704_2188 481
352 3300048912 Ga0496109_0036224 Ga0496109_0036224_1250_2797 481
353 3300048913 Ga0496110_0034920 Ga0496110_0034920_1548_3095 481
354 3300048913 Ga0496110_0067559 Ga0496110_0067559_350_1822 481
355 3300048914 Ga0496111_0001290 Ga0496111_0001290_1561_3108 481
356 3300048914 Ga0496111_0122061 Ga0496111_0122061_224_1708 481
357 3300048915 Ga0496112_0004530 Ga0496112_0004530_3607_5070 481
358 3300048915 Ga0496112_0013270 Ga0496112_0013270_786_2333 481
359 3300048915 Ga0496112_0048327 Ga0496112_0048327_1591_3075 481
360 3300048916 Ga0496113_0000443 Ga0496113_0000443_3278_4762 481
361 3300048916 Ga0496113_0000672 Ga0496113_0000672_7433_8980 481
362 3300048917 Ga0496114_0012266 Ga0496114_0012266_868_2313 481
363 3300048925 Ga0496122_0025938 Ga0496122_0025938_1260_2732 481
364 3300049568 Ga0501031_0000001 Ga0501031_0000001_117453_118922 481
365 3300049568 Ga0501031_0001643 Ga0501031_0001643_8973_10442 481
366 3300049569 Ga0501032_0000003 Ga0501032_0000003_117462_118931 481
367 3300049569 Ga0501032_0000025 Ga0501032_0000025_85090_86559 481
368 3300049570 Ga0501033_0000150 Ga0501033_0000150_63354_64823 481
369 3300049570 Ga0501033_0000229 Ga0501033_0000229_34530_35999 481
370 3300049571 Ga0501034_0000005 Ga0501034_0000005_117462_118931 481
371 3300049571 Ga0501034_0001654 Ga0501034_0001654_2424_3893 481
372 3300049571 Ga0501034_0079102 Ga0501034_0079102_47_1501 481
373 3300049571 Ga0501034_0199049 Ga0501034_0199049_476_1930 481
374 3300049572 Ga0501036_0000018 Ga0501036_0000018_117462_118931 481
375 3300049572 Ga0501036_0000151 Ga0501036_0000151_16057_17526 481
376 3300049573 Ga0501037_0000005 Ga0501037_0000005_117453_118922 481
377 3300049573 Ga0501037_0000176 Ga0501037_0000176_12814_14283 481
378 3300049574 Ga0501038_0000001 Ga0501038_0000001_117462_118931 481
379 3300049574 Ga0501038_0000046 Ga0501038_0000046_89053_90522 481
380 3300049575 Ga0501039_0000003 Ga0501039_0000003_79563_81032 481
381 3300049575 Ga0501039_0000015 Ga0501039_0000015_100540_102009 481
382 3300049576 Ga0501040_0002109 Ga0501040_0002109_2235_3704 481
383 3300049579 Ga0501043_0000051 Ga0501043_0000051_34528_35997 481
384 3300049579 Ga0501043_0000436 Ga0501043_0000436_16598_18067 481
385 3300049580 Ga0501046_0023691 Ga0501046_0023691_2503_3972 481
386 3300049581 Ga0501047_0001638 Ga0501047_0001638_18141_19610 481
387 3300049584 Ga0501068_0010554 Ga0501068_0010554_54_1508 481
388 3300049593 Ga0501077_0023964 Ga0501077_0023964_2288_3772 481
389 3300049822 Ga0501035_0000008 Ga0501035_0000008_63341_64810 481
390 3300049822 Ga0501035_0000102 Ga0501035_0000102_70959_72428 481
391 3300049823 Ga0501044_0000001 Ga0501044_0000001_299157_300626 481
392 3300049823 Ga0501044_0059282 Ga0501044_0059282_1140_2609 481
393 3300050507 nmdc:mga05p37_126394_c1 nmdc:mga05p37_126394_c1_859_2331 481
394 3300050510 nmdc:mga06r32_140423_c1 nmdc:mga06r32_140423_c1_175_1722 481
395 3300050510 nmdc:mga06r32_8046_c1 nmdc:mga06r32_8046_c1_921_2393 481
396 3300050510 nmdc:mga06r32_91033_c1 nmdc:mga06r32_91033_c1_237_1718 481
397 3300050512 nmdc:mga0n895_64835_c1 nmdc:mga0n895_64835_c1_752_2224 481
398 3300050514 nmdc:mga08x19_64247_c1 nmdc:mga08x19_64247_c1_322_1794 481
399 3300050515 nmdc:mga0a205_96113_c2 nmdc:mga0a205_96113_c2_229_1701 481
400 3300053087 Ga0500643_008247 Ga0500643_008247_2613_4076 481
401 3300053093 Ga0500651_0006447 Ga0500651_0006447_2199_3680 481
402 3300053119 Ga0500595_000002 Ga0500595_000002_412712_414193 481
403 3300053139 Ga0500568_0000108 Ga0500568_0000108_59252_60721 481
404 3300053153 Ga0500616_0000002 Ga0500616_0000002_486890_488371 481
405 3300053730 Ga0500645_001945 Ga0500645_001945_821_2302 481
406 iso_pu_bacteria 2508501123 2509116076 481
407 iso_pu_bacteria 2508501127 2509141488 481
408 iso_pu_bacteria 2509276018 2509371852 481
409 iso_pu_bacteria 2509276022 2509397745 481
410 iso_pu_bacteria 2510065059 2510319004 481
411 iso_pu_bacteria 2512875016 2512929794 481
412 iso_pu_bacteria 2512875024 2512964567 481
413 iso_pu_bacteria 2513237090 2513609060 481
414 iso_pu_bacteria 2513237164 2514033319 481
415 iso_pu_bacteria 2513237305 2514420464 481
416 iso_pu_bacteria 2513237351 2514588197 481
417 iso_pu_bacteria 2588253730 2588515383 481
418 iso_pu_bacteria 2597489875 2597815034 481
419 iso_pu_bacteria 2643221550 2643770170 481
420 iso_pu_bacteria 2643221551 2643774915 481
421 iso_pu_bacteria 2643221555 2643793359 481
422 iso_pu_bacteria 2643221560 2643821410 481
423 iso_pu_bacteria 2643221563 2643836005 481
424 iso_pu_bacteria 2643221595 2643985360 481
425 iso_pu_bacteria 2643221608 2644056930 481
426 iso_pu_bacteria 2643221627 2644155004 481
427 iso_pu_bacteria 2687453392 2688600152 481
428 iso_pu_bacteria 2693429783 2694633700 481
429 iso_pu_bacteria 2693429784 2694639960 481
430 iso_pu_bacteria 2721755686 2723577431 481
431 iso_pu_bacteria 2751185897 2753763746 481
432 iso_pu_bacteria 2756170246 2756673282 481
433 iso_pu_bacteria 2791355123 2792749135 481
434 iso_pu_bacteria 2830075706 2830076611 481
435 iso_pu_bacteria 2841734538 2841741143 481
436 iso_pu_bacteria 2844002411 2844005743 481
437 iso_pu_bacteria 2844009547 2844015468 481
438 iso_pu_bacteria 2847670302 2847671835 481
439 iso_pu_bacteria 2847686936 2847688064 481
440 iso_pu_bacteria 2852653556 2852655528 481
441 iso_pu_bacteria 2852680915 2852681040 481
442 iso_pu_bacteria 2856314179 2856318435 481
443 iso_pu_bacteria 2856320880 2856324389 481
444 iso_pu_bacteria 2856328259 2856333407 481
445 iso_pu_bacteria 2856334872 2856340986 481
446 iso_pu_bacteria 2856342000 2856345475 481
447 iso_pu_bacteria 2856349417 2856352023 481
448 iso_pu_bacteria 2856364286 2856364635 481
449 iso_pu_bacteria 2857349434 2857355074 481
450 iso_pu_bacteria 2857367948 2857373273 481
451 iso_pu_bacteria 2869162929 2869165033 481
452 iso_pu_bacteria 2869234852 2869237399 481
453 iso_pu_bacteria 2869242130 2869243651 481
454 iso_pu_bacteria 2869249662 2869251371 481
455 iso_pu_bacteria 2869256925 2869263955 481
456 iso_pu_bacteria 2869264136 2869265124 481
457 iso_pu_bacteria 2869271264 2869276533 481
458 iso_pu_bacteria 2869278585 2869281613 481
459 iso_pu_bacteria 2869285874 2869292692 481
460 iso_pu_bacteria 2871429161 2871429505 481
461 iso_pu_bacteria 2871444079 2871446948 481
462 iso_pu_bacteria 2871451962 2871458364 481
463 iso_pu_bacteria 2871459585 2871462191 481
464 iso_pu_bacteria 2871466892 2871470182 481
465 iso_pu_bacteria 2871474448 2871476515 481
466 iso_pu_bacteria 2871481445 2871482641 481
467 iso_pu_bacteria 2871488783 2871493954 481
468 iso_pu_bacteria 2871495908 2871498467 481
469 iso_pu_bacteria 2874102143 2874107060 481
470 iso_pu_bacteria 2874109183 2874115114 481
471 iso_pu_bacteria 2874116593 2874116612 481
472 iso_pu_bacteria 2874123672 2874127592 481
473 iso_pu_bacteria 2874131515 2874136953 481
474 iso_pu_bacteria 2874139085 2874140723 481
475 iso_pu_bacteria 2874146452 2874146967 481
476 iso_pu_bacteria 2874155637 2874157052 481
477 iso_pu_bacteria 2874162495 2874163489 481
478 iso_pu_bacteria 2874168670 2874175432 481
479 iso_pu_bacteria 2876363079 2876366643 481
480 iso_pu_bacteria 2876377896 2876383568 481
481 iso_pu_bacteria 2876386047 2876386744 481
482 iso_pu_bacteria 2876392853 2876399459 481
483 iso_pu_bacteria 2876399893 2876400048 481
484 iso_pu_bacteria 2876406927 2876409759 481
485 iso_pu_bacteria 2876413966 2876414491 481
486 iso_pu_bacteria 2876420981 2876422388 481
487 iso_pu_bacteria 2878035449 2878037771 481
488 iso_pu_bacteria 2878730984 2878737893 481
489 iso_pu_bacteria 2878738818 2878742504 481
490 iso_pu_bacteria 2878745973 2878746323 481
491 iso_pu_bacteria 2878753008 2878756530 481
492 iso_pu_bacteria 2878760144 2878762686 481
493 iso_pu_bacteria 2878767105 2878769652 481
494 iso_pu_bacteria 2878774303 2878776632 481
495 iso_pu_bacteria 2878781027 2878785320 481
496 iso_pu_bacteria 2878788777 2878795278 481
497 iso_pu_bacteria 2881147464 2881153674 481
498 iso_pu_bacteria 2881155292 2881157472 481
499 iso_pu_bacteria 2881161766 2881162828 481
500 iso_pu_bacteria 2881845957 2881847786 481
501 iso_pu_bacteria 2881861095 2881863726 481
502 iso_pu_bacteria 2882632389 2882634399 481
503 iso_pu_bacteria 2882912400 2882915343 481
504 iso_pu_bacteria 2883291878 2883293451 481
505 iso_pu_bacteria 2883354860 2883357967 481
506 iso_pu_bacteria 2885305155 2885311585 481
507 iso_pu_bacteria 2885312484 2885316377 481
508 iso_pu_bacteria 2885318864 2885324504 481
509 iso_pu_bacteria 2885326080 2885330578 481
510 iso_pu_bacteria 2885334103 2885340287 481
511 iso_pu_bacteria 2885342637 2885344513 481
512 iso_pu_bacteria 2885350715 2885355718 481
513 iso_pu_bacteria 2888337043 2888341327 481
514 iso_pu_bacteria 2888343758 2888348508 481
515 iso_pu_bacteria 2888350351 2888350656 481
516 iso_pu_bacteria 2889010040 2889012992 481
517 iso_pu_bacteria 2889016732 2889022143 481
518 iso_pu_bacteria 2903448605 2903452819 481
519 iso_pu_bacteria 2903492973 2903502542 481
520 iso_pu_bacteria 2903492973 2903505661 481
521 iso_pu_bacteria 2903521522 2903524510 481
522 iso_pu_bacteria 2903528002 2903530141 481
523 iso_pu_bacteria 2903540706 2903543265 481
524 iso_pu_bacteria 2904659560 2904665986 481
525 iso_pu_bacteria 2906308376 2906308404 481
526 iso_pu_bacteria 2906321335 2906322004 481
527 iso_pu_bacteria 2906328253 2906331231 481
528 iso_pu_bacteria 2906354277 2906360148 481
529 iso_pu_bacteria 2906363423 2906369205 481
530 iso_pu_bacteria 2906370794 2906374104 481
531 iso_pu_bacteria 2906378014 2906381814 481
532 iso_pu_bacteria 2906386501 2906391528 481
533 iso_pu_bacteria 2906401398 2906407883 481
534 iso_pu_bacteria 2906408224 2906408308 481
535 iso_pu_bacteria 2906414383 2906418472 481
536 iso_pu_bacteria 2906427513 2906434108 481
537 iso_pu_bacteria 2922130491 2922138894 481
538 iso_pu_bacteria 2922158528 2922160385 481
539 iso_pu_bacteria 2922172374 2922176894 481
540 iso_pu_bacteria 2922178524 2922183478 481
541 iso_pu_bacteria 2922185730 2922187102 481
542 iso_pu_bacteria 2924726620 2924732851 481
543 iso_pu_bacteria 2924733363 2924735408 481
544 iso_pu_bacteria 2924762789 2924764609 481
545 iso_pu_bacteria 2924776078 2924780304 481
546 iso_pu_bacteria 2924784321 2924788115 481
547 iso_pu_bacteria 2937813078 2937814384 481
548 iso_pu_bacteria 2937822353 2937829261 481
549 iso_pu_bacteria 2937836603 2937840522 481
550 iso_pu_bacteria 2937848649 2937852427 481
551 iso_pu_bacteria 2937877337 2937882826 481
552 iso_pu_bacteria 2937972304 2937973201 481
553 iso_pu_bacteria 2937994558 2937997114 481
554 iso_pu_bacteria 2938014810 2938019208 481
555 iso_pu_bacteria 2946787523 2946788756 481
556 iso_pu_bacteria 2958034702 2958037574 481
557 iso_pu_bacteria 2958041894 2958047285 481
558 iso_pu_bacteria 2958064165 2958065952 481
559 iso_pu_bacteria 2958071322 2958071356 481
560 iso_pu_bacteria 2958084443 2958089951 481
561 iso_pu_bacteria 2958092219 2958092501 481
562 iso_pu_bacteria 2958122699 2958126428 481
563 iso_pu_bacteria 2958130278 2958137415 481
564 iso_pu_bacteria 2958137437 2958140448 481
565 iso_pu_bacteria 2958144490 2958146532 481
566 iso_pu_bacteria 2958165035 2958167584 481
567 iso_pu_bacteria 2958179912 2958180208 481
568 iso_pu_bacteria 2961077736 2961078040 481
569 iso_pu_bacteria 2961163497 2961166056 481
570 iso_pu_bacteria 2961170736 2961172819 481
571 iso_pu_bacteria 2963644680 2963649437 481
572 iso_pu_bacteria 2965018300 2965020875 481
573 iso_pu_bacteria 2965025482 2965030679 481
574 iso_pu_bacteria 2965040258 2965041707 481
575 iso_pu_bacteria 2965047637 2965053976 481
576 iso_pu_bacteria 2965089291 2965094151 481
577 iso_pu_bacteria 2967996073 2967998030 481
578 iso_pu_bacteria 2968003550 2968008682 481
579 iso_pu_bacteria 2968016561 2968019592 481
580 iso_pu_bacteria 2968083720 2968084600 481
581 iso_pu_bacteria 2968091066 2968096886 481
582 iso_pu_bacteria 2968117919 2968118326 481
583 iso_pu_bacteria 2968171901 2968174453 481
584 iso_pu_bacteria 2970469710 2970472913 481
585 iso_pu_bacteria 2970489779 2970493527 481
586 iso_pu_bacteria 2970503327 2970505413 481
587 iso_pu_bacteria 2970510686 2970512490 481
588 iso_pu_bacteria 2970524798 2970529688 481
589 iso_pu_bacteria 2970554993 2970557544 481
590 iso_pu_bacteria 2970593180 2970596216 481
591 iso_pu_bacteria 2977821940 2977825710 481
592 iso_pu_bacteria 2977828996 2977831379 481
593 iso_pu_bacteria 2977843712 2977844838 481
594 iso_pu_bacteria 2977858184 2977863265 481
595 iso_pu_bacteria 2977864932 2977869542 481
596 iso_pu_bacteria 2977872689 2977873149 481
597 iso_pu_bacteria 2977915119 2977918493 481
598 iso_pu_bacteria 2977922695 2977927247 481
599 iso_pu_bacteria 2977935797 2977936986 481
600 iso_pu_bacteria 2977942078 2977943866 481
601 iso_pu_bacteria 2977950692 2977954397 481
602 iso_pu_bacteria 2977957713 2977960876 481
603 iso_pu_bacteria 2977971508 2977977440 481
604 iso_pu_bacteria 2977986579 2977993117 481
605 iso_pu_bacteria 2979808191 2979810134 481
606 iso_pu_bacteria 2987659509 2987662063 481
607 iso_pu_bacteria 2987666974 2987667413 481
608 iso_pu_bacteria 2996310559 2996313301 481
609 iso_pu_bacteria 2996348954 2996351967 481
610 iso_pu_bacteria 2996386984 2996392930 481
611 iso_pu_bacteria 3000135777 3000141873 481
612 iso_pu_bacteria 3004167301 3004170924 481
613 iso_pu_bacteria 3004188549 3004191114 481
614 iso_pu_bacteria 3004195979 3004202764 481
615 iso_pu_bacteria 3004211236 3004214622 481
616 iso_pu_bacteria 3004218560 3004219304 481
617 iso_pu_bacteria 3004232784 3004237604 481
618 iso_pu_bacteria 3004239961 3004245074 481
619 iso_pu_bacteria 3004268573 3004273540 481
620 iso_pu_bacteria 3004275668 3004278665 481
621 iso_pu_bacteria 3004334049 3004339379 481
622 iso_pu_bacteria 649633066 649874628 481
623 iso_pu_bacteria 8004361976 8004362627 481
624 iso_pu_bacteria 8004374579 8004378118 481
625 iso_pu_bacteria 8004387939 8004388488 481
626 iso_pu_bacteria 8004633249 8004633368 481
627 iso_pu_bacteria 8004640170 8004641787 481
628 iso_pu_bacteria 8004714634 8004714660 481
629 iso_pu_bacteria 8055617313 8055622722 481
630 iso_pu_bacteria 8057101203 8057105740 481
631 3300001904 JGI24736J21556_1000338 JGI24736J21556_10003386 482
632 3300001915 JGI24741J21665_1009272 JGI24741J21665_10092722 482
633 3300001979 JGI24740J21852_10001128 JGI24740J21852_1000112810 482
634 3300001979 JGI24740J21852_10005359 JGI24740J21852_100053593 482
635 3300001979 JGI24740J21852_10007731 JGI24740J21852_100077313 482
636 3300001979 JGI24740J21852_10013503 JGI24740J21852_100135031 482
637 3300001989 JGI24739J22299_10011579 JGI24739J22299_100115791 482
638 3300001989 JGI24739J22299_10024353 JGI24739J22299_100243531 482
639 3300001990 JGI24737J22298_10002933 JGI24737J22298_100029336 482
640 3300001990 JGI24737J22298_10011968 JGI24737J22298_100119681 482
641 3300001990 JGI24737J22298_10023118 JGI24737J22298_100231182 482
642 3300002067 JGI24735J21928_10013532 JGI24735J21928_100135322 482
643 3300002075 JGI24738J21930_10001952 JGI24738J21930_100019523 482
644 3300005290 Ga0065712_10075642 Ga0065712_100756423 482
645 3300005327 Ga0070658_10000305 Ga0070658_1000030516 482
646 3300005327 Ga0070658_10000379 Ga0070658_1000037917 482
647 3300005327 Ga0070658_10000850 Ga0070658_1000085020 482
648 3300005327 Ga0070658_10014485 Ga0070658_100144853 482
649 3300005327 Ga0070658_10051304 Ga0070658_100513043 482
650 3300005327 Ga0070658_10053035 Ga0070658_100530351 482
651 3300005327 Ga0070658_10113895 Ga0070658_101138952 482
652 3300005327 Ga0070658_10115961 Ga0070658_101159612 482
653 3300005328 Ga0070676_10000684 Ga0070676_100006845 482
654 3300005328 Ga0070676_10016127 Ga0070676_100161272 482
655 3300005329 Ga0070683_100000872 Ga0070683_1000008729 482
656 3300005329 Ga0070683_100001218 Ga0070683_1000012183 482
657 3300005329 Ga0070683_100005194 Ga0070683_1000051944 482
658 3300005329 Ga0070683_100019193 Ga0070683_1000191935 482
659 3300005329 Ga0070683_100090141 Ga0070683_1000901412 482
660 3300005330 Ga0070690_100018174 Ga0070690_1000181743 482
661 3300005331 Ga0070670_100000943 Ga0070670_1000009432 482
662 3300005331 Ga0070670_100002485 Ga0070670_1000024853 482
663 3300005331 Ga0070670_100004196 Ga0070670_10000419611 482
664 3300005331 Ga0070670_100131295 Ga0070670_1001312952 482
665 3300005333 Ga0070677_10003195 Ga0070677_100031954 482
666 3300005334 Ga0068869_100014247 Ga0068869_1000142474 482
667 3300005334 Ga0068869_100177760 Ga0068869_1001777601 482
668 3300005335 Ga0070666_10000788 Ga0070666_1000078817 482
669 3300005335 Ga0070666_10003797 Ga0070666_100037973 482
670 3300005335 Ga0070666_10025876 Ga0070666_100258763 482
671 3300005336 Ga0070680_100000600 Ga0070680_1000006008 482
672 3300005336 Ga0070680_100004470 Ga0070680_1000044706 482
673 3300005336 Ga0070680_100004642 Ga0070680_1000046428 482
674 3300005336 Ga0070680_100008845 Ga0070680_1000088455 482
675 3300005336 Ga0070680_100010643 Ga0070680_1000106437 482
676 3300005336 Ga0070680_100071155 Ga0070680_1000711553 482
677 3300005336 Ga0070680_100120398 Ga0070680_1001203981 482
678 3300005337 Ga0070682_100010648 Ga0070682_1000106486 482
679 3300005337 Ga0070682_100030569 Ga0070682_1000305692 482
680 3300005338 Ga0068868_100000211 Ga0068868_10000021138 482
681 3300005338 Ga0068868_100011949 Ga0068868_1000119493 482
682 3300005339 Ga0070660_100000129 Ga0070660_10000012922 482
683 3300005339 Ga0070660_100001859 Ga0070660_1000018597 482
684 3300005339 Ga0070660_100002066 Ga0070660_1000020667 482
685 3300005339 Ga0070660_100005957 Ga0070660_1000059573 482
686 3300005339 Ga0070660_100014573 Ga0070660_1000145733 482
687 3300005339 Ga0070660_100019096 Ga0070660_1000190963 482
688 3300005339 Ga0070660_100028562 Ga0070660_1000285623 482
689 3300005339 Ga0070660_100031328 Ga0070660_1000313282 482
690 3300005339 Ga0070660_100033386 Ga0070660_1000333862 482
691 3300005339 Ga0070660_100040066 Ga0070660_1000400663 482
692 3300005339 Ga0070660_100048163 Ga0070660_1000481633 482
693 3300005339 Ga0070660_100096948 Ga0070660_1000969482 482
694 3300005339 Ga0070660_100154036 Ga0070660_1001540361 482
695 3300005340 Ga0070689_100059567 Ga0070689_1000595673 482
696 3300005340 Ga0070689_100125604 Ga0070689_1001256042 482
697 3300005341 Ga0070691_10005745 Ga0070691_100057454 482
698 3300005344 Ga0070661_100000033 Ga0070661_10000003392 482
699 3300005344 Ga0070661_100002017 Ga0070661_1000020176 482
700 3300005344 Ga0070661_100004224 Ga0070661_1000042246 482
701 3300005344 Ga0070661_100018362 Ga0070661_1000183623 482
702 3300005344 Ga0070661_100024993 Ga0070661_1000249933 482
703 3300005344 Ga0070661_100132468 Ga0070661_1001324682 482
704 3300005345 Ga0070692_10013735 Ga0070692_100137353 482
705 3300005347 Ga0070668_100002657 Ga0070668_1000026572 482
706 3300005347 Ga0070668_100012835 Ga0070668_1000128353 482
707 3300005353 Ga0070669_100002555 Ga0070669_1000025552 482
708 3300005353 Ga0070669_100036391 Ga0070669_1000363911 482
709 3300005354 Ga0070675_100002924 Ga0070675_1000029245 482
710 3300005354 Ga0070675_100003598 Ga0070675_1000035982 482
711 3300005354 Ga0070675_100017003 Ga0070675_1000170033 482
712 3300005355 Ga0070671_100000752 Ga0070671_1000007523 482
713 3300005355 Ga0070671_100001276 Ga0070671_1000012769 482
714 3300005355 Ga0070671_100001537 Ga0070671_1000015374 482
715 3300005355 Ga0070671_100001615 Ga0070671_1000016153 482
716 3300005355 Ga0070671_100001659 Ga0070671_10000165911 482
717 3300005355 Ga0070671_100003305 Ga0070671_1000033058 482
718 3300005355 Ga0070671_100005392 Ga0070671_1000053925 482
719 3300005355 Ga0070671_100012222 Ga0070671_1000122223 482
720 3300005355 Ga0070671_100014111 Ga0070671_1000141114 482
721 3300005355 Ga0070671_100045632 Ga0070671_1000456323 482
722 3300005356 Ga0070674_100015430 Ga0070674_1000154302 482
723 3300005356 Ga0070674_100105869 Ga0070674_1001058692 482
724 3300005364 Ga0070673_100002363 Ga0070673_1000023632 482
725 3300005364 Ga0070673_100044036 Ga0070673_1000440362 482
726 3300005364 Ga0070673_100111879 Ga0070673_1001118792 482
727 3300005364 Ga0070673_100157431 Ga0070673_1001574311 482
728 3300005364 Ga0070673_100189082 Ga0070673_1001890821 482
729 3300005366 Ga0070659_100000142 Ga0070659_10000014220 482
730 3300005366 Ga0070659_100005145 Ga0070659_1000051453 482
731 3300005366 Ga0070659_100009365 Ga0070659_1000093652 482
732 3300005366 Ga0070659_100010150 Ga0070659_1000101503 482
733 3300005366 Ga0070659_100012774 Ga0070659_1000127743 482
734 3300005366 Ga0070659_100024936 Ga0070659_1000249365 482
735 3300005366 Ga0070659_100031664 Ga0070659_1000316643 482
736 3300005366 Ga0070659_100040883 Ga0070659_1000408834 482
737 3300005366 Ga0070659_100057384 Ga0070659_1000573842 482
738 3300005366 Ga0070659_100078933 Ga0070659_1000789331 482
739 3300005366 Ga0070659_100087077 Ga0070659_1000870772 482
740 3300005366 Ga0070659_100152871 Ga0070659_1001528711 482
741 3300005367 Ga0070667_100000368 Ga0070667_10000036825 482
742 3300005367 Ga0070667_100001727 Ga0070667_1000017271 482
743 3300005367 Ga0070667_100002988 Ga0070667_1000029888 482
744 3300005367 Ga0070667_100005056 Ga0070667_1000050564 482
745 3300005367 Ga0070667_100006137 Ga0070667_1000061372 482
746 3300005367 Ga0070667_100013924 Ga0070667_1000139244 482
747 3300005367 Ga0070667_100028536 Ga0070667_1000285363 482
748 3300005367 Ga0070667_100073314 Ga0070667_1000733142 482
749 3300005367 Ga0070667_100090631 Ga0070667_1000906313 482
750 3300005435 Ga0070714_100073499 Ga0070714_1000734992 482
751 3300005435 Ga0070714_100109792 Ga0070714_1001097922 482
752 3300005436 Ga0070713_100014792 Ga0070713_1000147923 482
753 3300005455 Ga0070663_100002670 Ga0070663_1000026703 482
754 3300005455 Ga0070663_100005172 Ga0070663_1000051722 482
755 3300005455 Ga0070663_100005966 Ga0070663_1000059665 482
756 3300005455 Ga0070663_100016951 Ga0070663_1000169512 482
757 3300005455 Ga0070663_100096565 Ga0070663_1000965652 482
758 3300005456 Ga0070678_100002723 Ga0070678_1000027234 482
759 3300005457 Ga0070662_100000021 Ga0070662_10000002147 482
760 3300005457 Ga0070662_100003529 Ga0070662_1000035294 482
761 3300005457 Ga0070662_100009507 Ga0070662_1000095073 482
762 3300005457 Ga0070662_100012137 Ga0070662_1000121375 482
763 3300005457 Ga0070662_100017938 Ga0070662_1000179383 482
764 3300005457 Ga0070662_100020888 Ga0070662_1000208882 482
765 3300005457 Ga0070662_100032534 Ga0070662_1000325343 482
766 3300005458 Ga0070681_10016990 Ga0070681_100169908 482
767 3300005458 Ga0070681_10041495 Ga0070681_100414953 482
768 3300005458 Ga0070681_10054387 Ga0070681_100543871 482
769 3300005458 Ga0070681_10080191 Ga0070681_100801912 482
770 3300005459 Ga0068867_100002865 Ga0068867_1000028652 482
771 3300005459 Ga0068867_100013035 Ga0068867_1000130357 482
772 3300005459 Ga0068867_100037400 Ga0068867_1000374002 482
773 3300005467 Ga0070706_100044073 Ga0070706_1000440733 482
774 3300005467 Ga0070706_100072698 Ga0070706_1000726982 482
775 3300005471 Ga0070698_100003229 Ga0070698_10000322912 482
776 3300005530 Ga0070679_100035868 Ga0070679_1000358683 482
777 3300005530 Ga0070679_100115263 Ga0070679_1001152632 482
778 3300005535 Ga0070684_100003221 Ga0070684_1000032213 482
779 3300005535 Ga0070684_100009141 Ga0070684_1000091417 482
780 3300005535 Ga0070684_100040425 Ga0070684_1000404253 482
781 3300005539 Ga0068853_100000377 Ga0068853_10000037732 482
782 3300005539 Ga0068853_100019914 Ga0068853_1000199143 482
783 3300005539 Ga0068853_100066697 Ga0068853_1000666972 482
784 3300005539 Ga0068853_100171074 Ga0068853_1001710741 482
785 3300005543 Ga0070672_100001912 Ga0070672_10000191210 482
786 3300005543 Ga0070672_100045817 Ga0070672_1000458173 482
787 3300005543 Ga0070672_100087536 Ga0070672_1000875363 482
788 3300005544 Ga0070686_100007369 Ga0070686_1000073691 482
789 3300005545 Ga0070695_100042561 Ga0070695_1000425613 482
790 3300005546 Ga0070696_100002429 Ga0070696_1000024299 482
791 3300005546 Ga0070696_100005022 Ga0070696_1000050225 482
792 3300005547 Ga0070693_100000142 Ga0070693_10000014225 482
793 3300005547 Ga0070693_100001485 Ga0070693_1000014858 482
794 3300005547 Ga0070693_100039835 Ga0070693_1000398352 482
795 3300005547 Ga0070693_100096547 Ga0070693_1000965471 482
796 3300005548 Ga0070665_100000511 Ga0070665_10000051126 482
797 3300005548 Ga0070665_100009401 Ga0070665_1000094019 482
798 3300005548 Ga0070665_100012240 Ga0070665_1000122405 482
799 3300005548 Ga0070665_100035413 Ga0070665_1000354134 482
800 3300005548 Ga0070665_100042559 Ga0070665_1000425595 482
801 3300005548 Ga0070665_100097616 Ga0070665_1000976163 482
802 3300005548 Ga0070665_100135763 Ga0070665_1001357632 482
803 3300005563 Ga0068855_100000300 Ga0068855_10000030063 482
804 3300005563 Ga0068855_100000745 Ga0068855_10000074534 482
805 3300005563 Ga0068855_100012583 Ga0068855_1000125838 482
806 3300005563 Ga0068855_100013523 Ga0068855_10001352310 482
807 3300005563 Ga0068855_100018695 Ga0068855_1000186956 482
808 3300005563 Ga0068855_100024176 Ga0068855_1000241765 482
809 3300005563 Ga0068855_100063456 Ga0068855_1000634562 482
810 3300005563 Ga0068855_100110416 Ga0068855_1001104162 482
811 3300005563 Ga0068855_100127278 Ga0068855_1001272782 482
812 3300005563 Ga0068855_100226415 Ga0068855_1002264152 482
813 3300005563 Ga0068855_100231531 Ga0068855_1002315312 482
814 3300005564 Ga0070664_100000153 Ga0070664_10000015328 482
815 3300005564 Ga0070664_100001180 Ga0070664_1000011803 482
816 3300005564 Ga0070664_100003525 Ga0070664_1000035258 482
817 3300005564 Ga0070664_100005876 Ga0070664_1000058768 482
818 3300005564 Ga0070664_100007149 Ga0070664_1000071496 482
819 3300005564 Ga0070664_100007605 Ga0070664_1000076058 482
820 3300005564 Ga0070664_100036433 Ga0070664_1000364333 482
821 3300005564 Ga0070664_100084767 Ga0070664_1000847672 482
822 3300005564 Ga0070664_100131359 Ga0070664_1001313592 482
823 3300005577 Ga0068857_100005521 Ga0068857_1000055218 482
824 3300005577 Ga0068857_100014306 Ga0068857_1000143064 482
825 3300005577 Ga0068857_100018102 Ga0068857_1000181022 482
826 3300005577 Ga0068857_100020750 Ga0068857_1000207503 482
827 3300005577 Ga0068857_100025988 Ga0068857_1000259883 482
828 3300005577 Ga0068857_100038230 Ga0068857_1000382304 482
829 3300005577 Ga0068857_100040798 Ga0068857_1000407982 482
830 3300005577 Ga0068857_100129928 Ga0068857_1001299282 482
831 3300005578 Ga0068854_100000728 Ga0068854_1000007288 482
832 3300005578 Ga0068854_100002199 Ga0068854_1000021998 482
833 3300005578 Ga0068854_100003807 Ga0068854_1000038072 482
834 3300005578 Ga0068854_100004330 Ga0068854_1000043306 482
835 3300005578 Ga0068854_100082051 Ga0068854_1000820512 482
836 3300005578 Ga0068854_100102502 Ga0068854_1001025022 482
837 3300005614 Ga0068856_100000177 Ga0068856_10000017728 482
838 3300005614 Ga0068856_100004105 Ga0068856_1000041056 482
839 3300005614 Ga0068856_100028489 Ga0068856_1000284892 482
840 3300005614 Ga0068856_100131609 Ga0068856_1001316092 482
841 3300005614 Ga0068856_100264555 Ga0068856_1002645552 482
842 3300005616 Ga0068852_100000831 Ga0068852_1000008319 482
843 3300005616 Ga0068852_100001121 Ga0068852_1000011219 482
844 3300005616 Ga0068852_100007771 Ga0068852_1000077712 482
845 3300005616 Ga0068852_100009207 Ga0068852_1000092072 482
846 3300005616 Ga0068852_100009998 Ga0068852_1000099986 482
847 3300005616 Ga0068852_100011601 Ga0068852_1000116014 482
848 3300005616 Ga0068852_100014916 Ga0068852_1000149166 482
849 3300005616 Ga0068852_100018310 Ga0068852_1000183103 482
850 3300005616 Ga0068852_100019159 Ga0068852_1000191593 482
851 3300005616 Ga0068852_100082978 Ga0068852_1000829782 482
852 3300005616 Ga0068852_100086196 Ga0068852_1000861962 482
853 3300005616 Ga0068852_100137015 Ga0068852_1001370152 482
854 3300005617 Ga0068859_100000221 Ga0068859_10000022147 482
855 3300005617 Ga0068859_100011473 Ga0068859_1000114736 482
856 3300005617 Ga0068859_100011617 Ga0068859_1000116176 482
857 3300005618 Ga0068864_100000261 Ga0068864_10000026154 482
858 3300005618 Ga0068864_100000324 Ga0068864_10000032442 482
859 3300005618 Ga0068864_100007278 Ga0068864_1000072787 482
860 3300005618 Ga0068864_100013433 Ga0068864_1000134334 482
861 3300005618 Ga0068864_100025411 Ga0068864_1000254113 482
862 3300005618 Ga0068864_100027191 Ga0068864_1000271912 482
863 3300005618 Ga0068864_100052275 Ga0068864_1000522753 482
864 3300005618 Ga0068864_100074408 Ga0068864_1000744082 482
865 3300005618 Ga0068864_100136533 Ga0068864_1001365332 482
866 3300005718 Ga0068866_10035464 Ga0068866_100354642 482
867 3300005834 Ga0068851_10030749 Ga0068851_100307492 482
868 3300005841 Ga0068863_100001640 Ga0068863_1000016406 482
869 3300005841 Ga0068863_100001823 Ga0068863_1000018233 482
870 3300005841 Ga0068863_100003774 Ga0068863_1000037741 482
871 3300005841 Ga0068863_100012046 Ga0068863_1000120466 482
872 3300005841 Ga0068863_100015353 Ga0068863_1000153533 482
873 3300005841 Ga0068863_100025080 Ga0068863_1000250806 482
874 3300005841 Ga0068863_100050697 Ga0068863_1000506971 482
875 3300005842 Ga0068858_100000919 Ga0068858_1000009193 482
876 3300005842 Ga0068858_100004134 Ga0068858_10000413415 482
877 3300005842 Ga0068858_100023221 Ga0068858_1000232215 482
878 3300005842 Ga0068858_100029876 Ga0068858_1000298764 482
879 3300005842 Ga0068858_100056546 Ga0068858_1000565463 482
880 3300005842 Ga0068858_100106184 Ga0068858_1001061841 482
881 3300005843 Ga0068860_100001066 Ga0068860_10000106620 482
882 3300005843 Ga0068860_100003216 Ga0068860_10000321610 482
883 3300005843 Ga0068860_100012537 Ga0068860_1000125371 482
884 3300005843 Ga0068860_100012929 Ga0068860_1000129298 482
885 3300005843 Ga0068860_100103508 Ga0068860_1001035083 482
886 3300005843 Ga0068860_100147920 Ga0068860_1001479202 482
887 3300005843 Ga0068860_100194923 Ga0068860_1001949232 482
888 3300005844 Ga0068862_100005895 Ga0068862_1000058958 482
889 3300005844 Ga0068862_100007386 Ga0068862_1000073869 482
890 3300006028 Ga0070717_10002352 Ga0070717_1000235210 482
891 3300006051 Ga0075364_10042922 Ga0075364_100429221 482
892 3300006175 Ga0070712_100017962 Ga0070712_1000179623 482
893 3300006237 Ga0097621_100036752 Ga0097621_1000367523 482
894 3300006237 Ga0097621_100073644 Ga0097621_1000736443 482
895 3300006237 Ga0097621_100247478 Ga0097621_1002474781 482
896 3300006358 Ga0068871_100002906 Ga0068871_1000029065 482
897 3300006880 Ga0075429_100196797 Ga0075429_1001967972 482
898 3300006881 Ga0068865_100017616 Ga0068865_1000176164 482
899 3300006931 Ga0097620_100000221 Ga0097620_10000022147 482
900 3300006931 Ga0097620_100011473 Ga0097620_1000114736 482
901 3300006931 Ga0097620_100011616 Ga0097620_1000116166 482
902 3300007076 Ga0075435_100142170 Ga0075435_1001421702 482
903 3300007788 Ga0099795_10015594 Ga0099795_100155941 482
904 3300007788 Ga0099795_10027040 Ga0099795_100270402 482
905 3300009093 Ga0105240_10006013 Ga0105240_100060132 482
906 3300009093 Ga0105240_10021655 Ga0105240_100216553 482
907 3300009093 Ga0105240_10103868 Ga0105240_101038682 482
908 3300009094 Ga0111539_10022638 Ga0111539_100226385 482
909 3300009094 Ga0111539_10030494 Ga0111539_100304945 482
910 3300009094 Ga0111539_10082976 Ga0111539_100829762 482
911 3300009098 Ga0105245_10018068 Ga0105245_100180685 482
912 3300009098 Ga0105245_10021410 Ga0105245_100214102 482
913 3300009098 Ga0105245_10022147 Ga0105245_100221473 482
914 3300009098 Ga0105245_10030661 Ga0105245_100306613 482
915 3300009101 Ga0105247_10022433 Ga0105247_100224331 482
916 3300009101 Ga0105247_10074775 Ga0105247_100747752 482
917 3300009147 Ga0114129_10000571 Ga0114129_1000057115 482
918 3300009147 Ga0114129_10119172 Ga0114129_101191722 482
919 3300009148 Ga0105243_10178619 Ga0105243_101786191 482
920 3300009174 Ga0105241_10027086 Ga0105241_100270862 482
921 3300009174 Ga0105241_10038519 Ga0105241_100385192 482
922 3300009176 Ga0105242_10003245 Ga0105242_100032456 482
923 3300009177 Ga0105248_10000442 Ga0105248_1000044238 482
924 3300009177 Ga0105248_10000502 Ga0105248_1000050214 482
925 3300009177 Ga0105248_10000604 Ga0105248_100006048 482
926 3300009177 Ga0105248_10000801 Ga0105248_100008019 482
927 3300009177 Ga0105248_10003885 Ga0105248_100038855 482
928 3300009177 Ga0105248_10016200 Ga0105248_100162003 482
929 3300009177 Ga0105248_10017490 Ga0105248_100174902 482
930 3300009177 Ga0105248_10022518 Ga0105248_100225184 482
931 3300009177 Ga0105248_10030322 Ga0105248_100303224 482
932 3300009177 Ga0105248_10035428 Ga0105248_100354283 482
933 3300009177 Ga0105248_10063137 Ga0105248_100631374 482
934 3300009177 Ga0105248_10163756 Ga0105248_101637562 482
935 3300009545 Ga0105237_10035190 Ga0105237_100351904 482
936 3300009551 Ga0105238_10005606 Ga0105238_100056067 482
937 3300009551 Ga0105238_10019905 Ga0105238_100199054 482
938 3300009551 Ga0105238_10044294 Ga0105238_100442943 482
939 3300009551 Ga0105238_10180123 Ga0105238_101801232 482
940 3300009553 Ga0105249_10006086 Ga0105249_100060866 482
941 3300009553 Ga0105249_10013760 Ga0105249_100137601 482
942 3300009553 Ga0105249_10040810 Ga0105249_100408102 482
943 3300010375 Ga0105239_10037042 Ga0105239_100370423 482
944 3300010375 Ga0105239_10216884 Ga0105239_102168842 482
945 3300011119 Ga0105246_10039556 Ga0105246_100395563 482
946 3300013100 Ga0157373_10008235 Ga0157373_100082358 482
947 3300013100 Ga0157373_10010145 Ga0157373_100101457 482
948 3300013100 Ga0157373_10010212 Ga0157373_100102124 482
949 3300013100 Ga0157373_10012780 Ga0157373_100127801 482
950 3300013100 Ga0157373_10021820 Ga0157373_100218202 482
951 3300013100 Ga0157373_10024952 Ga0157373_100249523 482
952 3300013100 Ga0157373_10028202 Ga0157373_100282022 482
953 3300013100 Ga0157373_10028291 Ga0157373_100282913 482
954 3300013100 Ga0157373_10029331 Ga0157373_100293312 482
955 3300013100 Ga0157373_10065047 Ga0157373_100650472 482
956 3300013102 Ga0157371_10000895 Ga0157371_1000089523 482
957 3300013102 Ga0157371_10002883 Ga0157371_100028838 482
958 3300013102 Ga0157371_10003905 Ga0157371_100039056 482
959 3300013102 Ga0157371_10005716 Ga0157371_100057169 482
960 3300013102 Ga0157371_10007603 Ga0157371_100076033 482
961 3300013102 Ga0157371_10013741 Ga0157371_100137413 482
962 3300013102 Ga0157371_10052623 Ga0157371_100526232 482
963 3300013104 Ga0157370_10007343 Ga0157370_100073439 482
964 3300013104 Ga0157370_10021219 Ga0157370_100212192 482
965 3300013104 Ga0157370_10029253 Ga0157370_100292532 482
966 3300013104 Ga0157370_10042552 Ga0157370_100425523 482
967 3300013104 Ga0157370_10051440 Ga0157370_100514402 482
968 3300013104 Ga0157370_10116679 Ga0157370_101166792 482
969 3300013105 Ga0157369_10001743 Ga0157369_100017435 482
970 3300013105 Ga0157369_10008003 Ga0157369_100080036 482
971 3300013105 Ga0157369_10012108 Ga0157369_100121084 482
972 3300013105 Ga0157369_10017379 Ga0157369_100173797 482
973 3300013105 Ga0157369_10337497 Ga0157369_103374971 482
974 3300013296 Ga0157374_10003127 Ga0157374_100031276 482
975 3300013296 Ga0157374_10011569 Ga0157374_100115693 482
976 3300013296 Ga0157374_10019669 Ga0157374_100196693 482
977 3300013297 Ga0157378_10024953 Ga0157378_100249533 482
978 3300013297 Ga0157378_10062626 Ga0157378_100626262 482
979 3300013297 Ga0157378_10104322 Ga0157378_101043222 482
980 3300013306 Ga0163162_10281485 Ga0163162_102814852 482
981 3300013307 Ga0157372_10080701 Ga0157372_100807012 482
982 3300013307 Ga0157372_10126413 Ga0157372_101264132 482
983 3300013307 Ga0157372_10253570 Ga0157372_102535702 482
984 3300013308 Ga0157375_10012994 Ga0157375_100129942 482
985 3300013308 Ga0157375_10025658 Ga0157375_100256582 482
986 3300013308 Ga0157375_10074230 Ga0157375_100742303 482
987 3300013308 Ga0157375_10339171 Ga0157375_103391711 482
988 3300014325 Ga0163163_10000164 Ga0163163_1000016415 482
989 3300014325 Ga0163163_10001448 Ga0163163_1000144812 482
990 3300014325 Ga0163163_10013626 Ga0163163_100136262 482
991 3300014968 Ga0157379_10007033 Ga0157379_100070333 482
992 3300014968 Ga0157379_10040472 Ga0157379_100404723 482
993 3300014968 Ga0157379_10047981 Ga0157379_100479812 482
994 3300020082 Ga0206353_10764760 Ga0206353_107647603 482
995 3300020082 Ga0206353_11719759 Ga0206353_117197592 482
996 3300021384 Ga0213876_10014546 Ga0213876_100145463 482
997 3300025290 Ga0207673_1005129 Ga0207673_10051291 482
998 3300025315 Ga0207697_10000296 Ga0207697_100002966 482
999 3300025315 Ga0207697_10002172 Ga0207697_100021725 482
1000 3300025321 Ga0207656_10002037 Ga0207656_100020373 482
1001 3300025893 Ga0207682_10004604 Ga0207682_100046044 482
1002 3300025893 Ga0207682_10006767 Ga0207682_100067673 482
1003 3300025901 Ga0207688_10002751 Ga0207688_100027519 482
1004 3300025901 Ga0207688_10004134 Ga0207688_100041341 482
1005 3300025901 Ga0207688_10071028 Ga0207688_100710282 482
1006 3300025903 Ga0207680_10001981 Ga0207680_100019817 482
1007 3300025903 Ga0207680_10002390 Ga0207680_100023908 482
1008 3300025903 Ga0207680_10016304 Ga0207680_100163043 482
1009 3300025904 Ga0207647_10000697 Ga0207647_1000069715 482
1010 3300025904 Ga0207647_10001325 Ga0207647_1000132512 482
1011 3300025904 Ga0207647_10001811 Ga0207647_1000181111 482
1012 3300025904 Ga0207647_10003634 Ga0207647_100036343 482
1013 3300025904 Ga0207647_10004712 Ga0207647_100047129 482
1014 3300025904 Ga0207647_10026990 Ga0207647_100269903 482
1015 3300025904 Ga0207647_10058302 Ga0207647_100583022 482
1016 3300025907 Ga0207645_10001931 Ga0207645_1000193112 482
1017 3300025907 Ga0207645_10012843 Ga0207645_100128432 482
1018 3300025907 Ga0207645_10015870 Ga0207645_100158703 482
1019 3300025909 Ga0207705_10000060 Ga0207705_1000006075 482
1020 3300025909 Ga0207705_10000174 Ga0207705_1000017421 482
1021 3300025909 Ga0207705_10000429 Ga0207705_1000042933 482
1022 3300025909 Ga0207705_10000779 Ga0207705_100007796 482
1023 3300025909 Ga0207705_10005626 Ga0207705_100056263 482
1024 3300025909 Ga0207705_10007191 Ga0207705_100071914 482
1025 3300025909 Ga0207705_10010399 Ga0207705_100103993 482
1026 3300025909 Ga0207705_10012947 Ga0207705_100129472 482
1027 3300025909 Ga0207705_10013373 Ga0207705_100133733 482
1028 3300025909 Ga0207705_10020277 Ga0207705_100202773 482
1029 3300025909 Ga0207705_10020495 Ga0207705_100204953 482
1030 3300025909 Ga0207705_10024693 Ga0207705_100246934 482
1031 3300025909 Ga0207705_10030279 Ga0207705_100302793 482
1032 3300025909 Ga0207705_10038560 Ga0207705_100385603 482
1033 3300025909 Ga0207705_10049693 Ga0207705_100496932 482
1034 3300025909 Ga0207705_10063728 Ga0207705_100637281 482
1035 3300025910 Ga0207684_10078477 Ga0207684_100784773 482
1036 3300025912 Ga0207707_10099884 Ga0207707_100998842 482
1037 3300025913 Ga0207695_10001996 Ga0207695_1000199615 482
1038 3300025913 Ga0207695_10019426 Ga0207695_100194265 482
1039 3300025913 Ga0207695_10093409 Ga0207695_100934092 482
1040 3300025916 Ga0207663_10120189 Ga0207663_101201892 482
1041 3300025917 Ga0207660_10001449 Ga0207660_100014499 482
1042 3300025917 Ga0207660_10004293 Ga0207660_100042933 482
1043 3300025917 Ga0207660_10009882 Ga0207660_100098823 482
1044 3300025917 Ga0207660_10013245 Ga0207660_100132453 482
1045 3300025917 Ga0207660_10024393 Ga0207660_100243932 482
1046 3300025917 Ga0207660_10032322 Ga0207660_100323222 482
1047 3300025917 Ga0207660_10054092 Ga0207660_100540922 482
1048 3300025917 Ga0207660_10071973 Ga0207660_100719732 482
1049 3300025919 Ga0207657_10000173 Ga0207657_1000017328 482
1050 3300025919 Ga0207657_10000631 Ga0207657_1000063125 482
1051 3300025919 Ga0207657_10001159 Ga0207657_1000115921 482
1052 3300025919 Ga0207657_10001954 Ga0207657_100019546 482
1053 3300025919 Ga0207657_10002129 Ga0207657_100021295 482
1054 3300025919 Ga0207657_10004219 Ga0207657_100042195 482
1055 3300025919 Ga0207657_10004601 Ga0207657_100046018 482
1056 3300025919 Ga0207657_10005022 Ga0207657_1000502210 482
1057 3300025919 Ga0207657_10009008 Ga0207657_100090082 482
1058 3300025919 Ga0207657_10009095 Ga0207657_100090957 482
1059 3300025919 Ga0207657_10020224 Ga0207657_100202243 482
1060 3300025919 Ga0207657_10021622 Ga0207657_100216227 482
1061 3300025919 Ga0207657_10023825 Ga0207657_100238254 482
1062 3300025919 Ga0207657_10029826 Ga0207657_100298263 482
1063 3300025919 Ga0207657_10034308 Ga0207657_100343083 482
1064 3300025919 Ga0207657_10037540 Ga0207657_100375402 482
1065 3300025919 Ga0207657_10038141 Ga0207657_100381413 482
1066 3300025919 Ga0207657_10044515 Ga0207657_100445154 482
1067 3300025919 Ga0207657_10046637 Ga0207657_100466373 482
1068 3300025919 Ga0207657_10087348 Ga0207657_100873481 482
1069 3300025919 Ga0207657_10093303 Ga0207657_100933032 482
1070 3300025920 Ga0207649_10000014 Ga0207649_1000001489 482
1071 3300025920 Ga0207649_10000702 Ga0207649_100007025 482
1072 3300025920 Ga0207649_10008251 Ga0207649_100082513 482
1073 3300025920 Ga0207649_10014529 Ga0207649_100145293 482
1074 3300025920 Ga0207649_10024355 Ga0207649_100243552 482
1075 3300025920 Ga0207649_10056099 Ga0207649_100560992 482
1076 3300025920 Ga0207649_10100805 Ga0207649_101008052 482
1077 3300025920 Ga0207649_10133344 Ga0207649_101333441 482
1078 3300025921 Ga0207652_10004551 Ga0207652_100045513 482
1079 3300025921 Ga0207652_10018830 Ga0207652_100188307 482
1080 3300025921 Ga0207652_10036043 Ga0207652_100360435 482
1081 3300025921 Ga0207652_10179708 Ga0207652_101797081 482
1082 3300025923 Ga0207681_10010134 Ga0207681_100101343 482
1083 3300025923 Ga0207681_10038492 Ga0207681_100384922 482
1084 3300025924 Ga0207694_10015718 Ga0207694_100157183 482
1085 3300025924 Ga0207694_10031171 Ga0207694_100311713 482
1086 3300025924 Ga0207694_10040302 Ga0207694_100403022 482
1087 3300025924 Ga0207694_10162896 Ga0207694_101628962 482
1088 3300025925 Ga0207650_10012588 Ga0207650_100125884 482
1089 3300025925 Ga0207650_10035092 Ga0207650_100350924 482
1090 3300025925 Ga0207650_10036885 Ga0207650_100368852 482
1091 3300025925 Ga0207650_10056076 Ga0207650_100560762 482
1092 3300025925 Ga0207650_10060299 Ga0207650_100602993 482
1093 3300025925 Ga0207650_10088475 Ga0207650_100884752 482
1094 3300025925 Ga0207650_10113917 Ga0207650_101139172 482
1095 3300025925 Ga0207650_10122873 Ga0207650_101228732 482
1096 3300025926 Ga0207659_10032848 Ga0207659_100328485 482
1097 3300025926 Ga0207659_10033900 Ga0207659_100339003 482
1098 3300025926 Ga0207659_10157383 Ga0207659_101573831 482
1099 3300025927 Ga0207687_10018262 Ga0207687_100182624 482
1100 3300025928 Ga0207700_10173307 Ga0207700_101733072 482
1101 3300025929 Ga0207664_10014967 Ga0207664_100149674 482
1102 3300025929 Ga0207664_10035382 Ga0207664_100353822 482
1103 3300025931 Ga0207644_10000061 Ga0207644_100000619 482
1104 3300025931 Ga0207644_10001396 Ga0207644_100013962 482
1105 3300025931 Ga0207644_10002341 Ga0207644_1000234110 482
1106 3300025931 Ga0207644_10004475 Ga0207644_100044757 482
1107 3300025931 Ga0207644_10008961 Ga0207644_100089613 482
1108 3300025931 Ga0207644_10010251 Ga0207644_100102514 482
1109 3300025931 Ga0207644_10025173 Ga0207644_100251733 482
1110 3300025931 Ga0207644_10068768 Ga0207644_100687682 482
1111 3300025931 Ga0207644_10112748 Ga0207644_101127482 482
1112 3300025931 Ga0207644_10166219 Ga0207644_101662191 482
1113 3300025932 Ga0207690_10000150 Ga0207690_1000015014 482
1114 3300025932 Ga0207690_10001575 Ga0207690_100015756 482
1115 3300025932 Ga0207690_10004110 Ga0207690_100041102 482
1116 3300025932 Ga0207690_10006736 Ga0207690_100067366 482
1117 3300025932 Ga0207690_10014783 Ga0207690_100147832 482
1118 3300025932 Ga0207690_10016579 Ga0207690_100165791 482
1119 3300025932 Ga0207690_10050815 Ga0207690_100508153 482
1120 3300025932 Ga0207690_10076032 Ga0207690_100760321 482
1121 3300025932 Ga0207690_10083744 Ga0207690_100837441 482
1122 3300025932 Ga0207690_10106114 Ga0207690_101061142 482
1123 3300025933 Ga0207706_10000358 Ga0207706_100003589 482
1124 3300025933 Ga0207706_10000405 Ga0207706_100004054 482
1125 3300025933 Ga0207706_10002282 Ga0207706_1000228215 482
1126 3300025933 Ga0207706_10002783 Ga0207706_100027834 482
1127 3300025933 Ga0207706_10004849 Ga0207706_100048493 482
1128 3300025933 Ga0207706_10014280 Ga0207706_100142808 482
1129 3300025933 Ga0207706_10037548 Ga0207706_100375483 482
1130 3300025933 Ga0207706_10045794 Ga0207706_100457942 482
1131 3300025933 Ga0207706_10054859 Ga0207706_100548592 482
1132 3300025933 Ga0207706_10065767 Ga0207706_100657672 482
1133 3300025933 Ga0207706_10071627 Ga0207706_100716273 482
1134 3300025933 Ga0207706_10098609 Ga0207706_100986092 482
1135 3300025933 Ga0207706_10103356 Ga0207706_101033562 482
1136 3300025934 Ga0207686_10004365 Ga0207686_100043657 482
1137 3300025937 Ga0207669_10024295 Ga0207669_100242952 482
1138 3300025937 Ga0207669_10028778 Ga0207669_100287783 482
1139 3300025938 Ga0207704_10003077 Ga0207704_100030778 482
1140 3300025938 Ga0207704_10006150 Ga0207704_100061502 482
1141 3300025938 Ga0207704_10013390 Ga0207704_100133902 482
1142 3300025939 Ga0207665_10023939 Ga0207665_100239392 482
1143 3300025940 Ga0207691_10000700 Ga0207691_1000070022 482
1144 3300025940 Ga0207691_10001051 Ga0207691_1000105117 482
1145 3300025940 Ga0207691_10011831 Ga0207691_100118311 482
1146 3300025940 Ga0207691_10014685 Ga0207691_100146854 482
1147 3300025940 Ga0207691_10026918 Ga0207691_100269186 482
1148 3300025940 Ga0207691_10075590 Ga0207691_100755902 482
1149 3300025941 Ga0207711_10000042 Ga0207711_10000042135 482
1150 3300025941 Ga0207711_10000526 Ga0207711_100005267 482
1151 3300025941 Ga0207711_10001694 Ga0207711_1000169418 482
1152 3300025941 Ga0207711_10001832 Ga0207711_1000183212 482
1153 3300025941 Ga0207711_10005428 Ga0207711_100054286 482
1154 3300025941 Ga0207711_10008051 Ga0207711_100080519 482
1155 3300025941 Ga0207711_10026379 Ga0207711_100263792 482
1156 3300025941 Ga0207711_10038748 Ga0207711_100387484 482
1157 3300025941 Ga0207711_10040182 Ga0207711_100401824 482
1158 3300025941 Ga0207711_10083436 Ga0207711_100834362 482
1159 3300025941 Ga0207711_10090753 Ga0207711_100907532 482
1160 3300025942 Ga0207689_10002260 Ga0207689_1000226011 482
1161 3300025942 Ga0207689_10015144 Ga0207689_100151445 482
1162 3300025942 Ga0207689_10018013 Ga0207689_100180132 482
1163 3300025944 Ga0207661_10006512 Ga0207661_100065126 482
1164 3300025944 Ga0207661_10007589 Ga0207661_100075893 482
1165 3300025944 Ga0207661_10012319 Ga0207661_100123194 482
1166 3300025944 Ga0207661_10074609 Ga0207661_100746092 482
1167 3300025945 Ga0207679_10002186 Ga0207679_100021868 482
1168 3300025945 Ga0207679_10012859 Ga0207679_100128593 482
1169 3300025945 Ga0207679_10034815 Ga0207679_100348153 482
1170 3300025945 Ga0207679_10041305 Ga0207679_100413053 482
1171 3300025945 Ga0207679_10066546 Ga0207679_100665461 482
1172 3300025949 Ga0207667_10000187 Ga0207667_1000018770 482
1173 3300025949 Ga0207667_10005712 Ga0207667_100057129 482
1174 3300025949 Ga0207667_10007828 Ga0207667_100078288 482
1175 3300025949 Ga0207667_10013328 Ga0207667_100133289 482
1176 3300025949 Ga0207667_10013952 Ga0207667_100139527 482
1177 3300025949 Ga0207667_10040741 Ga0207667_100407413 482
1178 3300025949 Ga0207667_10051145 Ga0207667_100511453 482
1179 3300025949 Ga0207667_10083718 Ga0207667_100837182 482
1180 3300025960 Ga0207651_10001053 Ga0207651_100010539 482
1181 3300025960 Ga0207651_10007712 Ga0207651_100077122 482
1182 3300025960 Ga0207651_10023431 Ga0207651_100234313 482
1183 3300025960 Ga0207651_10146398 Ga0207651_101463981 482
1184 3300025960 Ga0207651_10177216 Ga0207651_101772162 482
1185 3300025961 Ga0207712_10001308 Ga0207712_1000130817 482
1186 3300025961 Ga0207712_10018214 Ga0207712_100182143 482
1187 3300025972 Ga0207668_10000129 Ga0207668_100001297 482
1188 3300025981 Ga0207640_10000830 Ga0207640_1000083017 482
1189 3300025981 Ga0207640_10016159 Ga0207640_100161593 482
1190 3300025981 Ga0207640_10020546 Ga0207640_100205463 482
1191 3300025981 Ga0207640_10051871 Ga0207640_100518713 482
1192 3300025981 Ga0207640_10072008 Ga0207640_100720081 482
1193 3300025981 Ga0207640_10087081 Ga0207640_100870812 482
1194 3300025986 Ga0207658_10001750 Ga0207658_1000175013 482
1195 3300025986 Ga0207658_10002256 Ga0207658_1000225611 482
1196 3300025986 Ga0207658_10011393 Ga0207658_100113936 482
1197 3300025986 Ga0207658_10022285 Ga0207658_100222853 482
1198 3300025986 Ga0207658_10029106 Ga0207658_100291063 482
1199 3300025986 Ga0207658_10100613 Ga0207658_101006131 482
1200 3300026023 Ga0207677_10001135 Ga0207677_100011358 482
1201 3300026023 Ga0207677_10001443 Ga0207677_1000144310 482
1202 3300026023 Ga0207677_10118061 Ga0207677_101180611 482
1203 3300026035 Ga0207703_10002018 Ga0207703_100020184 482
1204 3300026035 Ga0207703_10002526 Ga0207703_1000252611 482
1205 3300026035 Ga0207703_10002744 Ga0207703_100027447 482
1206 3300026035 Ga0207703_10006187 Ga0207703_100061877 482
1207 3300026035 Ga0207703_10018103 Ga0207703_100181036 482
1208 3300026035 Ga0207703_10020439 Ga0207703_100204393 482
1209 3300026041 Ga0207639_10000393 Ga0207639_100003932 482
1210 3300026041 Ga0207639_10000740 Ga0207639_1000074016 482
1211 3300026041 Ga0207639_10007563 Ga0207639_100075633 482
1212 3300026041 Ga0207639_10039474 Ga0207639_100394742 482
1213 3300026041 Ga0207639_10076334 Ga0207639_100763342 482
1214 3300026041 Ga0207639_10103443 Ga0207639_101034432 482
1215 3300026067 Ga0207678_10000843 Ga0207678_1000084322 482
1216 3300026067 Ga0207678_10001160 Ga0207678_100011608 482
1217 3300026067 Ga0207678_10001499 Ga0207678_100014996 482
1218 3300026067 Ga0207678_10003603 Ga0207678_100036038 482
1219 3300026067 Ga0207678_10006065 Ga0207678_100060652 482
1220 3300026067 Ga0207678_10006189 Ga0207678_100061899 482
1221 3300026067 Ga0207678_10016516 Ga0207678_100165165 482
1222 3300026067 Ga0207678_10016599 Ga0207678_100165996 482
1223 3300026067 Ga0207678_10055882 Ga0207678_100558822 482
1224 3300026067 Ga0207678_10108899 Ga0207678_101088992 482
1225 3300026078 Ga0207702_10020334 Ga0207702_100203344 482
1226 3300026078 Ga0207702_10033063 Ga0207702_100330632 482
1227 3300026078 Ga0207702_10033355 Ga0207702_100333552 482
1228 3300026078 Ga0207702_10035513 Ga0207702_100355133 482
1229 3300026078 Ga0207702_10047958 Ga0207702_100479583 482
1230 3300026078 Ga0207702_10086096 Ga0207702_100860963 482
1231 3300026078 Ga0207702_10141698 Ga0207702_101416982 482
1232 3300026078 Ga0207702_10152717 Ga0207702_101527172 482
1233 3300026088 Ga0207641_10000415 Ga0207641_1000041527 482
1234 3300026088 Ga0207641_10033020 Ga0207641_100330203 482
1235 3300026088 Ga0207641_10042968 Ga0207641_100429682 482
1236 3300026088 Ga0207641_10185475 Ga0207641_101854751 482
1237 3300026089 Ga0207648_10003071 Ga0207648_100030719 482
1238 3300026089 Ga0207648_10007248 Ga0207648_100072485 482
1239 3300026089 Ga0207648_10014998 Ga0207648_100149988 482
1240 3300026089 Ga0207648_10034652 Ga0207648_100346523 482
1241 3300026095 Ga0207676_10000456 Ga0207676_1000045622 482
1242 3300026095 Ga0207676_10002207 Ga0207676_100022076 482
1243 3300026095 Ga0207676_10005125 Ga0207676_100051256 482
1244 3300026095 Ga0207676_10014753 Ga0207676_100147533 482
1245 3300026095 Ga0207676_10036002 Ga0207676_100360022 482
1246 3300026095 Ga0207676_10119988 Ga0207676_101199882 482
1247 3300026095 Ga0207676_10176742 Ga0207676_101767422 482
1248 3300026116 Ga0207674_10000283 Ga0207674_1000028336 482
1249 3300026116 Ga0207674_10000632 Ga0207674_1000063214 482
1250 3300026116 Ga0207674_10001013 Ga0207674_1000101330 482
1251 3300026116 Ga0207674_10002478 Ga0207674_1000247813 482
1252 3300026116 Ga0207674_10006840 Ga0207674_1000684012 482
1253 3300026116 Ga0207674_10006984 Ga0207674_100069849 482
1254 3300026116 Ga0207674_10025784 Ga0207674_100257843 482
1255 3300026116 Ga0207674_10030412 Ga0207674_100304126 482
1256 3300026116 Ga0207674_10134310 Ga0207674_101343102 482
1257 3300026116 Ga0207674_10141877 Ga0207674_101418772 482
1258 3300026121 Ga0207683_10002230 Ga0207683_1000223014 482
1259 3300026121 Ga0207683_10006746 Ga0207683_100067469 482
1260 3300026121 Ga0207683_10014363 Ga0207683_100143632 482
1261 3300026121 Ga0207683_10015525 Ga0207683_100155253 482
1262 3300026121 Ga0207683_10037370 Ga0207683_100373702 482
1263 3300026142 Ga0207698_10000457 Ga0207698_100004572 482
1264 3300026142 Ga0207698_10001077 Ga0207698_100010779 482
1265 3300026142 Ga0207698_10003402 Ga0207698_100034027 482
1266 3300026142 Ga0207698_10006883 Ga0207698_100068835 482
1267 3300026142 Ga0207698_10009005 Ga0207698_100090054 482
1268 3300026142 Ga0207698_10009573 Ga0207698_100095736 482
1269 3300026142 Ga0207698_10010670 Ga0207698_100106706 482
1270 3300026142 Ga0207698_10015443 Ga0207698_100154432 482
1271 3300026142 Ga0207698_10019150 Ga0207698_100191503 482
1272 3300026142 Ga0207698_10050996 Ga0207698_100509963 482
1273 3300026142 Ga0207698_10051392 Ga0207698_100513923 482
1274 3300027876 Ga0209974_10010996 Ga0209974_100109962 482
1275 3300027907 Ga0207428_10097492 Ga0207428_100974922 482
1276 3300028379 Ga0268266_10002204 Ga0268266_100022045 482
1277 3300028379 Ga0268266_10003658 Ga0268266_1000365816 482
1278 3300028379 Ga0268266_10013955 Ga0268266_100139557 482
1279 3300028379 Ga0268266_10023957 Ga0268266_100239574 482
1280 3300028379 Ga0268266_10042643 Ga0268266_100426433 482
1281 3300028379 Ga0268266_10047798 Ga0268266_100477984 482
1282 3300028379 Ga0268266_10087467 Ga0268266_100874672 482
1283 3300028380 Ga0268265_10001958 Ga0268265_100019582 482
1284 3300028380 Ga0268265_10007351 Ga0268265_100073515 482
1285 3300028380 Ga0268265_10026561 Ga0268265_100265612 482
1286 3300028380 Ga0268265_10030468 Ga0268265_100304684 482
1287 3300028381 Ga0268264_10000710 Ga0268264_1000071020 482
1288 3300028381 Ga0268264_10002392 Ga0268264_100023926 482
1289 3300028381 Ga0268264_10003045 Ga0268264_100030459 482
1290 3300028381 Ga0268264_10012745 Ga0268264_100127457 482
1291 3300028381 Ga0268264_10074838 Ga0268264_100748382 482
1292 3300028381 Ga0268264_10081926 Ga0268264_100819262 482
1293 3300028800 Ga0265338_10042019 Ga0265338_100420192 482
1294 3300031548 Ga0307408_100020384 Ga0307408_1000203841 482
1295 3300031731 Ga0307405_10010455 Ga0307405_100104554 482
1296 3300031731 Ga0307405_10011827 Ga0307405_100118272 482
1297 3300031731 Ga0307405_10038922 Ga0307405_100389223 482
1298 3300031731 Ga0307405_10127734 Ga0307405_101277342 482
1299 3300031824 Ga0307413_10003856 Ga0307413_100038566 482
1300 3300031824 Ga0307413_10015023 Ga0307413_100150235 482
1301 3300031824 Ga0307413_10054008 Ga0307413_100540082 482
1302 3300031824 Ga0307413_10127328 Ga0307413_101273282 482
1303 3300031852 Ga0307410_10000510 Ga0307410_100005103 482
1304 3300031852 Ga0307410_10001592 Ga0307410_100015924 482
1305 3300031852 Ga0307410_10005778 Ga0307410_100057784 482
1306 3300031852 Ga0307410_10007507 Ga0307410_100075077 482
1307 3300031852 Ga0307410_10009548 Ga0307410_100095482 482
1308 3300031852 Ga0307410_10098141 Ga0307410_100981412 482
1309 3300031901 Ga0307406_10079184 Ga0307406_100791842 482
1310 3300031901 Ga0307406_10116639 Ga0307406_101166391 482
1311 3300031901 Ga0307406_10117478 Ga0307406_101174782 482
1312 3300031903 Ga0307407_10021686 Ga0307407_100216862 482
1313 3300031903 Ga0307407_10022864 Ga0307407_100228642 482
1314 3300031903 Ga0307407_10023235 Ga0307407_100232352 482
1315 3300031911 Ga0307412_10023001 Ga0307412_100230014 482
1316 3300031911 Ga0307412_10044728 Ga0307412_100447283 482
1317 3300031911 Ga0307412_10047404 Ga0307412_100474042 482
1318 3300031911 Ga0307412_10074188 Ga0307412_100741882 482
1319 3300031995 Ga0307409_100006035 Ga0307409_1000060354 482
1320 3300031995 Ga0307409_100018666 Ga0307409_1000186664 482
1321 3300031995 Ga0307409_100020861 Ga0307409_1000208612 482
1322 3300031995 Ga0307409_100023075 Ga0307409_1000230753 482
1323 3300031995 Ga0307409_100031412 Ga0307409_1000314123 482
1324 3300031995 Ga0307409_100077271 Ga0307409_1000772712 482
1325 3300031995 Ga0307409_100078132 Ga0307409_1000781322 482
1326 3300031995 Ga0307409_100080003 Ga0307409_1000800033 482
1327 3300031995 Ga0307409_100103069 Ga0307409_1001030692 482
1328 3300031995 Ga0307409_100107745 Ga0307409_1001077452 482
1329 3300031995 Ga0307409_100149559 Ga0307409_1001495592 482
1330 3300032002 Ga0307416_100011384 Ga0307416_1000113845 482
1331 3300032002 Ga0307416_100019720 Ga0307416_1000197203 482
1332 3300032002 Ga0307416_100061090 Ga0307416_1000610903 482
1333 3300032002 Ga0307416_100187960 Ga0307416_1001879601 482
1334 3300032004 Ga0307414_10002419 Ga0307414_100024197 482
1335 3300032004 Ga0307414_10014565 Ga0307414_100145655 482
1336 3300032004 Ga0307414_10019990 Ga0307414_100199902 482
1337 3300032004 Ga0307414_10021883 Ga0307414_100218832 482
1338 3300032004 Ga0307414_10023113 Ga0307414_100231133 482
1339 3300032004 Ga0307414_10050490 Ga0307414_100504904 482
1340 3300032005 Ga0307411_10012113 Ga0307411_100121133 482
1341 3300032005 Ga0307411_10018473 Ga0307411_100184734 482
1342 3300032005 Ga0307411_10026435 Ga0307411_100264353 482
1343 3300032005 Ga0307411_10049123 Ga0307411_100491233 482
1344 3300032005 Ga0307411_10051734 Ga0307411_100517342 482
1345 3300032005 Ga0307411_10118475 Ga0307411_101184752 482
1346 3300032126 Ga0307415_100002637 Ga0307415_1000026375 482
1347 3300032126 Ga0307415_100093202 Ga0307415_1000932022 482
1348 3300032126 Ga0307415_100098839 Ga0307415_1000988392 482
1349 3300032126 Ga0307415_100102578 Ga0307415_1001025782 482
1350 3300035116 Ga0373945_0029332 Ga0373945_0029332_26_1573 482
1351 3300035118 Ga0373954_0023614 Ga0373954_0023614_133_1605 482
1352 3300035170 Ga0373943_0009911 Ga0373943_0009911_1596_3143 482
1353 3300035171 Ga0373946_0010095 Ga0373946_0010095_617_2164 482
1354 3300035171 Ga0373946_0014669 Ga0373946_0014669_114_1562 482
1355 3300035172 Ga0373955_0023588 Ga0373955_0023588_1662_3110 482
1356 3300035692 Ga0373935_0009737 Ga0373935_0009737_1246_2793 482
1357 3300035692 Ga0373935_0056971 Ga0373935_0056971_683_2131 482
1358 3300035725 Ga0373947_0029695 Ga0373947_0029695_1261_2709 482
1359 3300036401 Ga0373937_0004429 Ga0373937_0004429_7469_8917 482
1360 3300036401 Ga0373937_0053522 Ga0373937_0053522_991_2463 482
1361 3300037312 Ga0395899_0000112 Ga0395899_0000112_115675_117123 482
1362 3300037312 Ga0395899_0000416 Ga0395899_0000416_3567_5015 482
1363 3300037312 Ga0395899_0000691 Ga0395899_0000691_17852_19300 482
1364 3300037312 Ga0395899_0004509 Ga0395899_0004509_5984_7432 482
1365 3300037312 Ga0395899_0006041 Ga0395899_0006041_7082_8530 482
1366 3300037312 Ga0395899_0006191 Ga0395899_0006191_4786_6234 482
1367 3300037312 Ga0395899_0010397 Ga0395899_0010397_3803_5251 482
1368 3300037312 Ga0395899_0010953 Ga0395899_0010953_576_2039 482
1369 3300037312 Ga0395899_0011706 Ga0395899_0011706_2938_4386 482
1370 3300037312 Ga0395899_0016252 Ga0395899_0016252_1075_2523 482
1371 3300037312 Ga0395899_0020531 Ga0395899_0020531_2041_3489 482
1372 3300037312 Ga0395899_0041463 Ga0395899_0041463_1555_3003 482
1373 3300037312 Ga0395899_0064169 Ga0395899_0064169_726_2174 482
1374 3300037312 Ga0395899_0067482 Ga0395899_0067482_435_1883 482
1375 3300037312 Ga0395899_0075562 Ga0395899_0075562_595_2043 482
1376 3300037418 Ga0395900_0000126 Ga0395900_0000126_31362_32810 482
1377 3300037418 Ga0395900_0000316 Ga0395900_0000316_55435_56883 482
1378 3300037418 Ga0395900_0000862 Ga0395900_0000862_12542_13990 482
1379 3300037418 Ga0395900_0002554 Ga0395900_0002554_13258_14706 482
1380 3300037418 Ga0395900_0006489 Ga0395900_0006489_7044_8492 482
1381 3300037418 Ga0395900_0006829 Ga0395900_0006829_3707_5155 482
1382 3300037418 Ga0395900_0009816 Ga0395900_0009816_5486_6949 482
1383 3300037418 Ga0395900_0012046 Ga0395900_0012046_772_2220 482
1384 3300037418 Ga0395900_0012307 Ga0395900_0012307_6797_8245 482
1385 3300037418 Ga0395900_0013117 Ga0395900_0013117_4067_5515 482
1386 3300037418 Ga0395900_0014269 Ga0395900_0014269_3468_4916 482
1387 3300037418 Ga0395900_0018641 Ga0395900_0018641_4844_6292 482
1388 3300037418 Ga0395900_0025079 Ga0395900_0025079_1186_2634 482
1389 3300037418 Ga0395900_0033500 Ga0395900_0033500_1966_3414 482
1390 3300037418 Ga0395900_0033578 Ga0395900_0033578_2991_4439 482
1391 3300037418 Ga0395900_0039358 Ga0395900_0039358_3124_4572 482
1392 3300037418 Ga0395900_0060275 Ga0395900_0060275_574_2037 482
1393 3300037418 Ga0395900_0064409 Ga0395900_0064409_1821_3269 482
1394 3300037418 Ga0395900_0067116 Ga0395900_0067116_1064_2512 482
1395 3300037418 Ga0395900_0069053 Ga0395900_0069053_1986_3434 482
1396 3300037418 Ga0395900_0075423 Ga0395900_0075423_343_1791 482
1397 3300037418 Ga0395900_0076122 Ga0395900_0076122_1102_2550 482
1398 3300037418 Ga0395900_0081617 Ga0395900_0081617_837_2285 482
1399 3300037418 Ga0395900_0128276 Ga0395900_0128276_113_1561 482
1400 3300037418 Ga0395900_0132690 Ga0395900_0132690_689_2137 482
1401 3300037418 Ga0395900_0133896 Ga0395900_0133896_477_1925 482
1402 3300037418 Ga0395900_0150413 Ga0395900_0150413_169_1617 482
1403 3300037418 Ga0395900_0192575 Ga0395900_0192575_277_1725 482
1404 3300037418 Ga0395900_0259479 Ga0395900_0259479_224_1672 482
1405 3300037466 Ga0395898_0000192 Ga0395898_0000192_48061_49509 482
1406 3300037466 Ga0395898_0001190 Ga0395898_0001190_20303_21751 482
1407 3300037466 Ga0395898_0002752 Ga0395898_0002752_6733_8181 482
1408 3300037466 Ga0395898_0004549 Ga0395898_0004549_13493_14941 482
1409 3300037466 Ga0395898_0007693 Ga0395898_0007693_6408_7856 482
1410 3300037466 Ga0395898_0037634 Ga0395898_0037634_1873_3321 482
1411 3300037466 Ga0395898_0058566 Ga0395898_0058566_2041_3489 482
1412 3300037466 Ga0395898_0067460 Ga0395898_0067460_1525_2973 482
1413 3300037466 Ga0395898_0069154 Ga0395898_0069154_1471_2919 482
1414 3300037466 Ga0395898_0090997 Ga0395898_0090997_685_2148 482
1415 3300037466 Ga0395898_0110151 Ga0395898_0110151_463_1911 482
1416 3300037466 Ga0395898_0183087 Ga0395898_0183087_479_1927 482
1417 3300037466 Ga0395898_0248300 Ga0395898_0248300_90_1538 482
1418 3300037471 Ga0395905_0000066 Ga0395905_0000066_48102_49550 482
1419 3300037471 Ga0395905_0000501 Ga0395905_0000501_38642_40090 482
1420 3300037471 Ga0395905_0001949 Ga0395905_0001949_16686_18134 482
1421 3300037471 Ga0395905_0002085 Ga0395905_0002085_6458_7906 482
1422 3300037471 Ga0395905_0002298 Ga0395905_0002298_16840_18315 482
1423 3300037471 Ga0395905_0002354 Ga0395905_0002354_12956_14404 482
1424 3300037471 Ga0395905_0002529 Ga0395905_0002529_1237_2685 482
1425 3300037471 Ga0395905_0004344 Ga0395905_0004344_7684_9132 482
1426 3300037471 Ga0395905_0005775 Ga0395905_0005775_87_1550 482
1427 3300037471 Ga0395905_0006447 Ga0395905_0006447_3873_5321 482
1428 3300037471 Ga0395905_0008941 Ga0395905_0008941_3609_5057 482
1429 3300037471 Ga0395905_0009820 Ga0395905_0009820_1634_3082 482
1430 3300037471 Ga0395905_0011431 Ga0395905_0011431_5336_6784 482
1431 3300037471 Ga0395905_0014026 Ga0395905_0014026_2946_4394 482
1432 3300037471 Ga0395905_0015211 Ga0395905_0015211_5048_6496 482
1433 3300037471 Ga0395905_0016136 Ga0395905_0016136_2131_3579 482
1434 3300037471 Ga0395905_0017758 Ga0395905_0017758_2405_3853 482
1435 3300037471 Ga0395905_0022215 Ga0395905_0022215_2207_3655 482
1436 3300037471 Ga0395905_0064714 Ga0395905_0064714_243_1691 482
1437 3300037471 Ga0395905_0086140 Ga0395905_0086140_514_1962 482
1438 3300037471 Ga0395905_0123114 Ga0395905_0123114_678_2126 482
1439 3300037471 Ga0395905_0127483 Ga0395905_0127483_150_1598 482
1440 3300037853 Ga0436364_0717863 Ga0436364_0717863_66251_67699 482
1441 3300037853 Ga0436364_1467667 Ga0436364_1467667_3365_4813 482
1442 3300038443 Ga0395901_0000203 Ga0395901_0000203_21644_23092 482
1443 3300038443 Ga0395901_0000249 Ga0395901_0000249_31342_32790 482
1444 3300038443 Ga0395901_0000468 Ga0395901_0000468_24169_25617 482
1445 3300038443 Ga0395901_0001922 Ga0395901_0001922_2109_3557 482
1446 3300038443 Ga0395901_0004933 Ga0395901_0004933_1901_3349 482
1447 3300038443 Ga0395901_0005835 Ga0395901_0005835_7875_9323 482
1448 3300038443 Ga0395901_0005896 Ga0395901_0005896_3138_4586 482
1449 3300038443 Ga0395901_0012944 Ga0395901_0012944_3386_4849 482
1450 3300038443 Ga0395901_0013600 Ga0395901_0013600_332_1780 482
1451 3300038443 Ga0395901_0014884 Ga0395901_0014884_4841_6289 482
1452 3300038443 Ga0395901_0021085 Ga0395901_0021085_1210_2658 482
1453 3300038443 Ga0395901_0021790 Ga0395901_0021790_4054_5502 482
1454 3300038443 Ga0395901_0024237 Ga0395901_0024237_3661_5109 482
1455 3300038443 Ga0395901_0024645 Ga0395901_0024645_262_1710 482
1456 3300038443 Ga0395901_0036995 Ga0395901_0036995_574_2022 482
1457 3300038443 Ga0395901_0043000 Ga0395901_0043000_2418_3866 482
1458 3300038443 Ga0395901_0045097 Ga0395901_0045097_2243_3694 482
1459 3300038443 Ga0395901_0047933 Ga0395901_0047933_2053_3501 482
1460 3300038443 Ga0395901_0057114 Ga0395901_0057114_114_1562 482
1461 3300038443 Ga0395901_0059474 Ga0395901_0059474_1814_3262 482
1462 3300038443 Ga0395901_0085182 Ga0395901_0085182_675_2123 482
1463 3300038443 Ga0395901_0094287 Ga0395901_0094287_1423_2871 482
1464 3300038443 Ga0395901_0094647 Ga0395901_0094647_1078_2526 482
1465 3300038443 Ga0395901_0120186 Ga0395901_0120186_424_1872 482
1466 3300038443 Ga0395901_0152849 Ga0395901_0152849_70_1518 482
1467 3300038443 Ga0395901_0247438 Ga0395901_0247438_235_1683 482
1468 3300038443 Ga0395901_0292186 Ga0395901_0292186_90_1538 482
1469 3300038443 Ga0395901_0331390 Ga0395901_0331390_93_1541 482
1470 3300039437 Ga0436365_0009947 Ga0436365_0009947_4563_6011 482
1471 3300039447 Ga0436361_1020665 Ga0436361_1020665_238_1719 482
1472 3300042005 Ga0439448_0004421 Ga0439448_0004421_124_1572 482
1473 3300042007 Ga0439449_0017869 Ga0439449_0017869_35_1492 482
1474 3300042007 Ga0439449_0018892 Ga0439449_0018892_482_1930 482
1475 3300042144 Ga0450889_000174 Ga0450889_000174_4332_5780 482
1476 3300042157 Ga0439458_0000911 Ga0439458_0000911_5452_6900 482
1477 3300042439 Ga0439464_0020636 Ga0439464_0020636_207_1655 482
1478 3300044656 Ga0466969_0001359 Ga0466969_0001359_7911_9362 482
1479 3300044658 Ga0466972_0027364 Ga0466972_0027364_1170_2618 482
1480 3300044684 Ga0466966_0005151 Ga0466966_0005151_2096_3544 482
1481 3300044684 Ga0466966_0008479 Ga0466966_0008479_1149_2597 482
1482 3300044693 Ga0466961_0004065 Ga0466961_0004065_7035_8483 482
1483 3300044693 Ga0466961_0054089 Ga0466961_0054089_601_2049 482
1484 3300044694 Ga0466963_0003992 Ga0466963_0003992_6934_8382 482
1485 3300044694 Ga0466963_0006173 Ga0466963_0006173_1408_2856 482
1486 3300044694 Ga0466963_0006348 Ga0466963_0006348_3856_5304 482
1487 3300044694 Ga0466963_0078550 Ga0466963_0078550_66_1517 482
1488 3300044712 Ga0453684_0207636 Ga0453684_0207636_488_1945 482
1489 3300044719 Ga0466971_0004819 Ga0466971_0004819_1803_3251 482
1490 3300044719 Ga0466971_0026674 Ga0466971_0026674_215_1663 482
1491 3300044765 Ga0466970_0002777 Ga0466970_0002777_6317_7765 482
1492 3300044765 Ga0466970_0079507 Ga0466970_0079507_88_1536 482
1493 3300044842 Ga0466957_0001016 Ga0466957_0001016_5691_7139 482
1494 3300044842 Ga0466957_0009753 Ga0466957_0009753_3154_4602 482
1495 3300045836 Ga0466958_0001284 Ga0466958_0001284_124_1572 482
1496 3300045836 Ga0466958_0028353 Ga0466958_0028353_1149_2597 482
1497 3300045836 Ga0466958_0047917 Ga0466958_0047917_1045_2493 482
1498 3300045976 Ga0466967_0006319 Ga0466967_0006319_1353_2801 482
1499 3300045976 Ga0466967_0006556 Ga0466967_0006556_4061_5509 482
1500 3300045976 Ga0466967_0010103 Ga0466967_0010103_2429_3880 482
1501 3300045976 Ga0466967_0099166 Ga0466967_0099166_933_2381 482
1502 3300045976 Ga0466967_0204192 Ga0466967_0204192_261_1709 482
1503 3300045976 Ga0466967_0248700 Ga0466967_0248700_192_1640 482
1504 3300046455 Ga0495603_0073825 Ga0495603_0073825_127_1674 482
1505 3300046459 Ga0495629_0102047 Ga0495629_0102047_183_1730 482
1506 3300046461 Ga0495641_0035313 Ga0495641_0035313_791_2338 482
1507 3300046472 Ga0495580_0072753 Ga0495580_0072753_246_1793 482
1508 3300046492 Ga0495585_0006361 Ga0495585_0006361_5045_6592 482
1509 3300046501 Ga0495607_0041492 Ga0495607_0041492_900_2447 482
1510 3300046511 Ga0495608_0039239 Ga0495608_0039239_1541_3013 482
1511 3300046516 Ga0495628_0033392 Ga0495628_0033392_2593_4065 482
1512 3300046517 Ga0495630_0036945 Ga0495630_0036945_1704_3176 482
1513 3300046536 Ga0495587_0025783 Ga0495587_0025783_1033_2505 482
1514 3300046537 Ga0495598_0006933 Ga0495598_0006933_840_2288 482
1515 3300046537 Ga0495598_0010196 Ga0495598_0010196_125_1573 482
1516 3300046539 Ga0495621_0000768 Ga0495621_0000768_764_2212 482
1517 3300046558 Ga0495633_0017011 Ga0495633_0017011_1699_3147 482
1518 3300046616 Ga0495668_0094790 Ga0495668_0094790_100_1584 482
1519 3300046679 Ga0495623_0009670 Ga0495623_0009670_3661_5133 482
1520 3300046683 Ga0495658_0051463 Ga0495658_0051463_766_2313 482
1521 3300046684 Ga0495669_0000413 Ga0495669_0000413_19_1467 482
1522 3300046684 Ga0495669_0013834 Ga0495669_0013834_1411_2859 482
1523 3300046684 Ga0495669_0014360 Ga0495669_0014360_515_1972 482
1524 3300046684 Ga0495669_0021039 Ga0495669_0021039_109_1557 482
1525 3300046684 Ga0495669_0063074 Ga0495669_0063074_151_1599 482
1526 3300046689 Ga0495613_0039121 Ga0495613_0039121_1267_2814 482
1527 3300046691 Ga0495670_0007826 Ga0495670_0007826_2500_4047 482
1528 3300046691 Ga0495670_0014349 Ga0495670_0014349_1557_3005 482
1529 3300046691 Ga0495670_0047786 Ga0495670_0047786_650_2098 482
1530 3300046794 Ga0495589_0041442 Ga0495589_0041442_543_2090 482
1531 3300047444 Ga0495675_0043629 Ga0495675_0043629_990_2462 482
1532 3300047445 Ga0495677_0004211 Ga0495677_0004211_2744_4219 482
1533 3300047471 Ga0495684_0031512 Ga0495684_0031512_1825_3372 482
1534 3300048903 Ga0496100_0013522 Ga0496100_0013522_1573_3120 482
1535 3300048903 Ga0496100_0043356 Ga0496100_0043356_831_2279 482
1536 3300048903 Ga0496100_0073255 Ga0496100_0073255_535_1983 482
1537 3300048903 Ga0496100_0172016 Ga0496100_0172016_90_1538 482
1538 3300048904 Ga0496101_0001067 Ga0496101_0001067_6549_8096 482
1539 3300048904 Ga0496101_0025224 Ga0496101_0025224_1807_3255 482
1540 3300048904 Ga0496101_0064682 Ga0496101_0064682_819_2267 482
1541 3300048904 Ga0496101_0159795 Ga0496101_0159795_64_1584 482
1542 3300048905 Ga0496102_0002312 Ga0496102_0002312_7641_9188 482
1543 3300048905 Ga0496102_0005444 Ga0496102_0005444_3176_4624 482
1544 3300048905 Ga0496102_0052570 Ga0496102_0052570_499_2046 482
1545 3300048905 Ga0496102_0235132 Ga0496102_0235132_248_1699 482
1546 3300048906 Ga0496103_0001417 Ga0496103_0001417_4323_5870 482
1547 3300048907 Ga0496104_0005127 Ga0496104_0005127_1926_3446 482
1548 3300048907 Ga0496104_0010566 Ga0496104_0010566_1381_2928 482
1549 3300048907 Ga0496104_0070597 Ga0496104_0070597_110_1657 482
1550 3300048908 Ga0496105_0001119 Ga0496105_0001119_3699_5246 482
1551 3300048909 Ga0496106_0004576 Ga0496106_0004576_2266_3813 482
1552 3300048909 Ga0496106_0010389 Ga0496106_0010389_4821_6269 482
1553 3300048909 Ga0496106_0159291 Ga0496106_0159291_123_1577 482
1554 3300048910 Ga0496107_0000289 Ga0496107_0000289_8188_9735 482
1555 3300048910 Ga0496107_0004715 Ga0496107_0004715_7243_8691 482
1556 3300048910 Ga0496107_0008885 Ga0496107_0008885_5364_6812 482
1557 3300048910 Ga0496107_0011905 Ga0496107_0011905_1830_3278 482
1558 3300048911 Ga0496108_0001325 Ga0496108_0001325_8762_10309 482
1559 3300048911 Ga0496108_0004348 Ga0496108_0004348_3448_4896 482
1560 3300048911 Ga0496108_0004596 Ga0496108_0004596_2661_4109 482
1561 3300048911 Ga0496108_0131299 Ga0496108_0131299_184_1632 482
1562 3300048912 Ga0496109_0005139 Ga0496109_0005139_7130_8578 482
1563 3300048912 Ga0496109_0006697 Ga0496109_0006697_1907_3454 482
1564 3300048912 Ga0496109_0010584 Ga0496109_0010584_5753_7201 482
1565 3300048912 Ga0496109_0011548 Ga0496109_0011548_3449_4897 482
1566 3300048912 Ga0496109_0016687 Ga0496109_0016687_2117_3637 482
1567 3300048912 Ga0496109_0020575 Ga0496109_0020575_4203_5651 482
1568 3300048913 Ga0496110_0000304 Ga0496110_0000304_387_1835 482
1569 3300048913 Ga0496110_0005164 Ga0496110_0005164_1564_3111 482
1570 3300048913 Ga0496110_0010787 Ga0496110_0010787_5671_7119 482
1571 3300048913 Ga0496110_0050431 Ga0496110_0050431_2101_3549 482
1572 3300048913 Ga0496110_0095887 Ga0496110_0095887_1064_2512 482
1573 3300048913 Ga0496110_0124002 Ga0496110_0124002_345_1793 482
1574 3300048914 Ga0496111_0005184 Ga0496111_0005184_5957_7405 482
1575 3300048914 Ga0496111_0007993 Ga0496111_0007993_3182_4729 482
1576 3300048914 Ga0496111_0010979 Ga0496111_0010979_3425_4873 482
1577 3300048914 Ga0496111_0019705 Ga0496111_0019705_2261_3709 482
1578 3300048914 Ga0496111_0025743 Ga0496111_0025743_2317_3765 482
1579 3300048914 Ga0496111_0030244 Ga0496111_0030244_458_1906 482
1580 3300048914 Ga0496111_0079597 Ga0496111_0079597_722_2170 482
1581 3300048915 Ga0496112_0000602 Ga0496112_0000602_22274_23722 482
1582 3300048915 Ga0496112_0005334 Ga0496112_0005334_2872_4320 482
1583 3300048915 Ga0496112_0026958 Ga0496112_0026958_3386_4834 482
1584 3300048915 Ga0496112_0030210 Ga0496112_0030210_3730_5178 482
1585 3300048915 Ga0496112_0037155 Ga0496112_0037155_2526_3974 482
1586 3300048915 Ga0496112_0107262 Ga0496112_0107262_571_2040 482
1587 3300048915 Ga0496112_0119077 Ga0496112_0119077_892_2340 482
1588 3300048916 Ga0496113_0001600 Ga0496113_0001600_6493_7941 482
1589 3300048916 Ga0496113_0006907 Ga0496113_0006907_2394_3941 482
1590 3300048916 Ga0496113_0012073 Ga0496113_0012073_178_1626 482
1591 3300048916 Ga0496113_0040018 Ga0496113_0040018_1024_2472 482
1592 3300048916 Ga0496113_0088853 Ga0496113_0088853_78_1526 482
1593 3300048917 Ga0496114_0000006 Ga0496114_0000006_42558_44006 482
1594 3300048917 Ga0496114_0032503 Ga0496114_0032503_1721_3169 482
1595 3300048917 Ga0496114_0038872 Ga0496114_0038872_1051_2499 482
1596 3300048918 Ga0496115_0000579 Ga0496115_0000579_17592_19139 482
1597 3300048918 Ga0496115_0028051 Ga0496115_0028051_2135_3583 482
1598 3300049568 Ga0501031_0031857 Ga0501031_0031857_1388_2863 482
1599 3300049569 Ga0501032_0005057 Ga0501032_0005057_4504_5979 482
1600 3300049570 Ga0501033_0005309 Ga0501033_0005309_3773_5248 482
1601 3300049571 Ga0501034_0049154 Ga0501034_0049154_1242_2714 482
1602 3300049571 Ga0501034_0224832 Ga0501034_0224832_140_1597 482
1603 3300049573 Ga0501037_0000616 Ga0501037_0000616_12701_14176 482
1604 3300049574 Ga0501038_0029781 Ga0501038_0029781_3020_4474 482
1605 3300049579 Ga0501043_0000107 Ga0501043_0000107_46992_48467 482
1606 3300049584 Ga0501068_0120926 Ga0501068_0120926_82_1557 482
1607 3300049585 Ga0501069_0000039 Ga0501069_0000039_61390_62865 482
1608 3300049586 Ga0501070_0000132 Ga0501070_0000132_28032_29507 482
1609 3300049586 Ga0501070_0000299 Ga0501070_0000299_27109_28593 482
1610 3300049587 Ga0501071_0018641 Ga0501071_0018641_1749_3197 482
1611 3300049590 Ga0501074_0001123 Ga0501074_0001123_2542_4017 482
1612 3300049593 Ga0501077_0044349 Ga0501077_0044349_534_1988 482
1613 3300049679 Ga0501249_012773 Ga0501249_012773_296_1744 482
1614 3300049742 Ga0501080_0001676 Ga0501080_0001676_381_1865 482
1615 3300049742 Ga0501080_0012571 Ga0501080_0012571_2203_3678 482
1616 3300049744 Ga0501083_0000065 Ga0501083_0000065_71148_72623 482
1617 3300049822 Ga0501035_0000055 Ga0501035_0000055_123953_125428 482
1618 3300049822 Ga0501035_0009706 Ga0501035_0009706_5596_7080 482
1619 3300049823 Ga0501044_0000071 Ga0501044_0000071_11247_12722 482
1620 3300049823 Ga0501044_0023391 Ga0501044_0023391_4723_6207 482
1621 3300050493 nmdc:mga0k408_47712_c1 nmdc:mga0k408_47712_c1_126_1595 482
1622 3300050507 nmdc:mga05p37_155759_c1 nmdc:mga05p37_155759_c1_1059_2606 482
1623 3300050507 nmdc:mga05p37_711_c1 nmdc:mga05p37_711_c1_29591_31081 482
1624 3300050508 nmdc:mga09592_197675_c1 nmdc:mga09592_197675_c1_216_1664 482
1625 3300050508 nmdc:mga09592_3348_c1 nmdc:mga09592_3348_c1_9383_10873 482
1626 3300050510 nmdc:mga06r32_15930_c1 nmdc:mga06r32_15930_c1_1380_2828 482
1627 3300050510 nmdc:mga06r32_247_c1 nmdc:mga06r32_247_c1_13455_14945 482
1628 3300050511 nmdc:mga08y16_24024_c1 nmdc:mga08y16_24024_c1_1351_2799 482
1629 3300050511 nmdc:mga08y16_47929_c1 nmdc:mga08y16_47929_c1_807_2255 482
1630 3300053083 Ga0495655_0018656 Ga0495655_0018656_57_1505 482
1631 3300053119 Ga0500595_004812 Ga0500595_004812_2207_3703 482
1632 3300053134 Ga0500658_0000208 Ga0500658_0000208_26280_27728 482
1633 3300054114 Ga0501084_0086080 Ga0501084_0086080_966_2456 482
1634 3300061719 Ga0466962_0003266 Ga0466962_0003266_4509_5957 482
1635 3300061719 Ga0466962_0006762 Ga0466962_0006762_1620_3068 482
1636 3300061719 Ga0466962_0059021 Ga0466962_0059021_40_1488 482
1637 iso_pu_bacteria 2523231067 2523466134 482
1638 iso_pu_bacteria 2582581305 2585263045 482
1639 iso_pu_bacteria 2643221541 2643727537 482
1640 iso_pu_bacteria 2643221606 2644041303 482
1641 iso_pu_bacteria 2643221623 2644132908 482
1642 iso_pu_bacteria 2643221671 2644394843 482
1643 iso_pu_bacteria 2917554339 2917557730 482
1644 iso_pu_bacteria 2939669807 2939670154 482
1645 3300001915 JGI24741J21665_1004521 JGI24741J21665_10045212 483
1646 3300001989 JGI24739J22299_10006470 JGI24739J22299_100064707 483
1647 3300001989 JGI24739J22299_10023285 JGI24739J22299_100232852 483
1648 3300001990 JGI24737J22298_10005307 JGI24737J22298_100053075 483
1649 3300001990 JGI24737J22298_10007664 JGI24737J22298_100076642 483
1650 3300002067 JGI24735J21928_10015462 JGI24735J21928_100154622 483
1651 3300002075 JGI24738J21930_10000184 JGI24738J21930_100001848 483
1652 3300002075 JGI24738J21930_10002751 JGI24738J21930_100027515 483
1653 3300003214 JGI25165J46597_1000043 JGI25165J46597_1000043172 483
1654 3300005327 Ga0070658_10000479 Ga0070658_1000047921 483
1655 3300005327 Ga0070658_10006525 Ga0070658_100065259 483
1656 3300005333 Ga0070677_10000313 Ga0070677_100003135 483
1657 3300005334 Ga0068869_100166989 Ga0068869_1001669891 483
1658 3300005338 Ga0068868_100019655 Ga0068868_1000196553 483
1659 3300005339 Ga0070660_100004583 Ga0070660_1000045835 483
1660 3300005339 Ga0070660_100037771 Ga0070660_1000377713 483
1661 3300005340 Ga0070689_100093709 Ga0070689_1000937092 483
1662 3300005344 Ga0070661_100021239 Ga0070661_1000212393 483
1663 3300005354 Ga0070675_100006627 Ga0070675_1000066279 483
1664 3300005355 Ga0070671_100008209 Ga0070671_1000082093 483
1665 3300005355 Ga0070671_100053502 Ga0070671_1000535021 483
1666 3300005355 Ga0070671_100108398 Ga0070671_1001083982 483
1667 3300005356 Ga0070674_100020407 Ga0070674_1000204072 483
1668 3300005364 Ga0070673_100051154 Ga0070673_1000511542 483
1669 3300005366 Ga0070659_100018877 Ga0070659_1000188776 483
1670 3300005434 Ga0070709_10003261 Ga0070709_100032616 483
1671 3300005434 Ga0070709_10007053 Ga0070709_100070534 483
1672 3300005436 Ga0070713_100003651 Ga0070713_1000036513 483
1673 3300005437 Ga0070710_10000852 Ga0070710_100008525 483
1674 3300005437 Ga0070710_10026755 Ga0070710_100267552 483
1675 3300005439 Ga0070711_100031096 Ga0070711_1000310962 483
1676 3300005439 Ga0070711_100039533 Ga0070711_1000395332 483
1677 3300005441 Ga0070700_100083333 Ga0070700_1000833332 483
1678 3300005456 Ga0070678_100026940 Ga0070678_1000269404 483
1679 3300005457 Ga0070662_100007108 Ga0070662_1000071088 483
1680 3300005457 Ga0070662_100121128 Ga0070662_1001211282 483
1681 3300005458 Ga0070681_10063330 Ga0070681_100633303 483
1682 3300005466 Ga0070685_10007722 Ga0070685_100077224 483
1683 3300005543 Ga0070672_100004199 Ga0070672_1000041999 483
1684 3300005563 Ga0068855_100000023 Ga0068855_10000002318 483
1685 3300005614 Ga0068856_100003591 Ga0068856_1000035919 483
1686 3300005616 Ga0068852_100003329 Ga0068852_1000033294 483
1687 3300005617 Ga0068859_100231383 Ga0068859_1002313831 483
1688 3300005618 Ga0068864_100038262 Ga0068864_1000382623 483
1689 3300005937 Ga0081455_10004048 Ga0081455_100040488 483
1690 3300005937 Ga0081455_10117778 Ga0081455_101177782 483
1691 3300005981 Ga0081538_10023134 Ga0081538_100231342 483
1692 3300006163 Ga0070715_10011011 Ga0070715_100110113 483
1693 3300006173 Ga0070716_100003372 Ga0070716_1000033725 483
1694 3300006237 Ga0097621_100001076 Ga0097621_10000107618 483
1695 3300006237 Ga0097621_100064364 Ga0097621_1000643641 483
1696 3300006358 Ga0068871_100041487 Ga0068871_1000414873 483
1697 3300006881 Ga0068865_100076170 Ga0068865_1000761703 483
1698 3300006881 Ga0068865_100081124 Ga0068865_1000811242 483
1699 3300006931 Ga0097620_100231380 Ga0097620_1002313801 483
1700 3300009101 Ga0105247_10014973 Ga0105247_100149733 483
1701 3300009176 Ga0105242_10054054 Ga0105242_100540541 483
1702 3300009545 Ga0105237_10059304 Ga0105237_100593047 483
1703 3300009545 Ga0105237_10068625 Ga0105237_100686252 483
1704 3300009545 Ga0105237_10138109 Ga0105237_101381092 483
1705 3300013297 Ga0157378_10054431 Ga0157378_100544312 483
1706 3300017792 Ga0163161_10019426 Ga0163161_100194268 483
1707 3300021384 Ga0213876_10009789 Ga0213876_100097893 483
1708 3300025231 Ga0207427_101450 Ga0207427_1014506 483
1709 3300025254 Ga0209148_1000238 Ga0209148_100023855 483
1710 3300025254 Ga0209148_1001034 Ga0209148_100103421 483
1711 3300025261 Ga0209233_1000079 Ga0209233_100007998 483
1712 3300025272 Ga0209455_1000952 Ga0209455_100095210 483
1713 3300025292 Ga0209676_1000065 Ga0209676_1000065169 483
1714 3300025298 Ga0209050_1011937 Ga0209050_10119372 483
1715 3300025893 Ga0207682_10000362 Ga0207682_1000036221 483
1716 3300025898 Ga0207692_10013772 Ga0207692_100137723 483
1717 3300025898 Ga0207692_10033697 Ga0207692_100336972 483
1718 3300025904 Ga0207647_10002647 Ga0207647_1000264710 483
1719 3300025904 Ga0207647_10011193 Ga0207647_100111931 483
1720 3300025905 Ga0207685_10005166 Ga0207685_100051663 483
1721 3300025906 Ga0207699_10014726 Ga0207699_100147262 483
1722 3300025909 Ga0207705_10000121 Ga0207705_1000012125 483
1723 3300025914 Ga0207671_10092444 Ga0207671_100924442 483
1724 3300025915 Ga0207693_10002346 Ga0207693_100023469 483
1725 3300025916 Ga0207663_10015942 Ga0207663_100159422 483
1726 3300025919 Ga0207657_10076439 Ga0207657_100764392 483
1727 3300025921 Ga0207652_10217432 Ga0207652_102174321 483
1728 3300025926 Ga0207659_10129680 Ga0207659_101296801 483
1729 3300025929 Ga0207664_10018330 Ga0207664_100183305 483
1730 3300025931 Ga0207644_10022986 Ga0207644_100229865 483
1731 3300025931 Ga0207644_10040377 Ga0207644_100403773 483
1732 3300025933 Ga0207706_10008805 Ga0207706_100088058 483
1733 3300025933 Ga0207706_10120500 Ga0207706_101205002 483
1734 3300025934 Ga0207686_10012154 Ga0207686_100121542 483
1735 3300025939 Ga0207665_10002995 Ga0207665_100029953 483
1736 3300025940 Ga0207691_10009162 Ga0207691_100091627 483
1737 3300025941 Ga0207711_10023856 Ga0207711_100238563 483
1738 3300025949 Ga0207667_10000016 Ga0207667_1000001627 483
1739 3300025981 Ga0207640_10000063 Ga0207640_1000006330 483
1740 3300025981 Ga0207640_10026318 Ga0207640_100263184 483
1741 3300026067 Ga0207678_10001793 Ga0207678_100017935 483
1742 3300026067 Ga0207678_10041939 Ga0207678_100419393 483
1743 3300026075 Ga0207708_10013208 Ga0207708_100132086 483
1744 3300026078 Ga0207702_10002945 Ga0207702_1000294518 483
1745 3300026078 Ga0207702_10047040 Ga0207702_100470402 483
1746 3300026089 Ga0207648_10092097 Ga0207648_100920972 483
1747 3300026116 Ga0207674_10060487 Ga0207674_100604874 483
1748 3300026121 Ga0207683_10015034 Ga0207683_100150343 483
1749 3300026142 Ga0207698_10000130 Ga0207698_1000013023 483
1750 3300028379 Ga0268266_10026789 Ga0268266_100267893 483
1751 3300028577 Ga0265318_10010436 Ga0265318_100104365 483
1752 3300031241 Ga0265325_10000029 Ga0265325_1000002920 483
1753 3300031241 Ga0265325_10077889 Ga0265325_100778891 483
1754 3300031344 Ga0265316_10027060 Ga0265316_100270604 483
1755 3300031456 Ga0307513_10052637 Ga0307513_100526374 483
1756 3300031691 Ga0316579_10019507 Ga0316579_100195073 483
1757 3300035088 Ga0373940_0011193 Ga0373940_0011193_286_1776 483
1758 3300035089 Ga0373944_0005383 Ga0373944_0005383_1323_2813 483
1759 3300035111 Ga0373923_0000770 Ga0373923_0000770_1457_2947 483
1760 3300035112 Ga0373932_0004279 Ga0373932_0004279_742_2232 483
1761 3300035113 Ga0373936_0011986 Ga0373936_0011986_1089_2579 483
1762 3300035116 Ga0373945_0000820 Ga0373945_0000820_6189_7679 483
1763 3300035120 Ga0373957_0049201 Ga0373957_0049201_39_1529 483
1764 3300035170 Ga0373943_0011309 Ga0373943_0011309_775_2265 483
1765 3300035171 Ga0373946_0008895 Ga0373946_0008895_1519_3009 483
1766 3300035172 Ga0373955_0008373 Ga0373955_0008373_378_1868 483
1767 3300035691 Ga0373931_0006062 Ga0373931_0006062_2682_4172 483
1768 3300035692 Ga0373935_0003114 Ga0373935_0003114_463_1953 483
1769 3300035692 Ga0373935_0016336 Ga0373935_0016336_1477_2967 483
1770 3300035724 Ga0373933_0003240 Ga0373933_0003240_1082_2572 483
1771 3300035724 Ga0373933_0003450 Ga0373933_0003450_1661_3151 483
1772 3300035725 Ga0373947_0000967 Ga0373947_0000967_12091_13581 483
1773 3300036401 Ga0373937_0009649 Ga0373937_0009649_1218_2708 483
1774 3300036401 Ga0373937_0023996 Ga0373937_0023996_1974_3464 483
1775 3300036401 Ga0373937_0025035 Ga0373937_0025035_2353_3843 483
1776 3300037068 Ga0373925_0017471 Ga0373925_0017471_519_2009 483
1777 3300037068 Ga0373925_0030685 Ga0373925_0030685_1121_2611 483
1778 3300037471 Ga0395905_0026896 Ga0395905_0026896_1743_3194 483
1779 3300039437 Ga0436365_1089393 Ga0436365_1089393_482_1933 483
1780 3300039437 Ga0436365_1750726 Ga0436365_1750726_9862_11328 483
1781 3300042005 Ga0439448_0002459 Ga0439448_0002459_898_2349 483
1782 3300042005 Ga0439448_0013334 Ga0439448_0013334_153_1604 483
1783 3300042005 Ga0439448_0013353 Ga0439448_0013353_58_1509 483
1784 3300042012 Ga0439455_0001428 Ga0439455_0001428_445_1896 483
1785 3300042157 Ga0439458_0000418 Ga0439458_0000418_1412_2863 483
1786 3300042157 Ga0439458_0003486 Ga0439458_0003486_574_2025 483
1787 3300044658 Ga0466972_0000826 Ga0466972_0000826_6902_8353 483
1788 3300044694 Ga0466963_0005815 Ga0466963_0005815_773_2227 483
1789 3300044706 Ga0466964_0000258 Ga0466964_0000258_5542_6993 483
1790 3300044765 Ga0466970_0075205 Ga0466970_0075205_29_1480 483
1791 3300045049 Ga0466959_0109345 Ga0466959_0109345_24_1478 483
1792 3300046454 Ga0495592_0010286 Ga0495592_0010286_5067_6557 483
1793 3300046455 Ga0495603_0016180 Ga0495603_0016180_681_2171 483
1794 3300046459 Ga0495629_0000329 Ga0495629_0000329_22598_24088 483
1795 3300046459 Ga0495629_0110387 Ga0495629_0110387_377_1867 483
1796 3300046461 Ga0495641_0009705 Ga0495641_0009705_1536_3026 483
1797 3300046462 Ga0495651_0004021 Ga0495651_0004021_8794_10284 483
1798 3300046463 Ga0495653_0014748 Ga0495653_0014748_3523_5013 483
1799 3300046472 Ga0495580_0037173 Ga0495580_0037173_1620_3110 483
1800 3300046473 Ga0495582_0003339 Ga0495582_0003339_1656_3146 483
1801 3300046473 Ga0495582_0004669 Ga0495582_0004669_241_1731 483
1802 3300046475 Ga0495639_0006086 Ga0495639_0006086_2122_3612 483
1803 3300046492 Ga0495585_0001303 Ga0495585_0001303_8088_9578 483
1804 3300046499 Ga0495594_0035406 Ga0495594_0035406_40_1530 483
1805 3300046499 Ga0495594_0060486 Ga0495594_0060486_395_1885 483
1806 3300046501 Ga0495607_0021857 Ga0495607_0021857_1227_2717 483
1807 3300046511 Ga0495608_0005204 Ga0495608_0005204_1526_3016 483
1808 3300046511 Ga0495608_0019490 Ga0495608_0019490_1967_3457 483
1809 3300046511 Ga0495608_0097636 Ga0495608_0097636_250_1740 483
1810 3300046514 Ga0495618_0017248 Ga0495618_0017248_51_1541 483
1811 3300046516 Ga0495628_0033362 Ga0495628_0033362_883_2373 483
1812 3300046517 Ga0495630_0008635 Ga0495630_0008635_15_1505 483
1813 3300046523 Ga0495644_0000434 Ga0495644_0000434_1469_2959 483
1814 3300046529 Ga0495652_0084109 Ga0495652_0084109_1077_2567 483
1815 3300046529 Ga0495652_0117945 Ga0495652_0117945_359_1849 483
1816 3300046531 Ga0495665_0003951 Ga0495665_0003951_950_2440 483
1817 3300046533 Ga0495640_0098855 Ga0495640_0098855_377_1867 483
1818 3300046535 Ga0495586_0047376 Ga0495586_0047376_67_1557 483
1819 3300046536 Ga0495587_0019715 Ga0495587_0019715_1909_3399 483
1820 3300046536 Ga0495587_0064259 Ga0495587_0064259_118_1608 483
1821 3300046543 Ga0495645_0004397 Ga0495645_0004397_4895_6385 483
1822 3300046543 Ga0495645_0044840 Ga0495645_0044840_1368_2858 483
1823 3300046558 Ga0495633_0000643 Ga0495633_0000643_15762_17252 483
1824 3300046559 Ga0495667_0004005 Ga0495667_0004005_5936_7426 483
1825 3300046559 Ga0495667_0015395 Ga0495667_0015395_3221_4711 483
1826 3300046559 Ga0495667_0064954 Ga0495667_0064954_235_1725 483
1827 3300046615 Ga0495656_0001948 Ga0495656_0001948_2438_3928 483
1828 3300046663 Ga0495635_0001379 Ga0495635_0001379_1261_2751 483
1829 3300046663 Ga0495635_0074398 Ga0495635_0074398_573_2063 483
1830 3300046664 Ga0495659_0003909 Ga0495659_0003909_740_2230 483
1831 3300046674 Ga0495588_0003248 Ga0495588_0003248_31_1521 483
1832 3300046675 Ga0495657_0042792 Ga0495657_0042792_1296_2786 483
1833 3300046678 Ga0495599_0022815 Ga0495599_0022815_2077_3567 483
1834 3300046678 Ga0495599_0054617 Ga0495599_0054617_537_2027 483
1835 3300046680 Ga0495646_0008370 Ga0495646_0008370_889_2379 483
1836 3300046683 Ga0495658_0000930 Ga0495658_0000930_11566_13056 483
1837 3300046689 Ga0495613_0016485 Ga0495613_0016485_61_1551 483
1838 3300046690 Ga0495624_0016957 Ga0495624_0016957_995_2485 483
1839 3300046691 Ga0495670_0001695 Ga0495670_0001695_6688_8178 483
1840 3300046809 Ga0495600_0003611 Ga0495600_0003611_1486_2976 483
1841 3300047317 Ga0495604_0006295 Ga0495604_0006295_5809_7299 483
1842 3300047319 Ga0495674_0017914 Ga0495674_0017914_1019_2509 483
1843 3300047321 Ga0495676_0103476 Ga0495676_0103476_566_2053 483
1844 3300047322 Ga0495680_0001729 Ga0495680_0001729_3983_5473 483
1845 3300047322 Ga0495680_0009851 Ga0495680_0009851_1849_3339 483
1846 3300047322 Ga0495680_0010215 Ga0495680_0010215_880_2370 483
1847 3300047322 Ga0495680_0010928 Ga0495680_0010928_1447_2937 483
1848 3300047471 Ga0495684_0009501 Ga0495684_0009501_3892_5382 483
1849 3300047673 Ga0495593_0017149 Ga0495593_0017149_808_2298 483
1850 3300047673 Ga0495593_0018147 Ga0495593_0018147_1931_3421 483
1851 3300048088 Ga0495602_0006038 Ga0495602_0006038_5687_7177 483
1852 3300048903 Ga0496100_0060456 Ga0496100_0060456_501_1991 483
1853 3300048904 Ga0496101_0004772 Ga0496101_0004772_4929_6419 483
1854 3300048905 Ga0496102_0009819 Ga0496102_0009819_1628_3151 483
1855 3300048905 Ga0496102_0242602 Ga0496102_0242602_30_1481 483
1856 3300048907 Ga0496104_0000145 Ga0496104_0000145_28269_29759 483
1857 3300048907 Ga0496104_0015313 Ga0496104_0015313_263_1786 483
1858 3300048907 Ga0496104_0053594 Ga0496104_0053594_2097_3587 483
1859 3300048907 Ga0496104_0235546 Ga0496104_0235546_206_1696 483
1860 3300048908 Ga0496105_0002007 Ga0496105_0002007_716_2206 483
1861 3300048908 Ga0496105_0041918 Ga0496105_0041918_137_1627 483
1862 3300048908 Ga0496105_0057440 Ga0496105_0057440_31_1521 483
1863 3300048909 Ga0496106_0004182 Ga0496106_0004182_8221_9744 483
1864 3300048909 Ga0496106_0061478 Ga0496106_0061478_857_2347 483
1865 3300048910 Ga0496107_0005659 Ga0496107_0005659_350_1873 483
1866 3300048910 Ga0496107_0033404 Ga0496107_0033404_162_1652 483
1867 3300048911 Ga0496108_0005992 Ga0496108_0005992_7999_9522 483
1868 3300048912 Ga0496109_0028813 Ga0496109_0028813_1526_3049 483
1869 3300048912 Ga0496109_0209421 Ga0496109_0209421_53_1576 483
1870 3300048913 Ga0496110_0001396 Ga0496110_0001396_10066_11589 483
1871 3300048913 Ga0496110_0001652 Ga0496110_0001652_4707_6230 483
1872 3300048913 Ga0496110_0076726 Ga0496110_0076726_1294_2784 483
1873 3300048914 Ga0496111_0006534 Ga0496111_0006534_4273_5796 483
1874 3300048915 Ga0496112_0015016 Ga0496112_0015016_4527_6050 483
1875 3300048916 Ga0496113_0026195 Ga0496113_0026195_314_1837 483
1876 3300048916 Ga0496113_0095611 Ga0496113_0095611_270_1793 483
1877 3300048916 Ga0496113_0203090 Ga0496113_0203090_54_1544 483
1878 3300048917 Ga0496114_0061979 Ga0496114_0061979_184_1674 483
1879 3300049568 Ga0501031_0032795 Ga0501031_0032795_1881_3335 483
1880 3300049570 Ga0501033_0067587 Ga0501033_0067587_305_1759 483
1881 3300049571 Ga0501034_0071557 Ga0501034_0071557_867_2324 483
1882 3300049576 Ga0501040_0004434 Ga0501040_0004434_656_2122 483
1883 3300049576 Ga0501040_0066425 Ga0501040_0066425_479_1933 483
1884 3300049577 Ga0501041_0037558 Ga0501041_0037558_583_2037 483
1885 3300049578 Ga0501042_0004850 Ga0501042_0004850_1110_2564 483
1886 3300049580 Ga0501046_0021771 Ga0501046_0021771_873_2339 483
1887 3300049580 Ga0501046_0134750 Ga0501046_0134750_86_1540 483
1888 3300049582 Ga0501048_0012907 Ga0501048_0012907_3860_5326 483
1889 3300049583 Ga0501067_0012826 Ga0501067_0012826_2656_4113 483
1890 3300049584 Ga0501068_0075228 Ga0501068_0075228_491_1957 483
1891 3300049586 Ga0501070_0002059 Ga0501070_0002059_11168_12664 483
1892 3300049586 Ga0501070_0131359 Ga0501070_0131359_48_1523 483
1893 3300049587 Ga0501071_0011260 Ga0501071_0011260_3643_5097 483
1894 3300049588 Ga0501072_0075629 Ga0501072_0075629_1153_2607 483
1895 3300049591 Ga0501075_0001158 Ga0501075_0001158_13383_14849 483
1896 3300049591 Ga0501075_0011537 Ga0501075_0011537_80_1534 483
1897 3300049592 Ga0501076_0003615 Ga0501076_0003615_229_1683 483
1898 3300049741 Ga0501079_0008324 Ga0501079_0008324_5053_6519 483
1899 3300049744 Ga0501083_0070794 Ga0501083_0070794_567_2033 483
1900 3300049822 Ga0501035_0044898 Ga0501035_0044898_709_2163 483
1901 3300049823 Ga0501044_0001093 Ga0501044_0001093_25797_27293 483
1902 3300049824 Ga0501045_0007704 Ga0501045_0007704_5661_7127 483
1903 3300049824 Ga0501045_0087526 Ga0501045_0087526_618_2072 483
1904 3300050512 nmdc:mga0n895_159363_c1 nmdc:mga0n895_159363_c1_133_1623 483
1905 3300053077 Ga0495601_0000248 Ga0495601_0000248_8916_10406 483
1906 3300053077 Ga0495601_0002177 Ga0495601_0002177_1744_3234 483
1907 3300053078 Ga0495612_0000231 Ga0495612_0000231_6278_7768 483
1908 3300053078 Ga0495612_0009360 Ga0495612_0009360_638_2128 483
1909 3300053084 Ga0495595_0007721 Ga0495595_0007721_1727_3217 483
1910 3300053084 Ga0495595_0008103 Ga0495595_0008103_1470_2960 483
1911 3300053084 Ga0495595_0024881 Ga0495595_0024881_565_2055 483
1912 3300053085 Ga0495619_0002240 Ga0495619_0002240_4755_6245 483
1913 3300053085 Ga0495619_0007115 Ga0495619_0007115_981_2471 483
1914 3300053085 Ga0495619_0008090 Ga0495619_0008090_1235_2725 483
1915 3300053085 Ga0495619_0044971 Ga0495619_0044971_51_1541 483
1916 3300054114 Ga0501084_0008002 Ga0501084_0008002_659_2125 483
1917 3300054114 Ga0501084_0027757 Ga0501084_0027757_575_2029 483
1918 3300054114 Ga0501084_0066656 Ga0501084_0066656_195_1649 483
1919 3300060353 Ga0501082_0005139 Ga0501082_0005139_1089_2555 483
1920 3300003215 JGI25153J46596_10014266 JGI25153J46596_100142664 484
1921 3300003775 Ga0055524_1000088 Ga0055524_100008859 484
1922 3300004625 Ga0055543_1007157 Ga0055543_10071574 484
1923 3300005262 Ga0065165_1020337 Ga0065165_10203372 484
1924 3300005330 Ga0070690_100084547 Ga0070690_1000845471 484
1925 3300005335 Ga0070666_10080961 Ga0070666_100809612 484
1926 3300005344 Ga0070661_100012238 Ga0070661_1000122382 484
1927 3300005344 Ga0070661_100014229 Ga0070661_1000142293 484
1928 3300005347 Ga0070668_100141107 Ga0070668_1001411072 484
1929 3300005354 Ga0070675_100013571 Ga0070675_1000135712 484
1930 3300005356 Ga0070674_100001371 Ga0070674_10000137114 484
1931 3300005367 Ga0070667_100003689 Ga0070667_10000368912 484
1932 3300005367 Ga0070667_100029435 Ga0070667_1000294352 484
1933 3300005436 Ga0070713_100083522 Ga0070713_1000835222 484
1934 3300005439 Ga0070711_100000579 Ga0070711_10000057918 484
1935 3300005456 Ga0070678_100044590 Ga0070678_1000445902 484
1936 3300005457 Ga0070662_100128986 Ga0070662_1001289862 484
1937 3300005458 Ga0070681_10086329 Ga0070681_100863292 484
1938 3300005458 Ga0070681_10087020 Ga0070681_100870201 484
1939 3300005458 Ga0070681_10191434 Ga0070681_101914342 484
1940 3300005530 Ga0070679_100124122 Ga0070679_1001241222 484
1941 3300005548 Ga0070665_100060657 Ga0070665_1000606572 484
1942 3300005563 Ga0068855_100021428 Ga0068855_1000214282 484
1943 3300005564 Ga0070664_100001693 Ga0070664_1000016937 484
1944 3300005564 Ga0070664_100006228 Ga0070664_1000062286 484
1945 3300005614 Ga0068856_100004652 Ga0068856_1000046529 484
1946 3300005618 Ga0068864_100148040 Ga0068864_1001480402 484
1947 3300005981 Ga0081538_10023100 Ga0081538_100231004 484
1948 3300005983 Ga0081540_1001876 Ga0081540_10018768 484
1949 3300005983 Ga0081540_1037558 Ga0081540_10375583 484
1950 3300005985 Ga0081539_10001657 Ga0081539_100016575 484
1951 3300006028 Ga0070717_10075667 Ga0070717_100756672 484
1952 3300006175 Ga0070712_100033163 Ga0070712_1000331633 484
1953 3300009094 Ga0111539_10000100 Ga0111539_1000010092 484
1954 3300009177 Ga0105248_10007245 Ga0105248_100072454 484
1955 3300009177 Ga0105248_10026377 Ga0105248_100263777 484
1956 3300009177 Ga0105248_10092035 Ga0105248_100920352 484
1957 3300009551 Ga0105238_10184042 Ga0105238_101840422 484
1958 3300009553 Ga0105249_10063536 Ga0105249_100635362 484
1959 3300013104 Ga0157370_10050230 Ga0157370_100502303 484
1960 3300013296 Ga0157374_10006361 Ga0157374_100063611 484
1961 3300013297 Ga0157378_10092060 Ga0157378_100920603 484
1962 3300013306 Ga0163162_10037737 Ga0163162_100377372 484
1963 3300013306 Ga0163162_10134502 Ga0163162_101345023 484
1964 3300013308 Ga0157375_10009067 Ga0157375_100090673 484
1965 3300014325 Ga0163163_10004133 Ga0163163_1000413311 484
1966 3300015265 Ga0182005_1003002 Ga0182005_10030024 484
1967 3300021388 Ga0213875_10000132 Ga0213875_1000013262 484
1968 3300021388 Ga0213875_10003519 Ga0213875_100035196 484
1969 3300021388 Ga0213875_10024723 Ga0213875_100247233 484
1970 3300025263 Ga0209565_1000010 Ga0209565_1000010437 484
1971 3300025273 Ga0209673_1001854 Ga0209673_100185418 484
1972 3300025292 Ga0209676_1014351 Ga0209676_10143512 484
1973 3300025299 Ga0209256_1000034 Ga0209256_1000034293 484
1974 3300025304 Ga0209257_1002745 Ga0209257_100274513 484
1975 3300025898 Ga0207692_10003138 Ga0207692_100031386 484
1976 3300025901 Ga0207688_10006915 Ga0207688_100069153 484
1977 3300025912 Ga0207707_10094099 Ga0207707_100940993 484
1978 3300025912 Ga0207707_10148033 Ga0207707_101480332 484
1979 3300025912 Ga0207707_10171397 Ga0207707_101713971 484
1980 3300025915 Ga0207693_10039664 Ga0207693_100396643 484
1981 3300025916 Ga0207663_10005526 Ga0207663_100055266 484
1982 3300025919 Ga0207657_10023317 Ga0207657_100233173 484
1983 3300025920 Ga0207649_10049254 Ga0207649_100492543 484
1984 3300025920 Ga0207649_10157032 Ga0207649_101570321 484
1985 3300025925 Ga0207650_10011612 Ga0207650_100116123 484
1986 3300025928 Ga0207700_10032491 Ga0207700_100324913 484
1987 3300025929 Ga0207664_10043101 Ga0207664_100431012 484
1988 3300025931 Ga0207644_10122683 Ga0207644_101226832 484
1989 3300025933 Ga0207706_10030146 Ga0207706_100301464 484
1990 3300025937 Ga0207669_10022647 Ga0207669_100226473 484
1991 3300025941 Ga0207711_10004897 Ga0207711_100048975 484
1992 3300025942 Ga0207689_10057405 Ga0207689_100574052 484
1993 3300025945 Ga0207679_10004129 Ga0207679_100041295 484
1994 3300025949 Ga0207667_10014472 Ga0207667_100144723 484
1995 3300025986 Ga0207658_10010837 Ga0207658_100108372 484
1996 3300025986 Ga0207658_10031213 Ga0207658_100312133 484
1997 3300026023 Ga0207677_10085573 Ga0207677_100855732 484
1998 3300026067 Ga0207678_10002870 Ga0207678_100028705 484
1999 3300026078 Ga0207702_10003419 Ga0207702_1000341910 484
2000 3300026118 Ga0207675_100000671 Ga0207675_10000067110 484
2001 3300026118 Ga0207675_100006751 Ga0207675_10000675112 484
2002 3300027907 Ga0207428_10000096 Ga0207428_1000009656 484
2003 3300031241 Ga0265325_10004697 Ga0265325_100046978 484
2004 3300031247 Ga0265340_10001702 Ga0265340_100017024 484
2005 3300031247 Ga0265340_10020431 Ga0265340_100204312 484
2006 3300031247 Ga0265340_10074699 Ga0265340_100746991 484
2007 3300031249 Ga0265339_10003856 Ga0265339_100038568 484
2008 3300031251 Ga0265327_10013944 Ga0265327_100139444 484
2009 3300031344 Ga0265316_10015638 Ga0265316_100156384 484
2010 3300031344 Ga0265316_10067960 Ga0265316_100679603 484
2011 3300031456 Ga0307513_10105246 Ga0307513_101052462 484
2012 3300031595 Ga0265313_10000225 Ga0265313_1000022527 484
2013 3300031711 Ga0265314_10097242 Ga0265314_100972422 484
2014 3300031712 Ga0265342_10012486 Ga0265342_100124863 484
2015 3300031824 Ga0307413_10115352 Ga0307413_101153522 484
2016 3300031852 Ga0307410_10073113 Ga0307410_100731132 484
2017 3300031995 Ga0307409_100014001 Ga0307409_1000140012 484
2018 3300032005 Ga0307411_10034806 Ga0307411_100348062 484
2019 3300036401 Ga0373937_0101707 Ga0373937_0101707_266_1720 484
2020 3300037471 Ga0395905_0001950 Ga0395905_0001950_13365_14819 484
2021 3300037471 Ga0395905_0023342 Ga0395905_0023342_4107_5591 484
2022 3300037471 Ga0395905_0216561 Ga0395905_0216561_11_1465 484
2023 3300037853 Ga0436364_0061163 Ga0436364_0061163_541_1995 484
2024 3300037853 Ga0436364_0875825 Ga0436364_0875825_1474_2928 484
2025 3300037853 Ga0436364_0992577 Ga0436364_0992577_25405_26871 484
2026 3300038443 Ga0395901_0106522 Ga0395901_0106522_1013_2467 484
2027 3300039437 Ga0436365_0578833 Ga0436365_0578833_1274_2728 484
2028 3300039447 Ga0436361_0190268 Ga0436361_0190268_44_1555 484
2029 3300041410 Ga0439461_0001084 Ga0439461_0001084_1517_2974 484
2030 3300041413 Ga0439465_0002861 Ga0439465_0002861_3438_4895 484
2031 3300041997 Ga0439431_0000147 Ga0439431_0000147_4594_6051 484
2032 3300042004 Ga0439445_0001425 Ga0439445_0001425_2762_4219 484
2033 3300042006 Ga0439432_002908 Ga0439432_002908_3437_4894 484
2034 3300042015 Ga0439462_0002656 Ga0439462_0002656_2151_3608 484
2035 3300042156 Ga0439446_0003397 Ga0439446_0003397_1490_2947 484
2036 3300042435 Ga0439434_0002355 Ga0439434_0002355_884_2341 484
2037 3300042435 Ga0439434_0005577 Ga0439434_0005577_2137_3594 484
2038 3300042439 Ga0439464_0007652 Ga0439464_0007652_1250_2731 484
2039 3300044684 Ga0466966_0018074 Ga0466966_0018074_2572_4068 484
2040 3300045976 Ga0466967_0046549 Ga0466967_0046549_1019_2503 484
2041 3300045976 Ga0466967_0056920 Ga0466967_0056920_36_1523 484
2042 3300046460 Ga0495638_0046750 Ga0495638_0046750_1194_2672 484
2043 3300046694 Ga0495649_0022001 Ga0495649_0022001_831_2285 484
2044 3300047320 Ga0495672_0009403 Ga0495672_0009403_4723_6177 484
2045 3300047472 Ga0495686_0000191 Ga0495686_0000191_44753_46207 484
2046 3300048911 Ga0496108_0002014 Ga0496108_0002014_3010_4491 484
2047 3300048912 Ga0496109_0039714 Ga0496109_0039714_630_2111 484
2048 3300048914 Ga0496111_0004756 Ga0496111_0004756_1890_3371 484
2049 3300048915 Ga0496112_0010372 Ga0496112_0010372_1913_3394 484
2050 3300048915 Ga0496112_0029553 Ga0496112_0029553_1911_3398 484
2051 3300048915 Ga0496112_0210890 Ga0496112_0210890_270_1748 484
2052 3300049570 Ga0501033_0009635 Ga0501033_0009635_2126_3589 484
2053 3300049570 Ga0501033_0112971 Ga0501033_0112971_187_1641 484
2054 3300049571 Ga0501034_0082196 Ga0501034_0082196_1744_3207 484
2055 3300049572 Ga0501036_0021478 Ga0501036_0021478_1225_2688 484
2056 3300049579 Ga0501043_0031499 Ga0501043_0031499_2511_3965 484
2057 3300049583 Ga0501067_0000657 Ga0501067_0000657_9577_11040 484
2058 3300049586 Ga0501070_0105445 Ga0501070_0105445_266_1720 484
2059 3300049742 Ga0501080_0077332 Ga0501080_0077332_198_1652 484
2060 3300049742 Ga0501080_0105444 Ga0501080_0105444_837_2291 484
2061 3300049822 Ga0501035_0016756 Ga0501035_0016756_24_1487 484
2062 3300049823 Ga0501044_0098394 Ga0501044_0098394_1394_2857 484
2063 3300049823 Ga0501044_0121596 Ga0501044_0121596_168_1622 484
2064 3300053087 Ga0500643_014850 Ga0500643_014850_45_1502 484
2065 3300053134 Ga0500658_0006808 Ga0500658_0006808_2729_4186 484
2066 3300053178 Ga0500637_0008446 Ga0500637_0008446_1222_2676 484
2067 3300054114 Ga0501084_0030241 Ga0501084_0030241_933_2396 484
2068 3300054114 Ga0501084_0113270 Ga0501084_0113270_51_1514 484
2069 3300060353 Ga0501082_0015165 Ga0501082_0015165_932_2395 484
2070 iso_pu_bacteria 2990265787 2990266706 484
2071 3300001990 JGI24737J22298_10008831 JGI24737J22298_100088313 485
2072 3300002774 JGI25150J39212_1000285 JGI25150J39212_100028524 485
2073 3300003187 JGI25151J46595_10029309 JGI25151J46595_100293093 485
2074 3300003214 JGI25165J46597_1000028 JGI25165J46597_1000028221 485
2075 3300003214 JGI25165J46597_1000573 JGI25165J46597_10005733 485
2076 3300003215 JGI25153J46596_10000044 JGI25153J46596_1000004482 485
2077 3300003215 JGI25153J46596_10000113 JGI25153J46596_1000011343 485
2078 3300003215 JGI25153J46596_10001297 JGI25153J46596_100012977 485
2079 3300003759 Ga0055525_1000051 Ga0055525_1000051185 485
2080 3300003762 Ga0055542_1000020 Ga0055542_1000020303 485
2081 3300003763 Ga0055529_1000016 Ga0055529_100001643 485
2082 3300003771 Ga0055526_1000860 Ga0055526_100086012 485
2083 3300003773 Ga0055537_1001353 Ga0055537_10013535 485
2084 3300003781 Ga0055536_1000643 Ga0055536_100064317 485
2085 3300003781 Ga0055536_1003738 Ga0055536_10037383 485
2086 3300003781 Ga0055536_1005185 Ga0055536_10051855 485
2087 3300003791 Ga0055530_10000035 Ga0055530_1000003524 485
2088 3300003791 Ga0055530_10012785 Ga0055530_100127851 485
2089 3300003794 Ga0055531_10008646 Ga0055531_100086465 485
2090 3300003794 Ga0055531_10014014 Ga0055531_100140145 485
2091 3300005333 Ga0070677_10030438 Ga0070677_100304382 485
2092 3300005339 Ga0070660_100000681 Ga0070660_10000068116 485
2093 3300005344 Ga0070661_100009916 Ga0070661_1000099166 485
2094 3300005345 Ga0070692_10002933 Ga0070692_100029334 485
2095 3300005347 Ga0070668_100000123 Ga0070668_10000012312 485
2096 3300005355 Ga0070671_100000800 Ga0070671_10000080016 485
2097 3300005355 Ga0070671_100129176 Ga0070671_1001291762 485
2098 3300005356 Ga0070674_100000718 Ga0070674_1000007185 485
2099 3300005356 Ga0070674_100000748 Ga0070674_10000074810 485
2100 3300005455 Ga0070663_100088654 Ga0070663_1000886541 485
2101 3300005456 Ga0070678_100000174 Ga0070678_1000001746 485
2102 3300005548 Ga0070665_100000044 Ga0070665_100000044223 485
2103 3300005564 Ga0070664_100068165 Ga0070664_1000681652 485
2104 3300005841 Ga0068863_100000020 Ga0068863_10000002040 485
2105 3300005841 Ga0068863_100019074 Ga0068863_1000190743 485
2106 3300005842 Ga0068858_100002032 Ga0068858_10000203211 485
2107 3300005843 Ga0068860_100000437 Ga0068860_10000043725 485
2108 3300005844 Ga0068862_100000135 Ga0068862_10000013520 485
2109 3300005844 Ga0068862_100065008 Ga0068862_1000650084 485
2110 3300005937 Ga0081455_10070836 Ga0081455_100708362 485
2111 3300005985 Ga0081539_10004963 Ga0081539_1000496311 485
2112 3300005985 Ga0081539_10022108 Ga0081539_100221084 485
2113 3300006195 Ga0075366_10011090 Ga0075366_100110906 485
2114 3300006237 Ga0097621_100010249 Ga0097621_1000102496 485
2115 3300006871 Ga0075434_100118519 Ga0075434_1001185192 485
2116 3300009098 Ga0105245_10000829 Ga0105245_100008294 485
2117 3300009101 Ga0105247_10003366 Ga0105247_100033669 485
2118 3300009174 Ga0105241_10003211 Ga0105241_100032116 485
2119 3300009176 Ga0105242_10116791 Ga0105242_101167912 485
2120 3300009177 Ga0105248_10023426 Ga0105248_100234265 485
2121 3300009177 Ga0105248_10208927 Ga0105248_102089272 485
2122 3300009545 Ga0105237_10235766 Ga0105237_102357662 485
2123 3300009553 Ga0105249_10000097 Ga0105249_1000009732 485
2124 3300009553 Ga0105249_10132355 Ga0105249_101323552 485
2125 3300010375 Ga0105239_10000216 Ga0105239_1000021641 485
2126 3300013102 Ga0157371_10000146 Ga0157371_1000014667 485
2127 3300013297 Ga0157378_10113869 Ga0157378_101138693 485
2128 3300014326 Ga0157380_10053860 Ga0157380_100538602 485
2129 3300021358 Ga0213873_10000007 Ga0213873_10000007242 485
2130 3300021377 Ga0213874_10020297 Ga0213874_100202972 485
2131 3300021384 Ga0213876_10000005 Ga0213876_10000005278 485
2132 3300021388 Ga0213875_10000105 Ga0213875_1000010535 485
2133 3300025230 Ga0209563_100019 Ga0209563_100019321 485
2134 3300025245 Ga0207425_1000026 Ga0207425_1000026177 485
2135 3300025250 Ga0209026_1000120 Ga0209026_1000120128 485
2136 3300025254 Ga0209148_1000017 Ga0209148_1000017704 485
2137 3300025256 Ga0209759_1000368 Ga0209759_100036816 485
2138 3300025258 Ga0209129_1000578 Ga0209129_10005782 485
2139 3300025261 Ga0209233_1000087 Ga0209233_1000087223 485
2140 3300025261 Ga0209233_1000414 Ga0209233_10004144 485
2141 3300025263 Ga0209565_1000064 Ga0209565_100006488 485
2142 3300025272 Ga0209455_1000005 Ga0209455_1000005704 485
2143 3300025291 Ga0209675_1000076 Ga0209675_100007648 485
2144 3300025292 Ga0209676_1000070 Ga0209676_1000070208 485
2145 3300025292 Ga0209676_1000454 Ga0209676_100045428 485
2146 3300025292 Ga0209676_1000637 Ga0209676_100063734 485
2147 3300025292 Ga0209676_1012990 Ga0209676_10129904 485
2148 3300025294 Ga0209025_1000726 Ga0209025_100072626 485
2149 3300025294 Ga0209025_1019381 Ga0209025_10193813 485
2150 3300025295 Ga0209564_1004288 Ga0209564_10042885 485
2151 3300025295 Ga0209564_1005028 Ga0209564_10050285 485
2152 3300025297 Ga0209758_1000004 Ga0209758_10000041119 485
2153 3300025297 Ga0209758_1000035 Ga0209758_1000035400 485
2154 3300025297 Ga0209758_1000119 Ga0209758_1000119171 485
2155 3300025297 Ga0209758_1019205 Ga0209758_10192053 485
2156 3300025298 Ga0209050_1000001 Ga0209050_10000013115 485
2157 3300025298 Ga0209050_1000042 Ga0209050_1000042105 485
2158 3300025298 Ga0209050_1002869 Ga0209050_10028699 485
2159 3300025298 Ga0209050_1008083 Ga0209050_10080832 485
2160 3300025298 Ga0209050_1017219 Ga0209050_10172192 485
2161 3300025303 Ga0209051_1000793 Ga0209051_100079316 485
2162 3300025304 Ga0209257_1000285 Ga0209257_100028512 485
2163 3300025304 Ga0209257_1000562 Ga0209257_100056255 485
2164 3300025304 Ga0209257_1000617 Ga0209257_100061716 485
2165 3300025304 Ga0209257_1000633 Ga0209257_100063316 485
2166 3300025304 Ga0209257_1002873 Ga0209257_10028735 485
2167 3300025304 Ga0209257_1013885 Ga0209257_10138854 485
2168 3300025901 Ga0207688_10075489 Ga0207688_100754892 485
2169 3300025904 Ga0207647_10003782 Ga0207647_100037822 485
2170 3300025909 Ga0207705_10000220 Ga0207705_1000022023 485
2171 3300025911 Ga0207654_10001743 Ga0207654_100017433 485
2172 3300025913 Ga0207695_10010506 Ga0207695_100105062 485
2173 3300025913 Ga0207695_10037507 Ga0207695_100375072 485
2174 3300025919 Ga0207657_10006872 Ga0207657_100068722 485
2175 3300025920 Ga0207649_10000365 Ga0207649_1000036522 485
2176 3300025924 Ga0207694_10015766 Ga0207694_100157661 485
2177 3300025927 Ga0207687_10000601 Ga0207687_1000060120 485
2178 3300025931 Ga0207644_10000530 Ga0207644_100005307 485
2179 3300025931 Ga0207644_10000919 Ga0207644_1000091913 485
2180 3300025933 Ga0207706_10066417 Ga0207706_100664172 485
2181 3300025935 Ga0207709_10000031 Ga0207709_10000031282 485
2182 3300025937 Ga0207669_10000057 Ga0207669_1000005725 485
2183 3300025937 Ga0207669_10002114 Ga0207669_100021147 485
2184 3300025941 Ga0207711_10031610 Ga0207711_100316102 485
2185 3300025941 Ga0207711_10134330 Ga0207711_101343302 485
2186 3300025945 Ga0207679_10045352 Ga0207679_100453524 485
2187 3300025949 Ga0207667_10000552 Ga0207667_1000055246 485
2188 3300025960 Ga0207651_10077751 Ga0207651_100777511 485
2189 3300025960 Ga0207651_10087397 Ga0207651_100873973 485
2190 3300025961 Ga0207712_10000074 Ga0207712_1000007477 485
2191 3300025961 Ga0207712_10052438 Ga0207712_100524382 485
2192 3300025961 Ga0207712_10112944 Ga0207712_101129442 485
2193 3300025972 Ga0207668_10000085 Ga0207668_1000008532 485
2194 3300025981 Ga0207640_10005615 Ga0207640_100056152 485
2195 3300025981 Ga0207640_10015330 Ga0207640_100153302 485
2196 3300026035 Ga0207703_10000248 Ga0207703_1000024822 485
2197 3300026035 Ga0207703_10000484 Ga0207703_1000048420 485
2198 3300026078 Ga0207702_10001185 Ga0207702_100011857 485
2199 3300026088 Ga0207641_10000001 Ga0207641_10000001990 485
2200 3300026088 Ga0207641_10009229 Ga0207641_100092295 485
2201 3300026116 Ga0207674_10055096 Ga0207674_100550963 485
2202 3300026118 Ga0207675_100028373 Ga0207675_1000283736 485
2203 3300026121 Ga0207683_10072810 Ga0207683_100728102 485
2204 3300026142 Ga0207698_10002158 Ga0207698_100021585 485
2205 3300028379 Ga0268266_10000002 Ga0268266_100000022111 485
2206 3300028380 Ga0268265_10000152 Ga0268265_1000015258 485
2207 3300028380 Ga0268265_10004310 Ga0268265_100043103 485
2208 3300028381 Ga0268264_10001443 Ga0268264_1000144314 485
2209 3300028381 Ga0268264_10001849 Ga0268264_1000184917 485
2210 3300028786 Ga0307517_10022587 Ga0307517_100225874 485
2211 3300031456 Ga0307513_10089023 Ga0307513_100890234 485
2212 3300031616 Ga0307508_10000479 Ga0307508_1000047915 485
2213 3300031911 Ga0307412_10055822 Ga0307412_100558221 485
2214 3300031995 Ga0307409_100031572 Ga0307409_1000315721 485
2215 3300033180 Ga0307510_10042552 Ga0307510_100425526 485
2216 3300033180 Ga0307510_10062575 Ga0307510_100625753 485
2217 3300037418 Ga0395900_0053703 Ga0395900_0053703_363_1844 485
2218 3300037853 Ga0436364_0184827 Ga0436364_0184827_84663_86132 485
2219 3300038443 Ga0395901_0061025 Ga0395901_0061025_252_1709 485
2220 3300038705 Ga0237819_00255 Ga0237819_00255_13932_15401 485
2221 3300039437 Ga0436365_0320406 Ga0436365_0320406_1045_2502 485
2222 3300039437 Ga0436365_0393854 Ga0436365_0393854_22387_23844 485
2223 3300039437 Ga0436365_1223957 Ga0436365_1223957_2192_3664 485
2224 3300039447 Ga0436361_0466504 Ga0436361_0466504_723_2180 485
2225 3300039447 Ga0436361_0488174 Ga0436361_0488174_4408_5865 485
2226 3300039450 Ga0436363_1210084 Ga0436363_1210084_238_1695 485
2227 3300039453 Ga0436362_0976836 Ga0436362_0976836_71034_72491 485
2228 3300046460 Ga0495638_0000980 Ga0495638_0000980_21731_23188 485
2229 3300046471 Ga0495650_0000058 Ga0495650_0000058_207882_209339 485
2230 3300046491 Ga0495584_0025603 Ga0495584_0025603_1353_2810 485
2231 3300046492 Ga0495585_0071429 Ga0495585_0071429_105_1562 485
2232 3300046506 Ga0495583_0002103 Ga0495583_0002103_14450_15907 485
2233 3300046506 Ga0495583_0004082 Ga0495583_0004082_6963_8420 485
2234 3300046506 Ga0495583_0044767 Ga0495583_0044767_221_1678 485
2235 3300046507 Ga0495606_0001775 Ga0495606_0001775_26054_27511 485
2236 3300046522 Ga0495643_0002032 Ga0495643_0002032_13778_15235 485
2237 3300046522 Ga0495643_0009494 Ga0495643_0009494_4460_5917 485
2238 3300046524 Ga0495648_0000698 Ga0495648_0000698_16766_18223 485
2239 3300046536 Ga0495587_0029350 Ga0495587_0029350_665_2122 485
2240 3300046557 Ga0495622_0003700 Ga0495622_0003700_5282_6739 485
2241 3300046558 Ga0495633_0001273 Ga0495633_0001273_6132_7589 485
2242 3300046558 Ga0495633_0043489 Ga0495633_0043489_178_1635 485
2243 3300046616 Ga0495668_0000001 Ga0495668_0000001_634836_636293 485
2244 3300046616 Ga0495668_0000007 Ga0495668_0000007_50777_52234 485
2245 3300046648 Ga0495611_0030009 Ga0495611_0030009_41_1498 485
2246 3300046660 Ga0495625_0000237 Ga0495625_0000237_37379_38836 485
2247 3300046660 Ga0495625_0001988 Ga0495625_0001988_5207_6664 485
2248 3300046684 Ga0495669_0000110 Ga0495669_0000110_40055_41512 485
2249 3300046691 Ga0495670_0003751 Ga0495670_0003751_4322_5788 485
2250 3300046809 Ga0495600_0008652 Ga0495600_0008652_1492_2949 485
2251 3300047323 Ga0495683_0015077 Ga0495683_0015077_982_2439 485
2252 3300047443 Ga0495687_000178 Ga0495687_000178_41275_42732 485
2253 3300047443 Ga0495687_001431 Ga0495687_001431_17060_18517 485
2254 3300047470 Ga0495681_0002869 Ga0495681_0002869_341_1798 485
2255 3300047472 Ga0495686_0000254 Ga0495686_0000254_3265_4722 485
2256 3300048905 Ga0496102_0001521 Ga0496102_0001521_6513_7970 485
2257 3300048906 Ga0496103_0001692 Ga0496103_0001692_5592_7049 485
2258 3300048908 Ga0496105_0004704 Ga0496105_0004704_1806_3263 485
2259 3300048917 Ga0496114_0028053 Ga0496114_0028053_2297_3754 485
2260 3300048918 Ga0496115_0000979 Ga0496115_0000979_6681_8138 485
2261 3300048919 Ga0496116_0002615 Ga0496116_0002615_6388_7845 485
2262 3300048920 Ga0496117_0002852 Ga0496117_0002852_7061_8518 485
2263 3300048921 Ga0496118_0000580 Ga0496118_0000580_6556_8013 485
2264 3300048922 Ga0496119_0002655 Ga0496119_0002655_7347_8804 485
2265 3300048923 Ga0496120_0017843 Ga0496120_0017843_2749_4206 485
2266 3300048924 Ga0496121_0001577 Ga0496121_0001577_7350_8807 485
2267 3300048925 Ga0496122_0020198 Ga0496122_0020198_2759_4216 485
2268 3300048926 Ga0496123_0016388 Ga0496123_0016388_1093_2550 485
2269 3300048927 Ga0496124_0000626 Ga0496124_0000626_6564_8021 485
2270 3300048928 Ga0496125_0000638 Ga0496125_0000638_12654_14111 485
2271 3300048929 Ga0496126_0000752 Ga0496126_0000752_6575_8032 485
2272 3300049570 Ga0501033_0016744 Ga0501033_0016744_2372_3856 485
2273 3300049570 Ga0501033_0054868 Ga0501033_0054868_474_1958 485
2274 3300049571 Ga0501034_0010480 Ga0501034_0010480_3010_4494 485
2275 3300049571 Ga0501034_0013481 Ga0501034_0013481_6241_7698 485
2276 3300049572 Ga0501036_0062704 Ga0501036_0062704_657_2114 485
2277 3300049573 Ga0501037_0001417 Ga0501037_0001417_574_2058 485
2278 3300049573 Ga0501037_0087230 Ga0501037_0087230_716_2173 485
2279 3300049574 Ga0501038_0009818 Ga0501038_0009818_1689_3173 485
2280 3300049575 Ga0501039_0099311 Ga0501039_0099311_272_1756 485
2281 3300049578 Ga0501042_0038262 Ga0501042_0038262_1277_2761 485
2282 3300049581 Ga0501047_0018327 Ga0501047_0018327_1689_3173 485
2283 3300049581 Ga0501047_0021953 Ga0501047_0021953_1233_2690 485
2284 3300049581 Ga0501047_0185379 Ga0501047_0185379_20_1492 485
2285 3300049582 Ga0501048_0031295 Ga0501048_0031295_648_2132 485
2286 3300049589 Ga0501073_0010664 Ga0501073_0010664_4330_5787 485
2287 3300049742 Ga0501080_0033363 Ga0501080_0033363_1330_2787 485
2288 3300049822 Ga0501035_0017931 Ga0501035_0017931_2737_4194 485
2289 3300049822 Ga0501035_0045710 Ga0501035_0045710_615_2099 485
2290 3300049822 Ga0501035_0067314 Ga0501035_0067314_354_1838 485
2291 3300049823 Ga0501044_0018357 Ga0501044_0018357_693_2150 485
2292 3300049823 Ga0501044_0063445 Ga0501044_0063445_580_2064 485
2293 3300049823 Ga0501044_0161911 Ga0501044_0161911_244_1728 485
2294 3300049824 Ga0501045_0129005 Ga0501045_0129005_235_1719 485
2295 3300050516 nmdc:mga0sz30_44974_c1 nmdc:mga0sz30_44974_c1_335_1792 485
2296 3300053079 Ga0500610_0002234 Ga0500610_0002234_1062_2519 485
2297 3300053087 Ga0500643_000997 Ga0500643_000997_9711_11168 485
2298 3300053087 Ga0500643_003115 Ga0500643_003115_2541_3998 485
2299 3300053119 Ga0500595_000869 Ga0500595_000869_6737_8194 485
2300 3300053130 Ga0500642_0000216 Ga0500642_0000216_7041_8498 485
2301 3300053130 Ga0500642_0000659 Ga0500642_0000659_6585_8042 485
2302 3300053131 Ga0500652_000270 Ga0500652_000270_12333_13793 485
2303 3300053134 Ga0500658_0002995 Ga0500658_0002995_3105_4562 485
2304 3300053139 Ga0500568_0000746 Ga0500568_0000746_20863_22320 485
2305 3300053139 Ga0500568_0034259 Ga0500568_0034259_28_1500 485
2306 3300053140 Ga0500573_0000045 Ga0500573_0000045_27701_29158 485
2307 3300053151 Ga0500604_0000003 Ga0500604_0000003_120180_121637 485
2308 3300053153 Ga0500616_0000128 Ga0500616_0000128_10022_11479 485
2309 3300053158 Ga0500627_0000004 Ga0500627_0000004_34840_36297 485
2310 3300053177 Ga0500636_0001208 Ga0500636_0001208_8731_10188 485
2311 3300053730 Ga0500645_000011 Ga0500645_000011_115764_117221 485
2312 3300053730 Ga0500645_000864 Ga0500645_000864_13870_15327 485
2313 3300053731 Ga0500609_002252 Ga0500609_002252_358_1815 485
2314 3300053735 Ga0500596_000559 Ga0500596_000559_4922_6379 485
2315 3300053736 Ga0500599_004057 Ga0500599_004057_324_1781 485
2316 3300054114 Ga0501084_0018429 Ga0501084_0018429_3162_4619 485
2317 3300054114 Ga0501084_0182121 Ga0501084_0182121_189_1661 485
2318 3300060353 Ga0501082_0090880 Ga0501082_0090880_437_1894 485
2319 3300002459 JGI24751J29686_10000055 JGI24751J29686_100000553 486
2320 3300005295 Ga0065707_10081716 Ga0065707_1008171635 486
2321 3300005295 Ga0065707_10086469 Ga0065707_100864694 486
2322 3300005331 Ga0070670_100000051 Ga0070670_100000051115 486
2323 3300005331 Ga0070670_100000082 Ga0070670_10000008250 486
2324 3300005331 Ga0070670_100006073 Ga0070670_10000607311 486
2325 3300005335 Ga0070666_10020684 Ga0070666_100206845 486
2326 3300005347 Ga0070668_100000239 Ga0070668_10000023913 486
2327 3300005347 Ga0070668_100027078 Ga0070668_1000270783 486
2328 3300005347 Ga0070668_100033344 Ga0070668_1000333442 486
2329 3300005353 Ga0070669_100000015 Ga0070669_10000001550 486
2330 3300005353 Ga0070669_100097082 Ga0070669_1000970822 486
2331 3300005355 Ga0070671_100003888 Ga0070671_10000388810 486
2332 3300005367 Ga0070667_100000003 Ga0070667_10000000315 486
2333 3300005367 Ga0070667_100000302 Ga0070667_10000030223 486
2334 3300005367 Ga0070667_100000822 Ga0070667_10000082217 486
2335 3300005367 Ga0070667_100003956 Ga0070667_10000395611 486
2336 3300005466 Ga0070685_10001714 Ga0070685_100017141 486
2337 3300005577 Ga0068857_100058339 Ga0068857_1000583394 486
2338 3300005577 Ga0068857_100107960 Ga0068857_1001079603 486
2339 3300005578 Ga0068854_100021800 Ga0068854_1000218003 486
2340 3300005617 Ga0068859_100006416 Ga0068859_1000064168 486
2341 3300005617 Ga0068859_100008575 Ga0068859_1000085756 486
2342 3300005617 Ga0068859_100082988 Ga0068859_1000829884 486
2343 3300005618 Ga0068864_100000177 Ga0068864_10000017742 486
2344 3300005618 Ga0068864_100007209 Ga0068864_1000072097 486
2345 3300005618 Ga0068864_100043160 Ga0068864_1000431604 486
2346 3300005719 Ga0068861_100001270 Ga0068861_1000012707 486
2347 3300005719 Ga0068861_100085604 Ga0068861_1000856042 486
2348 3300005841 Ga0068863_100008644 Ga0068863_1000086446 486
2349 3300005841 Ga0068863_100020697 Ga0068863_1000206972 486
2350 3300005842 Ga0068858_100000629 Ga0068858_10000062931 486
2351 3300005843 Ga0068860_100000068 Ga0068860_100000068172 486
2352 3300005843 Ga0068860_100000416 Ga0068860_10000041623 486
2353 3300005844 Ga0068862_100000006 Ga0068862_100000006100 486
2354 3300005844 Ga0068862_100001068 Ga0068862_10000106813 486
2355 3300005844 Ga0068862_100017312 Ga0068862_1000173125 486
2356 3300006931 Ga0097620_100006416 Ga0097620_1000064168 486
2357 3300006931 Ga0097620_100008575 Ga0097620_1000085756 486
2358 3300006931 Ga0097620_100082989 Ga0097620_1000829894 486
2359 3300009177 Ga0105248_10030051 Ga0105248_100300518 486
2360 3300012513 Ga0157326_1000195 Ga0157326_10001953 486
2361 3300013296 Ga0157374_10102501 Ga0157374_101025012 486
2362 3300014326 Ga0157380_10001740 Ga0157380_1000174012 486
2363 3300025893 Ga0207682_10001774 Ga0207682_100017742 486
2364 3300025903 Ga0207680_10027353 Ga0207680_100273532 486
2365 3300025907 Ga0207645_10008890 Ga0207645_100088905 486
2366 3300025923 Ga0207681_10000001 Ga0207681_10000001774 486
2367 3300025923 Ga0207681_10113859 Ga0207681_101138592 486
2368 3300025925 Ga0207650_10000050 Ga0207650_10000050117 486
2369 3300025925 Ga0207650_10000818 Ga0207650_100008187 486
2370 3300025925 Ga0207650_10024048 Ga0207650_100240484 486
2371 3300025926 Ga0207659_10028870 Ga0207659_100288702 486
2372 3300025931 Ga0207644_10002604 Ga0207644_1000260410 486
2373 3300025931 Ga0207644_10017814 Ga0207644_100178142 486
2374 3300025933 Ga0207706_10001130 Ga0207706_100011309 486
2375 3300025933 Ga0207706_10001397 Ga0207706_100013975 486
2376 3300025937 Ga0207669_10006974 Ga0207669_100069744 486
2377 3300025940 Ga0207691_10007490 Ga0207691_100074905 486
2378 3300025941 Ga0207711_10006011 Ga0207711_100060119 486
2379 3300025941 Ga0207711_10031542 Ga0207711_100315426 486
2380 3300025945 Ga0207679_10043311 Ga0207679_100433112 486
2381 3300025961 Ga0207712_10017843 Ga0207712_100178433 486
2382 3300025972 Ga0207668_10000045 Ga0207668_1000004528 486
2383 3300025972 Ga0207668_10000729 Ga0207668_1000072918 486
2384 3300025972 Ga0207668_10040278 Ga0207668_100402783 486
2385 3300025972 Ga0207668_10098521 Ga0207668_100985212 486
2386 3300025981 Ga0207640_10027192 Ga0207640_100271922 486
2387 3300025986 Ga0207658_10000002 Ga0207658_10000002916 486
2388 3300025986 Ga0207658_10000263 Ga0207658_1000026336 486
2389 3300025986 Ga0207658_10004920 Ga0207658_100049205 486
2390 3300025986 Ga0207658_10010806 Ga0207658_100108065 486
2391 3300026035 Ga0207703_10004770 Ga0207703_100047708 486
2392 3300026075 Ga0207708_10071409 Ga0207708_100714092 486
2393 3300026088 Ga0207641_10001679 Ga0207641_1000167913 486
2394 3300026088 Ga0207641_10002174 Ga0207641_100021747 486
2395 3300026088 Ga0207641_10008012 Ga0207641_100080125 486
2396 3300026089 Ga0207648_10046425 Ga0207648_100464252 486
2397 3300026095 Ga0207676_10000004 Ga0207676_10000004226 486
2398 3300026095 Ga0207676_10000895 Ga0207676_100008957 486
2399 3300026116 Ga0207674_10037687 Ga0207674_100376874 486
2400 3300026118 Ga0207675_100000295 Ga0207675_10000029548 486
2401 3300026118 Ga0207675_100069331 Ga0207675_1000693314 486
2402 3300028380 Ga0268265_10000002 Ga0268265_10000002827 486
2403 3300028380 Ga0268265_10000946 Ga0268265_1000094617 486
2404 3300028381 Ga0268264_10000103 Ga0268264_10000103216 486
2405 3300028381 Ga0268264_10000184 Ga0268264_1000018436 486
2406 3300028381 Ga0268264_10051286 Ga0268264_100512864 486
2407 3300031731 Ga0307405_10065585 Ga0307405_100655852 486
2408 3300031852 Ga0307410_10042633 Ga0307410_100426333 486
2409 3300031911 Ga0307412_10005692 Ga0307412_100056923 486
2410 3300031911 Ga0307412_10020763 Ga0307412_100207633 486
2411 3300032002 Ga0307416_100037914 Ga0307416_1000379143 486
2412 3300032004 Ga0307414_10018820 Ga0307414_100188204 486
2413 3300046660 Ga0495625_0091035 Ga0495625_0091035_591_2051 486
2414 3300046691 Ga0495670_0008504 Ga0495670_0008504_3510_5009 486
2415 3300047472 Ga0495686_0000057 Ga0495686_0000057_200168_201628 486
2416 3300047472 Ga0495686_0008475 Ga0495686_0008475_270_1742 486
2417 3300048921 Ga0496118_0003742 Ga0496118_0003742_14190_15671 486
2418 3300048921 Ga0496118_0057100 Ga0496118_0057100_631_2091 486
2419 3300048924 Ga0496121_0092906 Ga0496121_0092906_592_2073 486
2420 3300048925 Ga0496122_0003251 Ga0496122_0003251_16055_17515 486
2421 3300048926 Ga0496123_0000577 Ga0496123_0000577_25134_26594 486
2422 3300048927 Ga0496124_0014484 Ga0496124_0014484_5576_7036 486
2423 3300048928 Ga0496125_0033431 Ga0496125_0033431_2915_4396 486
2424 3300049515 Ga0501292_000005 Ga0501292_000005_57937_59397 486
2425 3300049653 Ga0501206_001344 Ga0501206_001344_864_2324 486
2426 3300049663 Ga0501223_003784 Ga0501223_003784_574_2034 486
2427 3300049688 Ga0501259_000327 Ga0501259_000327_5176_6636 486
2428 3300049776 Ga0501280_000025 Ga0501280_000025_1247_2707 486
2429 3300049778 Ga0501282_000129 Ga0501282_000129_3940_5400 486
2430 3300053130 Ga0500642_0004340 Ga0500642_0004340_2403_3863 486
2431 3300053133 Ga0500655_000094 Ga0500655_000094_10146_11606 486
2432 3300053148 Ga0500590_006053 Ga0500590_006053_3921_5381 486
2433 3300053153 Ga0500616_0007071 Ga0500616_0007071_4988_6448 486
2434 3300053156 Ga0500622_0032406 Ga0500622_0032406_567_2027 486
2435 3300053724 Ga0500570_000135 Ga0500570_000135_7103_8563 486
2436 3300005841 Ga0068863_100029577 Ga0068863_1000295772 487
2437 3300013104 Ga0157370_10008105 Ga0157370_100081055 487
2438 3300025909 Ga0207705_10051439 Ga0207705_100514391 487
2439 3300025927 Ga0207687_10029526 Ga0207687_100295263 487
2440 3300025929 Ga0207664_10015174 Ga0207664_100151745 487
2441 3300025932 Ga0207690_10000051 Ga0207690_1000005199 487
2442 3300026023 Ga0207677_10000013 Ga0207677_10000013127 487
2443 3300026088 Ga0207641_10021857 Ga0207641_100218572 487
2444 3300036401 Ga0373937_0202240 Ga0373937_0202240_111_1595 487
2445 3300039447 Ga0436361_0424218 Ga0436361_0424218_1261_2730 487
2446 3300049741 Ga0501079_0013818 Ga0501079_0013818_1123_2586 487
2447 3300049743 Ga0501081_0165908 Ga0501081_0165908_17_1480 487
2448 3300060353 Ga0501082_0082634 Ga0501082_0082634_109_1572 487
2449 iso_pu_bacteria 2937843397 2937846775 487
2450 3300003762 Ga0055542_1001390 Ga0055542_100139011 488
2451 3300005327 Ga0070658_10000001 Ga0070658_10000001653 488
2452 3300005366 Ga0070659_100017956 Ga0070659_1000179564 488
2453 3300025909 Ga0207705_10000002 Ga0207705_100000021228 488
2454 3300025932 Ga0207690_10020805 Ga0207690_100208052 488
2455 3300031901 Ga0307406_10034911 Ga0307406_100349111 488
2456 3300048921 Ga0496118_0066307 Ga0496118_0066307_19_1512 488
2457 3300048929 Ga0496126_0225207 Ga0496126_0225207_39_1532 488
2458 3300005354 Ga0070675_100028636 Ga0070675_1000286363 489
2459 3300044656 Ga0466969_0018967 Ga0466969_0018967_1836_3329 489
2460 3300044684 Ga0466966_0057255 Ga0466966_0057255_859_2352 489
2461 3300045049 Ga0466959_0022048 Ga0466959_0022048_1220_2713 489
2462 3300053119 Ga0500595_016121 Ga0500595_016121_1126_2607 489
2463 3300005329 Ga0070683_100025315 Ga0070683_1000253155 490
2464 3300005548 Ga0070665_100026945 Ga0070665_1000269453 490
2465 3300009177 Ga0105248_10000066 Ga0105248_1000006616 490
2466 3300013100 Ga0157373_10077967 Ga0157373_100779672 490
2467 3300013104 Ga0157370_10075832 Ga0157370_100758322 490
2468 3300014326 Ga0157380_10000114 Ga0157380_1000011412 490
2469 3300025944 Ga0207661_10014534 Ga0207661_100145346 490
2470 3300025945 Ga0207679_10075673 Ga0207679_100756733 490
2471 3300028379 Ga0268266_10018298 Ga0268266_100182983 490
2472 3300028380 Ga0268265_10188048 Ga0268265_101880482 490
2473 3300037312 Ga0395899_0002095 Ga0395899_0002095_8999_10492 490
2474 3300037418 Ga0395900_0023614 Ga0395900_0023614_2311_3804 490
2475 3300037418 Ga0395900_0170176 Ga0395900_0170176_474_1967 490
2476 3300037466 Ga0395898_0006460 Ga0395898_0006460_7596_9089 490
2477 3300038443 Ga0395901_0003662 Ga0395901_0003662_3914_5407 490
2478 3300049570 Ga0501033_0140094 Ga0501033_0140094_184_1677 490
2479 3300049581 Ga0501047_0212504 Ga0501047_0212504_72_1565 490
2480 3300049823 Ga0501044_0080392 Ga0501044_0080392_942_2435 490
2481 3300053087 Ga0500643_000129 Ga0500643_000129_10216_11688 490
2482 3300005445 Ga0070708_100107810 Ga0070708_1001078103 491
2483 3300005471 Ga0070698_100006503 Ga0070698_10000650312 491
2484 3300005937 Ga0081455_10030375 Ga0081455_100303755 491
2485 3300005985 Ga0081539_10001888 Ga0081539_1000188821 491
2486 3300005985 Ga0081539_10012146 Ga0081539_100121466 491
2487 3300006038 Ga0075365_10056498 Ga0075365_100564982 491
2488 3300006038 Ga0075365_10104685 Ga0075365_101046852 491
2489 3300006177 Ga0075362_10007222 Ga0075362_100072222 491
2490 3300021441 Ga0213871_10004065 Ga0213871_100040653 491
2491 3300025910 Ga0207684_10058948 Ga0207684_100589482 491
2492 3300039438 Ga0436360_0682433 Ga0436360_0682433_10586_12082 491
2493 3300048904 Ga0496101_0098358 Ga0496101_0098358_490_2001 491
2494 3300048923 Ga0496120_0000781 Ga0496120_0000781_16190_17689 491
2495 3300050492 nmdc:mga0yw44_73960_c1 nmdc:mga0yw44_73960_c1_43_1542 491
2496 3300050516 nmdc:mga0sz30_717_c2 nmdc:mga0sz30_717_c2_380_1876 491
2497 3300053096 Ga0500641_0002743 Ga0500641_0002743_1609_3108 491
2498 3300053153 Ga0500616_0000501 Ga0500616_0000501_14640_16139 491
2499 iso_pu_bacteria 2599185301 2599940403 491
2500 iso_pu_bacteria 2937891427 2937893811 491
2501 iso_pu_bacteria 2958100919 2958107832 491
2502 iso_pu_bacteria 2958115193 2958116971 491
2503 iso_pu_bacteria 2961114664 2961121330 491
2504 iso_pu_bacteria 2965062239 2965067238 491
2505 iso_pu_bacteria 2965119406 2965122150 491
2506 iso_pu_bacteria 2968097103 2968097105 491
2507 iso_pu_bacteria 2968110612 2968117483 491
2508 iso_pu_bacteria 2968128360 2968133181 491
2509 iso_pu_bacteria 2979710463 2979712282 491
2510 iso_pu_bacteria 2979742915 2979749709 491
2511 iso_pu_bacteria 2987636660 2987643675 491
2512 iso_pu_bacteria 2987652177 2987656355 491
2513 iso_pu_bacteria 2996341866 2996344801 491
2514 iso_pu_bacteria 3004203850 3004207220 491
2515 iso_pu_bacteria 8004445564 8004447632 491
2516 iso_pu_bacteria 8004703790 8004710853 491
2517 3300002067 JGI24735J21928_10019505 JGI24735J21928_100195052 493
2518 3300005328 Ga0070676_10000230 Ga0070676_100002303 493
2519 3300005334 Ga0068869_100000200 Ga0068869_10000020025 493
2520 3300005338 Ga0068868_100001398 Ga0068868_1000013987 493
2521 3300005355 Ga0070671_100013565 Ga0070671_1000135653 493
2522 3300005364 Ga0070673_100000006 Ga0070673_100000006125 493
2523 3300005364 Ga0070673_100063482 Ga0070673_1000634821 493
2524 3300005459 Ga0068867_100000001 Ga0068867_100000001370 493
2525 3300006881 Ga0068865_100000003 Ga0068865_100000003201 493
2526 3300009098 Ga0105245_10000113 Ga0105245_1000011353 493
2527 3300009148 Ga0105243_10000373 Ga0105243_1000037346 493
2528 3300009176 Ga0105242_10000165 Ga0105242_100001656 493
2529 3300011119 Ga0105246_10001620 Ga0105246_1000162016 493
2530 3300013104 Ga0157370_10000069 Ga0157370_1000006961 493
2531 3300013297 Ga0157378_10002300 Ga0157378_1000230016 493
2532 3300013307 Ga0157372_10121515 Ga0157372_101215153 493
2533 3300013308 Ga0157375_10041491 Ga0157375_100414912 493
2534 3300014969 Ga0157376_10000089 Ga0157376_1000008954 493
2535 3300025907 Ga0207645_10003616 Ga0207645_1000361616 493
2536 3300025909 Ga0207705_10000365 Ga0207705_1000036539 493
2537 3300025909 Ga0207705_10047244 Ga0207705_100472443 493
2538 3300025919 Ga0207657_10009109 Ga0207657_1000910914 493
2539 3300025927 Ga0207687_10000225 Ga0207687_1000022524 493
2540 3300025931 Ga0207644_10020871 Ga0207644_100208713 493
2541 3300025934 Ga0207686_10001878 Ga0207686_100018786 493
2542 3300025935 Ga0207709_10000173 Ga0207709_1000017350 493
2543 3300025938 Ga0207704_10000001 Ga0207704_10000001318 493
2544 3300025942 Ga0207689_10000744 Ga0207689_1000074425 493
2545 3300025960 Ga0207651_10000002 Ga0207651_1000000279 493
2546 3300025960 Ga0207651_10139052 Ga0207651_101390522 493
2547 3300026023 Ga0207677_10000030 Ga0207677_1000003058 493
2548 3300026067 Ga0207678_10015911 Ga0207678_100159112 493
2549 3300026089 Ga0207648_10000001 Ga0207648_1000000179 493
2550 3300048927 Ga0496124_0086896 Ga0496124_0086896_1008_2489 493
2551 3300053178 Ga0500637_0006016 Ga0500637_0006016_4304_5791 493
2552 3300009545 Ga0105237_10013106 Ga0105237_100131066 494
2553 3300009551 Ga0105238_10032741 Ga0105238_100327415 494
2554 3300010375 Ga0105239_10105403 Ga0105239_101054032 494
2555 3300044658 Ga0466972_0014371 Ga0466972_0014371_2196_3707 494
2556 3300053108 Ga0500562_000021 Ga0500562_000021_9202_10689 494
2557 3300003794 Ga0055531_10000016 Ga0055531_10000016128 495
2558 3300009148 Ga0105243_10175802 Ga0105243_101758021 495
2559 3300025298 Ga0209050_1000026 Ga0209050_1000026327 495
2560 3300025304 Ga0209257_1000009 Ga0209257_1000009327 495
2561 3300026142 Ga0207698_10062444 Ga0207698_100624442 495
2562 3300048924 Ga0496121_0002895 Ga0496121_0002895_12629_14122 495
2563 3300006038 Ga0075365_10008773 Ga0075365_100087734 496
2564 3300006051 Ga0075364_10005189 Ga0075364_100051894 496
2565 3300050492 nmdc:mga0yw44_51957_c1 nmdc:mga0yw44_51957_c1_604_2145 496
2566 3300050492 nmdc:mga0yw44_59079_c1 nmdc:mga0yw44_59079_c1_750_2291 496
2567 iso_pu_bacteria 2503198000 2503203315 496
2568 iso_pu_bacteria 2937861824 2937862830 496
2569 iso_pu_bacteria 2937868953 2937875998 496
2570 iso_pu_bacteria 2937980651 2937984150 496
2571 iso_pu_bacteria 2958108152 2958110853 496
2572 iso_pu_bacteria 2961136820 2961142242 496
2573 iso_pu_bacteria 2961183825 2961186269 496
2574 iso_pu_bacteria 2965032056 2965039208 496
2575 iso_pu_bacteria 2965102966 2965107121 496
2576 iso_pu_bacteria 2965110997 2965117424 496
2577 iso_pu_bacteria 2968138860 2968143804 496
2578 iso_pu_bacteria 2970532167 2970533499 496
2579 iso_pu_bacteria 2970619444 2970622586 496
2580 iso_pu_bacteria 2970627176 2970630269 496
2581 iso_pu_bacteria 2977851361 2977857132 496
2582 iso_pu_bacteria 2977898635 2977905798 496
2583 iso_pu_bacteria 2977907340 2977909812 496
2584 iso_pu_bacteria 2979772303 2979774045 496
2585 iso_pu_bacteria 2987645492 2987646760 496
2586 iso_pu_bacteria 2987673487 2987678798 496
2587 iso_pu_bacteria 3004248173 3004254297 496
2588 iso_pu_bacteria 8004300914 8004306078 496
2589 iso_pu_bacteria 8004312739 8004319086 496
2590 iso_pu_bacteria 8004695233 8004700450 496
2591 iso_pu_bacteria 8004727605 8004730111 496
2592 3300028379 Ga0268266_10000187 Ga0268266_100001877 497
2593 3300005617 Ga0068859_100045506 Ga0068859_1000455062 498
2594 3300005618 Ga0068864_100000004 Ga0068864_100000004135 498
2595 3300005841 Ga0068863_100000002 Ga0068863_100000002135 498
2596 3300005844 Ga0068862_100000002 Ga0068862_100000002366 498
2597 3300006931 Ga0097620_100045506 Ga0097620_1000455062 498
2598 3300009177 Ga0105248_10000010 Ga0105248_10000010209 498
2599 3300009177 Ga0105248_10015860 Ga0105248_100158604 498
2600 3300009553 Ga0105249_10000026 Ga0105249_1000002620 498
2601 3300009553 Ga0105249_10000041 Ga0105249_10000041103 498
2602 3300025925 Ga0207650_10000083 Ga0207650_1000008357 498
2603 3300025941 Ga0207711_10000035 Ga0207711_1000003546 498
2604 3300025961 Ga0207712_10000460 Ga0207712_100004603 498
2605 3300025986 Ga0207658_10000388 Ga0207658_1000038813 498
2606 3300026088 Ga0207641_10000002 Ga0207641_10000002616 498
2607 3300026095 Ga0207676_10000005 Ga0207676_10000005191 498
2608 3300028380 Ga0268265_10000003 Ga0268265_10000003373 498
2609 3300031911 Ga0307412_10007474 Ga0307412_100074742 498
2610 3300046530 Ga0495654_0000194 Ga0495654_0000194_36160_37671 498
2611 3300046616 Ga0495668_0003497 Ga0495668_0003497_9105_10616 498
2612 3300046692 Ga0495671_0017287 Ga0495671_0017287_803_2299 498
2613 3300048905 Ga0496102_0008737 Ga0496102_0008737_1266_2762 498
2614 3300048905 Ga0496102_0021428 Ga0496102_0021428_3463_4959 498
2615 3300048906 Ga0496103_0002569 Ga0496103_0002569_7635_9131 498
2616 3300048906 Ga0496103_0009626 Ga0496103_0009626_3463_4959 498
2617 3300048919 Ga0496116_0017644 Ga0496116_0017644_3435_4931 498
2618 3300048920 Ga0496117_0007680 Ga0496117_0007680_2673_4169 498
2619 3300048920 Ga0496117_0018746 Ga0496117_0018746_757_2253 498
2620 3300048920 Ga0496117_0020493 Ga0496117_0020493_1105_2601 498
2621 3300048921 Ga0496118_0001620 Ga0496118_0001620_4234_5730 498
2622 3300048921 Ga0496118_0016661 Ga0496118_0016661_3322_4818 498
2623 3300048921 Ga0496118_0021282 Ga0496118_0021282_3463_4959 498
2624 3300048927 Ga0496124_0022909 Ga0496124_0022909_3463_4959 498
2625 3300049581 Ga0501047_0093209 Ga0501047_0093209_385_1917 498
2626 3300053116 Ga0500592_002520 Ga0500592_002520_465_1976 498
2627 3300053158 Ga0500627_0000386 Ga0500627_0000386_8671_10182 498
2628 3300005545 Ga0070695_100012697 Ga0070695_1000126972 502
2629 3300013100 Ga0157373_10009132 Ga0157373_100091324 502
2630 3300001904 JGI24736J21556_1000044 JGI24736J21556_100004410 511
2631 3300001976 JGI24752J21851_1000034 JGI24752J21851_10000347 511
2632 3300002067 JGI24735J21928_10005173 JGI24735J21928_100051732 511
2633 3300002070 JGI24750J21931_1000349 JGI24750J21931_10003494 511
2634 3300002074 JGI24748J21848_1000032 JGI24748J21848_100003258 511
2635 3300002075 JGI24738J21930_10001238 JGI24738J21930_100012385 511
2636 3300002076 JGI24749J21850_1000583 JGI24749J21850_10005834 511
2637 3300002239 JGI24034J26672_10000022 JGI24034J26672_1000002299 511
2638 3300005327 Ga0070658_10005651 Ga0070658_100056517 511
2639 3300005330 Ga0070690_100000056 Ga0070690_10000005616 511
2640 3300005335 Ga0070666_10000002 Ga0070666_1000000221 511
2641 3300005344 Ga0070661_100014188 Ga0070661_1000141884 511
2642 3300005353 Ga0070669_100000170 Ga0070669_10000017020 511
2643 3300005457 Ga0070662_100007293 Ga0070662_1000072936 511
2644 3300005457 Ga0070662_100010773 Ga0070662_1000107735 511
2645 3300005539 Ga0068853_100128477 Ga0068853_1001284772 511
2646 3300005544 Ga0070686_100000335 Ga0070686_10000033521 511
2647 3300005548 Ga0070665_100000036 Ga0070665_100000036320 511
2648 3300005578 Ga0068854_100057719 Ga0068854_1000577193 511
2649 3300005617 Ga0068859_100011388 Ga0068859_1000113884 511
2650 3300005618 Ga0068864_100009088 Ga0068864_1000090884 511
2651 3300005834 Ga0068851_10009967 Ga0068851_100099674 511
2652 3300005841 Ga0068863_100000095 Ga0068863_10000009578 511
2653 3300005842 Ga0068858_100002740 Ga0068858_1000027405 511
2654 3300005843 Ga0068860_100000001 Ga0068860_10000000121 511
2655 3300005844 Ga0068862_100000350 Ga0068862_10000035028 511
2656 3300005937 Ga0081455_10000255 Ga0081455_1000025517 511
2657 3300006931 Ga0097620_100011389 Ga0097620_1000113894 511
2658 3300013104 Ga0157370_10012095 Ga0157370_100120954 511
2659 3300013105 Ga0157369_10016431 Ga0157369_100164318 511
2660 3300014326 Ga0157380_10001342 Ga0157380_100013428 511
2661 3300014968 Ga0157379_10020107 Ga0157379_100201072 511
2662 3300017792 Ga0163161_10000008 Ga0163161_10000008287 511
2663 3300025321 Ga0207656_10007248 Ga0207656_100072482 511
2664 3300025903 Ga0207680_10000004 Ga0207680_10000004839 511
2665 3300025904 Ga0207647_10000352 Ga0207647_1000035215 511
2666 3300025911 Ga0207654_10006493 Ga0207654_100064934 511
2667 3300025913 Ga0207695_10001723 Ga0207695_1000172316 511
2668 3300025914 Ga0207671_10003257 Ga0207671_100032574 511
2669 3300025923 Ga0207681_10000297 Ga0207681_1000029714 511
2670 3300025924 Ga0207694_10008563 Ga0207694_100085633 511
2671 3300025931 Ga0207644_10000755 Ga0207644_1000075516 511
2672 3300025949 Ga0207667_10009187 Ga0207667_1000918711 511
2673 3300025961 Ga0207712_10000001 Ga0207712_10000001713 511
2674 3300025981 Ga0207640_10044401 Ga0207640_100444012 511
2675 3300026035 Ga0207703_10001677 Ga0207703_1000167711 511
2676 3300026078 Ga0207702_10000335 Ga0207702_1000033516 511
2677 3300026088 Ga0207641_10000148 Ga0207641_1000014877 511
2678 3300026095 Ga0207676_10045939 Ga0207676_100459392 511
2679 3300026116 Ga0207674_10089373 Ga0207674_100893733 511
2680 3300026118 Ga0207675_100001093 Ga0207675_10000109320 511
2681 3300026142 Ga0207698_10007426 Ga0207698_100074264 511
2682 3300028379 Ga0268266_10000042 Ga0268266_1000004221 511
2683 3300028380 Ga0268265_10000481 Ga0268265_1000048112 511
2684 3300028381 Ga0268264_10000006 Ga0268264_10000006839 511
2685 iso_pu_bacteria 2643221605 2644037444 511

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13537

GATase_7

Glutamine amidotransferase domain

87

215

0.91

PF13522

GATase_6

Glutamine amidotransferase domain

69

210

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
6lbp-assembly1.cif.gz_A structure of the glutamine phosphoribosylpyrophosphate amidotransferase from arabidopsis thaliana 0.9518 41 491
1ao0-assembly1.cif.gz_C glutamine phosphoribosylpyrophosphate (prpp) amidotransferase from b. subtilis complexed with adp and gmp 0.942 41 490
1gph-assembly1.cif.gz_1 structure of the allosteric regulatory enzyme of purine biosynthesis 0.9399 41 490
6lbp-assembly1.cif.gz_A structure of the glutamine phosphoribosylpyrophosphate amidotransferase from arabidopsis thaliana 0.9237 41 491
1ao0-assembly1.cif.gz_C glutamine phosphoribosylpyrophosphate (prpp) amidotransferase from b. subtilis complexed with adp and gmp 0.92 41 490
ID Description Score Start End Superfamily
1gph401 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.9583 41 298 3.60.20.10
1ao0B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9489 301 463 3.40.50.2020
af_Q22134_2_446_3.60.20.10 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.9338 41 459 3.60.20.10
1ao0B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9279 301 463 3.40.50.2020
af_Q22134_287_448_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9217 302 461 3.40.50.2020
ID Description Score Start End GO Terms
AF-A0A529NSB1-F1-model_v4 Amidophosphoribosyltransferase (EC 2.4.2.14) 0.9897 124 300 GO:0004044
AF-A0A526YM32-F1-model_v4 Amidophosphoribosyltransferase (EC 2.4.2.14) 0.988 88 216 GO:0004044
AF-X1HEG5-F1-model_v4 Glutamine amidotransferase type-2 domain-containing protein 0.981 203 308
AF-A0A356V981-F1-model_v4 Amidophosphoribosyltransferase 0.9797 168 255 GO:0016757
AF-A0A3S1FFR6-F1-model_v4 Amidophosphoribosyltransferase (EC 2.4.2.14) 0.979 149 494 GO:0004044
GO:0006189
GO:0009113

Feature Viewer

pLDDT pTM Quality
84.35 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map