F496907

General Info

Members Datasets Scaffolds Average Seq Length
2551 688 2460 390

Family's Representative Sequence

Representative Sequence 3300002987|JGI25159J45721_1004826|JGI25159J45721_10048263
Length 427
Sequence MSSIVANFDLVKGKLAKVKGRKIEAPEFKTPFVKRPTGRSLDSFMGWRRENGRVGVRNHVLLLPLDDLSNAACEAVANNIKGTLAIPHAYGRLQFGEDLEVHFRTLIGTGSNPNVAAVIVIGIEDGWTKRVVDGIAKTGKPVVGFGIEGHGDIATIAKASYVAKEFVQWATELQRVKCGIEELWVSTKCGESDTTTGLSSCPTVGNMYDKWIPRGVYGVFGETSEITGAEHLCKARAATPEVGERWYKMWKAYQDDVIEAHKTDDLSDSQPTKGNIAGGLTTIEEKALGNLEKIGRECKFIDILEPAQAPEKGPGLYYMDTSSAAAECVTLMAAGGYVVHTFPTGQGNVIGNPIVPVIKITGNPKTMRTMPEHIDVDVSGILRRDLTIPQAGDALIENIVRTANGRLTAAEALGHREFSMTKLYRSA

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
3 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
4 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
5 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
6 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
7 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
8 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
9 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
10 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
11 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
12 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
13 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
14 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
15 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
16 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
17 2643221569 Achromobacter sp. Root565 Isolate Unclassified
18 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
19 2643221594 Achromobacter sp. Root170 Isolate Unclassified
20 2643221621 Achromobacter sp. Root83 Isolate Unclassified
21 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
22 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
23 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
24 2643221733 Bosea sp. Root381 Isolate Unclassified
25 2643221736 Bosea sp. Root483D1 Isolate Unclassified
26 2671180694 Paenibacillus sp. A3 Isolate Unclassified
27 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
28 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
29 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
30 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
31 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
32 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
33 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
34 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
35 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
36 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
37 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
38 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
39 2836160341 Unclassified Planctomycetes Bin 134 Isolate Unclassified
40 2841760612 Bosea sp. Tri-49 Isolate Nodule
41 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
42 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
43 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
44 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
45 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
46 2844104063 Bosea sp. Tri-39 Isolate Nodule
47 2851182111 Bosea sp. Tri-44 Isolate Nodule
48 2851246043 Bosea sp. Tri-54 Isolate Nodule
49 2855730933 Achromobacter sp. HZ28 Isolate Nodule
50 2855767633 Achromobacter sp. HZ34 Isolate Nodule
51 2857472729 Cohnella sp. R-74144 Isolate Unclassified
52 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
53 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
54 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
55 2858950400 Achromobacter sp. K91 Isolate Unclassified
56 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
57 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
58 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
59 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
60 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
61 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
62 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
63 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
64 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
65 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
66 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
67 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
68 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
69 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
70 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
71 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
72 2904456579 Variovorax sp. 2002 Isolate Unclassified
73 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
74 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
75 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
76 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
77 2929520902 Variovorax beijingensis 502 Isolate Unclassified
78 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
79 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
80 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
81 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
82 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
83 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
84 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
85 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
86 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
87 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
88 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
89 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
90 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
91 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
92 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
93 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
94 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
95 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
96 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
97 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
98 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
99 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
100 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
101 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
102 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
103 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
104 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
105 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
106 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
107 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
108 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
109 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
110 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
111 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
112 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
113 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
114 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
115 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
116 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
117 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
118 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
119 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
120 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
121 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
122 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
123 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
124 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
125 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
126 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
127 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
128 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
129 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
130 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
131 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
132 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
133 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
134 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
135 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
136 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
137 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
138 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
139 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
140 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
141 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
142 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
143 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
144 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
145 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
146 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
147 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
148 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
149 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
150 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
151 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
152 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
153 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
154 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
155 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
156 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
157 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
158 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
159 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
160 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
161 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
162 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
163 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
164 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
165 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
166 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
167 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
168 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
169 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
170 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
171 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
172 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
173 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
174 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
175 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
176 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
177 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
178 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
179 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
180 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
181 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
182 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
183 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
184 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
185 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
186 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
187 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
188 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
189 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
190 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
191 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
192 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
193 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
194 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
195 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
196 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
197 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
198 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
199 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
200 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
201 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
202 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
203 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
204 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
205 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
206 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
207 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
208 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
209 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
210 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
211 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
212 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
213 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
214 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
215 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
216 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
217 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
218 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
219 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
220 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
221 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
222 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
223 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
224 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
225 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
226 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
227 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
228 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
229 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
230 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
231 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
232 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
233 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
234 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
235 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
236 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
237 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
238 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
239 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
240 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
241 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
242 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
243 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
244 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
245 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
246 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
247 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
248 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
249 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
250 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
251 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
252 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
253 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
254 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
255 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
256 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
257 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
258 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
259 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
260 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
261 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
262 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
263 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
264 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
265 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
266 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
267 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
268 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
269 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
270 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
271 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
272 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
273 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
274 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
275 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
276 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
277 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
278 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
279 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
280 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
336 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
337 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
338 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
341 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
342 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
343 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
344 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
345 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
346 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
347 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
348 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
349 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
350 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
351 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
352 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
353 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
354 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
355 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
356 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
357 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
358 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
359 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
360 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
361 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
362 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
363 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
364 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
365 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
366 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
367 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
368 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
369 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
370 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
371 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
372 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
373 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
374 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
375 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
376 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
377 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
378 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
379 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
380 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
381 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
382 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
383 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
384 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
385 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
386 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
387 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
388 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
389 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
390 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
391 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
392 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
393 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
394 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
395 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
396 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
397 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
398 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
399 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
400 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
401 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
402 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
403 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
404 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
405 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
406 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
407 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
408 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
409 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
410 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
411 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
412 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
413 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
414 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
415 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
416 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
417 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
418 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
419 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
420 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
421 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
422 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
423 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
424 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
425 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
426 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
427 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
428 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
429 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
430 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
431 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
432 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
433 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
434 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
435 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
436 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
437 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
438 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
439 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
440 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
441 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
442 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
443 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
444 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
445 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
446 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
447 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
448 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
449 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
450 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
451 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
452 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
453 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
454 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
455 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
456 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
457 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
458 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
459 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
460 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
461 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
462 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
463 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
464 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
465 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
466 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
467 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
468 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
469 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
470 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
471 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
472 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
473 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
474 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
475 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
476 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
477 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
478 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
479 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
480 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
481 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
482 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
483 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
484 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
485 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
486 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
487 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
488 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
489 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
490 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
491 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
492 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
493 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
494 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
495 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
496 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
497 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
498 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
499 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
500 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
501 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
502 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
503 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
504 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
505 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
506 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
507 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
508 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
509 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
510 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
511 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
512 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
513 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
514 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
515 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
516 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
517 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
518 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
519 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
520 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
521 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
522 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
523 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
524 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
525 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
526 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
527 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
528 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
529 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
530 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
531 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
532 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
533 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
534 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
535 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
536 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
537 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
538 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
539 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
540 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
541 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
542 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
543 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
544 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
545 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
546 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
547 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
548 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
549 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
550 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
551 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
552 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
553 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
554 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
555 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
556 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
557 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
558 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
559 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
560 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
561 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
562 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
563 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
564 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
565 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
566 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
567 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
568 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
569 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
570 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
571 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
572 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
573 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
574 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
575 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
576 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
577 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
578 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
579 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
580 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
581 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
582 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
583 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
584 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
585 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
586 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
587 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
588 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
589 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
590 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
591 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
592 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
593 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
594 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
595 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
596 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
597 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
598 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
599 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
600 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
601 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
602 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
603 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
604 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
605 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
606 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
607 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
608 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
609 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
610 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
611 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
612 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
613 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
614 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
615 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
616 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
617 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
618 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
619 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
620 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
621 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
622 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
623 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
624 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
625 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
626 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
627 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
628 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
629 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
630 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
631 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
632 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
633 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
634 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
635 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
636 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
637 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
638 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
639 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
640 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
641 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
642 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
643 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
644 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
645 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
646 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
647 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
648 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
649 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
650 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
651 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
652 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
653 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
654 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
655 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
656 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
657 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
658 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
659 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
660 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
661 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
662 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
663 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
664 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
665 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
666 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
667 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
668 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
669 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
670 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
671 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
672 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
673 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
674 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
675 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
676 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
677 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
678 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
679 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
680 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
681 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
682 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
683 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
684 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
685 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
686 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified
687 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule
688 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.16
Metatranscriptomes 0.27
Isolates 3.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.15
Nodule 0.82
Rhizoplane 3.57
Rhizosphere 84.63
Stem 0
Stem Tuber 0.04
Unclassified 4.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1001084 3300000546 Bacteria 4229
2 JGI24752J21851_1006045 3300001976 Bacteria 1580
3 JGI24743J22301_10002711 3300001991 Bacteria 2710
4 JGI24749J21850_1004600 3300002076 Bacteria 1930
5 JGI24744J21845_10015542 3300002077 Bacteria 1521
6 JGI24751J29686_10023872 3300002459 Bacteria 1268
7 JGI25155J39150_1000102 3300002704 Bacteria 45181
8 JGI25156J39149_1000010 3300002705 Bacteria 200080
9 JGI25156J39149_1003941 3300002705 Bacteria 4692
10 JGI25154J39366_1000027 3300002738 Bacteria 200075
11 JGI25157J39369_1000146 3300002741 Bacteria 59929
12 JGI25152J39213_1001500 3300002773 Bacteria 9945
13 JGI25159J45721_1004826 3300002987 Bacteria 4357
14 JGI25151J46595_10000665 3300003187 Bacteria 29242
15 JGI25151J46595_10001147 3300003187 Bacteria 19200
16 JGI25151J46595_10001988 3300003187 Bacteria 12814
17 JGI25151J46595_10006454 3300003187 Bacteria 5899
18 JGI25151J46595_10037386 3300003187 Bacteria 1821
19 JGI25406J46586_10000085 3300003203 Bacteria 42549
20 JGI25406J46586_10000963 3300003203 Bacteria 13521
21 JGI25153J46596_10001926 3300003215 Bacteria 12324
22 JGI25153J46596_10003713 3300003215 Bacteria 8427
23 JGI25160J50197_1000129 3300003354 Bacteria 68068
24 JGI25161J50226_1000080 3300003374 Bacteria 79971
25 JGI25404J52841_10010033 3300003659 Bacteria 2033
26 Ga0055529_1000955 3300003763 Bacteria 15071
27 Ga0055526_1000392 3300003771 Bacteria 35369
28 Ga0055526_1010926 3300003771 Bacteria 4159
29 Ga0055524_1000120 3300003775 Bacteria 91299
30 Ga0055524_1000220 3300003775 Bacteria 60522
31 Ga0055524_1014910 3300003775 Bacteria 2859
32 Ga0055534_1004574 3300003784 Bacteria 3956
33 Ga0055528_1005152 3300003790 Bacteria 6148
34 Ga0055530_10001496 3300003791 Bacteria 16970
35 Ga0055540_1000067 3300003792 Bacteria 122108
36 Ga0055540_1000742 3300003792 Bacteria 22142
37 Ga0055531_10001465 3300003794 Bacteria 17364
38 Ga0055543_1000782 3300004625 Bacteria 15786
39 Ga0065165_1000089 3300005262 Bacteria 150859
40 Ga0065165_1003799 3300005262 Bacteria 10095
41 Ga0065165_1010089 3300005262 Bacteria 4140
42 Ga0065714_10096614 3300005288 Bacteria 1756
43 Ga0065715_10109379 3300005293 Bacteria 2671
44 Ga0065715_10109792 3300005293 Bacteria 2652
45 Ga0065715_10111824 3300005293 Bacteria 2557
46 Ga0065707_10005979 3300005295 Bacteria 3405
47 Ga0070658_10004615 3300005327 Bacteria 11195
48 Ga0070658_10031847 3300005327 Bacteria 4237
49 Ga0070658_10033925 3300005327 Bacteria 4107
50 Ga0070658_10131546 3300005327 Bacteria 2086
51 Ga0070658_10139561 3300005327 Bacteria 2024
52 Ga0070676_10030944 3300005328 Bacteria 3056
53 Ga0070676_10032265 3300005328 Bacteria 3000
54 Ga0070676_10035163 3300005328 Bacteria 2880
55 Ga0070676_10053655 3300005328 Bacteria 2375
56 Ga0070676_10063347 3300005328 Bacteria 2202
57 Ga0070676_10091806 3300005328 Bacteria 1861
58 Ga0070683_100003861 3300005329 Bacteria 12250
59 Ga0070683_100004329 3300005329 Bacteria 11672
60 Ga0070683_100024665 3300005329 Bacteria 5390
61 Ga0070683_100193150 3300005329 Bacteria 1933
62 Ga0070690_100000791 3300005330 Bacteria 16062
63 Ga0070690_100002610 3300005330 Bacteria 9708
64 Ga0070690_100038731 3300005330 Bacteria 3010
65 Ga0070690_100132853 3300005330 Bacteria 1682
66 Ga0070670_100003026 3300005331 Bacteria 13907
67 Ga0070670_100003111 3300005331 Bacteria 13732
68 Ga0070670_100003829 3300005331 Bacteria 12534
69 Ga0070670_100008102 3300005331 Bacteria 8938
70 Ga0070670_100012137 3300005331 Bacteria 7369
71 Ga0070670_100097346 3300005331 Bacteria 2531
72 Ga0070670_100108692 3300005331 Bacteria 2390
73 Ga0070670_100154343 3300005331 Bacteria 1988
74 Ga0070670_100166482 3300005331 Bacteria 1911
75 Ga0070670_100235863 3300005331 Bacteria 1592
76 Ga0070677_10007914 3300005333 Bacteria 3559
77 Ga0070677_10023224 3300005333 Bacteria 2294
78 Ga0070677_10096775 3300005333 Bacteria 1294
79 Ga0068869_100000765 3300005334 Bacteria 18276
80 Ga0068869_100001018 3300005334 Bacteria 16298
81 Ga0068869_100042720 3300005334 Bacteria 3252
82 Ga0068869_100055614 3300005334 Bacteria 2884
83 Ga0068869_100077594 3300005334 Bacteria 2472
84 Ga0068869_100345413 3300005334 Bacteria 1212
85 Ga0070666_10001146 3300005335 Bacteria 16113
86 Ga0070666_10002429 3300005335 Bacteria 11261
87 Ga0070666_10028081 3300005335 Bacteria 3691
88 Ga0070666_10036356 3300005335 Bacteria 3269
89 Ga0070666_10122534 3300005335 Bacteria 1804
90 Ga0070666_10152790 3300005335 Bacteria 1611
91 Ga0070680_100009247 3300005336 Bacteria 7559
92 Ga0070680_100009721 3300005336 Bacteria 7402
93 Ga0070680_100018087 3300005336 Bacteria 5567
94 Ga0070680_100047040 3300005336 Bacteria 3512
95 Ga0070680_100053041 3300005336 Bacteria 3309
96 Ga0070680_100061472 3300005336 Bacteria 3075
97 Ga0070680_100067178 3300005336 Bacteria 2940
98 Ga0070680_100081819 3300005336 Bacteria 2664
99 Ga0070680_100144337 3300005336 Bacteria 1997
100 Ga0070680_100213452 3300005336 Bacteria 1628
101 Ga0070680_100232628 3300005336 Bacteria 1557
102 Ga0070682_100013046 3300005337 Bacteria 4771
103 Ga0070682_100018870 3300005337 Bacteria 4038
104 Ga0068868_100001147 3300005338 Bacteria 18142
105 Ga0068868_100002556 3300005338 Bacteria 12651
106 Ga0068868_100021273 3300005338 Bacteria 4885
107 Ga0068868_100021806 3300005338 Bacteria 4828
108 Ga0068868_100022425 3300005338 Bacteria 4764
109 Ga0068868_100023378 3300005338 Bacteria 4677
110 Ga0068868_100059175 3300005338 Bacteria 3030
111 Ga0068868_100099979 3300005338 Bacteria 2346
112 Ga0068868_100130729 3300005338 Bacteria 2054
113 Ga0070660_100000414 3300005339 Bacteria 28402
114 Ga0070660_100007676 3300005339 Bacteria 7517
115 Ga0070660_100011856 3300005339 Bacteria 6213
116 Ga0070660_100281948 3300005339 Bacteria 1360
117 Ga0070689_100015635 3300005340 Bacteria 5538
118 Ga0070689_100028507 3300005340 Bacteria 4221
119 Ga0070689_100036959 3300005340 Bacteria 3736
120 Ga0070689_100055599 3300005340 Bacteria 3067
121 Ga0070691_10008601 3300005341 Bacteria 4672
122 Ga0070691_10011393 3300005341 Bacteria 4060
123 Ga0070691_10022802 3300005341 Bacteria 2906
124 Ga0070691_10068626 3300005341 Bacteria 1717
125 Ga0070687_100000304 3300005343 Bacteria 16643
126 Ga0070687_100056866 3300005343 Bacteria 2048
127 Ga0070661_100001393 3300005344 Bacteria 16882
128 Ga0070661_100002474 3300005344 Bacteria 12663
129 Ga0070661_100013149 3300005344 Bacteria 5809
130 Ga0070661_100013622 3300005344 Bacteria 5710
131 Ga0070661_100027259 3300005344 Bacteria 4112
132 Ga0070661_100208388 3300005344 Bacteria 1495
133 Ga0070692_10003468 3300005345 Bacteria 6398
134 Ga0070692_10003506 3300005345 Bacteria 6373
135 Ga0070668_100001125 3300005347 Bacteria 18781
136 Ga0070668_100002102 3300005347 Bacteria 14565
137 Ga0070668_100002366 3300005347 Bacteria 13865
138 Ga0070668_100004406 3300005347 Bacteria 10453
139 Ga0070668_100011384 3300005347 Bacteria 6626
140 Ga0070668_100016884 3300005347 Bacteria 5460
141 Ga0070668_100025270 3300005347 Bacteria 4502
142 Ga0070668_100026967 3300005347 Bacteria 4361
143 Ga0070668_100074994 3300005347 Bacteria 2640
144 Ga0070669_100047634 3300005353 Bacteria 3127
145 Ga0070669_100053873 3300005353 Bacteria 2945
146 Ga0070669_100111016 3300005353 Bacteria 2081
147 Ga0070675_100003449 3300005354 Bacteria 11977
148 Ga0070675_100005167 3300005354 Bacteria 9955
149 Ga0070675_100012529 3300005354 Bacteria 6647
150 Ga0070675_100022937 3300005354 Bacteria 4988
151 Ga0070675_100029663 3300005354 Bacteria 4413
152 Ga0070675_100042024 3300005354 Bacteria 3734
153 Ga0070675_100054875 3300005354 Bacteria 3279
154 Ga0070675_100058740 3300005354 Bacteria 3172
155 Ga0070675_100082426 3300005354 Bacteria 2683
156 Ga0070675_100197462 3300005354 Bacteria 1745
157 Ga0070671_100000338 3300005355 Bacteria 32240
158 Ga0070671_100006434 3300005355 Bacteria 9385
159 Ga0070671_100009895 3300005355 Bacteria 7657
160 Ga0070671_100025730 3300005355 Bacteria 4831
161 Ga0070671_100029700 3300005355 Bacteria 4508
162 Ga0070671_100043354 3300005355 Bacteria 3738
163 Ga0070671_100045096 3300005355 Bacteria 3665
164 Ga0070671_100071227 3300005355 Bacteria 2901
165 Ga0070674_100001258 3300005356 Bacteria 13315
166 Ga0070674_100001631 3300005356 Bacteria 12072
167 Ga0070674_100010861 3300005356 Bacteria 5522
168 Ga0070674_100012431 3300005356 Bacteria 5228
169 Ga0070674_100017576 3300005356 Bacteria 4504
170 Ga0070674_100022508 3300005356 Bacteria 4066
171 Ga0070674_100045874 3300005356 Bacteria 2987
172 Ga0070674_100049172 3300005356 Bacteria 2898
173 Ga0070674_100083748 3300005356 Bacteria 2285
174 Ga0070674_100096938 3300005356 Bacteria 2141
175 Ga0070674_100229580 3300005356 Bacteria 1448
176 Ga0070673_100000088 3300005364 Bacteria 39833
177 Ga0070673_100009518 3300005364 Bacteria 6524
178 Ga0070673_100038782 3300005364 Bacteria 3640
179 Ga0070673_100042543 3300005364 Bacteria 3503
180 Ga0070673_100055219 3300005364 Bacteria 3129
181 Ga0070673_100097997 3300005364 Bacteria 2409
182 Ga0070673_100123447 3300005364 Bacteria 2164
183 Ga0070673_100158345 3300005364 Bacteria 1924
184 Ga0070673_100194102 3300005364 Bacteria 1745
185 Ga0070688_100001429 3300005365 Bacteria 11887
186 Ga0070688_100002890 3300005365 Bacteria 8757
187 Ga0070659_100000526 3300005366 Bacteria 27993
188 Ga0070659_100018703 3300005366 Bacteria 5230
189 Ga0070659_100026219 3300005366 Bacteria 4482
190 Ga0070659_100095232 3300005366 Bacteria 2391
191 Ga0070659_100240271 3300005366 Bacteria 1499
192 Ga0070659_100284167 3300005366 Bacteria 1377
193 Ga0070667_100002119 3300005367 Bacteria 17493
194 Ga0070667_100004866 3300005367 Bacteria 11253
195 Ga0070667_100007593 3300005367 Bacteria 8992
196 Ga0070667_100010142 3300005367 Bacteria 7793
197 Ga0070667_100013844 3300005367 Bacteria 6668
198 Ga0070667_100013983 3300005367 Bacteria 6634
199 Ga0070667_100019067 3300005367 Bacteria 5688
200 Ga0070667_100024190 3300005367 Bacteria 5044
201 Ga0070667_100031393 3300005367 Bacteria 4430
202 Ga0070667_100037267 3300005367 Bacteria 4077
203 Ga0070667_100052433 3300005367 Bacteria 3442
204 Ga0070667_100077023 3300005367 Bacteria 2847
205 Ga0070667_100079962 3300005367 Bacteria 2795
206 Ga0070667_100097524 3300005367 Bacteria 2536
207 Ga0070667_100166561 3300005367 Bacteria 1944
208 Ga0070667_100185192 3300005367 Bacteria 1842
209 Ga0070709_10000166 3300005434 Bacteria 41674
210 Ga0070709_10017608 3300005434 Bacteria 4101
211 Ga0070709_10060445 3300005434 Bacteria 2409
212 Ga0070714_100000688 3300005435 Bacteria 23874
213 Ga0070714_100002535 3300005435 Bacteria 13462
214 Ga0070714_100005454 3300005435 Bacteria 9711
215 Ga0070714_100006050 3300005435 Bacteria 9289
216 Ga0070714_100007950 3300005435 Bacteria 8262
217 Ga0070714_100015514 3300005435 Bacteria 6128
218 Ga0070714_100030334 3300005435 Bacteria 4499
219 Ga0070714_100056448 3300005435 Bacteria 3359
220 Ga0070714_100066445 3300005435 Bacteria 3108
221 Ga0070714_100154862 3300005435 Bacteria 2068
222 Ga0070714_100308075 3300005435 Bacteria 1478
223 Ga0070713_100000050 3300005436 Bacteria 73746
224 Ga0070713_100000296 3300005436 Bacteria 32917
225 Ga0070713_100001145 3300005436 Bacteria 16990
226 Ga0070713_100003263 3300005436 Bacteria 10702
227 Ga0070713_100006994 3300005436 Bacteria 7877
228 Ga0070713_100041234 3300005436 Bacteria 3760
229 Ga0070713_100181970 3300005436 Bacteria 1889
230 Ga0070710_10000177 3300005437 Bacteria 29266
231 Ga0070710_10070659 3300005437 Bacteria 2011
232 Ga0070710_10088176 3300005437 Bacteria 1825
233 Ga0070701_10000171 3300005438 Bacteria 20076
234 Ga0070711_100003077 3300005439 Bacteria 9646
235 Ga0070711_100018275 3300005439 Bacteria 4473
236 Ga0070705_100000234 3300005440 Bacteria 32936
237 Ga0070705_100030916 3300005440 Bacteria 2960
238 Ga0070705_100179028 3300005440 Bacteria 1434
239 Ga0070700_100000396 3300005441 Bacteria 22554
240 Ga0070700_100003757 3300005441 Bacteria 7858
241 Ga0070700_100009762 3300005441 Bacteria 5276
242 Ga0070694_100000367 3300005444 Bacteria 24183
243 Ga0070694_100048846 3300005444 Bacteria 2847
244 Ga0070694_100141761 3300005444 Bacteria 1747
245 Ga0070708_100000482 3300005445 Bacteria 30278
246 Ga0070708_100005262 3300005445 Bacteria 10243
247 Ga0070708_100018279 3300005445 Bacteria 5866
248 Ga0070708_100028996 3300005445 Bacteria 4768
249 Ga0070708_100194359 3300005445 Bacteria 1898
250 Ga0070663_100003639 3300005455 Bacteria 8925
251 Ga0070663_100008039 3300005455 Bacteria 6467
252 Ga0070663_100014515 3300005455 Bacteria 5059
253 Ga0070663_100022478 3300005455 Bacteria 4218
254 Ga0070663_100023734 3300005455 Bacteria 4116
255 Ga0070663_100089090 3300005455 Bacteria 2283
256 Ga0070678_100000181 3300005456 Bacteria 27394
257 Ga0070678_100003020 3300005456 Bacteria 9322
258 Ga0070678_100003364 3300005456 Bacteria 8915
259 Ga0070678_100003576 3300005456 Bacteria 8673
260 Ga0070678_100004173 3300005456 Bacteria 8154
261 Ga0070678_100005633 3300005456 Bacteria 7269
262 Ga0070678_100019293 3300005456 Bacteria 4442
263 Ga0070678_100020420 3300005456 Bacteria 4346
264 Ga0070678_100073367 3300005456 Bacteria 2568
265 Ga0070662_100000260 3300005457 Bacteria 31271
266 Ga0070662_100014312 3300005457 Bacteria 5297
267 Ga0070662_100015884 3300005457 Bacteria 5049
268 Ga0070662_100018876 3300005457 Bacteria 4672
269 Ga0070662_100021232 3300005457 Bacteria 4432
270 Ga0070662_100033017 3300005457 Bacteria 3642
271 Ga0070662_100140000 3300005457 Bacteria 1874
272 Ga0070662_100151198 3300005457 Bacteria 1807
273 Ga0070681_10000270 3300005458 Bacteria 41405
274 Ga0070681_10004175 3300005458 Bacteria 13673
275 Ga0070681_10008106 3300005458 Bacteria 10278
276 Ga0070681_10015325 3300005458 Bacteria 7626
277 Ga0070681_10018680 3300005458 Bacteria 6933
278 Ga0070681_10084807 3300005458 Bacteria 3120
279 Ga0070681_10117545 3300005458 Bacteria 2595
280 Ga0068867_100001228 3300005459 Bacteria 17661
281 Ga0068867_100002868 3300005459 Bacteria 12133
282 Ga0068867_100006609 3300005459 Bacteria 8198
283 Ga0068867_100008399 3300005459 Bacteria 7282
284 Ga0068867_100014239 3300005459 Bacteria 5634
285 Ga0068867_100120473 3300005459 Bacteria 2027
286 Ga0068867_100218880 3300005459 Bacteria 1533
287 Ga0068867_100257386 3300005459 Bacteria 1422
288 Ga0070685_10001545 3300005466 Bacteria 12142
289 Ga0070706_100000916 3300005467 Bacteria 32335
290 Ga0070706_100010400 3300005467 Bacteria 8641
291 Ga0070706_100023387 3300005467 Bacteria 5691
292 Ga0070706_100041792 3300005467 Bacteria 4234
293 Ga0070706_100074346 3300005467 Bacteria 3145
294 Ga0070707_100006418 3300005468 Bacteria 10932
295 Ga0070707_100054091 3300005468 Bacteria 3848
296 Ga0070707_100088252 3300005468 Bacteria 3000
297 Ga0070707_100256846 3300005468 Unclassified 1700
298 Ga0070698_100020280 3300005471 Bacteria 6966
299 Ga0070698_100085575 3300005471 Bacteria 3140
300 Ga0070698_100356594 3300005471 Bacteria 1394
301 Ga0070699_100001364 3300005518 Bacteria 22452
302 Ga0070699_100007905 3300005518 Bacteria 9243
303 Ga0070699_100018493 3300005518 Bacteria 5984
304 Ga0070699_100027305 3300005518 Bacteria 4926
305 Ga0070699_100039229 3300005518 Bacteria 4101
306 Ga0070699_100040940 3300005518 Bacteria 4010
307 Ga0070699_100062738 3300005518 Bacteria 3221
308 Ga0070699_100154268 3300005518 Bacteria 2032
309 Ga0070699_100267397 3300005518 Bacteria 1530
310 Ga0070679_100003292 3300005530 Bacteria 14788
311 Ga0070679_100009100 3300005530 Bacteria 9372
312 Ga0070679_100009718 3300005530 Bacteria 9099
313 Ga0070679_100011541 3300005530 Bacteria 8422
314 Ga0070679_100015757 3300005530 Bacteria 7271
315 Ga0070679_100016703 3300005530 Bacteria 7090
316 Ga0070679_100019099 3300005530 Bacteria 6659
317 Ga0070679_100026131 3300005530 Bacteria 5732
318 Ga0070679_100029306 3300005530 Bacteria 5431
319 Ga0070679_100059424 3300005530 Bacteria 3811
320 Ga0070679_100073882 3300005530 Bacteria 3401
321 Ga0070679_100088141 3300005530 Bacteria 3090
322 Ga0070679_100169850 3300005530 Bacteria 2154
323 Ga0070679_100170041 3300005530 Bacteria 2152
324 Ga0070684_100000545 3300005535 Bacteria 25878
325 Ga0070684_100020182 3300005535 Bacteria 5528
326 Ga0070684_100061046 3300005535 Bacteria 3299
327 Ga0070684_100081786 3300005535 Bacteria 2858
328 Ga0070684_100102937 3300005535 Bacteria 2553
329 Ga0070684_100137869 3300005535 Bacteria 2205
330 Ga0070697_100010429 3300005536 Bacteria 7251
331 Ga0070697_100012160 3300005536 Bacteria 6741
332 Ga0070697_100074049 3300005536 Bacteria 2797
333 Ga0070697_100144999 3300005536 Bacteria 1998
334 Ga0070697_100341772 3300005536 Bacteria 1292
335 Ga0068853_100001405 3300005539 Bacteria 17386
336 Ga0068853_100001673 3300005539 Bacteria 16221
337 Ga0068853_100030506 3300005539 Bacteria 4554
338 Ga0068853_100111784 3300005539 Bacteria 2427
339 Ga0068853_100136664 3300005539 Bacteria 2198
340 Ga0068853_100174994 3300005539 Bacteria 1944
341 Ga0070672_100000162 3300005543 Bacteria 36932
342 Ga0070672_100002172 3300005543 Bacteria 12368
343 Ga0070672_100005135 3300005543 Bacteria 8641
344 Ga0070672_100010390 3300005543 Bacteria 6457
345 Ga0070672_100028301 3300005543 Bacteria 4191
346 Ga0070672_100033301 3300005543 Bacteria 3901
347 Ga0070672_100091418 3300005543 Bacteria 2455
348 Ga0070672_100111685 3300005543 Bacteria 2228
349 Ga0070672_100160907 3300005543 Bacteria 1862
350 Ga0070672_100194532 3300005543 Bacteria 1694
351 Ga0070672_100241519 3300005543 Bacteria 1519
352 Ga0070686_100000664 3300005544 Bacteria 20136
353 Ga0070686_100039547 3300005544 Bacteria 2939
354 Ga0070686_100096357 3300005544 Bacteria 1989
355 Ga0070686_100106129 3300005544 Bacteria 1906
356 Ga0070695_100000111 3300005545 Bacteria 36343
357 Ga0070695_100001361 3300005545 Bacteria 13561
358 Ga0070695_100011788 3300005545 Bacteria 5234
359 Ga0070695_100047364 3300005545 Bacteria 2745
360 Ga0070695_100065579 3300005545 Bacteria 2365
361 Ga0070695_100079680 3300005545 Bacteria 2163
362 Ga0070696_100000082 3300005546 Bacteria 47144
363 Ga0070696_100003444 3300005546 Bacteria 10532
364 Ga0070696_100021368 3300005546 Bacteria 4387
365 Ga0070696_100032551 3300005546 Bacteria 3577
366 Ga0070696_100045224 3300005546 Bacteria 3050
367 Ga0070693_100000114 3300005547 Bacteria 35958
368 Ga0070693_100000865 3300005547 Bacteria 13507
369 Ga0070693_100001728 3300005547 Bacteria 9939
370 Ga0070693_100005035 3300005547 Bacteria 6312
371 Ga0070693_100062816 3300005547 Bacteria 2162
372 Ga0070665_100002442 3300005548 Bacteria 20489
373 Ga0070665_100016639 3300005548 Bacteria 7370
374 Ga0070665_100029771 3300005548 Bacteria 5494
375 Ga0070665_100053727 3300005548 Bacteria 4040
376 Ga0070665_100099737 3300005548 Bacteria 2908
377 Ga0070665_100115672 3300005548 Bacteria 2685
378 Ga0070665_100128633 3300005548 Bacteria 2535
379 Ga0070665_100131950 3300005548 Bacteria 2500
380 Ga0070704_100000018 3300005549 Bacteria 54668
381 Ga0070704_100001228 3300005549 Bacteria 13503
382 Ga0070704_100033699 3300005549 Bacteria 3465
383 Ga0070704_100045554 3300005549 Bacteria 3053
384 Ga0070704_100047528 3300005549 Bacteria 3000
385 Ga0070704_100280801 3300005549 Bacteria 1379
386 Ga0068855_100000110 3300005563 Bacteria 102379
387 Ga0068855_100003278 3300005563 Bacteria 19819
388 Ga0068855_100005802 3300005563 Bacteria 15063
389 Ga0068855_100008462 3300005563 Bacteria 12442
390 Ga0068855_100012806 3300005563 Bacteria 10119
391 Ga0068855_100015031 3300005563 Bacteria 9322
392 Ga0068855_100026128 3300005563 Bacteria 6985
393 Ga0068855_100026300 3300005563 Bacteria 6961
394 Ga0068855_100055276 3300005563 Bacteria 4663
395 Ga0068855_100061401 3300005563 Bacteria 4391
396 Ga0068855_100071639 3300005563 Bacteria 4030
397 Ga0068855_100078243 3300005563 Bacteria 3836
398 Ga0068855_100102704 3300005563 Bacteria 3290
399 Ga0068855_100109076 3300005563 Bacteria 3179
400 Ga0068855_100213025 3300005563 Bacteria 2170
401 Ga0068855_100250382 3300005563 Bacteria 1976
402 Ga0068855_100257576 3300005563 Bacteria 1944
403 Ga0068855_100304165 3300005563 Bacteria 1765
404 Ga0068855_100313391 3300005563 Bacteria 1735
405 Ga0068855_100318261 3300005563 Bacteria 1720
406 Ga0070664_100000378 3300005564 Bacteria 33105
407 Ga0070664_100008665 3300005564 Bacteria 8231
408 Ga0070664_100025255 3300005564 Bacteria 4923
409 Ga0070664_100031992 3300005564 Bacteria 4400
410 Ga0070664_100131581 3300005564 Bacteria 2198
411 Ga0070664_100213331 3300005564 Bacteria 1726
412 Ga0070664_100229970 3300005564 Bacteria 1662
413 Ga0068857_100001558 3300005577 Bacteria 18383
414 Ga0068857_100023087 3300005577 Bacteria 5472
415 Ga0068857_100193717 3300005577 Bacteria 1852
416 Ga0068857_100204717 3300005577 Bacteria 1800
417 Ga0068854_100001530 3300005578 Bacteria 14031
418 Ga0068854_100006640 3300005578 Bacteria 7371
419 Ga0068854_100017510 3300005578 Bacteria 4794
420 Ga0068854_100024990 3300005578 Bacteria 4098
421 Ga0068854_100031933 3300005578 Bacteria 3661
422 Ga0068854_100113346 3300005578 Bacteria 2048
423 Ga0068854_100117862 3300005578 Bacteria 2011
424 Ga0068854_100173130 3300005578 Unclassified 1681
425 Ga0068854_100197974 3300005578 Bacteria 1578
426 Ga0068856_100000111 3300005614 Bacteria 81104
427 Ga0068856_100005394 3300005614 Bacteria 12607
428 Ga0068856_100007590 3300005614 Bacteria 10584
429 Ga0068856_100014426 3300005614 Bacteria 7633
430 Ga0068856_100028421 3300005614 Bacteria 5461
431 Ga0068856_100048125 3300005614 Bacteria 4201
432 Ga0068856_100174136 3300005614 Unclassified 2164
433 Ga0068856_100417654 3300005614 Bacteria 1361
434 Ga0070702_100000345 3300005615 Bacteria 16164
435 Ga0068852_100003212 3300005616 Bacteria 11414
436 Ga0068852_100004140 3300005616 Bacteria 10216
437 Ga0068852_100017789 3300005616 Bacteria 5586
438 Ga0068852_100019144 3300005616 Bacteria 5410
439 Ga0068852_100020157 3300005616 Bacteria 5297
440 Ga0068852_100025599 3300005616 Bacteria 4783
441 Ga0068852_100027955 3300005616 Bacteria 4607
442 Ga0068852_100031859 3300005616 Bacteria 4358
443 Ga0068852_100048828 3300005616 Unclassified 3618
444 Ga0068852_100101955 3300005616 Bacteria 2593
445 Ga0068852_100179663 3300005616 Bacteria 1989
446 Ga0068852_100282870 3300005616 Bacteria 1600
447 Ga0068859_100000050 3300005617 Bacteria 131351
448 Ga0068859_100001228 3300005617 Bacteria 26165
449 Ga0068859_100001261 3300005617 Bacteria 25857
450 Ga0068859_100005369 3300005617 Bacteria 13040
451 Ga0068859_100020233 3300005617 Bacteria 6681
452 Ga0068859_100039506 3300005617 Bacteria 4734
453 Ga0068859_100071664 3300005617 Bacteria 3501
454 Ga0068859_100122048 3300005617 Bacteria 2672
455 Ga0068859_100137103 3300005617 Bacteria 2520
456 Ga0068859_100137529 3300005617 Bacteria 2517
457 Ga0068859_100166988 3300005617 Bacteria 2281
458 Ga0068859_100242045 3300005617 Bacteria 1894
459 Ga0068864_100000460 3300005618 Bacteria 35285
460 Ga0068864_100002785 3300005618 Bacteria 14445
461 Ga0068864_100016703 3300005618 Bacteria 6115
462 Ga0068864_100027165 3300005618 Bacteria 4831
463 Ga0068864_100094192 3300005618 Bacteria 2646
464 Ga0068864_100102538 3300005618 Bacteria 2539
465 Ga0068864_100123793 3300005618 Bacteria 2315
466 Ga0068864_100140665 3300005618 Bacteria 2177
467 Ga0068864_100141225 3300005618 Bacteria 2172
468 Ga0068866_10000156 3300005718 Bacteria 31375
469 Ga0068866_10003100 3300005718 Bacteria 6850
470 Ga0068866_10006388 3300005718 Bacteria 4908
471 Ga0068861_100001057 3300005719 Bacteria 16951
472 Ga0068861_100009536 3300005719 Bacteria 6707
473 Ga0068861_100023788 3300005719 Bacteria 4423
474 Ga0068861_100057676 3300005719 Bacteria 2967
475 Ga0068861_100078478 3300005719 Bacteria 2578
476 Ga0068861_100160238 3300005719 Bacteria 1855
477 Ga0068861_100211799 3300005719 Bacteria 1633
478 Ga0068851_10000414 3300005834 Bacteria 19144
479 Ga0068851_10001349 3300005834 Bacteria 10720
480 Ga0068851_10087221 3300005834 Bacteria 1638
481 Ga0068870_10008908 3300005840 Bacteria 4534
482 Ga0068870_10016826 3300005840 Bacteria 3504
483 Ga0068870_10106359 3300005840 Bacteria 1594
484 Ga0068870_10117541 3300005840 Bacteria 1527
485 Ga0068863_100001068 3300005841 Bacteria 27364
486 Ga0068863_100025983 3300005841 Bacteria 5587
487 Ga0068863_100040897 3300005841 Bacteria 4407
488 Ga0068863_100051003 3300005841 Bacteria 3922
489 Ga0068863_100051490 3300005841 Bacteria 3903
490 Ga0068863_100057234 3300005841 Bacteria 3690
491 Ga0068863_100090628 3300005841 Bacteria 2899
492 Ga0068863_100096663 3300005841 Bacteria 2804
493 Ga0068863_100096791 3300005841 Bacteria 2802
494 Ga0068863_100143699 3300005841 Bacteria 2281
495 Ga0068858_100000509 3300005842 Bacteria 40798
496 Ga0068858_100000908 3300005842 Bacteria 30684
497 Ga0068858_100000936 3300005842 Bacteria 30216
498 Ga0068858_100001799 3300005842 Bacteria 21863
499 Ga0068858_100003300 3300005842 Bacteria 16062
500 Ga0068858_100004438 3300005842 Bacteria 13763
501 Ga0068858_100015891 3300005842 Bacteria 7073
502 Ga0068858_100073047 3300005842 Bacteria 3184
503 Ga0068858_100160385 3300005842 Bacteria 2117
504 Ga0068858_100202702 3300005842 Bacteria 1876
505 Ga0068860_100000654 3300005843 Bacteria 40345
506 Ga0068860_100002554 3300005843 Bacteria 19028
507 Ga0068860_100005079 3300005843 Bacteria 13385
508 Ga0068860_100013086 3300005843 Bacteria 8143
509 Ga0068860_100029150 3300005843 Bacteria 5309
510 Ga0068860_100055316 3300005843 Bacteria 3772
511 Ga0068860_100132929 3300005843 Bacteria 2389
512 Ga0068860_100253711 3300005843 Bacteria 1713
513 Ga0068860_100319516 3300005843 Bacteria 1524
514 Ga0068862_100002561 3300005844 Bacteria 16062
515 Ga0068862_100005682 3300005844 Bacteria 10408
516 Ga0068862_100013649 3300005844 Bacteria 6726
517 Ga0068862_100048752 3300005844 Bacteria 3616
518 Ga0068862_100090908 3300005844 Bacteria 2658
519 Ga0081538_10002434 3300005981 Bacteria 18220
520 Ga0081538_10038698 3300005981 Bacteria 3072
521 Ga0081540_1000034 3300005983 Bacteria 142197
522 Ga0081540_1000233 3300005983 Bacteria 58300
523 Ga0081540_1014864 3300005983 Bacteria 4956
524 Ga0081540_1044763 3300005983 Bacteria 2256
525 Ga0081539_10000003 3300005985 Bacteria 594833
526 Ga0081539_10000226 3300005985 Bacteria 132618
527 Ga0081539_10000350 3300005985 Bacteria 101255
528 Ga0081539_10002808 3300005985 Bacteria 23283
529 Ga0081539_10011647 3300005985 Bacteria 6921
530 Ga0081539_10046218 3300005985 Bacteria 2496
531 Ga0070717_10004190 3300006028 Bacteria 10395
532 Ga0070717_10005576 3300006028 Bacteria 9182
533 Ga0075365_10006017 3300006038 Bacteria 6626
534 Ga0075365_10021391 3300006038 Bacteria 4035
535 Ga0075365_10021774 3300006038 Bacteria 4005
536 Ga0075363_100003654 3300006048 Bacteria 6605
537 Ga0075363_100014909 3300006048 Bacteria 3811
538 Ga0075363_100047677 3300006048 Bacteria 2276
539 Ga0075364_10011203 3300006051 Bacteria 5444
540 Ga0075364_10073250 3300006051 Bacteria 2257
541 Ga0070715_10007390 3300006163 Bacteria 3782
542 Ga0070716_100024556 3300006173 Bacteria 3209
543 Ga0070712_100001526 3300006175 Bacteria 14126
544 Ga0070712_100068090 3300006175 Bacteria 2535
545 Ga0075362_10004553 3300006177 Bacteria 4994
546 Ga0075362_10006498 3300006177 Bacteria 4362
547 Ga0075362_10013784 3300006177 Bacteria 3245
548 Ga0075367_10002211 3300006178 Bacteria 8773
549 Ga0075367_10010754 3300006178 Bacteria 4819
550 Ga0075367_10020194 3300006178 Bacteria 3706
551 Ga0075367_10046150 3300006178 Bacteria 2559
552 Ga0075367_10155512 3300006178 Bacteria 1420
553 Ga0075369_10003214 3300006186 Bacteria 5930
554 Ga0075369_10005977 3300006186 Bacteria 4581
555 Ga0075369_10021320 3300006186 Bacteria 2661
556 Ga0075366_10000889 3300006195 Bacteria 14448
557 Ga0075366_10004299 3300006195 Bacteria 7642
558 Ga0075366_10005946 3300006195 Bacteria 6639
559 Ga0075366_10010089 3300006195 Bacteria 5293
560 Ga0075366_10017173 3300006195 Bacteria 4162
561 Ga0075366_10034969 3300006195 Bacteria 2962
562 Ga0075366_10067248 3300006195 Bacteria 2132
563 Ga0075366_10123704 3300006195 Bacteria 1559
564 Ga0097621_100005385 3300006237 Bacteria 9019
565 Ga0097621_100016314 3300006237 Bacteria 5611
566 Ga0097621_100021031 3300006237 Bacteria 5037
567 Ga0097621_100045565 3300006237 Bacteria 3543
568 Ga0097621_100105628 3300006237 Bacteria 2375
569 Ga0097621_100160476 3300006237 Bacteria 1932
570 Ga0097621_100165215 3300006237 Bacteria 1905
571 Ga0097621_100205692 3300006237 Bacteria 1710
572 Ga0075370_10000260 3300006353 Bacteria 18957
573 Ga0075370_10003339 3300006353 Bacteria 7622
574 Ga0075370_10004894 3300006353 Bacteria 6575
575 Ga0075370_10020321 3300006353 Bacteria 3627
576 Ga0075370_10043805 3300006353 Bacteria 2530
577 Ga0068871_100002592 3300006358 Bacteria 12334
578 Ga0068871_100003991 3300006358 Bacteria 10206
579 Ga0068871_100005158 3300006358 Bacteria 9134
580 Ga0068871_100014718 3300006358 Bacteria 5838
581 Ga0068871_100020821 3300006358 Bacteria 5031
582 Ga0068871_100044435 3300006358 Bacteria 3573
583 Ga0068871_100044872 3300006358 Bacteria 3556
584 Ga0068871_100121511 3300006358 Bacteria 2206
585 Ga0068871_100165706 3300006358 Bacteria 1892
586 Ga0068871_100203430 3300006358 Bacteria 1710
587 Ga0068871_100219035 3300006358 Bacteria 1648
588 Ga0068871_100254005 3300006358 Bacteria 1532
589 Ga0075428_100001234 3300006844 Bacteria 27338
590 Ga0075428_100004047 3300006844 Bacteria 16112
591 Ga0075428_100007549 3300006844 Bacteria 12051
592 Ga0075428_100022830 3300006844 Bacteria 6923
593 Ga0075428_100025082 3300006844 Bacteria 6596
594 Ga0075428_100036509 3300006844 Bacteria 5412
595 Ga0075428_100044680 3300006844 Bacteria 4867
596 Ga0075428_100073981 3300006844 Bacteria 3722
597 Ga0075428_100178975 3300006844 Bacteria 2296
598 Ga0075428_100208739 3300006844 Bacteria 2111
599 Ga0075430_100019910 3300006846 Bacteria 5709
600 Ga0075430_100103452 3300006846 Bacteria 2377
601 Ga0075430_100134215 3300006846 Bacteria 2063
602 Ga0075431_100004172 3300006847 Bacteria 14132
603 Ga0075431_100005968 3300006847 Bacteria 12063
604 Ga0075431_100028493 3300006847 Bacteria 5740
605 Ga0075431_100061865 3300006847 Bacteria 3863
606 Ga0075431_100083839 3300006847 Bacteria 3290
607 Ga0075431_100097021 3300006847 Bacteria 3043
608 Ga0075431_100115980 3300006847 Bacteria 2765
609 Ga0075433_10005257 3300006852 Bacteria 10150
610 Ga0075433_10010717 3300006852 Bacteria 7372
611 Ga0075433_10015526 3300006852 Bacteria 6251
612 Ga0075433_10053925 3300006852 Bacteria 3507
613 Ga0075433_10089679 3300006852 Bacteria 2717
614 Ga0075433_10302772 3300006852 Bacteria 1416
615 Ga0075434_100000358 3300006871 Bacteria 33110
616 Ga0075434_100001872 3300006871 Bacteria 18204
617 Ga0075434_100007534 3300006871 Bacteria 10080
618 Ga0075434_100008875 3300006871 Bacteria 9360
619 Ga0075434_100038634 3300006871 Bacteria 4728
620 Ga0075434_100107526 3300006871 Bacteria 2800
621 Ga0075434_100199420 3300006871 Bacteria 2021
622 Ga0075429_100004465 3300006880 Bacteria 12038
623 Ga0075429_100004891 3300006880 Bacteria 11543
624 Ga0075429_100005055 3300006880 Bacteria 11348
625 Ga0075429_100020573 3300006880 Bacteria 5726
626 Ga0075429_100071233 3300006880 Bacteria 3027
627 Ga0075429_100249503 3300006880 Bacteria 1554
628 Ga0068865_100000555 3300006881 Bacteria 20766
629 Ga0068865_100029629 3300006881 Bacteria 3634
630 Ga0075436_100000499 3300006914 Bacteria 25388
631 Ga0075436_100001270 3300006914 Bacteria 17140
632 Ga0075436_100001595 3300006914 Bacteria 15494
633 Ga0075436_100007515 3300006914 Bacteria 7446
634 Ga0075436_100012218 3300006914 Bacteria 5883
635 Ga0075436_100033467 3300006914 Bacteria 3543
636 Ga0075436_100040430 3300006914 Bacteria 3218
637 Ga0075436_100061715 3300006914 Bacteria 2590
638 Ga0075436_100067051 3300006914 Bacteria 2481
639 Ga0075436_100083387 3300006914 Bacteria 2218
640 Ga0097620_100000050 3300006931 Bacteria 131351
641 Ga0097620_100001228 3300006931 Bacteria 26165
642 Ga0097620_100001261 3300006931 Bacteria 25857
643 Ga0097620_100005369 3300006931 Bacteria 13040
644 Ga0097620_100020233 3300006931 Bacteria 6681
645 Ga0097620_100039503 3300006931 Bacteria 4734
646 Ga0097620_100071665 3300006931 Bacteria 3501
647 Ga0097620_100122046 3300006931 Bacteria 2672
648 Ga0097620_100137100 3300006931 Bacteria 2520
649 Ga0097620_100137522 3300006931 Bacteria 2517
650 Ga0097620_100166992 3300006931 Bacteria 2281
651 Ga0097620_100242050 3300006931 Bacteria 1894
652 Ga0099826_10101113 3300006948 Bacteria 1739
653 Ga0075435_100000518 3300007076 Bacteria 23614
654 Ga0075435_100000614 3300007076 Bacteria 21898
655 Ga0075435_100005567 3300007076 Bacteria 8816
656 Ga0075435_100005891 3300007076 Bacteria 8623
657 Ga0075435_100020348 3300007076 Bacteria 5082
658 Ga0075435_100116089 3300007076 Bacteria 2229
659 Ga0075435_100124014 3300007076 Bacteria 2157
660 Ga0099794_10045989 3300007265 Bacteria 2089
661 Ga0099794_10093076 3300007265 Bacteria 1498
662 Ga0099795_10011102 3300007788 Bacteria 2678
663 Ga0105251_10008986 3300009011 Bacteria 5961
664 Ga0105244_10002330 3300009036 Bacteria 14435
665 Ga0105250_10013698 3300009092 Bacteria 3341
666 Ga0105250_10033246 3300009092 Bacteria 2070
667 Ga0105240_10002253 3300009093 Bacteria 31317
668 Ga0105240_10002277 3300009093 Bacteria 31116
669 Ga0105240_10002317 3300009093 Bacteria 30815
670 Ga0105240_10004031 3300009093 Bacteria 22598
671 Ga0105240_10008860 3300009093 Bacteria 14325
672 Ga0105240_10014573 3300009093 Bacteria 10727
673 Ga0105240_10020031 3300009093 Bacteria 8930
674 Ga0105240_10056095 3300009093 Bacteria 4930
675 Ga0105240_10057621 3300009093 Bacteria 4852
676 Ga0105240_10108454 3300009093 Bacteria 3364
677 Ga0105240_10146957 3300009093 Bacteria 2812
678 Ga0105240_10173518 3300009093 Bacteria 2551
679 Ga0105240_10224480 3300009093 Bacteria 2186
680 Ga0111539_10000774 3300009094 Bacteria 41587
681 Ga0111539_10004948 3300009094 Bacteria 17333
682 Ga0111539_10009844 3300009094 Bacteria 12063
683 Ga0111539_10012218 3300009094 Bacteria 10770
684 Ga0111539_10019536 3300009094 Bacteria 8359
685 Ga0111539_10025598 3300009094 Bacteria 7232
686 Ga0111539_10027603 3300009094 Bacteria 6934
687 Ga0111539_10029884 3300009094 Bacteria 6629
688 Ga0111539_10035170 3300009094 Bacteria 6066
689 Ga0111539_10048101 3300009094 Bacteria 5094
690 Ga0111539_10077382 3300009094 Bacteria 3915
691 Ga0111539_10094104 3300009094 Bacteria 3520
692 Ga0111539_10276914 3300009094 Bacteria 1952
693 Ga0111539_10283886 3300009094 Bacteria 1927
694 Ga0105245_10006058 3300009098 Bacteria 10630
695 Ga0105245_10006192 3300009098 Bacteria 10530
696 Ga0105245_10012365 3300009098 Bacteria 7427
697 Ga0105245_10018143 3300009098 Bacteria 6152
698 Ga0105245_10018998 3300009098 Bacteria 6016
699 Ga0105245_10047958 3300009098 Bacteria 3820
700 Ga0105245_10078074 3300009098 Bacteria 3020
701 Ga0105245_10105489 3300009098 Bacteria 2614
702 Ga0105247_10000096 3300009101 Bacteria 95855
703 Ga0105247_10007792 3300009101 Bacteria 6552
704 Ga0105247_10026353 3300009101 Bacteria 3509
705 Ga0114129_10012508 3300009147 Bacteria 12083
706 Ga0114129_10057622 3300009147 Bacteria 5435
707 Ga0114129_10076783 3300009147 Bacteria 4649
708 Ga0114129_10244767 3300009147 Bacteria 2410
709 Ga0114129_10400193 3300009147 Bacteria 1810
710 Ga0114129_10631570 3300009147 Bacteria 1384
711 Ga0114129_10643173 3300009147 Bacteria 1370
712 Ga0105243_10002682 3300009148 Bacteria 14791
713 Ga0105243_10092325 3300009148 Bacteria 2496
714 Ga0105243_10150520 3300009148 Bacteria 1996
715 Ga0105241_10009644 3300009174 Bacteria 7093
716 Ga0105241_10009841 3300009174 Bacteria 7026
717 Ga0105241_10014428 3300009174 Bacteria 5785
718 Ga0105241_10046734 3300009174 Bacteria 3288
719 Ga0105241_10213921 3300009174 Bacteria 1616
720 Ga0105242_10000987 3300009176 Bacteria 22250
721 Ga0105242_10004690 3300009176 Bacteria 10583
722 Ga0105242_10005171 3300009176 Bacteria 10070
723 Ga0105242_10155246 3300009176 Bacteria 1999
724 Ga0105248_10005713 3300009177 Bacteria 13661
725 Ga0105248_10018063 3300009177 Bacteria 7785
726 Ga0105248_10019213 3300009177 Bacteria 7559
727 Ga0105248_10029722 3300009177 Bacteria 6098
728 Ga0105248_10046801 3300009177 Bacteria 4850
729 Ga0105248_10115806 3300009177 Bacteria 3023
730 Ga0105248_10280886 3300009177 Bacteria 1874
731 Ga0105248_10444987 3300009177 Bacteria 1460
732 Ga0105237_10013426 3300009545 Bacteria 8591
733 Ga0105237_10057451 3300009545 Bacteria 3894
734 Ga0105237_10078653 3300009545 Bacteria 3287
735 Ga0105237_10148920 3300009545 Bacteria 2336
736 Ga0105238_10035651 3300009551 Bacteria 5056
737 Ga0105238_10070957 3300009551 Bacteria 3481
738 Ga0105238_10101306 3300009551 Bacteria 2863
739 Ga0105238_10109205 3300009551 Bacteria 2747
740 Ga0105238_10137593 3300009551 Bacteria 2420
741 Ga0105249_10008399 3300009553 Bacteria 8996
742 Ga0105249_10031945 3300009553 Bacteria 4763
743 Ga0105249_10043097 3300009553 Bacteria 4105
744 Ga0105033_102584 3300009986 Bacteria 1501
745 Ga0105239_10037192 3300010375 Bacteria 5338
746 Ga0105239_10072852 3300010375 Bacteria 3777
747 Ga0105239_10106209 3300010375 Bacteria 3110
748 Ga0105239_10392130 3300010375 Bacteria 1571
749 Ga0105246_10021584 3300011119 Bacteria 4145
750 Ga0157373_10001619 3300013100 Bacteria 17169
751 Ga0157373_10002312 3300013100 Bacteria 14442
752 Ga0157373_10013368 3300013100 Bacteria 6020
753 Ga0157373_10027369 3300013100 Bacteria 4113
754 Ga0157373_10036627 3300013100 Bacteria 3520
755 Ga0157373_10057905 3300013100 Bacteria 2748
756 Ga0157371_10000248 3300013102 Bacteria 76451
757 Ga0157371_10059206 3300013102 Bacteria 2715
758 Ga0157371_10072086 3300013102 Bacteria 2446
759 Ga0157371_10113325 3300013102 Bacteria 1925
760 Ga0157370_10001476 3300013104 Bacteria 29099
761 Ga0157370_10002434 3300013104 Bacteria 22443
762 Ga0157370_10002793 3300013104 Bacteria 20861
763 Ga0157370_10017634 3300013104 Bacteria 7198
764 Ga0157370_10028618 3300013104 Bacteria 5479
765 Ga0157370_10046551 3300013104 Bacteria 4159
766 Ga0157370_10058497 3300013104 Bacteria 3663
767 Ga0157370_10090644 3300013104 Bacteria 2871
768 Ga0157370_10113977 3300013104 Bacteria 2526
769 Ga0157370_10251043 3300013104 Bacteria 1636
770 Ga0157370_10279892 3300013104 Bacteria 1541
771 Ga0157369_10002433 3300013105 Bacteria 22368
772 Ga0157369_10005169 3300013105 Bacteria 15270
773 Ga0157369_10009381 3300013105 Bacteria 11188
774 Ga0157369_10017645 3300013105 Bacteria 8020
775 Ga0157369_10028282 3300013105 Bacteria 6206
776 Ga0157369_10044702 3300013105 Unclassified 4819
777 Ga0157369_10068958 3300013105 Bacteria 3799
778 Ga0157369_10442469 3300013105 Bacteria 1346
779 Ga0157369_10475029 3300013105 Bacteria 1294
780 Ga0157374_10000383 3300013296 Bacteria 40730
781 Ga0157374_10140746 3300013296 Bacteria 2342
782 Ga0157374_10151670 3300013296 Bacteria 2253
783 Ga0157374_10197504 3300013296 Bacteria 1969
784 Ga0157374_10223434 3300013296 Bacteria 1849
785 Ga0157378_10001843 3300013297 Bacteria 19029
786 Ga0157378_10006389 3300013297 Bacteria 10304
787 Ga0157378_10013081 3300013297 Bacteria 7260
788 Ga0157378_10164146 3300013297 Bacteria 2079
789 Ga0163162_10009180 3300013306 Bacteria 9623
790 Ga0163162_10014658 3300013306 Bacteria 7660
791 Ga0163162_10022421 3300013306 Bacteria 6221
792 Ga0163162_10028063 3300013306 Bacteria 5568
793 Ga0163162_10066313 3300013306 Bacteria 3659
794 Ga0163162_10073237 3300013306 Bacteria 3481
795 Ga0163162_10092342 3300013306 Bacteria 3110
796 Ga0163162_10099059 3300013306 Bacteria 3005
797 Ga0163162_10286032 3300013306 Bacteria 1781
798 Ga0157372_10000853 3300013307 Bacteria 33072
799 Ga0157372_10002272 3300013307 Bacteria 20823
800 Ga0157372_10007773 3300013307 Bacteria 11387
801 Ga0157372_10010528 3300013307 Bacteria 9839
802 Ga0157372_10021026 3300013307 Bacteria 7046
803 Ga0157372_10025906 3300013307 Bacteria 6378
804 Ga0157372_10076391 3300013307 Bacteria 3782
805 Ga0157372_10077546 3300013307 Bacteria 3753
806 Ga0157372_10103094 3300013307 Bacteria 3260
807 Ga0157375_10002420 3300013308 Bacteria 16164
808 Ga0157375_10010965 3300013308 Bacteria 7994
809 Ga0157375_10015344 3300013308 Bacteria 6855
810 Ga0157375_10017406 3300013308 Bacteria 6485
811 Ga0157375_10061562 3300013308 Bacteria 3727
812 Ga0157375_10070871 3300013308 Bacteria 3497
813 Ga0157375_10082273 3300013308 Bacteria 3261
814 Ga0157375_10124072 3300013308 Bacteria 2696
815 Ga0157375_10250122 3300013308 Bacteria 1933
816 Ga0157375_10270500 3300013308 Bacteria 1861
817 Ga0157375_10352751 3300013308 Bacteria 1637
818 Ga0157375_10425083 3300013308 Bacteria 1494
819 Ga0163163_10002007 3300014325 Bacteria 17193
820 Ga0163163_10018281 3300014325 Bacteria 6557
821 Ga0163163_10018338 3300014325 Bacteria 6549
822 Ga0163163_10054333 3300014325 Bacteria 3957
823 Ga0163163_10054599 3300014325 Bacteria 3947
824 Ga0163163_10086471 3300014325 Bacteria 3144
825 Ga0163163_10146952 3300014325 Bacteria 2401
826 Ga0157380_10095999 3300014326 Bacteria 2457
827 Ga0157377_10007961 3300014745 Bacteria 5145
828 Ga0157377_10147190 3300014745 Bacteria 1453
829 Ga0157379_10000112 3300014968 Bacteria 56064
830 Ga0157379_10002542 3300014968 Bacteria 15302
831 Ga0157379_10003708 3300014968 Bacteria 13001
832 Ga0157379_10017141 3300014968 Bacteria 6379
833 Ga0157379_10064873 3300014968 Bacteria 3264
834 Ga0157379_10098574 3300014968 Bacteria 2624
835 Ga0157376_10002564 3300014969 Bacteria 12333
836 Ga0157376_10003872 3300014969 Bacteria 10345
837 Ga0157376_10006926 3300014969 Bacteria 8035
838 Ga0157376_10009458 3300014969 Bacteria 7078
839 Ga0157376_10018283 3300014969 Bacteria 5369
840 Ga0157376_10048694 3300014969 Bacteria 3507
841 Ga0157376_10058385 3300014969 Bacteria 3231
842 Ga0157376_10091163 3300014969 Bacteria 2640
843 Ga0157376_10168401 3300014969 Bacteria 1993
844 Ga0157376_10374289 3300014969 Bacteria 1370
845 Ga0183361_10020 3300016635 Bacteria 128627
846 Ga0163161_10039411 3300017792 Bacteria 3392
847 Ga0163161_10117754 3300017792 Bacteria 1993
848 Ga0163161_10231188 3300017792 Bacteria 1435
849 Ga0163161_10253178 3300017792 Bacteria 1373
850 Ga0163161_10276995 3300017792 Bacteria 1315
851 Ga0206356_10748952 3300020070 Bacteria 1838
852 Ga0206353_10626947 3300020082 Bacteria 1914
853 Ga0213873_10000922 3300021358 Bacteria 4757
854 Ga0213872_10021887 3300021361 Bacteria 2944
855 Ga0213874_10012479 3300021377 Bacteria 2180
856 Ga0213874_10032583 3300021377 Bacteria 1514
857 Ga0213876_10001148 3300021384 Bacteria 16814
858 Ga0213876_10001201 3300021384 Bacteria 16350
859 Ga0213875_10001830 3300021388 Bacteria 13220
860 Ga0213875_10007325 3300021388 Bacteria 5704
861 Ga0209435_100003 3300025206 Bacteria 669534
862 Ga0209436_103757 3300025208 Bacteria 3925
863 Ga0207425_1001795 3300025245 Bacteria 8312
864 Ga0209646_1000008 3300025246 Bacteria 669534
865 Ga0209026_1000007 3300025250 Bacteria 669534
866 Ga0209759_1000019 3300025256 Bacteria 357908
867 Ga0209759_1000150 3300025256 Bacteria 120839
868 Ga0209129_1000095 3300025258 Bacteria 171644
869 Ga0209129_1002122 3300025258 Bacteria 10086
870 Ga0209129_1002488 3300025258 Bacteria 8990
871 Ga0209565_1000077 3300025263 Bacteria 161163
872 Ga0209565_1000116 3300025263 Bacteria 114340
873 Ga0209565_1004239 3300025263 Bacteria 4433
874 Ga0209565_1005400 3300025263 Bacteria 3721
875 Ga0209455_1001612 3300025272 Bacteria 9889
876 Ga0209673_1001210 3300025273 Bacteria 27444
877 Ga0209673_1009392 3300025273 Bacteria 4243
878 Ga0209130_1000087 3300025284 Bacteria 155407
879 Ga0209130_1000095 3300025284 Bacteria 145126
880 Ga0209130_1000134 3300025284 Bacteria 119102
881 Ga0209675_1003004 3300025291 Bacteria 8298
882 Ga0209675_1007519 3300025291 Bacteria 4163
883 Ga0209675_1007884 3300025291 Bacteria 3999
884 Ga0209676_1000019 3300025292 Bacteria 620012
885 Ga0209676_1000145 3300025292 Bacteria 174391
886 Ga0209025_1000040 3300025294 Bacteria 376228
887 Ga0209025_1000231 3300025294 Bacteria 130671
888 Ga0209025_1000406 3300025294 Bacteria 87410
889 Ga0209025_1000762 3300025294 Bacteria 53705
890 Ga0209025_1001626 3300025294 Bacteria 28065
891 Ga0209025_1003068 3300025294 Bacteria 16402
892 Ga0209025_1005144 3300025294 Bacteria 10850
893 Ga0209025_1005742 3300025294 Bacteria 9968
894 Ga0209025_1011730 3300025294 Bacteria 5722
895 Ga0209025_1013094 3300025294 Bacteria 5243
896 Ga0209025_1039569 3300025294 Bacteria 2054
897 Ga0209564_1000062 3300025295 Bacteria 321275
898 Ga0209564_1000274 3300025295 Bacteria 107980
899 Ga0209564_1000728 3300025295 Bacteria 46991
900 Ga0209564_1007827 3300025295 Bacteria 5420
901 Ga0209564_1012801 3300025295 Bacteria 3623
902 Ga0209758_1000072 3300025297 Bacteria 277776
903 Ga0209758_1000122 3300025297 Bacteria 190970
904 Ga0209758_1000302 3300025297 Bacteria 96619
905 Ga0209758_1007283 3300025297 Bacteria 7592
906 Ga0209758_1008050 3300025297 Bacteria 6956
907 Ga0209050_1000023 3300025298 Bacteria 537172
908 Ga0209050_1000143 3300025298 Bacteria 171806
909 Ga0209050_1019316 3300025298 Bacteria 2594
910 Ga0209256_1000003 3300025299 Bacteria 1661127
911 Ga0209256_1000119 3300025299 Bacteria 168215
912 Ga0209256_1001038 3300025299 Bacteria 32584
913 Ga0209256_1028690 3300025299 Bacteria 1565
914 Ga0207426_1000397 3300025302 Bacteria 73966
915 Ga0207426_1013333 3300025302 Bacteria 3050
916 Ga0209051_1000017 3300025303 Bacteria 537172
917 Ga0209051_1000350 3300025303 Bacteria 68654
918 Ga0209051_1005009 3300025303 Bacteria 7894
919 Ga0209051_1013687 3300025303 Bacteria 3841
920 Ga0209051_1014556 3300025303 Bacteria 3663
921 Ga0209257_1000041 3300025304 Bacteria 537172
922 Ga0207697_10000878 3300025315 Bacteria 17003
923 Ga0207697_10020857 3300025315 Bacteria 2683
924 Ga0207697_10024842 3300025315 Bacteria 2451
925 Ga0207697_10077986 3300025315 Bacteria 1393
926 Ga0207656_10002354 3300025321 Bacteria 6344
927 Ga0207656_10005152 3300025321 Bacteria 4595
928 Ga0207656_10025355 3300025321 Bacteria 2406
929 Ga0207656_10043842 3300025321 Bacteria 1909
930 Ga0207655_1000081 3300025728 Bacteria 214272
931 Ga0207713_1005290 3300025735 Bacteria 8119
932 Ga0207682_10000322 3300025893 Bacteria 21806
933 Ga0207682_10000734 3300025893 Bacteria 15195
934 Ga0207682_10004201 3300025893 Bacteria 6082
935 Ga0207682_10027596 3300025893 Bacteria 2261
936 Ga0207682_10035024 3300025893 Bacteria 2026
937 Ga0207692_10042245 3300025898 Bacteria 2262
938 Ga0207642_10002655 3300025899 Bacteria 5574
939 Ga0207642_10002928 3300025899 Bacteria 5341
940 Ga0207710_10001100 3300025900 Bacteria 13851
941 Ga0207710_10031418 3300025900 Bacteria 2322
942 Ga0207688_10064844 3300025901 Bacteria 2063
943 Ga0207688_10129224 3300025901 Bacteria 1480
944 Ga0207680_10009052 3300025903 Bacteria 4921
945 Ga0207680_10014314 3300025903 Bacteria 4100
946 Ga0207680_10023983 3300025903 Bacteria 3340
947 Ga0207685_10015914 3300025905 Bacteria 2395
948 Ga0207699_10009538 3300025906 Bacteria 4838
949 Ga0207699_10039273 3300025906 Bacteria 2718
950 Ga0207699_10052903 3300025906 Bacteria 2406
951 Ga0207699_10130385 3300025906 Bacteria 1639
952 Ga0207645_10000566 3300025907 Bacteria 30620
953 Ga0207645_10001846 3300025907 Bacteria 17066
954 Ga0207645_10003269 3300025907 Bacteria 12375
955 Ga0207645_10005615 3300025907 Bacteria 9069
956 Ga0207645_10012049 3300025907 Bacteria 5879
957 Ga0207645_10039297 3300025907 Bacteria 3032
958 Ga0207645_10051024 3300025907 Bacteria 2643
959 Ga0207645_10117450 3300025907 Bacteria 1725
960 Ga0207645_10144351 3300025907 Bacteria 1551
961 Ga0207643_10000359 3300025908 Bacteria 30555
962 Ga0207643_10005706 3300025908 Bacteria 6656
963 Ga0207643_10025037 3300025908 Bacteria 3296
964 Ga0207643_10025602 3300025908 Bacteria 3262
965 Ga0207643_10100650 3300025908 Bacteria 1695
966 Ga0207705_10040333 3300025909 Unclassified 3348
967 Ga0207705_10088206 3300025909 Bacteria 2269
968 Ga0207684_10001435 3300025910 Bacteria 25772
969 Ga0207684_10015827 3300025910 Bacteria 6485
970 Ga0207684_10064256 3300025910 Bacteria 3116
971 Ga0207684_10096107 3300025910 Bacteria 2529
972 Ga0207654_10007099 3300025911 Bacteria 5644
973 Ga0207654_10013783 3300025911 Bacteria 4165
974 Ga0207654_10024105 3300025911 Bacteria 3267
975 Ga0207654_10032026 3300025911 Bacteria 2900
976 Ga0207654_10060487 3300025911 Bacteria 2213
977 Ga0207707_10004047 3300025912 Bacteria 12993
978 Ga0207707_10004182 3300025912 Bacteria 12784
979 Ga0207707_10014718 3300025912 Bacteria 6817
980 Ga0207707_10037315 3300025912 Bacteria 4247
981 Ga0207707_10102264 3300025912 Bacteria 2505
982 Ga0207707_10104201 3300025912 Bacteria 2479
983 Ga0207707_10267505 3300025912 Bacteria 1482
984 Ga0207707_10282263 3300025912 Bacteria 1438
985 Ga0207695_10010633 3300025913 Bacteria 11243
986 Ga0207695_10015435 3300025913 Bacteria 8993
987 Ga0207695_10018070 3300025913 Bacteria 8162
988 Ga0207695_10026095 3300025913 Bacteria 6526
989 Ga0207695_10029551 3300025913 Bacteria 6051
990 Ga0207695_10030199 3300025913 Bacteria 5970
991 Ga0207695_10033181 3300025913 Bacteria 5637
992 Ga0207695_10067247 3300025913 Bacteria 3676
993 Ga0207695_10068579 3300025913 Bacteria 3634
994 Ga0207695_10180178 3300025913 Bacteria 2034
995 Ga0207671_10042375 3300025914 Bacteria 3369
996 Ga0207671_10056265 3300025914 Bacteria 2914
997 Ga0207671_10195766 3300025914 Bacteria 1577
998 Ga0207693_10000254 3300025915 Bacteria 49362
999 Ga0207693_10005030 3300025915 Bacteria 11101
1000 Ga0207693_10045324 3300025915 Bacteria 3455
1001 Ga0207663_10000170 3300025916 Bacteria 29272
1002 Ga0207663_10009347 3300025916 Bacteria 5174
1003 Ga0207660_10004490 3300025917 Bacteria 9101
1004 Ga0207660_10013388 3300025917 Bacteria 5377
1005 Ga0207660_10060572 3300025917 Bacteria 2722
1006 Ga0207660_10087926 3300025917 Bacteria 2297
1007 Ga0207660_10145920 3300025917 Bacteria 1814
1008 Ga0207660_10186308 3300025917 Bacteria 1614
1009 Ga0207660_10197139 3300025917 Bacteria 1571
1010 Ga0207660_10216583 3300025917 Bacteria 1501
1011 Ga0207662_10000269 3300025918 Bacteria 23948
1012 Ga0207662_10005657 3300025918 Bacteria 6684
1013 Ga0207662_10010985 3300025918 Bacteria 5010
1014 Ga0207662_10040377 3300025918 Bacteria 2743
1015 Ga0207662_10077594 3300025918 Bacteria 2021
1016 Ga0207657_10000894 3300025919 Bacteria 31534
1017 Ga0207657_10000910 3300025919 Bacteria 31264
1018 Ga0207657_10002586 3300025919 Bacteria 19581
1019 Ga0207657_10009641 3300025919 Bacteria 9690
1020 Ga0207657_10010420 3300025919 Bacteria 9279
1021 Ga0207657_10011936 3300025919 Bacteria 8597
1022 Ga0207657_10054102 3300025919 Unclassified 3473
1023 Ga0207657_10100815 3300025919 Bacteria 2397
1024 Ga0207649_10007671 3300025920 Bacteria 5869
1025 Ga0207649_10008175 3300025920 Bacteria 5696
1026 Ga0207649_10009735 3300025920 Bacteria 5264
1027 Ga0207649_10240052 3300025920 Bacteria 1300
1028 Ga0207652_10002789 3300025921 Bacteria 14674
1029 Ga0207652_10014053 3300025921 Bacteria 6480
1030 Ga0207652_10020495 3300025921 Bacteria 5445
1031 Ga0207652_10032606 3300025921 Bacteria 4382
1032 Ga0207652_10038737 3300025921 Bacteria 4042
1033 Ga0207652_10064636 3300025921 Bacteria 3166
1034 Ga0207652_10074683 3300025921 Bacteria 2952
1035 Ga0207652_10083693 3300025921 Bacteria 2794
1036 Ga0207652_10128589 3300025921 Bacteria 2258
1037 Ga0207652_10232749 3300025921 Bacteria 1661
1038 Ga0207652_10238279 3300025921 Bacteria 1640
1039 Ga0207646_10007355 3300025922 Bacteria 11216
1040 Ga0207646_10072730 3300025922 Bacteria 3071
1041 Ga0207646_10088310 3300025922 Bacteria 2774
1042 Ga0207646_10183280 3300025922 Bacteria 1891
1043 Ga0207681_10004029 3300025923 Bacteria 9113
1044 Ga0207681_10016931 3300025923 Bacteria 4570
1045 Ga0207681_10026224 3300025923 Bacteria 3757
1046 Ga0207681_10048133 3300025923 Bacteria 2876
1047 Ga0207681_10137157 3300025923 Bacteria 1817
1048 Ga0207681_10182015 3300025923 Bacteria 1601
1049 Ga0207694_10084650 3300025924 Bacteria 2494
1050 Ga0207694_10278506 3300025924 Bacteria 1373
1051 Ga0207650_10006778 3300025925 Bacteria 7811
1052 Ga0207650_10006791 3300025925 Bacteria 7805
1053 Ga0207650_10007082 3300025925 Bacteria 7642
1054 Ga0207650_10019133 3300025925 Bacteria 4812
1055 Ga0207650_10038704 3300025925 Bacteria 3484
1056 Ga0207650_10048127 3300025925 Bacteria 3144
1057 Ga0207650_10052972 3300025925 Bacteria 3007
1058 Ga0207650_10058189 3300025925 Bacteria 2877
1059 Ga0207650_10060031 3300025925 Bacteria 2837
1060 Ga0207650_10063538 3300025925 Bacteria 2760
1061 Ga0207650_10090302 3300025925 Bacteria 2339
1062 Ga0207650_10144783 3300025925 Bacteria 1871
1063 Ga0207650_10295923 3300025925 Bacteria 1321
1064 Ga0207659_10002162 3300025926 Bacteria 11680
1065 Ga0207659_10008786 3300025926 Bacteria 6293
1066 Ga0207659_10009706 3300025926 Bacteria 6018
1067 Ga0207659_10014831 3300025926 Bacteria 5037
1068 Ga0207659_10021968 3300025926 Bacteria 4243
1069 Ga0207659_10056197 3300025926 Bacteria 2818
1070 Ga0207659_10087462 3300025926 Bacteria 2319
1071 Ga0207687_10002262 3300025927 Bacteria 13120
1072 Ga0207687_10002498 3300025927 Bacteria 12485
1073 Ga0207687_10003693 3300025927 Bacteria 10301
1074 Ga0207687_10048895 3300025927 Bacteria 2939
1075 Ga0207687_10093060 3300025927 Bacteria 2203
1076 Ga0207687_10107229 3300025927 Bacteria 2066
1077 Ga0207687_10279393 3300025927 Bacteria 1338
1078 Ga0207700_10000029 3300025928 Bacteria 132615
1079 Ga0207700_10001192 3300025928 Bacteria 14939
1080 Ga0207700_10001526 3300025928 Bacteria 13117
1081 Ga0207700_10002806 3300025928 Bacteria 10028
1082 Ga0207700_10004530 3300025928 Bacteria 8208
1083 Ga0207664_10000168 3300025929 Bacteria 52834
1084 Ga0207664_10001380 3300025929 Bacteria 15949
1085 Ga0207664_10049306 3300025929 Bacteria 3314
1086 Ga0207664_10076163 3300025929 Bacteria 2715
1087 Ga0207664_10081040 3300025929 Bacteria 2640
1088 Ga0207664_10154994 3300025929 Bacteria 1949
1089 Ga0207664_10281259 3300025929 Bacteria 1460
1090 Ga0207644_10002009 3300025931 Bacteria 13168
1091 Ga0207644_10002533 3300025931 Bacteria 11752
1092 Ga0207644_10002966 3300025931 Bacteria 10931
1093 Ga0207644_10011226 3300025931 Bacteria 5922
1094 Ga0207644_10012107 3300025931 Bacteria 5722
1095 Ga0207644_10015020 3300025931 Bacteria 5193
1096 Ga0207644_10019061 3300025931 Bacteria 4650
1097 Ga0207644_10039113 3300025931 Bacteria 3346
1098 Ga0207644_10039942 3300025931 Bacteria 3314
1099 Ga0207644_10056950 3300025931 Bacteria 2821
1100 Ga0207644_10062939 3300025931 Bacteria 2692
1101 Ga0207644_10142981 3300025931 Bacteria 1844
1102 Ga0207644_10207302 3300025931 Bacteria 1548
1103 Ga0207644_10286144 3300025931 Bacteria 1324
1104 Ga0207690_10021165 3300025932 Bacteria 4028
1105 Ga0207690_10060193 3300025932 Bacteria 2576
1106 Ga0207690_10162126 3300025932 Bacteria 1668
1107 Ga0207690_10274384 3300025932 Bacteria 1311
1108 Ga0207706_10000008 3300025933 Bacteria 201940
1109 Ga0207706_10000918 3300025933 Bacteria 30228
1110 Ga0207706_10015589 3300025933 Bacteria 6865
1111 Ga0207706_10017980 3300025933 Bacteria 6361
1112 Ga0207706_10025205 3300025933 Bacteria 5332
1113 Ga0207706_10034060 3300025933 Bacteria 4532
1114 Ga0207706_10085191 3300025933 Bacteria 2778
1115 Ga0207706_10094141 3300025933 Bacteria 2635
1116 Ga0207706_10112183 3300025933 Bacteria 2399
1117 Ga0207706_10136569 3300025933 Bacteria 2157
1118 Ga0207706_10175242 3300025933 Bacteria 1884
1119 Ga0207686_10000302 3300025934 Bacteria 35955
1120 Ga0207686_10003451 3300025934 Bacteria 8490
1121 Ga0207686_10004433 3300025934 Bacteria 7526
1122 Ga0207686_10013258 3300025934 Bacteria 4557
1123 Ga0207686_10014352 3300025934 Bacteria 4407
1124 Ga0207686_10153659 3300025934 Bacteria 1605
1125 Ga0207686_10193233 3300025934 Bacteria 1452
1126 Ga0207709_10000759 3300025935 Bacteria 25445
1127 Ga0207709_10005409 3300025935 Bacteria 7262
1128 Ga0207670_10001147 3300025936 Bacteria 13941
1129 Ga0207670_10013237 3300025936 Bacteria 4854
1130 Ga0207670_10021145 3300025936 Bacteria 4009
1131 Ga0207670_10039924 3300025936 Bacteria 3077
1132 Ga0207670_10058975 3300025936 Bacteria 2609
1133 Ga0207670_10113586 3300025936 Bacteria 1956
1134 Ga0207670_10118013 3300025936 Bacteria 1923
1135 Ga0207669_10005372 3300025937 Bacteria 5743
1136 Ga0207669_10017247 3300025937 Bacteria 3698
1137 Ga0207669_10030798 3300025937 Bacteria 2987
1138 Ga0207669_10034968 3300025937 Bacteria 2853
1139 Ga0207669_10102327 3300025937 Bacteria 1897
1140 Ga0207669_10110195 3300025937 Bacteria 1843
1141 Ga0207669_10113094 3300025937 Bacteria 1824
1142 Ga0207669_10134098 3300025937 Bacteria 1707
1143 Ga0207704_10000698 3300025938 Bacteria 14805
1144 Ga0207704_10026586 3300025938 Bacteria 3177
1145 Ga0207704_10073401 3300025938 Bacteria 2179
1146 Ga0207704_10113959 3300025938 Bacteria 1834
1147 Ga0207704_10144508 3300025938 Bacteria 1669
1148 Ga0207665_10000144 3300025939 Bacteria 48077
1149 Ga0207665_10003107 3300025939 Bacteria 11137
1150 Ga0207665_10109588 3300025939 Bacteria 1938
1151 Ga0207691_10000445 3300025940 Bacteria 40892
1152 Ga0207691_10001965 3300025940 Bacteria 20102
1153 Ga0207691_10003889 3300025940 Bacteria 14502
1154 Ga0207691_10005758 3300025940 Bacteria 11991
1155 Ga0207691_10006969 3300025940 Bacteria 10902
1156 Ga0207691_10017602 3300025940 Bacteria 6773
1157 Ga0207691_10017742 3300025940 Bacteria 6747
1158 Ga0207691_10027487 3300025940 Bacteria 5333
1159 Ga0207691_10045823 3300025940 Bacteria 4019
1160 Ga0207691_10192422 3300025940 Bacteria 1779
1161 Ga0207691_10197646 3300025940 Bacteria 1751
1162 Ga0207691_10201505 3300025940 Bacteria 1732
1163 Ga0207711_10002349 3300025941 Bacteria 16953
1164 Ga0207711_10032140 3300025941 Bacteria 4437
1165 Ga0207711_10053204 3300025941 Bacteria 3472
1166 Ga0207711_10059364 3300025941 Bacteria 3293
1167 Ga0207711_10061594 3300025941 Bacteria 3236
1168 Ga0207711_10065889 3300025941 Bacteria 3132
1169 Ga0207711_10071157 3300025941 Bacteria 3017
1170 Ga0207711_10170714 3300025941 Bacteria 1973
1171 Ga0207711_10203801 3300025941 Bacteria 1806
1172 Ga0207689_10000264 3300025942 Bacteria 47214
1173 Ga0207689_10001002 3300025942 Bacteria 27139
1174 Ga0207689_10001752 3300025942 Bacteria 20489
1175 Ga0207689_10018905 3300025942 Bacteria 5811
1176 Ga0207689_10025980 3300025942 Bacteria 4904
1177 Ga0207689_10028106 3300025942 Bacteria 4703
1178 Ga0207689_10102669 3300025942 Bacteria 2349
1179 Ga0207689_10240972 3300025942 Bacteria 1495
1180 Ga0207689_10285880 3300025942 Bacteria 1366
1181 Ga0207661_10002159 3300025944 Bacteria 13551
1182 Ga0207661_10010709 3300025944 Bacteria 6609
1183 Ga0207661_10026953 3300025944 Bacteria 4385
1184 Ga0207661_10052101 3300025944 Bacteria 3268
1185 Ga0207661_10084180 3300025944 Bacteria 2633
1186 Ga0207661_10271990 3300025944 Bacteria 1512
1187 Ga0207661_10359374 3300025944 Bacteria 1315
1188 Ga0207679_10000934 3300025945 Bacteria 18670
1189 Ga0207679_10008329 3300025945 Bacteria 6604
1190 Ga0207679_10026399 3300025945 Bacteria 4004
1191 Ga0207679_10097947 3300025945 Bacteria 2285
1192 Ga0207679_10105695 3300025945 Bacteria 2211
1193 Ga0207679_10125934 3300025945 Bacteria 2047
1194 Ga0207679_10248342 3300025945 Bacteria 1511
1195 Ga0207667_10001326 3300025949 Bacteria 31063
1196 Ga0207667_10002319 3300025949 Bacteria 23836
1197 Ga0207667_10005114 3300025949 Bacteria 16016
1198 Ga0207667_10007810 3300025949 Bacteria 12787
1199 Ga0207667_10011686 3300025949 Bacteria 10187
1200 Ga0207667_10013199 3300025949 Bacteria 9471
1201 Ga0207667_10025214 3300025949 Bacteria 6512
1202 Ga0207667_10047830 3300025949 Bacteria 4526
1203 Ga0207667_10065289 3300025949 Bacteria 3797
1204 Ga0207667_10107719 3300025949 Bacteria 2875
1205 Ga0207667_10179921 3300025949 Bacteria 2172
1206 Ga0207667_10254061 3300025949 Bacteria 1798
1207 Ga0207667_10258707 3300025949 Bacteria 1780
1208 Ga0207667_10359671 3300025949 Bacteria 1484
1209 Ga0207651_10001791 3300025960 Bacteria 9983
1210 Ga0207651_10008798 3300025960 Bacteria 5480
1211 Ga0207651_10089694 3300025960 Bacteria 2245
1212 Ga0207651_10134288 3300025960 Bacteria 1900
1213 Ga0207712_10000914 3300025961 Bacteria 21401
1214 Ga0207712_10050072 3300025961 Bacteria 2915
1215 Ga0207668_10002718 3300025972 Bacteria 10355
1216 Ga0207668_10002952 3300025972 Bacteria 9967
1217 Ga0207668_10006144 3300025972 Bacteria 7084
1218 Ga0207668_10006590 3300025972 Bacteria 6865
1219 Ga0207668_10014807 3300025972 Bacteria 4834
1220 Ga0207668_10025949 3300025972 Bacteria 3799
1221 Ga0207668_10191690 3300025972 Bacteria 1620
1222 Ga0207640_10007012 3300025981 Bacteria 6202
1223 Ga0207640_10012816 3300025981 Bacteria 4789
1224 Ga0207640_10014760 3300025981 Bacteria 4505
1225 Ga0207640_10025893 3300025981 Bacteria 3557
1226 Ga0207640_10027679 3300025981 Bacteria 3457
1227 Ga0207640_10275967 3300025981 Bacteria 1318
1228 Ga0207658_10005406 3300025986 Bacteria 8764
1229 Ga0207658_10010573 3300025986 Bacteria 6271
1230 Ga0207658_10015102 3300025986 Bacteria 5296
1231 Ga0207658_10027760 3300025986 Bacteria 3980
1232 Ga0207658_10034275 3300025986 Bacteria 3627
1233 Ga0207658_10054407 3300025986 Bacteria 2961
1234 Ga0207658_10072215 3300025986 Bacteria 2615
1235 Ga0207658_10171666 3300025986 Bacteria 1787
1236 Ga0207658_10197228 3300025986 Bacteria 1678
1237 Ga0207677_10001411 3300026023 Bacteria 12801
1238 Ga0207677_10001899 3300026023 Bacteria 11029
1239 Ga0207677_10005148 3300026023 Bacteria 7077
1240 Ga0207677_10006672 3300026023 Bacteria 6339
1241 Ga0207677_10011282 3300026023 Bacteria 5087
1242 Ga0207677_10012603 3300026023 Bacteria 4869
1243 Ga0207677_10014588 3300026023 Bacteria 4595
1244 Ga0207677_10022852 3300026023 Bacteria 3851
1245 Ga0207677_10055131 3300026023 Bacteria 2717
1246 Ga0207677_10063856 3300026023 Bacteria 2561
1247 Ga0207703_10000312 3300026035 Bacteria 52728
1248 Ga0207703_10000519 3300026035 Bacteria 39563
1249 Ga0207703_10001439 3300026035 Bacteria 21733
1250 Ga0207703_10001924 3300026035 Bacteria 18395
1251 Ga0207703_10004500 3300026035 Bacteria 11440
1252 Ga0207703_10010082 3300026035 Bacteria 7405
1253 Ga0207703_10056104 3300026035 Bacteria 3207
1254 Ga0207703_10234668 3300026035 Bacteria 1646
1255 Ga0207703_10272757 3300026035 Bacteria 1533
1256 Ga0207703_10356315 3300026035 Bacteria 1348
1257 Ga0207703_10364156 3300026035 Bacteria 1334
1258 Ga0207639_10003226 3300026041 Bacteria 10969
1259 Ga0207639_10019458 3300026041 Bacteria 4842
1260 Ga0207639_10133260 3300026041 Bacteria 2060
1261 Ga0207639_10140382 3300026041 Bacteria 2012
1262 Ga0207678_10008479 3300026067 Bacteria 9064
1263 Ga0207678_10013310 3300026067 Bacteria 7219
1264 Ga0207678_10013688 3300026067 Bacteria 7125
1265 Ga0207678_10026139 3300026067 Bacteria 5094
1266 Ga0207678_10055132 3300026067 Bacteria 3424
1267 Ga0207678_10101232 3300026067 Bacteria 2461
1268 Ga0207678_10118446 3300026067 Bacteria 2259
1269 Ga0207678_10232350 3300026067 Bacteria 1579
1270 Ga0207708_10000494 3300026075 Bacteria 30296
1271 Ga0207708_10000736 3300026075 Bacteria 24605
1272 Ga0207708_10014620 3300026075 Bacteria 5873
1273 Ga0207708_10081135 3300026075 Bacteria 2493
1274 Ga0207702_10000510 3300026078 Bacteria 43837
1275 Ga0207702_10001951 3300026078 Bacteria 20113
1276 Ga0207702_10009236 3300026078 Bacteria 8287
1277 Ga0207702_10011613 3300026078 Bacteria 7340
1278 Ga0207702_10034707 3300026078 Bacteria 4218
1279 Ga0207702_10052132 3300026078 Bacteria 3461
1280 Ga0207702_10279662 3300026078 Bacteria 1577
1281 Ga0207641_10002633 3300026088 Bacteria 16445
1282 Ga0207641_10003157 3300026088 Bacteria 14760
1283 Ga0207641_10003409 3300026088 Bacteria 14084
1284 Ga0207641_10005405 3300026088 Bacteria 10910
1285 Ga0207641_10017709 3300026088 Bacteria 5836
1286 Ga0207641_10023223 3300026088 Bacteria 5110
1287 Ga0207641_10034439 3300026088 Bacteria 4213
1288 Ga0207641_10044364 3300026088 Bacteria 3739
1289 Ga0207641_10045360 3300026088 Bacteria 3701
1290 Ga0207641_10121886 3300026088 Bacteria 2328
1291 Ga0207641_10146921 3300026088 Bacteria 2132
1292 Ga0207648_10001616 3300026089 Bacteria 24706
1293 Ga0207648_10001763 3300026089 Bacteria 23706
1294 Ga0207648_10006120 3300026089 Bacteria 11993
1295 Ga0207648_10008506 3300026089 Bacteria 9930
1296 Ga0207648_10016567 3300026089 Bacteria 6728
1297 Ga0207648_10022205 3300026089 Bacteria 5701
1298 Ga0207648_10026787 3300026089 Bacteria 5120
1299 Ga0207648_10031739 3300026089 Bacteria 4669
1300 Ga0207648_10074003 3300026089 Bacteria 2969
1301 Ga0207648_10081943 3300026089 Bacteria 2813
1302 Ga0207676_10000470 3300026095 Bacteria 33856
1303 Ga0207676_10002657 3300026095 Bacteria 12701
1304 Ga0207676_10004691 3300026095 Bacteria 9683
1305 Ga0207676_10012094 3300026095 Bacteria 6177
1306 Ga0207676_10024376 3300026095 Bacteria 4476
1307 Ga0207676_10034877 3300026095 Bacteria 3812
1308 Ga0207676_10038933 3300026095 Bacteria 3633
1309 Ga0207676_10043251 3300026095 Bacteria 3467
1310 Ga0207676_10046420 3300026095 Bacteria 3361
1311 Ga0207676_10073349 3300026095 Bacteria 2754
1312 Ga0207676_10350331 3300026095 Bacteria 1365
1313 Ga0207676_10370113 3300026095 Bacteria 1331
1314 Ga0207676_10385738 3300026095 Bacteria 1305
1315 Ga0207674_10000062 3300026116 Bacteria 111069
1316 Ga0207674_10000709 3300026116 Bacteria 43489
1317 Ga0207674_10002483 3300026116 Bacteria 23239
1318 Ga0207674_10045502 3300026116 Bacteria 4514
1319 Ga0207674_10132731 3300026116 Bacteria 2453
1320 Ga0207675_100000697 3300026118 Bacteria 33220
1321 Ga0207675_100001280 3300026118 Bacteria 25152
1322 Ga0207675_100001316 3300026118 Bacteria 24900
1323 Ga0207675_100002525 3300026118 Bacteria 18102
1324 Ga0207675_100013518 3300026118 Bacteria 7619
1325 Ga0207675_100015875 3300026118 Bacteria 7023
1326 Ga0207675_100035962 3300026118 Bacteria 4619
1327 Ga0207675_100103442 3300026118 Bacteria 2684
1328 Ga0207675_100113214 3300026118 Bacteria 2562
1329 Ga0207683_10000227 3300026121 Bacteria 49549
1330 Ga0207683_10000568 3300026121 Bacteria 34203
1331 Ga0207683_10001219 3300026121 Bacteria 23337
1332 Ga0207683_10001441 3300026121 Bacteria 21521
1333 Ga0207683_10003890 3300026121 Bacteria 12952
1334 Ga0207683_10006363 3300026121 Bacteria 10111
1335 Ga0207683_10010344 3300026121 Bacteria 7957
1336 Ga0207683_10016063 3300026121 Bacteria 6370
1337 Ga0207683_10020379 3300026121 Bacteria 5671
1338 Ga0207683_10039856 3300026121 Bacteria 4098
1339 Ga0207683_10040419 3300026121 Bacteria 4070
1340 Ga0207683_10066461 3300026121 Bacteria 3179
1341 Ga0207683_10172623 3300026121 Bacteria 1959
1342 Ga0207683_10173336 3300026121 Bacteria 1954
1343 Ga0207698_10001850 3300026142 Bacteria 12355
1344 Ga0207698_10002880 3300026142 Bacteria 10291
1345 Ga0207698_10014880 3300026142 Bacteria 5190
1346 Ga0207698_10018491 3300026142 Bacteria 4750
1347 Ga0207698_10020427 3300026142 Bacteria 4559
1348 Ga0207698_10024335 3300026142 Bacteria 4248
1349 Ga0207698_10031555 3300026142 Unclassified 3826
1350 Ga0207698_10059367 3300026142 Bacteria 2970
1351 Ga0207698_10093619 3300026142 Bacteria 2467
1352 Ga0207698_10126866 3300026142 Bacteria 2172
1353 Ga0207698_10171374 3300026142 Bacteria 1911
1354 Ga0207698_10193180 3300026142 Bacteria 1816
1355 Ga0207698_10228156 3300026142 Bacteria 1688
1356 Ga0209371_1007913 3300027312 Bacteria 3613
1357 Ga0209969_1000759 3300027360 Bacteria 4329
1358 Ga0209967_1000554 3300027364 Bacteria 4917
1359 Ga0209981_1000574 3300027378 Bacteria 4664
1360 Ga0209981_1006417 3300027378 Bacteria 1573
1361 Ga0209996_1000669 3300027395 Bacteria 4101
1362 Ga0210000_1000619 3300027462 Bacteria 4867
1363 Ga0210000_1001550 3300027462 Bacteria 3243
1364 Ga0209995_1005446 3300027471 Bacteria 2043
1365 Ga0209995_1012367 3300027471 Bacteria 1392
1366 Ga0209968_1001892 3300027526 Bacteria 3178
1367 Ga0209999_1000519 3300027543 Bacteria 6013
1368 Ga0209999_1005633 3300027543 Bacteria 2253
1369 Ga0209983_1011015 3300027665 Bacteria 1849
1370 Ga0209588_1028637 3300027671 Bacteria 1774
1371 Ga0209971_1001259 3300027682 Bacteria 6321
1372 Ga0209971_1006979 3300027682 Bacteria 2678
1373 Ga0209966_1012711 3300027695 Bacteria 1549
1374 Ga0209966_1012913 3300027695 Bacteria 1539
1375 Ga0209813_10000476 3300027866 Bacteria 9614
1376 Ga0209974_10000194 3300027876 Bacteria 19284
1377 Ga0209974_10001758 3300027876 Bacteria 7890
1378 Ga0209974_10012396 3300027876 Bacteria 2851
1379 Ga0207428_10003084 3300027907 Bacteria 16402
1380 Ga0207428_10003647 3300027907 Bacteria 14845
1381 Ga0207428_10006244 3300027907 Bacteria 11012
1382 Ga0207428_10008344 3300027907 Bacteria 9359
1383 Ga0207428_10024205 3300027907 Bacteria 5100
1384 Ga0207428_10058156 3300027907 Bacteria 3069
1385 Ga0207428_10079841 3300027907 Bacteria 2557
1386 Ga0207428_10182725 3300027907 Bacteria 1584
1387 Ga0268266_10007894 3300028379 Bacteria 9531
1388 Ga0268266_10008086 3300028379 Bacteria 9390
1389 Ga0268266_10009978 3300028379 Bacteria 8337
1390 Ga0268266_10019877 3300028379 Bacteria 5724
1391 Ga0268266_10041780 3300028379 Bacteria 3914
1392 Ga0268266_10045694 3300028379 Bacteria 3747
1393 Ga0268266_10048744 3300028379 Bacteria 3631
1394 Ga0268266_10054328 3300028379 Bacteria 3441
1395 Ga0268266_10069069 3300028379 Bacteria 3061
1396 Ga0268266_10102809 3300028379 Bacteria 2521
1397 Ga0268266_10112273 3300028379 Bacteria 2416
1398 Ga0268266_10157087 3300028379 Bacteria 2055
1399 Ga0268265_10004584 3300028380 Bacteria 9553
1400 Ga0268265_10004996 3300028380 Bacteria 9104
1401 Ga0268265_10005389 3300028380 Bacteria 8758
1402 Ga0268265_10012818 3300028380 Bacteria 5692
1403 Ga0268265_10110928 3300028380 Bacteria 2239
1404 Ga0268265_10149434 3300028380 Bacteria 1968
1405 Ga0268265_10205450 3300028380 Bacteria 1712
1406 Ga0268265_10217718 3300028380 Bacteria 1668
1407 Ga0268264_10000145 3300028381 Bacteria 167262
1408 Ga0268264_10000702 3300028381 Bacteria 38628
1409 Ga0268264_10001853 3300028381 Bacteria 19220
1410 Ga0268264_10014241 3300028381 Bacteria 6538
1411 Ga0268264_10020100 3300028381 Bacteria 5456
1412 Ga0268264_10029856 3300028381 Bacteria 4468
1413 Ga0268264_10063126 3300028381 Bacteria 3113
1414 Ga0268264_10128828 3300028381 Bacteria 2240
1415 Ga0268264_10258265 3300028381 Bacteria 1622
1416 Ga0268264_10328243 3300028381 Bacteria 1449
1417 Ga0265337_1013649 3300028556 Bacteria 2717
1418 Ga0265318_10006296 3300028577 Bacteria 5482
1419 Ga0307515_10000093 3300028794 Bacteria 212053
1420 Ga0307515_10017976 3300028794 Bacteria 12835
1421 Ga0307515_10155276 3300028794 Bacteria 2366
1422 Ga0265338_10000045 3300028800 Bacteria 223264
1423 Ga0265338_10000205 3300028800 Bacteria 111060
1424 Ga0265338_10009967 3300028800 Bacteria 11233
1425 Ga0265338_10066764 3300028800 Bacteria 3111
1426 Ga0307511_10000005 3300030521 Bacteria 175482
1427 Ga0307511_10002396 3300030521 Bacteria 19597
1428 Ga0307511_10029420 3300030521 Bacteria 4961
1429 Ga0265330_10014406 3300031235 Bacteria 3670
1430 Ga0265330_10028519 3300031235 Bacteria 2515
1431 Ga0265330_10037714 3300031235 Bacteria 2151
1432 Ga0265332_10000958 3300031238 Bacteria 17090
1433 Ga0265332_10001524 3300031238 Bacteria 12848
1434 Ga0265328_10007751 3300031239 Bacteria 4463
1435 Ga0265325_10000630 3300031241 Bacteria 25635
1436 Ga0265325_10018378 3300031241 Bacteria 3876
1437 Ga0265325_10074544 3300031241 Bacteria 1697
1438 Ga0265329_10003688 3300031242 Bacteria 6604
1439 Ga0265340_10016731 3300031247 Bacteria 3795
1440 Ga0265339_10038895 3300031249 Bacteria 2651
1441 Ga0265339_10082269 3300031249 Bacteria 1700
1442 Ga0265331_10002114 3300031250 Bacteria 13701
1443 Ga0265331_10003801 3300031250 Bacteria 9577
1444 Ga0265331_10015421 3300031250 Bacteria 4034
1445 Ga0265331_10039283 3300031250 Bacteria 2308
1446 Ga0265316_10025070 3300031344 Bacteria 4982
1447 Ga0265316_10026875 3300031344 Bacteria 4776
1448 Ga0265316_10049063 3300031344 Bacteria 3327
1449 Ga0265316_10143199 3300031344 Bacteria 1794
1450 Ga0307513_10000104 3300031456 Bacteria 119239
1451 Ga0307509_10000002 3300031507 Bacteria 607551
1452 Ga0307509_10023370 3300031507 Bacteria 6945
1453 Ga0307509_10040989 3300031507 Bacteria 5031
1454 Ga0307509_10049824 3300031507 Bacteria 4488
1455 Ga0307408_100040078 3300031548 Bacteria 3315
1456 Ga0307408_100097633 3300031548 Bacteria 2232
1457 Ga0307408_100127701 3300031548 Bacteria 1979
1458 Ga0265313_10074095 3300031595 Bacteria 1562
1459 Ga0307508_10112275 3300031616 Bacteria 2326
1460 Ga0316575_10006567 3300031665 Bacteria 4190
1461 Ga0316575_10016119 3300031665 Bacteria 2824
1462 Ga0316575_10016590 3300031665 Bacteria 2789
1463 Ga0316575_10035985 3300031665 Bacteria 1947
1464 Ga0316579_10007610 3300031691 Bacteria 4482
1465 Ga0316579_10009935 3300031691 Bacteria 4012
1466 Ga0316579_10027858 3300031691 Bacteria 2568
1467 Ga0316579_10032999 3300031691 Bacteria 2376
1468 Ga0316579_10064955 3300031691 Bacteria 1721
1469 Ga0265314_10000523 3300031711 Bacteria 49565
1470 Ga0265314_10001945 3300031711 Bacteria 22010
1471 Ga0265314_10015124 3300031711 Bacteria 6137
1472 Ga0265342_10003160 3300031712 Bacteria 13732
1473 Ga0316576_10019148 3300031727 Bacteria 4687
1474 Ga0316576_10199278 3300031727 Bacteria 1508
1475 Ga0316578_10004329 3300031728 Bacteria 6682
1476 Ga0316578_10009032 3300031728 Bacteria 5105
1477 Ga0316578_10012288 3300031728 Bacteria 4511
1478 Ga0316578_10039586 3300031728 Bacteria 2723
1479 Ga0307405_10052570 3300031731 Bacteria 2534
1480 Ga0307413_10046722 3300031824 Bacteria 2577
1481 Ga0307413_10058152 3300031824 Bacteria 2368
1482 Ga0307410_10005780 3300031852 Bacteria 6595
1483 Ga0307410_10138911 3300031852 Bacteria 1795
1484 Ga0307406_10002674 3300031901 Bacteria 9701
1485 Ga0307406_10033409 3300031901 Bacteria 3149
1486 Ga0307406_10141911 3300031901 Bacteria 1701
1487 Ga0307407_10004002 3300031903 Bacteria 6166
1488 Ga0307407_10006689 3300031903 Bacteria 5154
1489 Ga0307412_10014011 3300031911 Bacteria 4720
1490 Ga0307412_10019161 3300031911 Bacteria 4136
1491 Ga0307412_10095129 3300031911 Bacteria 2094
1492 Ga0307409_100000674 3300031995 Bacteria 15138
1493 Ga0307409_100018856 3300031995 Bacteria 4654
1494 Ga0307409_100153391 3300031995 Bacteria 2004
1495 Ga0307409_100274245 3300031995 Bacteria 1555
1496 Ga0307416_100012024 3300032002 Bacteria 5809
1497 Ga0307416_100015040 3300032002 Bacteria 5328
1498 Ga0307416_100018117 3300032002 Bacteria 4951
1499 Ga0307416_100029619 3300032002 Bacteria 4093
1500 Ga0307416_100438825 3300032002 Bacteria 1355
1501 Ga0307414_10177423 3300032004 Bacteria 1710
1502 Ga0307411_10060228 3300032005 Bacteria 2520
1503 Ga0307415_100001423 3300032126 Bacteria 11439
1504 Ga0307415_100094136 3300032126 Bacteria 2177
1505 Ga0307415_100197221 3300032126 Bacteria 1594
1506 Ga0307415_100235887 3300032126 Bacteria 1476
1507 Ga0316583_10002176 3300032133 Bacteria 6755
1508 Ga0316583_10005429 3300032133 Bacteria 4574
1509 Ga0316583_10026229 3300032133 Bacteria 2080
1510 Ga0316585_10006962 3300032137 Bacteria 3246
1511 Ga0316593_10023588 3300032168 Bacteria 1943
1512 Ga0316593_10057995 3300032168 Bacteria 1319
1513 Ga0307507_10014093 3300033179 Bacteria 9587
1514 Ga0307510_10000007 3300033180 Bacteria 558582
1515 Ga0307510_10039627 3300033180 Bacteria 5186
1516 Ga0316592_1005024 3300033524 Bacteria 2492
1517 Ga0316586_1003345 3300033527 Bacteria 2096
1518 Ga0316588_1002715 3300033528 Bacteria 3121
1519 Ga0373938_0001276 3300034957 Bacteria 4046
1520 Ga0373926_0004126 3300035083 Bacteria 4748
1521 Ga0373934_0000243 3300035086 Bacteria 19594
1522 Ga0373934_0003740 3300035086 Bacteria 5600
1523 Ga0373934_0011985 3300035086 Bacteria 3270
1524 Ga0373934_0022213 3300035086 Bacteria 2446
1525 Ga0373940_0005447 3300035088 Bacteria 2758
1526 Ga0373940_0016453 3300035088 Bacteria 1832
1527 Ga0373951_0012561 3300035091 Bacteria 1904
1528 Ga0373952_0004182 3300035092 Bacteria 2608
1529 Ga0373952_0020049 3300035092 Bacteria 1398
1530 Ga0373923_0001240 3300035111 Bacteria 7157
1531 Ga0373923_0046228 3300035111 Bacteria 1810
1532 Ga0373932_0000353 3300035112 Bacteria 14116
1533 Ga0373932_0009251 3300035112 Bacteria 2367
1534 Ga0373936_0045960 3300035113 Bacteria 1759
1535 Ga0373939_0001442 3300035114 Bacteria 5753
1536 Ga0373939_0002736 3300035114 Bacteria 4137
1537 Ga0373939_0003087 3300035114 Bacteria 3911
1538 Ga0373945_0056549 3300035116 Bacteria 1455
1539 Ga0373953_0004970 3300035117 Bacteria 4282
1540 Ga0373953_0005184 3300035117 Bacteria 4213
1541 Ga0373954_0000003 3300035118 Bacteria 137757
1542 Ga0373954_0003106 3300035118 Bacteria 7012
1543 Ga0373954_0009477 3300035118 Bacteria 4282
1544 Ga0373954_0009838 3300035118 Bacteria 4208
1545 Ga0373954_0018758 3300035118 Bacteria 3116
1546 Ga0373956_0002064 3300035119 Bacteria 8323
1547 Ga0373956_0005959 3300035119 Bacteria 4874
1548 Ga0373956_0047177 3300035119 Bacteria 1926
1549 Ga0373957_0008533 3300035120 Bacteria 3323
1550 Ga0373957_0091909 3300035120 Bacteria 1207
1551 Ga0373960_0007072 3300035121 Bacteria 2648
1552 Ga0373960_0019603 3300035121 Bacteria 1779
1553 Ga0373943_0001697 3300035170 Bacteria 9992
1554 Ga0373943_0011387 3300035170 Bacteria 4003
1555 Ga0373943_0027495 3300035170 Bacteria 2673
1556 Ga0373943_0065997 3300035170 Bacteria 1821
1557 Ga0373946_0008281 3300035171 Bacteria 3816
1558 Ga0373946_0026490 3300035171 Bacteria 2288
1559 Ga0373946_0041523 3300035171 Bacteria 1887
1560 Ga0373955_0000145 3300035172 Bacteria 28047
1561 Ga0373955_0001065 3300035172 Bacteria 11686
1562 Ga0373955_0001607 3300035172 Bacteria 9675
1563 Ga0373955_0015582 3300035172 Bacteria 3725
1564 Ga0373955_0018267 3300035172 Bacteria 3485
1565 Ga0373955_0042371 3300035172 Bacteria 2444
1566 Ga0373955_0042484 3300035172 Bacteria 2441
1567 Ga0373955_0046475 3300035172 Bacteria 2347
1568 Ga0373955_0094716 3300035172 Bacteria 1707
1569 Ga0373942_0002017 3300035207 Bacteria 5051
1570 Ga0373942_0047388 3300035207 Bacteria 1194
1571 Ga0373962_0001024 3300035242 Bacteria 6467
1572 Ga0316574_0009125 3300035398 Bacteria 5540
1573 Ga0316574_0011818 3300035398 Bacteria 4973
1574 Ga0316574_0020894 3300035398 Bacteria 3880
1575 Ga0316574_0099034 3300035398 Bacteria 1865
1576 Ga0316574_0124507 3300035398 Bacteria 1656
1577 Ga0316574_0144681 3300035398 Bacteria 1532
1578 Ga0316574_0168269 3300035398 Bacteria 1411
1579 Ga0373924_0000941 3300035410 Bacteria 9198
1580 Ga0373924_0004607 3300035410 Bacteria 4828
1581 Ga0373924_0006633 3300035410 Bacteria 4152
1582 Ga0373924_0034351 3300035410 Bacteria 2052
1583 Ga0373931_0000189 3300035691 Bacteria 26663
1584 Ga0373931_0002113 3300035691 Bacteria 8752
1585 Ga0373931_0005256 3300035691 Bacteria 5971
1586 Ga0373931_0033728 3300035691 Bacteria 2654
1587 Ga0373931_0096464 3300035691 Bacteria 1656
1588 Ga0373935_0000017 3300035692 Bacteria 70368
1589 Ga0373935_0005734 3300035692 Bacteria 7338
1590 Ga0373935_0009848 3300035692 Bacteria 5722
1591 Ga0373935_0016747 3300035692 Bacteria 4436
1592 Ga0373935_0033804 3300035692 Bacteria 3185
1593 Ga0373935_0050401 3300035692 Bacteria 2642
1594 Ga0373935_0073411 3300035692 Bacteria 2210
1595 Ga0373935_0147534 3300035692 Bacteria 1594
1596 Ga0373927_0016477 3300035695 Bacteria 4873
1597 Ga0373927_0018526 3300035695 Bacteria 4573
1598 Ga0373927_0036724 3300035695 Bacteria 3185
1599 Ga0373927_0079565 3300035695 Bacteria 2124
1600 Ga0373927_0081786 3300035695 Bacteria 2093
1601 Ga0373927_0084079 3300035695 Bacteria 2064
1602 Ga0373927_0109731 3300035695 Bacteria 1797
1603 Ga0373933_0000579 3300035724 Bacteria 22962
1604 Ga0373933_0001228 3300035724 Bacteria 15165
1605 Ga0373933_0004151 3300035724 Bacteria 7977
1606 Ga0373933_0008876 3300035724 Bacteria 5481
1607 Ga0373933_0035109 3300035724 Bacteria 2926
1608 Ga0373933_0057746 3300035724 Bacteria 2333
1609 Ga0373933_0115462 3300035724 Bacteria 1677
1610 Ga0373947_0009952 3300035725 Bacteria 5463
1611 Ga0373947_0018315 3300035725 Bacteria 4031
1612 Ga0373947_0061412 3300035725 Bacteria 2284
1613 Ga0373947_0135362 3300035725 Bacteria 1576
1614 Ga0373947_0193816 3300035725 Bacteria 1327
1615 Ga0373937_0000103 3300036401 Bacteria 80386
1616 Ga0373937_0000131 3300036401 Bacteria 72767
1617 Ga0373937_0001360 3300036401 Bacteria 20455
1618 Ga0373937_0007447 3300036401 Bacteria 9471
1619 Ga0373937_0012811 3300036401 Bacteria 7384
1620 Ga0373937_0021739 3300036401 Bacteria 5759
1621 Ga0373937_0027437 3300036401 Bacteria 5149
1622 Ga0373937_0036403 3300036401 Bacteria 4484
1623 Ga0373937_0037606 3300036401 Bacteria 4411
1624 Ga0373937_0045372 3300036401 Bacteria 4016
1625 Ga0373937_0046984 3300036401 Bacteria 3949
1626 Ga0373937_0157864 3300036401 Bacteria 2126
1627 Ga0373937_0223313 3300036401 Bacteria 1773
1628 Ga0316582_0018444 3300036647 Bacteria 4062
1629 Ga0316582_0076960 3300036647 Bacteria 2171
1630 Ga0316582_0095048 3300036647 Bacteria 1966
1631 Ga0316582_0135484 3300036647 Bacteria 1657
1632 Ga0316584_0000192 3300036712 Bacteria 29986
1633 Ga0316584_0042219 3300036712 Bacteria 3400
1634 Ga0316584_0051908 3300036712 Bacteria 3067
1635 Ga0316584_0061049 3300036712 Bacteria 2823
1636 Ga0316584_0070015 3300036712 Bacteria 2630
1637 Ga0316584_0079431 3300036712 Bacteria 2457
1638 Ga0316584_0089186 3300036712 Bacteria 2309
1639 Ga0316584_0153546 3300036712 Bacteria 1713
1640 Ga0373925_0000058 3300037068 Bacteria 122682
1641 Ga0373925_0040900 3300037068 Bacteria 3433
1642 Ga0373925_0043332 3300037068 Bacteria 3339
1643 Ga0373925_0044352 3300037068 Bacteria 3302
1644 Ga0373925_0054731 3300037068 Bacteria 2985
1645 Ga0373925_0112646 3300037068 Bacteria 2103
1646 Ga0395899_0028085 3300037312 Bacteria 4238
1647 Ga0395899_0061267 3300037312 Bacteria 2771
1648 Ga0395899_0065936 3300037312 Bacteria 2660
1649 Ga0395900_0019231 3300037418 Bacteria 6964
1650 Ga0395900_0036870 3300037418 Bacteria 5040
1651 Ga0395900_0046502 3300037418 Bacteria 4469
1652 Ga0395900_0059277 3300037418 Bacteria 3940
1653 Ga0395900_0201866 3300037418 Bacteria 2011
1654 Ga0395900_0204678 3300037418 Bacteria 1995
1655 Ga0395900_0283517 3300037418 Bacteria 1648
1656 Ga0395900_0295256 3300037418 Bacteria 1608
1657 Ga0395898_0015812 3300037466 Bacteria 7734
1658 Ga0395898_0023421 3300037466 Bacteria 6241
1659 Ga0395898_0029771 3300037466 Bacteria 5465
1660 Ga0395898_0047621 3300037466 Bacteria 4206
1661 Ga0395898_0060385 3300037466 Bacteria 3684
1662 Ga0395898_0077240 3300037466 Bacteria 3215
1663 Ga0395898_0127713 3300037466 Bacteria 2436
1664 Ga0395898_0153070 3300037466 Bacteria 2206
1665 Ga0395898_0154242 3300037466 Bacteria 2197
1666 Ga0395898_0184252 3300037466 Bacteria 1995
1667 Ga0395905_0000043 3300037471 Bacteria 247469
1668 Ga0395905_0014552 3300037471 Bacteria 7506
1669 Ga0395905_0049067 3300037471 Bacteria 3955
1670 Ga0395905_0067525 3300037471 Bacteria 3349
1671 Ga0395905_0115317 3300037471 Bacteria 2524
1672 Ga0395905_0120534 3300037471 Bacteria 2466
1673 Ga0395905_0158564 3300037471 Bacteria 2127
1674 Ga0395905_0180344 3300037471 Bacteria 1982
1675 Ga0316581_0001310 3300037588 Bacteria 5524
1676 Ga0436364_0207258 3300037853 Bacteria 22246
1677 Ga0436364_0314874 3300037853 Bacteria 1261
1678 Ga0436364_0351220 3300037853 Bacteria 2167
1679 Ga0436364_0764338 3300037853 Bacteria 31107
1680 Ga0436364_0988190 3300037853 Bacteria 2674
1681 Ga0436364_1220763 3300037853 Bacteria 6566
1682 Ga0436364_1270512 3300037853 Bacteria 5001
1683 Ga0436364_1468533 3300037853 Bacteria 1358
1684 Ga0395901_0011296 3300038443 Bacteria 9047
1685 Ga0395901_0017178 3300038443 Bacteria 7381
1686 Ga0395901_0017650 3300038443 Bacteria 7285
1687 Ga0395901_0034121 3300038443 Bacteria 5255
1688 Ga0395901_0090732 3300038443 Bacteria 3198
1689 Ga0395901_0233125 3300038443 Bacteria 1921
1690 Ga0400488_25049 3300038741 Bacteria 6520
1691 Ga0400483_010883 3300039062 Bacteria 2039
1692 Ga0400483_052876 3300039062 Bacteria 1405
1693 Ga0400483_192796 3300039062 Bacteria 5957
1694 Ga0400489_18675 3300039093 Bacteria 22223
1695 Ga0400489_49853 3300039093 Bacteria 14837
1696 Ga0400487_25275 3300039110 Bacteria 1161
1697 Ga0436365_0727164 3300039437 Bacteria 12956
1698 Ga0436365_1241251 3300039437 Bacteria 27325
1699 Ga0436365_1282334 3300039437 Bacteria 2414
1700 Ga0436365_1865855 3300039437 Bacteria 6531
1701 Ga0436360_1082140 3300039438 Bacteria 5044
1702 Ga0436361_0234825 3300039447 Bacteria 1897
1703 Ga0436361_0837620 3300039447 Bacteria 1401
1704 Ga0436363_0024737 3300039450 Bacteria 5925
1705 Ga0436363_1334135 3300039450 Bacteria 2120
1706 Ga0436363_1512283 3300039450 Bacteria 5634
1707 Ga0436362_0025995 3300039453 Bacteria 2084
1708 Ga0436362_1027627 3300039453 Bacteria 4387
1709 Ga0439436_0001332 3300041404 Bacteria 7098
1710 Ga0439453_0000481 3300041408 Bacteria 4376
1711 Ga0439466_0019516 3300041411 Bacteria 2426
1712 Ga0439465_0003831 3300041413 Bacteria 4907
1713 Ga0451853_3625268 3300041512 Bacteria 1655
1714 Ga0439433_0002646 3300041999 Bacteria 3805
1715 Ga0439441_012443 3300042001 Bacteria 1461
1716 Ga0439445_0000170 3300042004 Bacteria 11554
1717 Ga0439449_0004416 3300042007 Bacteria 5423
1718 Ga0439451_020065 3300042009 Bacteria 1347
1719 Ga0439462_0010265 3300042015 Bacteria 2371
1720 Ga0439446_0005653 3300042156 Bacteria 3222
1721 Ga0450909_001487 3300042185 Bacteria 3271
1722 Ga0439434_0004262 3300042435 Bacteria 4180
1723 Ga0439434_0005544 3300042435 Bacteria 3687
1724 Ga0439434_0011570 3300042435 Bacteria 2610
1725 Ga0439435_0000427 3300042436 Bacteria 6569
1726 Ga0439444_0000069 3300042437 Bacteria 7681
1727 Ga0451577_0008711 3300042876 Bacteria 9837
1728 Ga0451577_0009071 3300042876 Bacteria 9601
1729 Ga0451577_0033459 3300042876 Bacteria 4634
1730 Ga0451577_0130421 3300042876 Bacteria 2255
1731 Ga0451577_0286070 3300042876 Unclassified 1494
1732 Ga0466969_0001994 3300044656 Bacteria 10909
1733 Ga0466972_0003545 3300044658 Bacteria 7749
1734 Ga0466966_0026781 3300044684 Bacteria 3762
1735 Ga0466961_0012714 3300044693 Bacteria 5391
1736 Ga0466961_0028539 3300044693 Bacteria 3588
1737 Ga0466963_0038709 3300044694 Bacteria 3120
1738 Ga0466964_0006291 3300044706 Bacteria 4419
1739 Ga0453684_0275738 3300044712 Bacteria 1920
1740 Ga0466968_0000683 3300044735 Bacteria 11685
1741 Ga0466968_0004230 3300044735 Bacteria 5352
1742 Ga0466970_0082030 3300044765 Bacteria 1744
1743 Ga0466957_0000089 3300044842 Bacteria 36497
1744 Ga0466960_0011379 3300044901 Bacteria 3722
1745 Ga0466959_0001172 3300045049 Bacteria 15783
1746 Ga0466959_0008856 3300045049 Bacteria 7136
1747 Ga0466959_0009421 3300045049 Bacteria 6947
1748 Ga0466959_0015485 3300045049 Bacteria 5556
1749 Ga0451576_0001669 3300045051 Bacteria 36837
1750 Ga0451576_0001675 3300045051 Bacteria 36759
1751 Ga0451576_0005273 3300045051 Bacteria 16262
1752 Ga0451576_0086106 3300045051 Bacteria 3268
1753 Ga0451576_0369994 3300045051 Bacteria 1502
1754 Ga0466958_0034236 3300045836 Bacteria 3030
1755 Ga0466958_0067726 3300045836 Bacteria 2181
1756 Ga0466967_0133314 3300045976 Bacteria 2308
1757 Ga0495592_0000062 3300046454 Bacteria 99207
1758 Ga0495592_0049105 3300046454 Bacteria 3137
1759 Ga0495592_0072897 3300046454 Bacteria 2498
1760 Ga0495592_0076710 3300046454 Bacteria 2424
1761 Ga0495590_0017572 3300046457 Bacteria 2572
1762 Ga0495590_0056223 3300046457 Bacteria 1375
1763 Ga0495591_002493 3300046458 Bacteria 10195
1764 Ga0495591_005888 3300046458 Bacteria 5554
1765 Ga0495629_0000115 3300046459 Bacteria 72648
1766 Ga0495629_0001063 3300046459 Bacteria 21933
1767 Ga0495629_0001807 3300046459 Bacteria 16771
1768 Ga0495629_0005730 3300046459 Bacteria 9270
1769 Ga0495629_0039433 3300046459 Bacteria 3324
1770 Ga0495629_0044725 3300046459 Bacteria 3107
1771 Ga0495629_0048099 3300046459 Bacteria 2990
1772 Ga0495638_0003283 3300046460 Bacteria 12754
1773 Ga0495638_0014124 3300046460 Bacteria 5407
1774 Ga0495641_0003356 3300046461 Bacteria 12023
1775 Ga0495651_0001912 3300046462 Bacteria 16134
1776 Ga0495651_0003749 3300046462 Bacteria 11627
1777 Ga0495651_0005207 3300046462 Bacteria 9913
1778 Ga0495653_0000072 3300046463 Bacteria 85266
1779 Ga0495653_0003451 3300046463 Bacteria 12705
1780 Ga0495653_0004667 3300046463 Bacteria 11079
1781 Ga0495653_0015156 3300046463 Bacteria 6284
1782 Ga0495653_0089891 3300046463 Bacteria 2248
1783 Ga0495653_0100678 3300046463 Bacteria 2094
1784 Ga0495650_0005305 3300046471 Bacteria 8430
1785 Ga0495650_0017498 3300046471 Bacteria 3592
1786 Ga0495580_0006433 3300046472 Bacteria 9563
1787 Ga0495580_0015198 3300046472 Bacteria 5819
1788 Ga0495580_0025336 3300046472 Bacteria 4335
1789 Ga0495580_0038208 3300046472 Bacteria 3440
1790 Ga0495580_0038330 3300046472 Bacteria 3433
1791 Ga0495582_0014890 3300046473 Bacteria 4273
1792 Ga0495582_0022387 3300046473 Bacteria 3457
1793 Ga0495582_0049259 3300046473 Bacteria 2320
1794 Ga0495605_0012353 3300046474 Bacteria 4740
1795 Ga0495605_0069680 3300046474 Bacteria 1664
1796 Ga0495639_0003385 3300046475 Bacteria 6911
1797 Ga0495639_0007850 3300046475 Bacteria 4586
1798 Ga0495639_0008512 3300046475 Bacteria 4400
1799 Ga0495662_0036717 3300046476 Bacteria 2364
1800 Ga0495664_0000009 3300046477 Bacteria 289534
1801 Ga0495664_0042127 3300046477 Bacteria 2703
1802 Ga0495584_0008312 3300046491 Bacteria 5375
1803 Ga0495584_0012414 3300046491 Bacteria 4348
1804 Ga0495584_0043732 3300046491 Bacteria 2261
1805 Ga0495585_0080064 3300046492 Bacteria 1771
1806 Ga0495594_0027422 3300046499 Bacteria 3069
1807 Ga0495596_0000832 3300046500 Bacteria 18665
1808 Ga0495596_0001312 3300046500 Bacteria 14347
1809 Ga0495607_0060761 3300046501 Bacteria 2150
1810 Ga0495607_0087371 3300046501 Bacteria 1697
1811 Ga0495583_0002560 3300046506 Bacteria 15337
1812 Ga0495583_0019920 3300046506 Bacteria 3490
1813 Ga0495583_0056047 3300046506 Bacteria 1779
1814 Ga0495606_0007905 3300046507 Bacteria 9378
1815 Ga0495606_0010540 3300046507 Bacteria 7653
1816 Ga0495606_0018588 3300046507 Bacteria 5203
1817 Ga0495608_0000061 3300046511 Bacteria 86891
1818 Ga0495608_0003916 3300046511 Bacteria 10705
1819 Ga0495616_0009920 3300046513 Bacteria 5536
1820 Ga0495618_0000061 3300046514 Bacteria 78337
1821 Ga0495618_0005652 3300046514 Bacteria 7602
1822 Ga0495620_0005528 3300046515 Bacteria 7046
1823 Ga0495620_0036318 3300046515 Bacteria 2206
1824 Ga0495620_0036549 3300046515 Bacteria 2196
1825 Ga0495628_0000012 3300046516 Bacteria 224162
1826 Ga0495628_0004166 3300046516 Bacteria 12869
1827 Ga0495628_0005756 3300046516 Bacteria 10859
1828 Ga0495628_0023537 3300046516 Bacteria 5054
1829 Ga0495628_0034390 3300046516 Bacteria 4076
1830 Ga0495628_0063792 3300046516 Bacteria 2886
1831 Ga0495628_0192958 3300046516 Bacteria 1537
1832 Ga0495630_0010670 3300046517 Bacteria 6632
1833 Ga0495630_0015707 3300046517 Bacteria 5532
1834 Ga0495630_0026145 3300046517 Bacteria 4320
1835 Ga0495630_0056182 3300046517 Bacteria 2949
1836 Ga0495630_0063049 3300046517 Bacteria 2785
1837 Ga0495630_0081720 3300046517 Bacteria 2438
1838 Ga0495630_0090327 3300046517 Bacteria 2314
1839 Ga0495631_0003805 3300046518 Bacteria 8201
1840 Ga0495631_0005592 3300046518 Bacteria 6568
1841 Ga0495631_0013284 3300046518 Bacteria 3999
1842 Ga0495631_0028611 3300046518 Bacteria 2541
1843 Ga0495632_0017133 3300046519 Bacteria 4007
1844 Ga0495632_0062788 3300046519 Bacteria 1800
1845 Ga0495637_0007448 3300046520 Bacteria 5421
1846 Ga0495643_0006316 3300046522 Bacteria 7834
1847 Ga0495643_0011455 3300046522 Bacteria 5401
1848 Ga0495643_0037999 3300046522 Bacteria 2638
1849 Ga0495643_0086339 3300046522 Bacteria 1625
1850 Ga0495644_0032333 3300046523 Bacteria 1976
1851 Ga0495648_0011365 3300046524 Bacteria 6709
1852 Ga0495648_0020006 3300046524 Bacteria 4682
1853 Ga0495648_0045460 3300046524 Bacteria 2731
1854 Ga0495666_0005421 3300046526 Bacteria 6423
1855 Ga0495666_0009188 3300046526 Bacteria 4944
1856 Ga0495642_0007602 3300046528 Bacteria 4152
1857 Ga0495642_0010765 3300046528 Bacteria 3504
1858 Ga0495652_0000021 3300046529 Bacteria 181454
1859 Ga0495652_0004306 3300046529 Bacteria 13640
1860 Ga0495652_0032040 3300046529 Bacteria 4599
1861 Ga0495652_0072337 3300046529 Bacteria 2874
1862 Ga0495654_0009184 3300046530 Bacteria 5421
1863 Ga0495654_0027893 3300046530 Bacteria 2890
1864 Ga0495654_0037383 3300046530 Bacteria 2435
1865 Ga0495665_0004644 3300046531 Bacteria 7409
1866 Ga0495665_0015272 3300046531 Bacteria 4137
1867 Ga0495665_0026132 3300046531 Bacteria 3136
1868 Ga0495665_0037280 3300046531 Bacteria 2595
1869 Ga0495665_0066116 3300046531 Bacteria 1908
1870 Ga0495665_0072069 3300046531 Bacteria 1819
1871 Ga0495640_0000028 3300046533 Bacteria 79904
1872 Ga0495640_0006679 3300046533 Bacteria 9101
1873 Ga0495640_0013131 3300046533 Bacteria 6304
1874 Ga0495640_0031348 3300046533 Bacteria 3794
1875 Ga0495586_0007082 3300046535 Bacteria 5977
1876 Ga0495586_0008178 3300046535 Bacteria 5574
1877 Ga0495586_0009251 3300046535 Bacteria 5238
1878 Ga0495586_0012052 3300046535 Bacteria 4593
1879 Ga0495586_0013720 3300046535 Bacteria 4300
1880 Ga0495586_0198461 3300046535 Bacteria 1137
1881 Ga0495587_0000033 3300046536 Bacteria 123885
1882 Ga0495587_0004825 3300046536 Bacteria 8855
1883 Ga0495587_0009004 3300046536 Bacteria 6408
1884 Ga0495587_0029072 3300046536 Bacteria 3357
1885 Ga0495587_0110371 3300046536 Bacteria 1580
1886 Ga0495609_0016445 3300046538 Bacteria 3447
1887 Ga0495609_0018956 3300046538 Bacteria 3187
1888 Ga0495621_0001657 3300046539 Bacteria 5837
1889 Ga0495597_0000019 3300046542 Bacteria 164636
1890 Ga0495597_0000058 3300046542 Bacteria 92755
1891 Ga0495597_0002251 3300046542 Bacteria 12572
1892 Ga0495597_0006725 3300046542 Bacteria 5919
1893 Ga0495645_0000017 3300046543 Bacteria 156865
1894 Ga0495645_0000609 3300046543 Bacteria 24694
1895 Ga0495645_0000843 3300046543 Bacteria 20844
1896 Ga0495645_0001841 3300046543 Bacteria 14405
1897 Ga0495645_0016307 3300046543 Bacteria 5302
1898 Ga0495645_0060228 3300046543 Bacteria 2752
1899 Ga0495645_0119832 3300046543 Bacteria 1854
1900 Ga0495622_0000196 3300046557 Bacteria 47964
1901 Ga0495622_0002089 3300046557 Bacteria 9766
1902 Ga0495622_0013911 3300046557 Bacteria 3734
1903 Ga0495633_0006886 3300046558 Bacteria 6653
1904 Ga0495633_0009809 3300046558 Bacteria 5263
1905 Ga0495633_0023642 3300046558 Bacteria 3042
1906 Ga0495667_0000011 3300046559 Bacteria 222545
1907 Ga0495667_0000672 3300046559 Bacteria 21886
1908 Ga0495667_0001460 3300046559 Bacteria 15551
1909 Ga0495667_0078757 3300046559 Bacteria 2143
1910 Ga0495667_0098363 3300046559 Bacteria 1894
1911 Ga0495667_0098876 3300046559 Bacteria 1889
1912 Ga0495656_0007411 3300046615 Bacteria 3875
1913 Ga0495668_0003141 3300046616 Bacteria 12745
1914 Ga0495668_0026664 3300046616 Bacteria 3278
1915 Ga0495668_0030630 3300046616 Bacteria 3036
1916 Ga0495668_0048473 3300046616 Bacteria 2356
1917 Ga0495668_0100806 3300046616 Bacteria 1580
1918 Ga0495634_0000220 3300046642 Bacteria 53609
1919 Ga0495634_0001130 3300046642 Bacteria 24672
1920 Ga0495634_0026629 3300046642 Bacteria 4033
1921 Ga0495634_0046247 3300046642 Bacteria 2939
1922 Ga0495634_0077175 3300046642 Bacteria 2185
1923 Ga0495634_0124527 3300046642 Bacteria 1648
1924 Ga0495611_0003515 3300046648 Bacteria 6897
1925 Ga0495611_0036614 3300046648 Bacteria 2178
1926 Ga0495611_0078038 3300046648 Bacteria 1519
1927 Ga0495625_0024548 3300046660 Bacteria 4587
1928 Ga0495635_0000019 3300046663 Bacteria 193402
1929 Ga0495635_0007180 3300046663 Bacteria 7780
1930 Ga0495635_0016849 3300046663 Bacteria 5104
1931 Ga0495635_0048647 3300046663 Bacteria 2923
1932 Ga0495661_0001133 3300046665 Bacteria 23317
1933 Ga0495661_0005288 3300046665 Bacteria 9176
1934 Ga0495661_0075586 3300046665 Bacteria 1957
1935 Ga0495661_0079148 3300046665 Bacteria 1899
1936 Ga0495661_0086112 3300046665 Bacteria 1799
1937 Ga0495588_0018753 3300046674 Bacteria 3378
1938 Ga0495657_0000378 3300046675 Bacteria 41496
1939 Ga0495657_0009256 3300046675 Bacteria 7477
1940 Ga0495657_0032069 3300046675 Bacteria 3669
1941 Ga0495599_0000024 3300046678 Bacteria 121388
1942 Ga0495599_0015770 3300046678 Bacteria 4690
1943 Ga0495599_0153466 3300046678 Bacteria 1425
1944 Ga0495623_0000022 3300046679 Bacteria 98899
1945 Ga0495623_0003295 3300046679 Bacteria 10663
1946 Ga0495623_0009483 3300046679 Bacteria 6321
1947 Ga0495623_0026360 3300046679 Bacteria 3742
1948 Ga0495646_0000033 3300046680 Bacteria 83930
1949 Ga0495646_0001525 3300046680 Bacteria 13804
1950 Ga0495646_0025972 3300046680 Bacteria 3679
1951 Ga0495646_0034625 3300046680 Bacteria 3136
1952 Ga0495646_0054051 3300046680 Bacteria 2417
1953 Ga0495646_0064318 3300046680 Bacteria 2175
1954 Ga0495647_0002023 3300046681 Bacteria 6335
1955 Ga0495647_0008562 3300046681 Bacteria 3440
1956 Ga0495658_0003278 3300046683 Bacteria 8044
1957 Ga0495658_0055595 3300046683 Bacteria 2255
1958 Ga0495658_0076122 3300046683 Bacteria 1960
1959 Ga0495658_0126589 3300046683 Bacteria 1551
1960 Ga0495669_0049879 3300046684 Bacteria 1876
1961 Ga0495613_0009781 3300046689 Bacteria 7128
1962 Ga0495613_0021121 3300046689 Bacteria 4854
1963 Ga0495613_0035495 3300046689 Bacteria 3700
1964 Ga0495613_0038298 3300046689 Bacteria 3554
1965 Ga0495624_0000768 3300046690 Bacteria 25268
1966 Ga0495624_0001964 3300046690 Bacteria 15647
1967 Ga0495624_0005770 3300046690 Bacteria 8869
1968 Ga0495624_0008963 3300046690 Bacteria 6951
1969 Ga0495624_0035255 3300046690 Bacteria 3231
1970 Ga0495670_0005274 3300046691 Bacteria 6359
1971 Ga0495670_0026270 3300046691 Bacteria 2881
1972 Ga0495670_0056278 3300046691 Bacteria 1973
1973 Ga0495671_0026726 3300046692 Bacteria 2988
1974 Ga0495671_0027130 3300046692 Bacteria 2960
1975 Ga0495671_0030347 3300046692 Bacteria 2769
1976 Ga0495671_0035825 3300046692 Bacteria 2518
1977 Ga0495649_0001475 3300046694 Bacteria 17679
1978 Ga0495649_0025625 3300046694 Bacteria 3284
1979 Ga0495649_0084480 3300046694 Bacteria 1695
1980 Ga0495589_0000861 3300046794 Bacteria 18936
1981 Ga0495589_0003845 3300046794 Bacteria 8070
1982 Ga0495600_0000028 3300046809 Bacteria 90661
1983 Ga0495600_0000657 3300046809 Bacteria 17939
1984 Ga0495600_0009629 3300046809 Bacteria 5972
1985 Ga0495600_0017922 3300046809 Bacteria 4507
1986 Ga0495600_0018548 3300046809 Bacteria 4434
1987 Ga0495600_0046862 3300046809 Bacteria 2820
1988 Ga0495600_0051933 3300046809 Bacteria 2676
1989 Ga0495600_0122751 3300046809 Bacteria 1689
1990 Ga0495600_0194322 3300046809 Bacteria 1304
1991 Ga0495660_0012857 3300046810 Bacteria 4854
1992 Ga0495660_0051548 3300046810 Bacteria 2239
1993 Ga0495660_0129958 3300046810 Bacteria 1264
1994 Ga0495581_0001914 3300047315 Bacteria 11661
1995 Ga0495581_0005793 3300047315 Bacteria 7163
1996 Ga0495581_0009339 3300047315 Bacteria 5676
1997 Ga0495581_0044986 3300047315 Bacteria 2552
1998 Ga0495581_0064417 3300047315 Bacteria 2117
1999 Ga0495604_0000011 3300047317 Bacteria 292024
2000 Ga0495604_0013594 3300047317 Bacteria 6492
2001 Ga0495604_0015332 3300047317 Bacteria 6116
2002 Ga0495604_0029226 3300047317 Bacteria 4384
2003 Ga0495604_0097564 3300047317 Bacteria 2167
2004 Ga0495674_0000015 3300047319 Bacteria 224071
2005 Ga0495674_0016124 3300047319 Bacteria 6973
2006 Ga0495674_0031893 3300047319 Bacteria 4781
2007 Ga0495674_0052325 3300047319 Bacteria 3594
2008 Ga0495674_0094033 3300047319 Bacteria 2557
2009 Ga0495674_0113720 3300047319 Bacteria 2292
2010 Ga0495674_0165371 3300047319 Bacteria 1849
2011 Ga0495674_0299994 3300047319 Bacteria 1312
2012 Ga0495672_0033356 3300047320 Bacteria 3190
2013 Ga0495672_0050320 3300047320 Bacteria 2460
2014 Ga0495676_0012310 3300047321 Bacteria 7708
2015 Ga0495676_0017794 3300047321 Bacteria 6275
2016 Ga0495676_0021777 3300047321 Bacteria 5590
2017 Ga0495676_0026748 3300047321 Bacteria 4960
2018 Ga0495676_0074109 3300047321 Bacteria 2608
2019 Ga0495676_0152020 3300047321 Bacteria 1646
2020 Ga0495680_0000812 3300047322 Bacteria 34880
2021 Ga0495680_0009066 3300047322 Bacteria 8982
2022 Ga0495680_0012341 3300047322 Bacteria 7521
2023 Ga0495680_0019802 3300047322 Bacteria 5673
2024 Ga0495680_0070190 3300047322 Bacteria 2671
2025 Ga0495687_000060 3300047443 Bacteria 179124
2026 Ga0495687_000350 3300047443 Bacteria 59063
2027 Ga0495687_015375 3300047443 Bacteria 3896
2028 Ga0495687_022160 3300047443 Bacteria 3057
2029 Ga0495675_0000295 3300047444 Bacteria 35782
2030 Ga0495675_0003515 3300047444 Bacteria 9442
2031 Ga0495675_0003662 3300047444 Bacteria 9287
2032 Ga0495675_0032366 3300047444 Bacteria 3337
2033 Ga0495677_0003018 3300047445 Bacteria 6544
2034 Ga0495677_0012062 3300047445 Bacteria 3154
2035 Ga0495679_000026 3300047446 Bacteria 196639
2036 Ga0495679_000245 3300047446 Bacteria 45040
2037 Ga0495679_002264 3300047446 Bacteria 9936
2038 Ga0495679_025669 3300047446 Bacteria 1967
2039 Ga0495673_0000335 3300047469 Bacteria 60281
2040 Ga0495673_0007801 3300047469 Bacteria 6096
2041 Ga0495673_0062981 3300047469 Bacteria 1582
2042 Ga0495681_0000005 3300047470 Bacteria 225279
2043 Ga0495681_0007520 3300047470 Bacteria 6941
2044 Ga0495681_0008222 3300047470 Bacteria 6557
2045 Ga0495681_0015730 3300047470 Bacteria 4271
2046 Ga0495681_0054108 3300047470 Bacteria 1877
2047 Ga0495684_0000036 3300047471 Bacteria 107181
2048 Ga0495684_0020175 3300047471 Bacteria 5133
2049 Ga0495684_0046440 3300047471 Bacteria 3322
2050 Ga0495684_0082407 3300047471 Bacteria 2440
2051 Ga0495686_0014653 3300047472 Bacteria 5391
2052 Ga0495593_0001674 3300047673 Bacteria 13131
2053 Ga0495593_0007037 3300047673 Bacteria 6597
2054 Ga0495593_0088071 3300047673 Bacteria 1600
2055 Ga0495593_0095932 3300047673 Bacteria 1524
2056 Ga0495602_0000018 3300048088 Bacteria 183837
2057 Ga0495602_0031584 3300048088 Bacteria 5004
2058 Ga0495602_0033350 3300048088 Bacteria 4831
2059 Ga0495602_0058452 3300048088 Bacteria 3374
2060 Ga0495614_0046053 3300048089 Bacteria 1870
2061 Ga0495614_0063828 3300048089 Bacteria 1583
2062 Ga0495614_0083312 3300048089 Bacteria 1387
2063 Ga0495626_0008241 3300048091 Bacteria 5733
2064 Ga0495626_0008439 3300048091 Bacteria 5645
2065 Ga0495626_0010810 3300048091 Bacteria 4850
2066 Ga0495626_0014377 3300048091 Bacteria 4087
2067 Ga0496100_0035629 3300048903 Bacteria 3132
2068 Ga0496101_0174015 3300048904 Bacteria 1655
2069 Ga0496101_0242092 3300048904 Bacteria 1404
2070 Ga0496102_0039979 3300048905 Bacteria 4241
2071 Ga0496102_0169234 3300048905 Bacteria 2057
2072 Ga0496102_0214595 3300048905 Bacteria 1814
2073 Ga0496102_0264863 3300048905 Bacteria 1620
2074 Ga0496102_0365754 3300048905 Bacteria 1358
2075 Ga0496103_0142093 3300048906 Bacteria 1536
2076 Ga0496104_0000175 3300048907 Bacteria 56916
2077 Ga0496104_0002357 3300048907 Bacteria 16326
2078 Ga0496104_0003379 3300048907 Bacteria 13784
2079 Ga0496104_0009058 3300048907 Bacteria 8852
2080 Ga0496104_0026761 3300048907 Bacteria 5330
2081 Ga0496104_0028770 3300048907 Bacteria 5150
2082 Ga0496104_0061783 3300048907 Bacteria 3552
2083 Ga0496104_0068986 3300048907 Bacteria 3360
2084 Ga0496105_0007248 3300048908 Bacteria 8565
2085 Ga0496105_0014273 3300048908 Bacteria 6322
2086 Ga0496105_0019067 3300048908 Bacteria 5529
2087 Ga0496105_0035302 3300048908 Bacteria 4115
2088 Ga0496105_0059288 3300048908 Bacteria 3159
2089 Ga0496105_0076042 3300048908 Bacteria 2773
2090 Ga0496105_0119224 3300048908 Bacteria 2177
2091 Ga0496106_0000334 3300048909 Bacteria 33088
2092 Ga0496106_0001067 3300048909 Bacteria 20209
2093 Ga0496106_0104347 3300048909 Bacteria 2201
2094 Ga0496106_0124796 3300048909 Bacteria 2015
2095 Ga0496107_0009614 3300048910 Bacteria 6705
2096 Ga0496107_0088487 3300048910 Bacteria 2261
2097 Ga0496107_0131986 3300048910 Bacteria 1844
2098 Ga0496108_0001410 3300048911 Bacteria 18935
2099 Ga0496108_0001485 3300048911 Bacteria 18526
2100 Ga0496108_0001994 3300048911 Bacteria 16347
2101 Ga0496108_0012643 3300048911 Bacteria 6878
2102 Ga0496108_0054756 3300048911 Bacteria 3348
2103 Ga0496108_0097929 3300048911 Bacteria 2499
2104 Ga0496108_0106011 3300048911 Bacteria 2400
2105 Ga0496108_0106174 3300048911 Bacteria 2398
2106 Ga0496109_0001151 3300048912 Bacteria 22020
2107 Ga0496109_0004099 3300048912 Bacteria 12178
2108 Ga0496109_0004300 3300048912 Bacteria 11896
2109 Ga0496109_0005509 3300048912 Bacteria 10599
2110 Ga0496109_0025515 3300048912 Bacteria 5267
2111 Ga0496109_0032109 3300048912 Bacteria 4717
2112 Ga0496109_0032518 3300048912 Bacteria 4689
2113 Ga0496109_0337966 3300048912 Bacteria 1422
2114 Ga0496109_0385585 3300048912 Bacteria 1324
2115 Ga0496110_0003529 3300048913 Bacteria 12009
2116 Ga0496110_0004061 3300048913 Bacteria 11295
2117 Ga0496110_0004114 3300048913 Bacteria 11239
2118 Ga0496110_0015658 3300048913 Bacteria 6317
2119 Ga0496110_0024070 3300048913 Bacteria 5188
2120 Ga0496110_0033235 3300048913 Bacteria 4460
2121 Ga0496110_0073883 3300048913 Bacteria 3026
2122 Ga0496110_0103988 3300048913 Bacteria 2548
2123 Ga0496110_0179084 3300048913 Bacteria 1924
2124 Ga0496110_0259005 3300048913 Bacteria 1583
2125 Ga0496110_0276879 3300048913 Bacteria 1528
2126 Ga0496111_0000362 3300048914 Bacteria 22540
2127 Ga0496111_0002041 3300048914 Bacteria 12016
2128 Ga0496111_0003573 3300048914 Bacteria 9635
2129 Ga0496111_0103935 3300048914 Bacteria 2090
2130 Ga0496111_0175879 3300048914 Bacteria 1591
2131 Ga0496111_0177154 3300048914 Bacteria 1585
2132 Ga0496112_0000056 3300048915 Bacteria 77708
2133 Ga0496112_0000755 3300048915 Bacteria 22673
2134 Ga0496112_0001355 3300048915 Bacteria 18635
2135 Ga0496112_0003671 3300048915 Bacteria 12793
2136 Ga0496112_0004153 3300048915 Bacteria 12193
2137 Ga0496112_0020129 3300048915 Bacteria 6317
2138 Ga0496112_0025394 3300048915 Bacteria 5689
2139 Ga0496112_0066539 3300048915 Bacteria 3556
2140 Ga0496112_0153912 3300048915 Bacteria 2267
2141 Ga0496112_0179019 3300048915 Bacteria 2084
2142 Ga0496113_0004878 3300048916 Bacteria 8308
2143 Ga0496113_0007156 3300048916 Bacteria 7147
2144 Ga0496113_0013283 3300048916 Bacteria 5572
2145 Ga0496113_0021063 3300048916 Bacteria 4595
2146 Ga0496113_0068623 3300048916 Bacteria 2691
2147 Ga0496113_0068976 3300048916 Bacteria 2684
2148 Ga0496114_0004949 3300048917 Bacteria 10387
2149 Ga0496114_0007967 3300048917 Bacteria 8385
2150 Ga0496114_0050781 3300048917 Bacteria 3452
2151 Ga0496114_0076831 3300048917 Bacteria 2814
2152 Ga0496114_0100758 3300048917 Bacteria 2465
2153 Ga0496114_0342448 3300048917 Bacteria 1322
2154 Ga0496115_0069540 3300048918 Bacteria 2852
2155 Ga0496115_0097378 3300048918 Bacteria 2409
2156 Ga0496115_0151226 3300048918 Bacteria 1917
2157 Ga0496116_0023537 3300048919 Bacteria 4585
2158 Ga0496116_0120025 3300048919 Bacteria 1524
2159 Ga0496117_0006817 3300048920 Bacteria 11373
2160 Ga0496117_0009447 3300048920 Bacteria 9074
2161 Ga0496117_0082879 3300048920 Bacteria 2099
2162 Ga0496118_0000401 3300048921 Bacteria 73186
2163 Ga0496118_0006350 3300048921 Bacteria 13041
2164 Ga0496121_0001952 3300048924 Bacteria 32880
2165 Ga0496121_0003905 3300048924 Bacteria 20690
2166 Ga0496121_0004910 3300048924 Bacteria 17550
2167 Ga0496121_0016298 3300048924 Bacteria 7683
2168 Ga0496121_0030946 3300048924 Bacteria 4904
2169 Ga0496121_0068518 3300048924 Bacteria 2870
2170 Ga0496122_0003399 3300048925 Bacteria 20950
2171 Ga0496122_0006573 3300048925 Bacteria 13282
2172 Ga0496123_0000136 3300048926 Bacteria 152399
2173 Ga0496124_0000103 3300048927 Bacteria 179162
2174 Ga0496124_0004093 3300048927 Bacteria 17250
2175 Ga0496124_0064437 3300048927 Bacteria 3059
2176 Ga0496124_0186448 3300048927 Bacteria 1592
2177 Ga0496125_0000482 3300048928 Bacteria 70413
2178 Ga0496125_0003169 3300048928 Bacteria 20390
2179 Ga0496125_0009441 3300048928 Bacteria 10017
2180 Ga0496125_0027805 3300048928 Bacteria 5119
2181 Ga0496126_0000389 3300048929 Bacteria 90452
2182 Ga0496126_0004363 3300048929 Bacteria 16963
2183 Ga0496126_0258225 3300048929 Bacteria 1450
2184 Ga0501032_0046476 3300049569 Bacteria 2934
2185 Ga0501033_0021452 3300049570 Bacteria 4873
2186 Ga0501033_0057231 3300049570 Bacteria 2882
2187 Ga0501033_0060320 3300049570 Bacteria 2799
2188 Ga0501034_0001791 3300049571 Bacteria 27438
2189 Ga0501034_0019580 3300049571 Bacteria 6920
2190 Ga0501034_0054616 3300049571 Bacteria 4021
2191 Ga0501034_0059944 3300049571 Bacteria 3822
2192 Ga0501034_0116771 3300049571 Bacteria 2656
2193 Ga0501034_0129683 3300049571 Bacteria 2505
2194 Ga0501036_0005876 3300049572 Bacteria 9940
2195 Ga0501036_0035339 3300049572 Bacteria 4229
2196 Ga0501036_0046105 3300049572 Bacteria 3691
2197 Ga0501037_0116821 3300049573 Bacteria 1920
2198 Ga0501038_0001150 3300049574 Bacteria 23992
2199 Ga0501038_0011563 3300049574 Bacteria 8051
2200 Ga0501038_0026277 3300049574 Bacteria 5186
2201 Ga0501038_0035650 3300049574 Bacteria 4367
2202 Ga0501038_0046808 3300049574 Bacteria 3749
2203 Ga0501038_0073346 3300049574 Bacteria 2899
2204 Ga0501038_0076393 3300049574 Bacteria 2829
2205 Ga0501039_0005097 3300049575 Bacteria 9952
2206 Ga0501039_0018526 3300049575 Bacteria 5345
2207 Ga0501039_0063229 3300049575 Bacteria 2868
2208 Ga0501039_0137830 3300049575 Bacteria 1916
2209 Ga0501039_0149638 3300049575 Bacteria 1834
2210 Ga0501040_0000302 3300049576 Bacteria 28825
2211 Ga0501040_0069994 3300049576 Bacteria 2420
2212 Ga0501041_0000776 3300049577 Bacteria 17119
2213 Ga0501041_0036218 3300049577 Bacteria 2991
2214 Ga0501041_0050856 3300049577 Bacteria 2525
2215 Ga0501042_0032113 3300049578 Bacteria 3716
2216 Ga0501042_0168987 3300049578 Bacteria 1578
2217 Ga0501043_0017849 3300049579 Bacteria 5564
2218 Ga0501043_0133179 3300049579 Bacteria 1948
2219 Ga0501043_0192910 3300049579 Bacteria 1584
2220 Ga0501046_0000992 3300049580 Bacteria 27750
2221 Ga0501046_0012729 3300049580 Bacteria 7155
2222 Ga0501046_0032554 3300049580 Bacteria 4222
2223 Ga0501046_0082316 3300049580 Bacteria 2486
2224 Ga0501046_0090716 3300049580 Bacteria 2351
2225 Ga0501047_0006878 3300049581 Bacteria 10687
2226 Ga0501047_0055369 3300049581 Bacteria 3836
2227 Ga0501047_0066749 3300049581 Bacteria 3468
2228 Ga0501047_0068994 3300049581 Bacteria 3405
2229 Ga0501047_0072955 3300049581 Bacteria 3304
2230 Ga0501047_0074314 3300049581 Bacteria 3272
2231 Ga0501047_0091627 3300049581 Bacteria 2918
2232 Ga0501048_0002096 3300049582 Bacteria 15203
2233 Ga0501048_0025493 3300049582 Bacteria 4309
2234 Ga0501048_0062367 3300049582 Bacteria 2638
2235 Ga0501067_0015302 3300049583 Bacteria 4245
2236 Ga0501067_0049784 3300049583 Bacteria 2322
2237 Ga0501068_0057009 3300049584 Bacteria 2368
2238 Ga0501068_0059842 3300049584 Bacteria 2313
2239 Ga0501068_0063195 3300049584 Bacteria 2252
2240 Ga0501068_0106085 3300049584 Bacteria 1744
2241 Ga0501069_0000753 3300049585 Bacteria 15120
2242 Ga0501069_0002492 3300049585 Bacteria 9395
2243 Ga0501069_0020064 3300049585 Bacteria 3618
2244 Ga0501069_0023857 3300049585 Bacteria 3335
2245 Ga0501069_0087230 3300049585 Bacteria 1763
2246 Ga0501070_0001170 3300049586 Bacteria 23464
2247 Ga0501070_0004788 3300049586 Bacteria 11576
2248 Ga0501070_0007363 3300049586 Bacteria 9344
2249 Ga0501070_0027379 3300049586 Bacteria 4782
2250 Ga0501070_0037102 3300049586 Bacteria 4068
2251 Ga0501070_0063680 3300049586 Bacteria 3054
2252 Ga0501070_0171365 3300049586 Bacteria 1788
2253 Ga0501071_0005763 3300049587 Bacteria 7996
2254 Ga0501072_0002409 3300049588 Bacteria 14027
2255 Ga0501072_0021818 3300049588 Bacteria 4966
2256 Ga0501072_0030616 3300049588 Bacteria 4210
2257 Ga0501072_0213969 3300049588 Bacteria 1536
2258 Ga0501073_0005923 3300049589 Bacteria 9125
2259 Ga0501073_0007998 3300049589 Bacteria 7851
2260 Ga0501073_0009999 3300049589 Bacteria 6976
2261 Ga0501073_0167617 3300049589 Bacteria 1521
2262 Ga0501074_0000574 3300049590 Bacteria 22747
2263 Ga0501074_0005553 3300049590 Bacteria 9069
2264 Ga0501074_0032692 3300049590 Bacteria 3768
2265 Ga0501074_0034148 3300049590 Bacteria 3687
2266 Ga0501074_0088725 3300049590 Bacteria 2215
2267 Ga0501074_0130966 3300049590 Bacteria 1794
2268 Ga0501075_0000045 3300049591 Bacteria 50874
2269 Ga0501075_0006755 3300049591 Bacteria 7918
2270 Ga0501075_0010485 3300049591 Bacteria 6513
2271 Ga0501075_0043416 3300049591 Bacteria 3372
2272 Ga0501075_0067208 3300049591 Bacteria 2706
2273 Ga0501076_0000394 3300049592 Bacteria 27363
2274 Ga0501076_0001383 3300049592 Bacteria 16245
2275 Ga0501076_0003698 3300049592 Bacteria 10760
2276 Ga0501077_0000629 3300049593 Bacteria 21374
2277 Ga0501077_0037063 3300049593 Bacteria 3107
2278 Ga0501217_018736 3300049661 Bacteria 1610
2279 Ga0501079_0000771 3300049741 Bacteria 21925
2280 Ga0501079_0003366 3300049741 Bacteria 11728
2281 Ga0501079_0020434 3300049741 Bacteria 5061
2282 Ga0501079_0023207 3300049741 Bacteria 4763
2283 Ga0501079_0026665 3300049741 Bacteria 4430
2284 Ga0501079_0110325 3300049741 Bacteria 2138
2285 Ga0501080_0009055 3300049742 Bacteria 9060
2286 Ga0501080_0009317 3300049742 Bacteria 8951
2287 Ga0501080_0011191 3300049742 Bacteria 8211
2288 Ga0501080_0021145 3300049742 Bacteria 6022
2289 Ga0501080_0038140 3300049742 Bacteria 4487
2290 Ga0501080_0045623 3300049742 Bacteria 4080
2291 Ga0501080_0059134 3300049742 Bacteria 3567
2292 Ga0501080_0073094 3300049742 Bacteria 3190
2293 Ga0501080_0121069 3300049742 Bacteria 2425
2294 Ga0501080_0129611 3300049742 Bacteria 2335
2295 Ga0501081_0001457 3300049743 Bacteria 14500
2296 Ga0501081_0002316 3300049743 Bacteria 11989
2297 Ga0501081_0002657 3300049743 Bacteria 11303
2298 Ga0501081_0022931 3300049743 Bacteria 4180
2299 Ga0501081_0147533 3300049743 Bacteria 1688
2300 Ga0501083_0005518 3300049744 Bacteria 8962
2301 Ga0501083_0072056 3300049744 Bacteria 2297
2302 Ga0501035_0001502 3300049822 Bacteria 23865
2303 Ga0501035_0003296 3300049822 Bacteria 15478
2304 Ga0501035_0013856 3300049822 Bacteria 7442
2305 Ga0501035_0055851 3300049822 Bacteria 3525
2306 Ga0501035_0103110 3300049822 Bacteria 2502
2307 Ga0501035_0161886 3300049822 Bacteria 1936
2308 Ga0501035_0165034 3300049822 Bacteria 1915
2309 Ga0501044_0005438 3300049823 Bacteria 14152
2310 Ga0501044_0005924 3300049823 Bacteria 13543
2311 Ga0501044_0009435 3300049823 Bacteria 10628
2312 Ga0501044_0032581 3300049823 Bacteria 5477
2313 Ga0501044_0041563 3300049823 Bacteria 4787
2314 Ga0501044_0043991 3300049823 Bacteria 4637
2315 Ga0501044_0044170 3300049823 Bacteria 4627
2316 Ga0501044_0047523 3300049823 Bacteria 4438
2317 Ga0501044_0057579 3300049823 Bacteria 3988
2318 Ga0501044_0063388 3300049823 Bacteria 3776
2319 Ga0501044_0064532 3300049823 Bacteria 3738
2320 Ga0501044_0080009 3300049823 Bacteria 3310
2321 Ga0501044_0101395 3300049823 Bacteria 2896
2322 Ga0501044_0129701 3300049823 Bacteria 2516
2323 Ga0501044_0138081 3300049823 Bacteria 2427
2324 Ga0501044_0170287 3300049823 Bacteria 2150
2325 Ga0501045_0001370 3300049824 Bacteria 16220
2326 Ga0501045_0013789 3300049824 Bacteria 5714
2327 Ga0501045_0040278 3300049824 Bacteria 3400
2328 Ga0501045_0064785 3300049824 Bacteria 2683
2329 Ga0501045_0170995 3300049824 Bacteria 1618
2330 nmdc:mga03683_44495_c1 3300050489 Bacteria 1835
2331 nmdc:mga03n38_41650_c1 3300050490 Bacteria 2003
2332 nmdc:mga00v17_14534_c1 3300050491 Bacteria 4397
2333 nmdc:mga00v17_50376_c1 3300050491 Bacteria 2530
2334 nmdc:mga0yw44_23947_c1 3300050492 Bacteria 3447
2335 nmdc:mga0yw44_98522_c1 3300050492 Bacteria 1859
2336 nmdc:mga0k408_11361_c1 3300050493 Bacteria 4848
2337 nmdc:mga0k408_4350_c1 3300050493 Bacteria 7521
2338 nmdc:mga0k408_47203_c1 3300050493 Bacteria 2489
2339 nmdc:mga0k408_51080_c1 3300050493 Bacteria 2395
2340 nmdc:mga0k408_5246_c1 3300050493 Bacteria 6881
2341 nmdc:mga0k408_55909_c1 3300050493 Bacteria 2289
2342 nmdc:mga06z11_26354_c1 3300050494 Bacteria 2766
2343 nmdc:mga06z11_3297_c1 3300050494 Bacteria 6246
2344 nmdc:mga06z11_7489_c1 3300050494 Bacteria 4495
2345 nmdc:mga04h51_615_c1 3300050495 Bacteria 8450
2346 nmdc:mga07m45_20783_c1 3300050496 Bacteria 3568
2347 nmdc:mga07m45_3394_c1 3300050496 Bacteria 7673
2348 nmdc:mga07m45_66050_c1 3300050496 Bacteria 2055
2349 nmdc:mga07m45_6981_c2 3300050496 Bacteria 5319
2350 nmdc:mga07m45_9756_c1 3300050496 Bacteria 4993
2351 nmdc:mga05p37_11294_c1 3300050507 Bacteria 10623
2352 nmdc:mga05p37_181569_c1 3300050507 Bacteria 2560
2353 nmdc:mga05p37_223699_c1 3300050507 Bacteria 2270
2354 nmdc:mga05p37_228563_c1 3300050507 Bacteria 2242
2355 nmdc:mga05p37_3076_c1 3300050507 Bacteria 19372
2356 nmdc:mga05p37_48136_c2 3300050507 Bacteria 4920
2357 nmdc:mga05p37_5061_c2 3300050507 Bacteria 9847
2358 nmdc:mga05p37_61459_c1 3300050507 Bacteria 4624
2359 nmdc:mga09592_1195_c1 3300050508 Bacteria 20776
2360 nmdc:mga09592_128738_c1 3300050508 Bacteria 2177
2361 nmdc:mga09592_158136_c1 3300050508 Bacteria 1957
2362 nmdc:mga09592_315_c1 3300050508 Bacteria 35276
2363 nmdc:mga0qj67_173074_c1 3300050509 Bacteria 1753
2364 nmdc:mga0qj67_24464_c1 3300050509 Bacteria 4655
2365 nmdc:mga0qj67_29101_c1 3300050509 Bacteria 4290
2366 nmdc:mga0qj67_30531_c1 3300050509 Bacteria 4197
2367 nmdc:mga0qj67_38505_c1 3300050509 Bacteria 3751
2368 nmdc:mga0qj67_47246_c1 3300050509 Bacteria 3400
2369 nmdc:mga0qj67_52587_c1 3300050509 Bacteria 3224
2370 nmdc:mga0qj67_64958_c1 3300050509 Bacteria 2905
2371 nmdc:mga0qj67_8966_c1 3300050509 Bacteria 7420
2372 nmdc:mga06r32_315564_c1 3300050510 Bacteria 1549
2373 nmdc:mga06r32_4869_c1 3300050510 Bacteria 12090
2374 nmdc:mga06r32_74946_c1 3300050510 Bacteria 3282
2375 nmdc:mga06r32_8310_c1 3300050510 Bacteria 9341
2376 nmdc:mga06r32_93662_c1 3300050510 Bacteria 2938
2377 nmdc:mga08y16_147_c1 3300050511 Bacteria 61021
2378 nmdc:mga08y16_148913_c1 3300050511 Bacteria 2433
2379 nmdc:mga08y16_19131_c1 3300050511 Bacteria 7216
2380 nmdc:mga08y16_221015_c1 3300050511 Bacteria 1961
2381 nmdc:mga08y16_23263_c1 3300050511 Bacteria 6543
2382 nmdc:mga08y16_262278_c1 3300050511 Bacteria 1784
2383 nmdc:mga08y16_29925_c1 3300050511 Bacteria 5734
2384 nmdc:mga08y16_303975_c1 3300050511 Bacteria 1644
2385 nmdc:mga08y16_317431_c1 3300050511 Bacteria 1604
2386 nmdc:mga08y16_334982_c1 3300050511 Bacteria 1556
2387 nmdc:mga08y16_59193_c1 3300050511 Bacteria 4002
2388 nmdc:mga0n895_1137_c1 3300050512 Bacteria 19479
2389 nmdc:mga0n895_114457_c1 3300050512 Bacteria 2715
2390 nmdc:mga0n895_1601_c1 3300050512 Bacteria 5085
2391 nmdc:mga0n895_19648_c1 3300050512 Bacteria 6282
2392 nmdc:mga0n895_219621_c1 3300050512 Bacteria 1930
2393 nmdc:mga0n895_281803_c1 3300050512 Bacteria 1685
2394 nmdc:mga0n895_283645_c1 3300050512 Bacteria 1679
2395 nmdc:mga0n895_79545_c1 3300050512 Bacteria 3265
2396 nmdc:mga0rr50_1387_c1 3300050513 Bacteria 13256
2397 nmdc:mga0rr50_15574_c1 3300050513 Bacteria 5022
2398 nmdc:mga0rr50_9578_c1 3300050513 Bacteria 6100
2399 nmdc:mga08x19_101351_c1 3300050514 Bacteria 1911
2400 nmdc:mga08x19_111334_c1 3300050514 Bacteria 1826
2401 nmdc:mga08x19_15247_c1 3300050514 Bacteria 4674
2402 nmdc:mga08x19_20153_c1 3300050514 Bacteria 4104
2403 nmdc:mga08x19_38857_c1 3300050514 Bacteria 3023
2404 nmdc:mga08x19_52035_c1 3300050514 Bacteria 2632
2405 nmdc:mga08x19_60938_c1 3300050514 Bacteria 2445
2406 nmdc:mga08x19_9079_c1 3300050514 Bacteria 5936
2407 nmdc:mga0a205_4178_c1 3300050515 Bacteria 12940
2408 nmdc:mga0a205_44270_c1 3300050515 Bacteria 4290
2409 nmdc:mga0a205_56652_c1 3300050515 Bacteria 3784
2410 nmdc:mga0a205_71885_c1 3300050515 Bacteria 3341
2411 nmdc:mga0a205_91052_c1 3300050515 Bacteria 2947
2412 nmdc:mga0sz30_6728_c1 3300050516 Bacteria 4284
2413 Ga0495601_0000024 3300053077 Bacteria 133160
2414 Ga0495601_0011833 3300053077 Bacteria 5232
2415 Ga0495601_0052433 3300053077 Bacteria 2576
2416 Ga0495601_0103852 3300053077 Bacteria 1837
2417 Ga0495612_0000079 3300053078 Bacteria 44236
2418 Ga0495612_0009187 3300053078 Bacteria 4010
2419 Ga0500610_0000484 3300053079 Bacteria 12265
2420 Ga0500610_0000504 3300053079 Bacteria 12015
2421 Ga0495595_0000036 3300053084 Bacteria 79035
2422 Ga0495595_0004673 3300053084 Bacteria 5510
2423 Ga0495619_0000034 3300053085 Bacteria 129851
2424 Ga0495619_0007830 3300053085 Bacteria 6762
2425 Ga0495619_0091938 3300053085 Bacteria 2055
2426 Ga0495619_0235971 3300053085 Bacteria 1267
2427 Ga0500578_0000085 3300053086 Bacteria 103911
2428 Ga0500644_0000705 3300053088 Bacteria 11835
2429 Ga0500651_0002090 3300053093 Bacteria 10377
2430 Ga0500566_0027781 3300053094 Bacteria 3312
2431 Ga0500641_0015280 3300053096 Bacteria 2846
2432 Ga0500562_010957 3300053108 Bacteria 2301
2433 Ga0500642_0034477 3300053130 Bacteria 2142
2434 Ga0500652_000572 3300053131 Bacteria 12879
2435 Ga0500616_0067300 3300053153 Bacteria 1837
2436 Ga0500616_0109324 3300053153 Bacteria 1338
2437 Ga0500622_0000080 3300053156 Bacteria 102519
2438 Ga0500622_0012388 3300053156 Bacteria 4617
2439 Ga0500627_0001388 3300053158 Bacteria 6734
2440 Ga0500636_0166844 3300053177 Bacteria 1195
2441 Ga0500637_0034605 3300053178 Bacteria 2827
2442 Ga0500637_0047688 3300053178 Bacteria 2434
2443 Ga0501084_0002016 3300054114 Bacteria 16220
2444 Ga0501084_0006846 3300054114 Bacteria 9384
2445 Ga0501084_0053845 3300054114 Bacteria 3366
2446 Ga0501084_0057188 3300054114 Bacteria 3264
2447 Ga0501084_0114557 3300054114 Bacteria 2267
2448 Ga0501084_0118613 3300054114 Bacteria 2224
2449 Ga0501084_0201797 3300054114 Bacteria 1678
2450 Ga0500661_000179 3300055283 Bacteria 11055
2451 Ga0590075_006645 3300059424 Bacteria 2739
2452 Ga0590077_003920 3300059426 Bacteria 3072
2453 Ga0501082_0021180 3300060353 Bacteria 5608
2454 Ga0501082_0040245 3300060353 Bacteria 4032
2455 Ga0501082_0058469 3300060353 Bacteria 3322
2456 Ga0501082_0104768 3300060353 Bacteria 2447
2457 Ga0501082_0116984 3300060353 Bacteria 2309
2458 Ga0501082_0247636 3300060353 Bacteria 1551
2459 Ga0530510_0000797 3300061734 Bacteria 20554
2460 Ga0530510_0004236 3300061734 Bacteria 9915

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048915 Ga0496112_0179019 Ga0496112_0179019_992_1987 317
2 3300039110 Ga0400487_25275 Ga0400487_25275_16_1044 327
3 3300042001 Ga0439441_012443 Ga0439441_012443_11_1012 333
4 3300035695 Ga0373927_0084079 Ga0373927_0084079_1017_2051 342
5 3300046492 Ga0495585_0080064 Ga0495585_0080064_727_1755 342
6 3300046665 Ga0495661_0079148 Ga0495661_0079148_859_1887 342
7 3300050511 nmdc:mga08y16_317431_c1 nmdc:mga08y16_317431_c1_16_1044 342
8 3300013105 Ga0157369_10005169 Ga0157369_100051698 344
9 3300037466 Ga0395898_0047621 Ga0395898_0047621_202_1290 344
10 3300038443 Ga0395901_0017650 Ga0395901_0017650_1161_2249 344
11 3300053177 Ga0500636_0166844 Ga0500636_0166844_118_1176 350
12 3300035725 Ga0373947_0193816 Ga0373947_0193816_53_1138 361
13 3300009147 Ga0114129_10400193 Ga0114129_104001932 363
14 3300025291 Ga0209675_1007519 Ga0209675_10075194 363
15 3300025294 Ga0209025_1005144 Ga0209025_10051449 363
16 3300005985 Ga0081539_10002808 Ga0081539_1000280814 365
17 3300009986 Ga0105033_102584 Ga0105033_1025841 366
18 3300035086 Ga0373934_0022213 Ga0373934_0022213_38_1138 366
19 3300035695 Ga0373927_0109731 Ga0373927_0109731_660_1760 366
20 3300037466 Ga0395898_0153070 Ga0395898_0153070_1080_2180 366
21 3300039062 Ga0400483_052876 Ga0400483_052876_284_1390 366
22 3300046517 Ga0495630_0056182 Ga0495630_0056182_1833_2933 366
23 3300046530 Ga0495654_0027893 Ga0495654_0027893_425_1525 366
24 3300046535 Ga0495586_0198461 Ga0495586_0198461_24_1124 366
25 3300046559 Ga0495667_0098363 Ga0495667_0098363_17_1117 366
26 3300047319 Ga0495674_0299994 Ga0495674_0299994_171_1271 366
27 3300053077 Ga0495601_0103852 Ga0495601_0103852_705_1805 366
28 3300005530 Ga0070679_100088141 Ga0070679_1000881413 367
29 3300005563 Ga0068855_100012806 Ga0068855_1000128063 367
30 3300006871 Ga0075434_100107526 Ga0075434_1001075263 367
31 3300009093 Ga0105240_10004031 Ga0105240_1000403115 367
32 3300013104 Ga0157370_10002434 Ga0157370_1000243415 367
33 3300013105 Ga0157369_10475029 Ga0157369_104750291 367
34 3300025949 Ga0207667_10013199 Ga0207667_100131993 367
35 3300049585 Ga0501069_0087230 Ga0501069_0087230_186_1337 367
36 3300049823 Ga0501044_0170287 Ga0501044_0170287_623_1774 367
37 3300050512 nmdc:mga0n895_114457_c1 nmdc:mga0n895_114457_c1_222_1382 367
38 3300005329 Ga0070683_100003861 Ga0070683_1000038613 368
39 3300005341 Ga0070691_10022802 Ga0070691_100228023 368
40 3300005435 Ga0070714_100005454 Ga0070714_1000054544 368
41 3300005535 Ga0070684_100000545 Ga0070684_10000054518 368
42 3300005564 Ga0070664_100229970 Ga0070664_1002299702 368
43 3300005614 Ga0068856_100005394 Ga0068856_1000053944 368
44 3300025928 Ga0207700_10004530 Ga0207700_100045303 368
45 3300025929 Ga0207664_10049306 Ga0207664_100493062 368
46 3300025944 Ga0207661_10002159 Ga0207661_100021596 368
47 3300025945 Ga0207679_10097947 Ga0207679_100979472 368
48 3300026078 Ga0207702_10009236 Ga0207702_100092364 368
49 3300037588 Ga0316581_0001310 Ga0316581_0001310_1688_2833 368
50 3300048913 Ga0496110_0103988 Ga0496110_0103988_118_1275 368
51 3300005577 Ga0068857_100001558 Ga0068857_1000015587 369
52 3300026116 Ga0207674_10000062 Ga0207674_1000006247 369
53 3300005329 Ga0070683_100024665 Ga0070683_1000246653 370
54 3300005535 Ga0070684_100081786 Ga0070684_1000817863 370
55 3300025921 Ga0207652_10238279 Ga0207652_102382791 370
56 3300025944 Ga0207661_10359374 Ga0207661_103593741 370
57 3300032002 Ga0307416_100438825 Ga0307416_1004388251 370
58 3300035172 Ga0373955_0018267 Ga0373955_0018267_1707_2864 370
59 3300039438 Ga0436360_1082140 Ga0436360_1082140_3454_4572 370
60 3300046809 Ga0495600_0194322 Ga0495600_0194322_13_1125 370
61 3300005445 Ga0070708_100005262 Ga0070708_1000052628 371
62 3300005467 Ga0070706_100074346 Ga0070706_1000743462 371
63 3300005518 Ga0070699_100039229 Ga0070699_1000392296 371
64 3300025910 Ga0207684_10064256 Ga0207684_100642562 371
65 3300025922 Ga0207646_10072730 Ga0207646_100727302 371
66 3300045051 Ga0451576_0001675 Ga0451576_0001675_9479_10654 371
67 3300049578 Ga0501042_0032113 Ga0501042_0032113_23_1147 372
68 3300049741 Ga0501079_0023207 Ga0501079_0023207_21_1139 372
69 3300049824 Ga0501045_0064785 Ga0501045_0064785_937_2055 372
70 3300005546 Ga0070696_100032551 Ga0070696_1000325512 373
71 3300031691 Ga0316579_10027858 Ga0316579_100278582 374
72 3300049824 Ga0501045_0170995 Ga0501045_0170995_250_1386 374
73 iso_pu_bacteria 2858688981 2858692510 374
74 3300005336 Ga0070680_100232628 Ga0070680_1002326282 375
75 3300025917 Ga0207660_10197139 Ga0207660_101971392 375
76 3300046458 Ga0495591_005888 Ga0495591_005888_1816_2985 375
77 3300046460 Ga0495638_0014124 Ga0495638_0014124_2782_3951 375
78 3300046471 Ga0495650_0017498 Ga0495650_0017498_1308_2477 375
79 3300046474 Ga0495605_0012353 Ga0495605_0012353_790_1959 375
80 3300046491 Ga0495584_0008312 Ga0495584_0008312_2765_3934 375
81 3300046501 Ga0495607_0087371 Ga0495607_0087371_63_1232 375
82 3300046507 Ga0495606_0018588 Ga0495606_0018588_2401_3570 375
83 3300046513 Ga0495616_0009920 Ga0495616_0009920_2939_4108 375
84 3300046515 Ga0495620_0036318 Ga0495620_0036318_147_1316 375
85 3300046519 Ga0495632_0017133 Ga0495632_0017133_1382_2551 375
86 3300046520 Ga0495637_0007448 Ga0495637_0007448_2796_3965 375
87 3300046522 Ga0495643_0011455 Ga0495643_0011455_1437_2606 375
88 3300046524 Ga0495648_0045460 Ga0495648_0045460_126_1295 375
89 3300046530 Ga0495654_0009184 Ga0495654_0009184_2796_3965 375
90 3300046542 Ga0495597_0006725 Ga0495597_0006725_1811_2980 375
91 3300046665 Ga0495661_0005288 Ga0495661_0005288_1779_2948 375
92 3300046692 Ga0495671_0027130 Ga0495671_0027130_112_1281 375
93 3300046694 Ga0495649_0025625 Ga0495649_0025625_1457_2626 375
94 3300046810 Ga0495660_0012857 Ga0495660_0012857_1754_2923 375
95 3300047469 Ga0495673_0007801 Ga0495673_0007801_2765_3934 375
96 3300047470 Ga0495681_0007520 Ga0495681_0007520_2796_3965 375
97 3300047472 Ga0495686_0014653 Ga0495686_0014653_2796_3965 375
98 3300049572 Ga0501036_0046105 Ga0501036_0046105_1057_2217 375
99 3300049574 Ga0501038_0046808 Ga0501038_0046808_420_1580 375
100 3300049575 Ga0501039_0149638 Ga0501039_0149638_601_1761 375
101 3300049576 Ga0501040_0069994 Ga0501040_0069994_919_2079 375
102 3300049580 Ga0501046_0090716 Ga0501046_0090716_190_1350 375
103 3300049582 Ga0501048_0062367 Ga0501048_0062367_382_1542 375
104 3300049584 Ga0501068_0059842 Ga0501068_0059842_1130_2290 375
105 3300049590 Ga0501074_0034148 Ga0501074_0034148_1026_2186 375
106 3300049743 Ga0501081_0147533 Ga0501081_0147533_168_1328 375
107 3300049744 Ga0501083_0072056 Ga0501083_0072056_124_1284 375
108 3300049824 Ga0501045_0040278 Ga0501045_0040278_1108_2268 375
109 3300054114 Ga0501084_0118613 Ga0501084_0118613_908_2068 375
110 3300060353 Ga0501082_0058469 Ga0501082_0058469_1041_2201 375
111 iso_pu_bacteria 2836160341 2836164194 376
112 3300009553 Ga0105249_10043097 Ga0105249_100430973 377
113 iso_pu_bacteria 2512564039 2512730932 379
114 iso_pu_bacteria 2524023129 2524187173 379
115 iso_pu_bacteria 2585428059 2587737476 379
116 iso_pu_bacteria 2593339198 2595317840 379
117 iso_pu_bacteria 2671180694 2673821512 379
118 iso_pu_bacteria 2857472729 2857478449 379
119 iso_pu_bacteria 2919425241 2919429094 379
120 iso_pu_bacteria 3001272096 3001272272 379
121 iso_pu_bacteria 8054795415 8054804009 379
122 iso_pu_bacteria 8055632911 8055637477 379
123 3300031691 Ga0316579_10032999 Ga0316579_100329992 380
124 3300036647 Ga0316582_0076960 Ga0316582_0076960_188_1351 380
125 iso_pu_bacteria 2888578766 2888580759 380
126 iso_pu_bacteria 2889049205 2889050568 380
127 iso_pu_bacteria 2925326138 2925331838 380
128 iso_pu_bacteria 8057733483 8057733644 380
129 3300036647 Ga0316582_0018444 Ga0316582_0018444_952_2097 381
130 3300038741 Ga0400488_25049 Ga0400488_25049_2596_3741 381
131 3300039437 Ga0436365_1282334 Ga0436365_1282334_583_1797 381
132 3300049586 Ga0501070_0027379 Ga0501070_0027379_777_1991 381
133 3300049823 Ga0501044_0057579 Ga0501044_0057579_1829_3043 381
134 3300005327 Ga0070658_10139561 Ga0070658_101395613 382
135 3300005458 Ga0070681_10117545 Ga0070681_101175455 382
136 3300005530 Ga0070679_100009718 Ga0070679_10000971810 382
137 3300037418 Ga0395900_0295256 Ga0395900_0295256_241_1392 382
138 3300037466 Ga0395898_0184252 Ga0395898_0184252_72_1223 382
139 3300037471 Ga0395905_0120534 Ga0395905_0120534_285_1436 382
140 3300042156 Ga0439446_0005653 Ga0439446_0005653_367_1518 382
141 3300042435 Ga0439434_0005544 Ga0439434_0005544_1189_2340 382
142 3300045976 Ga0466967_0133314 Ga0466967_0133314_723_1874 382
143 3300047317 Ga0495604_0097564 Ga0495604_0097564_875_2035 382
144 3300048919 Ga0496116_0023537 Ga0496116_0023537_2483_3643 382
145 iso_pu_bacteria 2558860112 2558906548 382
146 iso_pu_bacteria 2816332139 2816507483 382
147 iso_pu_bacteria 2863067949 2863073249 382
148 iso_pu_bacteria 2899370129 2899370595 382
149 3300005434 Ga0070709_10000166 Ga0070709_1000016610 383
150 3300005435 Ga0070714_100015514 Ga0070714_1000155143 383
151 3300005436 Ga0070713_100000050 Ga0070713_10000005016 383
152 3300005437 Ga0070710_10000177 Ga0070710_1000017724 383
153 3300005439 Ga0070711_100003077 Ga0070711_1000030776 383
154 3300005445 Ga0070708_100018279 Ga0070708_1000182791 383
155 3300005468 Ga0070707_100256846 Ga0070707_1002568462 383
156 3300005471 Ga0070698_100356594 Ga0070698_1003565942 383
157 3300005518 Ga0070699_100018493 Ga0070699_1000184932 383
158 3300005518 Ga0070699_100154268 Ga0070699_1001542681 383
159 3300005536 Ga0070697_100010429 Ga0070697_1000104294 383
160 3300006028 Ga0070717_10004190 Ga0070717_100041904 383
161 3300006173 Ga0070716_100024556 Ga0070716_1000245562 383
162 3300006175 Ga0070712_100001526 Ga0070712_1000015267 383
163 3300014325 Ga0163163_10054599 Ga0163163_100545993 383
164 3300025906 Ga0207699_10009538 Ga0207699_100095382 383
165 3300025915 Ga0207693_10005030 Ga0207693_100050307 383
166 3300025916 Ga0207663_10000170 Ga0207663_1000017023 383
167 3300025922 Ga0207646_10088310 Ga0207646_100883103 383
168 3300025928 Ga0207700_10000029 Ga0207700_1000002976 383
169 3300025929 Ga0207664_10000168 Ga0207664_1000016848 383
170 3300025939 Ga0207665_10000144 Ga0207665_1000014423 383
171 iso_pu_bacteria 2828305725 2828305918 383
172 3300005293 Ga0065715_10109792 Ga0065715_101097923 384
173 3300005327 Ga0070658_10004615 Ga0070658_100046159 384
174 3300005339 Ga0070660_100011856 Ga0070660_1000118564 384
175 3300005435 Ga0070714_100000688 Ga0070714_10000068823 384
176 3300005455 Ga0070663_100023734 Ga0070663_1000237342 384
177 3300005530 Ga0070679_100015757 Ga0070679_1000157574 384
178 3300005563 Ga0068855_100026300 Ga0068855_1000263004 384
179 3300005563 Ga0068855_100250382 Ga0068855_1002503821 384
180 3300005578 Ga0068854_100173130 Ga0068854_1001731301 384
181 3300005614 Ga0068856_100174136 Ga0068856_1001741362 384
182 3300006847 Ga0075431_100097021 Ga0075431_1000970212 384
183 3300009093 Ga0105240_10008860 Ga0105240_100088603 384
184 3300009094 Ga0111539_10094104 Ga0111539_100941041 384
185 3300009147 Ga0114129_10643173 Ga0114129_106431731 384
186 3300013100 Ga0157373_10036627 Ga0157373_100366272 384
187 3300013104 Ga0157370_10028618 Ga0157370_100286183 384
188 3300013105 Ga0157369_10044702 Ga0157369_100447023 384
189 3300013307 Ga0157372_10000853 Ga0157372_1000085314 384
190 3300021358 Ga0213873_10000922 Ga0213873_100009224 384
191 3300021377 Ga0213874_10012479 Ga0213874_100124793 384
192 3300021384 Ga0213876_10001148 Ga0213876_100011483 384
193 3300021384 Ga0213876_10001201 Ga0213876_100012017 384
194 3300021388 Ga0213875_10007325 Ga0213875_100073255 384
195 3300025909 Ga0207705_10040333 Ga0207705_100403333 384
196 3300025913 Ga0207695_10067247 Ga0207695_100672472 384
197 3300025919 Ga0207657_10054102 Ga0207657_100541022 384
198 3300025929 Ga0207664_10001380 Ga0207664_100013805 384
199 3300025944 Ga0207661_10271990 Ga0207661_102719902 384
200 3300025949 Ga0207667_10002319 Ga0207667_100023193 384
201 3300025949 Ga0207667_10258707 Ga0207667_102587072 384
202 3300025981 Ga0207640_10275967 Ga0207640_102759671 384
203 3300026067 Ga0207678_10232350 Ga0207678_102323502 384
204 3300031824 Ga0307413_10046722 Ga0307413_100467223 384
205 3300035114 Ga0373939_0001442 Ga0373939_0001442_1866_3077 384
206 3300035121 Ga0373960_0007072 Ga0373960_0007072_1292_2503 384
207 3300035242 Ga0373962_0001024 Ga0373962_0001024_1242_2453 384
208 3300035398 Ga0316574_0168269 Ga0316574_0168269_137_1297 384
209 3300037853 Ga0436364_1270512 Ga0436364_1270512_2336_3616 384
210 3300037853 Ga0436364_1468533 Ga0436364_1468533_50_1330 384
211 3300039437 Ga0436365_0727164 Ga0436365_0727164_2749_4029 384
212 3300039437 Ga0436365_1241251 Ga0436365_1241251_11847_13127 384
213 3300039450 Ga0436363_0024737 Ga0436363_0024737_1660_2940 384
214 3300039450 Ga0436363_1512283 Ga0436363_1512283_3255_4535 384
215 3300039453 Ga0436362_1027627 Ga0436362_1027627_1800_3080 384
216 3300042876 Ga0451577_0286070 Ga0451577_0286070_301_1458 384
217 3300046683 Ga0495658_0126589 Ga0495658_0126589_207_1367 384
218 3300050512 nmdc:mga0n895_79545_c1 nmdc:mga0n895_79545_c1_19_1179 384
219 iso_pu_bacteria 2883577096 2883579285 384
220 iso_pu_bacteria 2908669403 2908673454 384
221 iso_pu_bacteria 3007803356 3007808846 384
222 3300001976 JGI24752J21851_1006045 JGI24752J21851_10060452 385
223 3300001991 JGI24743J22301_10002711 JGI24743J22301_100027111 385
224 3300002076 JGI24749J21850_1004600 JGI24749J21850_10046002 385
225 3300002077 JGI24744J21845_10015542 JGI24744J21845_100155422 385
226 3300002459 JGI24751J29686_10023872 JGI24751J29686_100238721 385
227 3300005293 Ga0065715_10109379 Ga0065715_101093793 385
228 3300005293 Ga0065715_10111824 Ga0065715_101118241 385
229 3300005327 Ga0070658_10031847 Ga0070658_100318472 385
230 3300005327 Ga0070658_10131546 Ga0070658_101315462 385
231 3300005328 Ga0070676_10030944 Ga0070676_100309443 385
232 3300005328 Ga0070676_10032265 Ga0070676_100322652 385
233 3300005328 Ga0070676_10063347 Ga0070676_100633473 385
234 3300005329 Ga0070683_100004329 Ga0070683_1000043298 385
235 3300005329 Ga0070683_100193150 Ga0070683_1001931503 385
236 3300005330 Ga0070690_100002610 Ga0070690_1000026105 385
237 3300005330 Ga0070690_100038731 Ga0070690_1000387314 385
238 3300005330 Ga0070690_100132853 Ga0070690_1001328532 385
239 3300005331 Ga0070670_100003026 Ga0070670_10000302617 385
240 3300005331 Ga0070670_100003111 Ga0070670_1000031113 385
241 3300005331 Ga0070670_100003829 Ga0070670_1000038292 385
242 3300005331 Ga0070670_100097346 Ga0070670_1000973463 385
243 3300005331 Ga0070670_100108692 Ga0070670_1001086922 385
244 3300005331 Ga0070670_100154343 Ga0070670_1001543432 385
245 3300005331 Ga0070670_100166482 Ga0070670_1001664822 385
246 3300005333 Ga0070677_10007914 Ga0070677_100079142 385
247 3300005334 Ga0068869_100000765 Ga0068869_10000076513 385
248 3300005334 Ga0068869_100345413 Ga0068869_1003454131 385
249 3300005335 Ga0070666_10001146 Ga0070666_1000114614 385
250 3300005335 Ga0070666_10002429 Ga0070666_100024295 385
251 3300005335 Ga0070666_10122534 Ga0070666_101225342 385
252 3300005335 Ga0070666_10152790 Ga0070666_101527901 385
253 3300005336 Ga0070680_100047040 Ga0070680_1000470403 385
254 3300005336 Ga0070680_100213452 Ga0070680_1002134522 385
255 3300005338 Ga0068868_100002556 Ga0068868_1000025568 385
256 3300005338 Ga0068868_100021273 Ga0068868_1000212732 385
257 3300005338 Ga0068868_100022425 Ga0068868_1000224254 385
258 3300005338 Ga0068868_100023378 Ga0068868_1000233783 385
259 3300005338 Ga0068868_100059175 Ga0068868_1000591754 385
260 3300005338 Ga0068868_100130729 Ga0068868_1001307292 385
261 3300005339 Ga0070660_100000414 Ga0070660_10000041416 385
262 3300005339 Ga0070660_100007676 Ga0070660_1000076764 385
263 3300005340 Ga0070689_100015635 Ga0070689_1000156356 385
264 3300005340 Ga0070689_100028507 Ga0070689_1000285074 385
265 3300005344 Ga0070661_100001393 Ga0070661_10000139310 385
266 3300005344 Ga0070661_100013149 Ga0070661_1000131494 385
267 3300005344 Ga0070661_100013622 Ga0070661_1000136223 385
268 3300005344 Ga0070661_100208388 Ga0070661_1002083881 385
269 3300005347 Ga0070668_100001125 Ga0070668_10000112515 385
270 3300005347 Ga0070668_100002102 Ga0070668_10000210212 385
271 3300005347 Ga0070668_100004406 Ga0070668_1000044063 385
272 3300005347 Ga0070668_100011384 Ga0070668_1000113842 385
273 3300005353 Ga0070669_100053873 Ga0070669_1000538733 385
274 3300005353 Ga0070669_100111016 Ga0070669_1001110162 385
275 3300005354 Ga0070675_100003449 Ga0070675_1000034496 385
276 3300005354 Ga0070675_100005167 Ga0070675_1000051672 385
277 3300005354 Ga0070675_100012529 Ga0070675_1000125294 385
278 3300005354 Ga0070675_100022937 Ga0070675_1000229374 385
279 3300005354 Ga0070675_100042024 Ga0070675_1000420242 385
280 3300005354 Ga0070675_100058740 Ga0070675_1000587404 385
281 3300005355 Ga0070671_100000338 Ga0070671_10000033828 385
282 3300005355 Ga0070671_100025730 Ga0070671_1000257305 385
283 3300005355 Ga0070671_100029700 Ga0070671_1000297004 385
284 3300005355 Ga0070671_100043354 Ga0070671_1000433541 385
285 3300005355 Ga0070671_100071227 Ga0070671_1000712273 385
286 3300005356 Ga0070674_100001258 Ga0070674_1000012586 385
287 3300005356 Ga0070674_100010861 Ga0070674_1000108616 385
288 3300005356 Ga0070674_100022508 Ga0070674_1000225085 385
289 3300005356 Ga0070674_100045874 Ga0070674_1000458743 385
290 3300005356 Ga0070674_100096938 Ga0070674_1000969382 385
291 3300005356 Ga0070674_100229580 Ga0070674_1002295801 385
292 3300005364 Ga0070673_100000088 Ga0070673_1000000888 385
293 3300005364 Ga0070673_100009518 Ga0070673_1000095185 385
294 3300005364 Ga0070673_100038782 Ga0070673_1000387822 385
295 3300005364 Ga0070673_100042543 Ga0070673_1000425432 385
296 3300005364 Ga0070673_100123447 Ga0070673_1001234472 385
297 3300005364 Ga0070673_100158345 Ga0070673_1001583452 385
298 3300005364 Ga0070673_100194102 Ga0070673_1001941022 385
299 3300005365 Ga0070688_100001429 Ga0070688_10000142910 385
300 3300005365 Ga0070688_100002890 Ga0070688_1000028906 385
301 3300005366 Ga0070659_100000526 Ga0070659_10000052614 385
302 3300005366 Ga0070659_100018703 Ga0070659_1000187032 385
303 3300005366 Ga0070659_100095232 Ga0070659_1000952322 385
304 3300005366 Ga0070659_100284167 Ga0070659_1002841671 385
305 3300005367 Ga0070667_100004866 Ga0070667_10000486611 385
306 3300005367 Ga0070667_100010142 Ga0070667_1000101423 385
307 3300005367 Ga0070667_100013844 Ga0070667_1000138444 385
308 3300005367 Ga0070667_100019067 Ga0070667_1000190674 385
309 3300005367 Ga0070667_100031393 Ga0070667_1000313932 385
310 3300005367 Ga0070667_100037267 Ga0070667_1000372671 385
311 3300005367 Ga0070667_100079962 Ga0070667_1000799622 385
312 3300005367 Ga0070667_100166561 Ga0070667_1001665612 385
313 3300005434 Ga0070709_10017608 Ga0070709_100176083 385
314 3300005435 Ga0070714_100002535 Ga0070714_10000253515 385
315 3300005435 Ga0070714_100056448 Ga0070714_1000564483 385
316 3300005436 Ga0070713_100000296 Ga0070713_1000002964 385
317 3300005436 Ga0070713_100001145 Ga0070713_1000011457 385
318 3300005436 Ga0070713_100006994 Ga0070713_1000069948 385
319 3300005437 Ga0070710_10070659 Ga0070710_100706592 385
320 3300005437 Ga0070710_10088176 Ga0070710_100881762 385
321 3300005439 Ga0070711_100018275 Ga0070711_1000182753 385
322 3300005445 Ga0070708_100000482 Ga0070708_10000048215 385
323 3300005445 Ga0070708_100028996 Ga0070708_1000289964 385
324 3300005445 Ga0070708_100194359 Ga0070708_1001943592 385
325 3300005455 Ga0070663_100003639 Ga0070663_1000036398 385
326 3300005455 Ga0070663_100008039 Ga0070663_1000080394 385
327 3300005455 Ga0070663_100014515 Ga0070663_1000145154 385
328 3300005455 Ga0070663_100089090 Ga0070663_1000890903 385
329 3300005456 Ga0070678_100000181 Ga0070678_10000018125 385
330 3300005456 Ga0070678_100003020 Ga0070678_1000030202 385
331 3300005456 Ga0070678_100003364 Ga0070678_1000033648 385
332 3300005456 Ga0070678_100003576 Ga0070678_1000035763 385
333 3300005456 Ga0070678_100005633 Ga0070678_1000056335 385
334 3300005456 Ga0070678_100019293 Ga0070678_1000192932 385
335 3300005457 Ga0070662_100000260 Ga0070662_10000026019 385
336 3300005457 Ga0070662_100014312 Ga0070662_1000143122 385
337 3300005457 Ga0070662_100140000 Ga0070662_1001400002 385
338 3300005457 Ga0070662_100151198 Ga0070662_1001511981 385
339 3300005458 Ga0070681_10008106 Ga0070681_100081068 385
340 3300005458 Ga0070681_10015325 Ga0070681_100153257 385
341 3300005458 Ga0070681_10084807 Ga0070681_100848072 385
342 3300005459 Ga0068867_100218880 Ga0068867_1002188801 385
343 3300005466 Ga0070685_10001545 Ga0070685_100015452 385
344 3300005467 Ga0070706_100010400 Ga0070706_1000104008 385
345 3300005467 Ga0070706_100023387 Ga0070706_1000233875 385
346 3300005467 Ga0070706_100041792 Ga0070706_1000417926 385
347 3300005468 Ga0070707_100006418 Ga0070707_10000641810 385
348 3300005468 Ga0070707_100088252 Ga0070707_1000882522 385
349 3300005518 Ga0070699_100007905 Ga0070699_1000079059 385
350 3300005518 Ga0070699_100062738 Ga0070699_1000627381 385
351 3300005518 Ga0070699_100267397 Ga0070699_1002673972 385
352 3300005530 Ga0070679_100009100 Ga0070679_1000091004 385
353 3300005530 Ga0070679_100170041 Ga0070679_1001700411 385
354 3300005535 Ga0070684_100020182 Ga0070684_1000201821 385
355 3300005535 Ga0070684_100061046 Ga0070684_1000610463 385
356 3300005535 Ga0070684_100102937 Ga0070684_1001029372 385
357 3300005536 Ga0070697_100012160 Ga0070697_1000121607 385
358 3300005536 Ga0070697_100144999 Ga0070697_1001449993 385
359 3300005539 Ga0068853_100001673 Ga0068853_10000167313 385
360 3300005539 Ga0068853_100030506 Ga0068853_1000305061 385
361 3300005539 Ga0068853_100111784 Ga0068853_1001117842 385
362 3300005539 Ga0068853_100136664 Ga0068853_1001366642 385
363 3300005543 Ga0070672_100000162 Ga0070672_10000016211 385
364 3300005543 Ga0070672_100002172 Ga0070672_10000217210 385
365 3300005543 Ga0070672_100005135 Ga0070672_1000051354 385
366 3300005543 Ga0070672_100111685 Ga0070672_1001116853 385
367 3300005543 Ga0070672_100160907 Ga0070672_1001609072 385
368 3300005543 Ga0070672_100194532 Ga0070672_1001945322 385
369 3300005543 Ga0070672_100241519 Ga0070672_1002415192 385
370 3300005544 Ga0070686_100039547 Ga0070686_1000395472 385
371 3300005544 Ga0070686_100096357 Ga0070686_1000963572 385
372 3300005546 Ga0070696_100003444 Ga0070696_1000034447 385
373 3300005546 Ga0070696_100021368 Ga0070696_1000213682 385
374 3300005547 Ga0070693_100005035 Ga0070693_1000050355 385
375 3300005548 Ga0070665_100002442 Ga0070665_10000244218 385
376 3300005548 Ga0070665_100131950 Ga0070665_1001319503 385
377 3300005549 Ga0070704_100045554 Ga0070704_1000455543 385
378 3300005549 Ga0070704_100047528 Ga0070704_1000475282 385
379 3300005563 Ga0068855_100000110 Ga0068855_10000011024 385
380 3300005563 Ga0068855_100026128 Ga0068855_1000261287 385
381 3300005563 Ga0068855_100055276 Ga0068855_1000552764 385
382 3300005563 Ga0068855_100061401 Ga0068855_1000614013 385
383 3300005563 Ga0068855_100078243 Ga0068855_1000782432 385
384 3300005563 Ga0068855_100257576 Ga0068855_1002575762 385
385 3300005563 Ga0068855_100318261 Ga0068855_1003182612 385
386 3300005564 Ga0070664_100000378 Ga0070664_1000003789 385
387 3300005564 Ga0070664_100008665 Ga0070664_1000086659 385
388 3300005564 Ga0070664_100031992 Ga0070664_1000319923 385
389 3300005564 Ga0070664_100131581 Ga0070664_1001315811 385
390 3300005564 Ga0070664_100213331 Ga0070664_1002133312 385
391 3300005577 Ga0068857_100023087 Ga0068857_1000230875 385
392 3300005577 Ga0068857_100193717 Ga0068857_1001937172 385
393 3300005577 Ga0068857_100204717 Ga0068857_1002047172 385
394 3300005578 Ga0068854_100006640 Ga0068854_1000066405 385
395 3300005578 Ga0068854_100017510 Ga0068854_1000175104 385
396 3300005578 Ga0068854_100024990 Ga0068854_1000249901 385
397 3300005578 Ga0068854_100031933 Ga0068854_1000319333 385
398 3300005578 Ga0068854_100117862 Ga0068854_1001178622 385
399 3300005614 Ga0068856_100000111 Ga0068856_10000011130 385
400 3300005614 Ga0068856_100007590 Ga0068856_10000759012 385
401 3300005614 Ga0068856_100048125 Ga0068856_1000481253 385
402 3300005614 Ga0068856_100417654 Ga0068856_1004176541 385
403 3300005616 Ga0068852_100004140 Ga0068852_1000041401 385
404 3300005616 Ga0068852_100017789 Ga0068852_1000177896 385
405 3300005616 Ga0068852_100019144 Ga0068852_1000191442 385
406 3300005616 Ga0068852_100025599 Ga0068852_1000255992 385
407 3300005616 Ga0068852_100027955 Ga0068852_1000279552 385
408 3300005617 Ga0068859_100001228 Ga0068859_10000122818 385
409 3300005617 Ga0068859_100005369 Ga0068859_10000536911 385
410 3300005617 Ga0068859_100071664 Ga0068859_1000716642 385
411 3300005617 Ga0068859_100122048 Ga0068859_1001220483 385
412 3300005617 Ga0068859_100137529 Ga0068859_1001375293 385
413 3300005618 Ga0068864_100000460 Ga0068864_1000004605 385
414 3300005618 Ga0068864_100002785 Ga0068864_10000278510 385
415 3300005618 Ga0068864_100016703 Ga0068864_1000167039 385
416 3300005618 Ga0068864_100027165 Ga0068864_1000271655 385
417 3300005618 Ga0068864_100094192 Ga0068864_1000941921 385
418 3300005618 Ga0068864_100102538 Ga0068864_1001025382 385
419 3300005718 Ga0068866_10003100 Ga0068866_100031008 385
420 3300005718 Ga0068866_10006388 Ga0068866_100063881 385
421 3300005719 Ga0068861_100023788 Ga0068861_1000237882 385
422 3300005719 Ga0068861_100160238 Ga0068861_1001602382 385
423 3300005834 Ga0068851_10001349 Ga0068851_1000134910 385
424 3300005834 Ga0068851_10087221 Ga0068851_100872211 385
425 3300005840 Ga0068870_10008908 Ga0068870_100089086 385
426 3300005840 Ga0068870_10016826 Ga0068870_100168263 385
427 3300005840 Ga0068870_10106359 Ga0068870_101063592 385
428 3300005840 Ga0068870_10117541 Ga0068870_101175412 385
429 3300005841 Ga0068863_100040897 Ga0068863_1000408971 385
430 3300005841 Ga0068863_100051490 Ga0068863_1000514904 385
431 3300005841 Ga0068863_100057234 Ga0068863_1000572343 385
432 3300005841 Ga0068863_100090628 Ga0068863_1000906282 385
433 3300005841 Ga0068863_100096791 Ga0068863_1000967914 385
434 3300005842 Ga0068858_100000936 Ga0068858_1000009366 385
435 3300005842 Ga0068858_100001799 Ga0068858_10000179919 385
436 3300005842 Ga0068858_100015891 Ga0068858_1000158914 385
437 3300005842 Ga0068858_100073047 Ga0068858_1000730473 385
438 3300005842 Ga0068858_100160385 Ga0068858_1001603853 385
439 3300005843 Ga0068860_100005079 Ga0068860_1000050799 385
440 3300005843 Ga0068860_100055316 Ga0068860_1000553162 385
441 3300005843 Ga0068860_100253711 Ga0068860_1002537112 385
442 3300005844 Ga0068862_100005682 Ga0068862_1000056824 385
443 3300005844 Ga0068862_100013649 Ga0068862_1000136492 385
444 3300005844 Ga0068862_100048752 Ga0068862_1000487522 385
445 3300005981 Ga0081538_10002434 Ga0081538_1000243412 385
446 3300005981 Ga0081538_10038698 Ga0081538_100386982 385
447 3300005985 Ga0081539_10011647 Ga0081539_100116475 385
448 3300006028 Ga0070717_10005576 Ga0070717_100055767 385
449 3300006163 Ga0070715_10007390 Ga0070715_100073905 385
450 3300006175 Ga0070712_100068090 Ga0070712_1000680903 385
451 3300006237 Ga0097621_100016314 Ga0097621_1000163146 385
452 3300006237 Ga0097621_100021031 Ga0097621_1000210313 385
453 3300006237 Ga0097621_100045565 Ga0097621_1000455653 385
454 3300006237 Ga0097621_100105628 Ga0097621_1001056283 385
455 3300006237 Ga0097621_100160476 Ga0097621_1001604763 385
456 3300006237 Ga0097621_100165215 Ga0097621_1001652152 385
457 3300006237 Ga0097621_100205692 Ga0097621_1002056922 385
458 3300006358 Ga0068871_100003991 Ga0068871_10000399113 385
459 3300006358 Ga0068871_100005158 Ga0068871_1000051589 385
460 3300006358 Ga0068871_100020821 Ga0068871_1000208214 385
461 3300006358 Ga0068871_100121511 Ga0068871_1001215112 385
462 3300006358 Ga0068871_100203430 Ga0068871_1002034302 385
463 3300006358 Ga0068871_100219035 Ga0068871_1002190352 385
464 3300006844 Ga0075428_100004047 Ga0075428_10000404711 385
465 3300006846 Ga0075430_100019910 Ga0075430_1000199106 385
466 3300006847 Ga0075431_100004172 Ga0075431_1000041724 385
467 3300006852 Ga0075433_10010717 Ga0075433_100107178 385
468 3300006871 Ga0075434_100007534 Ga0075434_1000075342 385
469 3300006880 Ga0075429_100004891 Ga0075429_1000048912 385
470 3300006880 Ga0075429_100071233 Ga0075429_1000712332 385
471 3300006881 Ga0068865_100029629 Ga0068865_1000296293 385
472 3300006914 Ga0075436_100061715 Ga0075436_1000617152 385
473 3300006914 Ga0075436_100067051 Ga0075436_1000670513 385
474 3300006931 Ga0097620_100001228 Ga0097620_10000122818 385
475 3300006931 Ga0097620_100005369 Ga0097620_10000536911 385
476 3300006931 Ga0097620_100071665 Ga0097620_1000716652 385
477 3300006931 Ga0097620_100122046 Ga0097620_1001220463 385
478 3300006931 Ga0097620_100137522 Ga0097620_1001375221 385
479 3300007076 Ga0075435_100116089 Ga0075435_1001160892 385
480 3300009093 Ga0105240_10014573 Ga0105240_100145737 385
481 3300009093 Ga0105240_10056095 Ga0105240_100560953 385
482 3300009094 Ga0111539_10029884 Ga0111539_100298843 385
483 3300009094 Ga0111539_10035170 Ga0111539_100351705 385
484 3300009094 Ga0111539_10276914 Ga0111539_102769142 385
485 3300009098 Ga0105245_10012365 Ga0105245_100123659 385
486 3300009098 Ga0105245_10078074 Ga0105245_100780743 385
487 3300009098 Ga0105245_10105489 Ga0105245_101054892 385
488 3300009147 Ga0114129_10057622 Ga0114129_100576226 385
489 3300009147 Ga0114129_10631570 Ga0114129_106315702 385
490 3300009174 Ga0105241_10009841 Ga0105241_100098413 385
491 3300009174 Ga0105241_10046734 Ga0105241_100467342 385
492 3300009174 Ga0105241_10213921 Ga0105241_102139212 385
493 3300009176 Ga0105242_10005171 Ga0105242_100051715 385
494 3300009177 Ga0105248_10280886 Ga0105248_102808862 385
495 3300009551 Ga0105238_10070957 Ga0105238_100709573 385
496 3300013104 Ga0157370_10001476 Ga0157370_1000147610 385
497 3300013104 Ga0157370_10113977 Ga0157370_101139772 385
498 3300013105 Ga0157369_10009381 Ga0157369_100093815 385
499 3300013296 Ga0157374_10151670 Ga0157374_101516703 385
500 3300013296 Ga0157374_10223434 Ga0157374_102234341 385
501 3300013306 Ga0163162_10009180 Ga0163162_100091809 385
502 3300013306 Ga0163162_10022421 Ga0163162_100224213 385
503 3300013306 Ga0163162_10066313 Ga0163162_100663133 385
504 3300013307 Ga0157372_10021026 Ga0157372_100210267 385
505 3300013307 Ga0157372_10077546 Ga0157372_100775463 385
506 3300013308 Ga0157375_10017406 Ga0157375_100174062 385
507 3300013308 Ga0157375_10061562 Ga0157375_100615625 385
508 3300013308 Ga0157375_10070871 Ga0157375_100708712 385
509 3300013308 Ga0157375_10250122 Ga0157375_102501222 385
510 3300013308 Ga0157375_10352751 Ga0157375_103527512 385
511 3300014325 Ga0163163_10018281 Ga0163163_100182814 385
512 3300014326 Ga0157380_10095999 Ga0157380_100959992 385
513 3300014969 Ga0157376_10009458 Ga0157376_100094582 385
514 3300014969 Ga0157376_10018283 Ga0157376_100182833 385
515 3300014969 Ga0157376_10048694 Ga0157376_100486945 385
516 3300014969 Ga0157376_10091163 Ga0157376_100911632 385
517 3300014969 Ga0157376_10374289 Ga0157376_103742891 385
518 3300017792 Ga0163161_10039411 Ga0163161_100394113 385
519 3300017792 Ga0163161_10117754 Ga0163161_101177543 385
520 3300017792 Ga0163161_10253178 Ga0163161_102531781 385
521 3300020070 Ga0206356_10748952 Ga0206356_107489522 385
522 3300020082 Ga0206353_10626947 Ga0206353_106269472 385
523 3300021361 Ga0213872_10021887 Ga0213872_100218873 385
524 3300025315 Ga0207697_10000878 Ga0207697_100008787 385
525 3300025315 Ga0207697_10020857 Ga0207697_100208573 385
526 3300025315 Ga0207697_10024842 Ga0207697_100248422 385
527 3300025321 Ga0207656_10002354 Ga0207656_100023544 385
528 3300025321 Ga0207656_10025355 Ga0207656_100253552 385
529 3300025893 Ga0207682_10000322 Ga0207682_100003228 385
530 3300025893 Ga0207682_10000734 Ga0207682_100007343 385
531 3300025898 Ga0207692_10042245 Ga0207692_100422452 385
532 3300025899 Ga0207642_10002655 Ga0207642_100026551 385
533 3300025900 Ga0207710_10031418 Ga0207710_100314182 385
534 3300025901 Ga0207688_10064844 Ga0207688_100648442 385
535 3300025901 Ga0207688_10129224 Ga0207688_101292242 385
536 3300025903 Ga0207680_10009052 Ga0207680_100090524 385
537 3300025903 Ga0207680_10014314 Ga0207680_100143143 385
538 3300025903 Ga0207680_10023983 Ga0207680_100239832 385
539 3300025905 Ga0207685_10015914 Ga0207685_100159142 385
540 3300025906 Ga0207699_10039273 Ga0207699_100392732 385
541 3300025907 Ga0207645_10000566 Ga0207645_1000056611 385
542 3300025907 Ga0207645_10003269 Ga0207645_100032692 385
543 3300025907 Ga0207645_10012049 Ga0207645_100120497 385
544 3300025907 Ga0207645_10051024 Ga0207645_100510242 385
545 3300025907 Ga0207645_10144351 Ga0207645_101443512 385
546 3300025908 Ga0207643_10000359 Ga0207643_1000035922 385
547 3300025908 Ga0207643_10005706 Ga0207643_100057063 385
548 3300025908 Ga0207643_10025602 Ga0207643_100256023 385
549 3300025908 Ga0207643_10100650 Ga0207643_101006502 385
550 3300025910 Ga0207684_10015827 Ga0207684_100158275 385
551 3300025910 Ga0207684_10096107 Ga0207684_100961073 385
552 3300025911 Ga0207654_10013783 Ga0207654_100137833 385
553 3300025911 Ga0207654_10024105 Ga0207654_100241055 385
554 3300025911 Ga0207654_10060487 Ga0207654_100604872 385
555 3300025912 Ga0207707_10014718 Ga0207707_100147182 385
556 3300025912 Ga0207707_10037315 Ga0207707_100373154 385
557 3300025912 Ga0207707_10267505 Ga0207707_102675052 385
558 3300025913 Ga0207695_10029551 Ga0207695_100295514 385
559 3300025913 Ga0207695_10033181 Ga0207695_100331813 385
560 3300025915 Ga0207693_10000254 Ga0207693_1000025418 385
561 3300025915 Ga0207693_10045324 Ga0207693_100453243 385
562 3300025916 Ga0207663_10009347 Ga0207663_100093473 385
563 3300025917 Ga0207660_10186308 Ga0207660_101863082 385
564 3300025917 Ga0207660_10216583 Ga0207660_102165832 385
565 3300025918 Ga0207662_10005657 Ga0207662_100056577 385
566 3300025918 Ga0207662_10010985 Ga0207662_100109852 385
567 3300025919 Ga0207657_10000894 Ga0207657_1000089423 385
568 3300025919 Ga0207657_10000910 Ga0207657_1000091028 385
569 3300025919 Ga0207657_10002586 Ga0207657_1000258621 385
570 3300025919 Ga0207657_10009641 Ga0207657_100096412 385
571 3300025919 Ga0207657_10010420 Ga0207657_100104206 385
572 3300025919 Ga0207657_10011936 Ga0207657_100119368 385
573 3300025920 Ga0207649_10008175 Ga0207649_100081752 385
574 3300025920 Ga0207649_10009735 Ga0207649_100097358 385
575 3300025920 Ga0207649_10240052 Ga0207649_102400521 385
576 3300025921 Ga0207652_10074683 Ga0207652_100746834 385
577 3300025921 Ga0207652_10232749 Ga0207652_102327492 385
578 3300025922 Ga0207646_10007355 Ga0207646_100073557 385
579 3300025922 Ga0207646_10183280 Ga0207646_101832802 385
580 3300025923 Ga0207681_10016931 Ga0207681_100169313 385
581 3300025923 Ga0207681_10026224 Ga0207681_100262243 385
582 3300025923 Ga0207681_10137157 Ga0207681_101371572 385
583 3300025925 Ga0207650_10006778 Ga0207650_100067781 385
584 3300025925 Ga0207650_10006791 Ga0207650_100067915 385
585 3300025925 Ga0207650_10038704 Ga0207650_100387042 385
586 3300025925 Ga0207650_10048127 Ga0207650_100481273 385
587 3300025925 Ga0207650_10052972 Ga0207650_100529722 385
588 3300025925 Ga0207650_10058189 Ga0207650_100581893 385
589 3300025925 Ga0207650_10060031 Ga0207650_100600313 385
590 3300025925 Ga0207650_10063538 Ga0207650_100635382 385
591 3300025925 Ga0207650_10295923 Ga0207650_102959231 385
592 3300025926 Ga0207659_10002162 Ga0207659_100021623 385
593 3300025926 Ga0207659_10009706 Ga0207659_100097064 385
594 3300025926 Ga0207659_10014831 Ga0207659_100148314 385
595 3300025926 Ga0207659_10021968 Ga0207659_100219682 385
596 3300025926 Ga0207659_10056197 Ga0207659_100561972 385
597 3300025927 Ga0207687_10002262 Ga0207687_1000226210 385
598 3300025927 Ga0207687_10002498 Ga0207687_100024989 385
599 3300025927 Ga0207687_10093060 Ga0207687_100930602 385
600 3300025927 Ga0207687_10107229 Ga0207687_101072293 385
601 3300025928 Ga0207700_10001192 Ga0207700_1000119212 385
602 3300025928 Ga0207700_10001526 Ga0207700_1000152611 385
603 3300025929 Ga0207664_10154994 Ga0207664_101549942 385
604 3300025931 Ga0207644_10002966 Ga0207644_100029668 385
605 3300025931 Ga0207644_10011226 Ga0207644_100112267 385
606 3300025931 Ga0207644_10015020 Ga0207644_100150202 385
607 3300025931 Ga0207644_10039113 Ga0207644_100391135 385
608 3300025931 Ga0207644_10056950 Ga0207644_100569501 385
609 3300025931 Ga0207644_10062939 Ga0207644_100629392 385
610 3300025931 Ga0207644_10286144 Ga0207644_102861442 385
611 3300025932 Ga0207690_10274384 Ga0207690_102743841 385
612 3300025933 Ga0207706_10000008 Ga0207706_1000000873 385
613 3300025933 Ga0207706_10000918 Ga0207706_1000091826 385
614 3300025933 Ga0207706_10015589 Ga0207706_100155893 385
615 3300025933 Ga0207706_10025205 Ga0207706_100252056 385
616 3300025933 Ga0207706_10094141 Ga0207706_100941413 385
617 3300025933 Ga0207706_10175242 Ga0207706_101752422 385
618 3300025934 Ga0207686_10000302 Ga0207686_100003027 385
619 3300025934 Ga0207686_10014352 Ga0207686_100143525 385
620 3300025936 Ga0207670_10021145 Ga0207670_100211451 385
621 3300025936 Ga0207670_10113586 Ga0207670_101135862 385
622 3300025936 Ga0207670_10118013 Ga0207670_101180133 385
623 3300025937 Ga0207669_10005372 Ga0207669_100053724 385
624 3300025937 Ga0207669_10030798 Ga0207669_100307982 385
625 3300025937 Ga0207669_10034968 Ga0207669_100349682 385
626 3300025937 Ga0207669_10102327 Ga0207669_101023272 385
627 3300025937 Ga0207669_10110195 Ga0207669_101101951 385
628 3300025937 Ga0207669_10134098 Ga0207669_101340982 385
629 3300025938 Ga0207704_10073401 Ga0207704_100734011 385
630 3300025938 Ga0207704_10113959 Ga0207704_101139592 385
631 3300025939 Ga0207665_10109588 Ga0207665_101095881 385
632 3300025940 Ga0207691_10000445 Ga0207691_1000044534 385
633 3300025940 Ga0207691_10001965 Ga0207691_1000196510 385
634 3300025940 Ga0207691_10005758 Ga0207691_100057587 385
635 3300025940 Ga0207691_10006969 Ga0207691_1000696911 385
636 3300025940 Ga0207691_10017602 Ga0207691_100176028 385
637 3300025940 Ga0207691_10017742 Ga0207691_100177426 385
638 3300025940 Ga0207691_10027487 Ga0207691_100274877 385
639 3300025940 Ga0207691_10192422 Ga0207691_101924222 385
640 3300025940 Ga0207691_10197646 Ga0207691_101976462 385
641 3300025940 Ga0207691_10201505 Ga0207691_102015052 385
642 3300025941 Ga0207711_10002349 Ga0207711_100023498 385
643 3300025941 Ga0207711_10059364 Ga0207711_100593642 385
644 3300025941 Ga0207711_10061594 Ga0207711_100615944 385
645 3300025941 Ga0207711_10065889 Ga0207711_100658891 385
646 3300025941 Ga0207711_10203801 Ga0207711_102038012 385
647 3300025942 Ga0207689_10000264 Ga0207689_1000026417 385
648 3300025942 Ga0207689_10001002 Ga0207689_1000100213 385
649 3300025942 Ga0207689_10018905 Ga0207689_100189055 385
650 3300025942 Ga0207689_10028106 Ga0207689_100281065 385
651 3300025944 Ga0207661_10026953 Ga0207661_100269531 385
652 3300025944 Ga0207661_10052101 Ga0207661_100521012 385
653 3300025944 Ga0207661_10084180 Ga0207661_100841802 385
654 3300025945 Ga0207679_10000934 Ga0207679_100009348 385
655 3300025945 Ga0207679_10125934 Ga0207679_101259342 385
656 3300025949 Ga0207667_10001326 Ga0207667_100013267 385
657 3300025949 Ga0207667_10025214 Ga0207667_100252146 385
658 3300025949 Ga0207667_10107719 Ga0207667_101077192 385
659 3300025960 Ga0207651_10001791 Ga0207651_100017914 385
660 3300025960 Ga0207651_10008798 Ga0207651_100087985 385
661 3300025960 Ga0207651_10089694 Ga0207651_100896941 385
662 3300025972 Ga0207668_10002952 Ga0207668_100029528 385
663 3300025972 Ga0207668_10006590 Ga0207668_100065904 385
664 3300025972 Ga0207668_10014807 Ga0207668_100148073 385
665 3300025972 Ga0207668_10025949 Ga0207668_100259492 385
666 3300025981 Ga0207640_10012816 Ga0207640_100128165 385
667 3300025981 Ga0207640_10027679 Ga0207640_100276793 385
668 3300025986 Ga0207658_10005406 Ga0207658_100054063 385
669 3300025986 Ga0207658_10010573 Ga0207658_100105732 385
670 3300025986 Ga0207658_10015102 Ga0207658_100151023 385
671 3300025986 Ga0207658_10054407 Ga0207658_100544072 385
672 3300025986 Ga0207658_10197228 Ga0207658_101972282 385
673 3300026023 Ga0207677_10001411 Ga0207677_100014113 385
674 3300026023 Ga0207677_10001899 Ga0207677_1000189913 385
675 3300026023 Ga0207677_10006672 Ga0207677_100066724 385
676 3300026023 Ga0207677_10022852 Ga0207677_100228525 385
677 3300026023 Ga0207677_10055131 Ga0207677_100551314 385
678 3300026035 Ga0207703_10001439 Ga0207703_1000143913 385
679 3300026035 Ga0207703_10010082 Ga0207703_100100827 385
680 3300026035 Ga0207703_10056104 Ga0207703_100561043 385
681 3300026035 Ga0207703_10272757 Ga0207703_102727572 385
682 3300026041 Ga0207639_10003226 Ga0207639_1000322611 385
683 3300026067 Ga0207678_10008479 Ga0207678_100084797 385
684 3300026067 Ga0207678_10013310 Ga0207678_100133105 385
685 3300026067 Ga0207678_10013688 Ga0207678_100136884 385
686 3300026067 Ga0207678_10101232 Ga0207678_101012322 385
687 3300026067 Ga0207678_10118446 Ga0207678_101184463 385
688 3300026075 Ga0207708_10000494 Ga0207708_1000049422 385
689 3300026078 Ga0207702_10000510 Ga0207702_100005109 385
690 3300026078 Ga0207702_10001951 Ga0207702_1000195120 385
691 3300026078 Ga0207702_10034707 Ga0207702_100347074 385
692 3300026078 Ga0207702_10279662 Ga0207702_102796621 385
693 3300026088 Ga0207641_10003409 Ga0207641_100034093 385
694 3300026088 Ga0207641_10005405 Ga0207641_100054058 385
695 3300026088 Ga0207641_10023223 Ga0207641_100232232 385
696 3300026088 Ga0207641_10034439 Ga0207641_100344394 385
697 3300026088 Ga0207641_10044364 Ga0207641_100443644 385
698 3300026088 Ga0207641_10045360 Ga0207641_100453603 385
699 3300026088 Ga0207641_10121886 Ga0207641_101218863 385
700 3300026088 Ga0207641_10146921 Ga0207641_101469212 385
701 3300026089 Ga0207648_10001616 Ga0207648_1000161617 385
702 3300026089 Ga0207648_10006120 Ga0207648_1000612010 385
703 3300026089 Ga0207648_10016567 Ga0207648_100165674 385
704 3300026089 Ga0207648_10022205 Ga0207648_100222052 385
705 3300026089 Ga0207648_10026787 Ga0207648_100267872 385
706 3300026089 Ga0207648_10074003 Ga0207648_100740033 385
707 3300026095 Ga0207676_10000470 Ga0207676_1000047016 385
708 3300026095 Ga0207676_10002657 Ga0207676_100026579 385
709 3300026095 Ga0207676_10004691 Ga0207676_100046917 385
710 3300026095 Ga0207676_10012094 Ga0207676_100120942 385
711 3300026095 Ga0207676_10024376 Ga0207676_100243764 385
712 3300026095 Ga0207676_10043251 Ga0207676_100432514 385
713 3300026095 Ga0207676_10046420 Ga0207676_100464202 385
714 3300026095 Ga0207676_10370113 Ga0207676_103701131 385
715 3300026116 Ga0207674_10000709 Ga0207674_1000070913 385
716 3300026116 Ga0207674_10002483 Ga0207674_100024833 385
717 3300026116 Ga0207674_10045502 Ga0207674_100455026 385
718 3300026118 Ga0207675_100001280 Ga0207675_10000128024 385
719 3300026118 Ga0207675_100002525 Ga0207675_10000252519 385
720 3300026118 Ga0207675_100015875 Ga0207675_1000158753 385
721 3300026118 Ga0207675_100035962 Ga0207675_1000359627 385
722 3300026121 Ga0207683_10000227 Ga0207683_1000022746 385
723 3300026121 Ga0207683_10000568 Ga0207683_1000056827 385
724 3300026121 Ga0207683_10001441 Ga0207683_1000144119 385
725 3300026121 Ga0207683_10006363 Ga0207683_1000636310 385
726 3300026121 Ga0207683_10010344 Ga0207683_100103447 385
727 3300026121 Ga0207683_10016063 Ga0207683_100160633 385
728 3300026121 Ga0207683_10040419 Ga0207683_100404195 385
729 3300026121 Ga0207683_10172623 Ga0207683_101726232 385
730 3300026121 Ga0207683_10173336 Ga0207683_101733361 385
731 3300026142 Ga0207698_10014880 Ga0207698_100148808 385
732 3300026142 Ga0207698_10024335 Ga0207698_100243353 385
733 3300026142 Ga0207698_10059367 Ga0207698_100593672 385
734 3300026142 Ga0207698_10093619 Ga0207698_100936193 385
735 3300026142 Ga0207698_10228156 Ga0207698_102281561 385
736 3300027360 Ga0209969_1000759 Ga0209969_10007595 385
737 3300027364 Ga0209967_1000554 Ga0209967_10005543 385
738 3300027378 Ga0209981_1006417 Ga0209981_10064172 385
739 3300027462 Ga0210000_1000619 Ga0210000_10006198 385
740 3300027471 Ga0209995_1005446 Ga0209995_10054463 385
741 3300027526 Ga0209968_1001892 Ga0209968_10018924 385
742 3300027543 Ga0209999_1005633 Ga0209999_10056332 385
743 3300027665 Ga0209983_1011015 Ga0209983_10110152 385
744 3300027682 Ga0209971_1001259 Ga0209971_10012592 385
745 3300027876 Ga0209974_10000194 Ga0209974_1000019410 385
746 3300027876 Ga0209974_10001758 Ga0209974_100017585 385
747 3300027876 Ga0209974_10012396 Ga0209974_100123962 385
748 3300027907 Ga0207428_10058156 Ga0207428_100581562 385
749 3300027907 Ga0207428_10079841 Ga0207428_100798413 385
750 3300028379 Ga0268266_10009978 Ga0268266_100099788 385
751 3300028379 Ga0268266_10041780 Ga0268266_100417803 385
752 3300028379 Ga0268266_10054328 Ga0268266_100543282 385
753 3300028379 Ga0268266_10069069 Ga0268266_100690691 385
754 3300028379 Ga0268266_10102809 Ga0268266_101028092 385
755 3300028380 Ga0268265_10004584 Ga0268265_100045846 385
756 3300028380 Ga0268265_10149434 Ga0268265_101494342 385
757 3300028380 Ga0268265_10217718 Ga0268265_102177182 385
758 3300028381 Ga0268264_10000702 Ga0268264_100007025 385
759 3300028381 Ga0268264_10020100 Ga0268264_100201004 385
760 3300028381 Ga0268264_10063126 Ga0268264_100631263 385
761 3300028381 Ga0268264_10128828 Ga0268264_101288283 385
762 3300028381 Ga0268264_10328243 Ga0268264_103282432 385
763 3300028577 Ga0265318_10006296 Ga0265318_100062965 385
764 3300028800 Ga0265338_10066764 Ga0265338_100667643 385
765 3300031238 Ga0265332_10000958 Ga0265332_1000095815 385
766 3300031238 Ga0265332_10001524 Ga0265332_1000152414 385
767 3300031239 Ga0265328_10007751 Ga0265328_100077516 385
768 3300031241 Ga0265325_10074544 Ga0265325_100745442 385
769 3300031242 Ga0265329_10003688 Ga0265329_100036884 385
770 3300031249 Ga0265339_10038895 Ga0265339_100388952 385
771 3300031250 Ga0265331_10002114 Ga0265331_100021149 385
772 3300031250 Ga0265331_10003801 Ga0265331_100038014 385
773 3300031344 Ga0265316_10026875 Ga0265316_100268754 385
774 3300031344 Ga0265316_10143199 Ga0265316_101431992 385
775 3300031548 Ga0307408_100040078 Ga0307408_1000400783 385
776 3300031548 Ga0307408_100097633 Ga0307408_1000976332 385
777 3300031711 Ga0265314_10000523 Ga0265314_1000052350 385
778 3300031711 Ga0265314_10015124 Ga0265314_100151242 385
779 3300031712 Ga0265342_10003160 Ga0265342_100031609 385
780 3300031727 Ga0316576_10199278 Ga0316576_101992782 385
781 3300031731 Ga0307405_10052570 Ga0307405_100525702 385
782 3300031824 Ga0307413_10058152 Ga0307413_100581523 385
783 3300031852 Ga0307410_10005780 Ga0307410_100057807 385
784 3300031901 Ga0307406_10033409 Ga0307406_100334092 385
785 3300031903 Ga0307407_10006689 Ga0307407_100066893 385
786 3300031911 Ga0307412_10019161 Ga0307412_100191613 385
787 3300031911 Ga0307412_10095129 Ga0307412_100951292 385
788 3300031995 Ga0307409_100153391 Ga0307409_1001533912 385
789 3300031995 Ga0307409_100274245 Ga0307409_1002742452 385
790 3300032002 Ga0307416_100018117 Ga0307416_1000181173 385
791 3300032002 Ga0307416_100029619 Ga0307416_1000296192 385
792 3300032004 Ga0307414_10177423 Ga0307414_101774232 385
793 3300032005 Ga0307411_10060228 Ga0307411_100602283 385
794 3300035086 Ga0373934_0003740 Ga0373934_0003740_420_1580 385
795 3300035086 Ga0373934_0011985 Ga0373934_0011985_195_1373 385
796 3300035111 Ga0373923_0001240 Ga0373923_0001240_33_1193 385
797 3300035117 Ga0373953_0005184 Ga0373953_0005184_459_1634 385
798 3300035118 Ga0373954_0018758 Ga0373954_0018758_743_1903 385
799 3300035119 Ga0373956_0002064 Ga0373956_0002064_6524_7684 385
800 3300035119 Ga0373956_0047177 Ga0373956_0047177_726_1886 385
801 3300035120 Ga0373957_0008533 Ga0373957_0008533_1573_2733 385
802 3300035120 Ga0373957_0091909 Ga0373957_0091909_17_1177 385
803 3300035170 Ga0373943_0027495 Ga0373943_0027495_736_1896 385
804 3300035172 Ga0373955_0001065 Ga0373955_0001065_2402_3562 385
805 3300035172 Ga0373955_0015582 Ga0373955_0015582_1577_2737 385
806 3300035172 Ga0373955_0042371 Ga0373955_0042371_414_1592 385
807 3300035172 Ga0373955_0042484 Ga0373955_0042484_340_1515 385
808 3300035398 Ga0316574_0020894 Ga0316574_0020894_2387_3547 385
809 3300035410 Ga0373924_0000941 Ga0373924_0000941_5663_6832 385
810 3300035410 Ga0373924_0034351 Ga0373924_0034351_701_1861 385
811 3300035691 Ga0373931_0096464 Ga0373931_0096464_318_1478 385
812 3300035692 Ga0373935_0073411 Ga0373935_0073411_338_1498 385
813 3300035724 Ga0373933_0004151 Ga0373933_0004151_6231_7391 385
814 3300035724 Ga0373933_0035109 Ga0373933_0035109_1184_2344 385
815 3300035724 Ga0373933_0115462 Ga0373933_0115462_384_1544 385
816 3300035725 Ga0373947_0018315 Ga0373947_0018315_1491_2651 385
817 3300036401 Ga0373937_0007447 Ga0373937_0007447_65_1225 385
818 3300036401 Ga0373937_0036403 Ga0373937_0036403_2198_3358 385
819 3300036401 Ga0373937_0157864 Ga0373937_0157864_353_1528 385
820 3300036401 Ga0373937_0223313 Ga0373937_0223313_27_1205 385
821 3300037068 Ga0373925_0040900 Ga0373925_0040900_1941_3101 385
822 3300037466 Ga0395898_0015812 Ga0395898_0015812_3365_4525 385
823 3300037466 Ga0395898_0029771 Ga0395898_0029771_863_2032 385
824 3300037466 Ga0395898_0154242 Ga0395898_0154242_83_1252 385
825 3300037471 Ga0395905_0180344 Ga0395905_0180344_151_1320 385
826 3300037853 Ga0436364_0314874 Ga0436364_0314874_17_1213 385
827 3300037853 Ga0436364_0351220 Ga0436364_0351220_321_1493 385
828 3300038443 Ga0395901_0090732 Ga0395901_0090732_1970_3139 385
829 3300039453 Ga0436362_0025995 Ga0436362_0025995_208_1434 385
830 3300042876 Ga0451577_0009071 Ga0451577_0009071_5959_7128 385
831 3300044656 Ga0466969_0001994 Ga0466969_0001994_6180_7385 385
832 3300044658 Ga0466972_0003545 Ga0466972_0003545_4388_5557 385
833 3300044684 Ga0466966_0026781 Ga0466966_0026781_703_1872 385
834 3300044693 Ga0466961_0028539 Ga0466961_0028539_1406_2611 385
835 3300044694 Ga0466963_0038709 Ga0466963_0038709_1326_2486 385
836 3300044706 Ga0466964_0006291 Ga0466964_0006291_2094_3263 385
837 3300044735 Ga0466968_0000683 Ga0466968_0000683_4415_5584 385
838 3300044735 Ga0466968_0004230 Ga0466968_0004230_2346_3551 385
839 3300044765 Ga0466970_0082030 Ga0466970_0082030_428_1597 385
840 3300044842 Ga0466957_0000089 Ga0466957_0000089_1394_2563 385
841 3300045049 Ga0466959_0001172 Ga0466959_0001172_11240_12445 385
842 3300045836 Ga0466958_0067726 Ga0466958_0067726_94_1263 385
843 3300046459 Ga0495629_0044725 Ga0495629_0044725_1556_2725 385
844 3300046459 Ga0495629_0048099 Ga0495629_0048099_257_1417 385
845 3300046460 Ga0495638_0003283 Ga0495638_0003283_6846_8015 385
846 3300046463 Ga0495653_0089891 Ga0495653_0089891_171_1340 385
847 3300046472 Ga0495580_0015198 Ga0495580_0015198_2929_4089 385
848 3300046472 Ga0495580_0025336 Ga0495580_0025336_2356_3516 385
849 3300046472 Ga0495580_0038330 Ga0495580_0038330_644_1804 385
850 3300046473 Ga0495582_0014890 Ga0495582_0014890_25_1185 385
851 3300046474 Ga0495605_0069680 Ga0495605_0069680_441_1610 385
852 3300046475 Ga0495639_0008512 Ga0495639_0008512_3216_4376 385
853 3300046491 Ga0495584_0012414 Ga0495584_0012414_1205_2374 385
854 3300046500 Ga0495596_0000832 Ga0495596_0000832_12906_14075 385
855 3300046507 Ga0495606_0007905 Ga0495606_0007905_224_1393 385
856 3300046507 Ga0495606_0010540 Ga0495606_0010540_372_1541 385
857 3300046516 Ga0495628_0063792 Ga0495628_0063792_1454_2614 385
858 3300046517 Ga0495630_0015707 Ga0495630_0015707_1782_2942 385
859 3300046518 Ga0495631_0003805 Ga0495631_0003805_1456_2625 385
860 3300046518 Ga0495631_0005592 Ga0495631_0005592_4272_5441 385
861 3300046518 Ga0495631_0013284 Ga0495631_0013284_1246_2415 385
862 3300046518 Ga0495631_0028611 Ga0495631_0028611_993_2162 385
863 3300046519 Ga0495632_0062788 Ga0495632_0062788_619_1788 385
864 3300046522 Ga0495643_0006316 Ga0495643_0006316_4905_6074 385
865 3300046522 Ga0495643_0037999 Ga0495643_0037999_1226_2395 385
866 3300046522 Ga0495643_0086339 Ga0495643_0086339_427_1596 385
867 3300046524 Ga0495648_0011365 Ga0495648_0011365_1034_2203 385
868 3300046528 Ga0495642_0007602 Ga0495642_0007602_1363_2532 385
869 3300046528 Ga0495642_0010765 Ga0495642_0010765_1540_2709 385
870 3300046531 Ga0495665_0004644 Ga0495665_0004644_1364_2524 385
871 3300046535 Ga0495586_0012052 Ga0495586_0012052_1687_2856 385
872 3300046536 Ga0495587_0110371 Ga0495587_0110371_318_1493 385
873 3300046538 Ga0495609_0016445 Ga0495609_0016445_1065_2234 385
874 3300046542 Ga0495597_0002251 Ga0495597_0002251_1206_2375 385
875 3300046557 Ga0495622_0002089 Ga0495622_0002089_5474_6643 385
876 3300046557 Ga0495622_0013911 Ga0495622_0013911_939_2108 385
877 3300046558 Ga0495633_0006886 Ga0495633_0006886_4520_5689 385
878 3300046558 Ga0495633_0009809 Ga0495633_0009809_3782_4951 385
879 3300046558 Ga0495633_0023642 Ga0495633_0023642_262_1431 385
880 3300046615 Ga0495656_0007411 Ga0495656_0007411_1217_2386 385
881 3300046616 Ga0495668_0003141 Ga0495668_0003141_2806_3975 385
882 3300046616 Ga0495668_0026664 Ga0495668_0026664_1119_2288 385
883 3300046616 Ga0495668_0030630 Ga0495668_0030630_972_2141 385
884 3300046616 Ga0495668_0048473 Ga0495668_0048473_775_1944 385
885 3300046642 Ga0495634_0124527 Ga0495634_0124527_174_1334 385
886 3300046648 Ga0495611_0003515 Ga0495611_0003515_3641_4810 385
887 3300046648 Ga0495611_0036614 Ga0495611_0036614_630_1799 385
888 3300046648 Ga0495611_0078038 Ga0495611_0078038_242_1411 385
889 3300046663 Ga0495635_0007180 Ga0495635_0007180_3030_4190 385
890 3300046663 Ga0495635_0048647 Ga0495635_0048647_1583_2743 385
891 3300046665 Ga0495661_0001133 Ga0495661_0001133_1113_2282 385
892 3300046665 Ga0495661_0075586 Ga0495661_0075586_508_1677 385
893 3300046674 Ga0495588_0018753 Ga0495588_0018753_961_2130 385
894 3300046679 Ga0495623_0009483 Ga0495623_0009483_861_2030 385
895 3300046679 Ga0495623_0026360 Ga0495623_0026360_2507_3667 385
896 3300046681 Ga0495647_0008562 Ga0495647_0008562_917_2077 385
897 3300046683 Ga0495658_0055595 Ga0495658_0055595_89_1258 385
898 3300046683 Ga0495658_0076122 Ga0495658_0076122_776_1936 385
899 3300046684 Ga0495669_0049879 Ga0495669_0049879_654_1823 385
900 3300046689 Ga0495613_0021121 Ga0495613_0021121_3336_4496 385
901 3300046690 Ga0495624_0000768 Ga0495624_0000768_62_1231 385
902 3300046691 Ga0495670_0005274 Ga0495670_0005274_869_2038 385
903 3300046691 Ga0495670_0026270 Ga0495670_0026270_491_1660 385
904 3300046692 Ga0495671_0030347 Ga0495671_0030347_777_1946 385
905 3300046694 Ga0495649_0001475 Ga0495649_0001475_9046_10215 385
906 3300046809 Ga0495600_0017922 Ga0495600_0017922_1090_2259 385
907 3300046809 Ga0495600_0046862 Ga0495600_0046862_107_1282 385
908 3300046809 Ga0495600_0122751 Ga0495600_0122751_40_1200 385
909 3300046810 Ga0495660_0051548 Ga0495660_0051548_669_1838 385
910 3300047315 Ga0495581_0009339 Ga0495581_0009339_594_1763 385
911 3300047315 Ga0495581_0044986 Ga0495581_0044986_973_2133 385
912 3300047319 Ga0495674_0016124 Ga0495674_0016124_1992_3161 385
913 3300047319 Ga0495674_0165371 Ga0495674_0165371_235_1395 385
914 3300047321 Ga0495676_0012310 Ga0495676_0012310_3371_4540 385
915 3300047321 Ga0495676_0017794 Ga0495676_0017794_4559_5728 385
916 3300047321 Ga0495676_0026748 Ga0495676_0026748_2824_3993 385
917 3300047321 Ga0495676_0152020 Ga0495676_0152020_152_1321 385
918 3300047322 Ga0495680_0012341 Ga0495680_0012341_494_1654 385
919 3300047443 Ga0495687_000060 Ga0495687_000060_65096_66265 385
920 3300047445 Ga0495677_0003018 Ga0495677_0003018_4410_5579 385
921 3300047445 Ga0495677_0012062 Ga0495677_0012062_1852_3021 385
922 3300047469 Ga0495673_0062981 Ga0495673_0062981_172_1341 385
923 3300047470 Ga0495681_0000005 Ga0495681_0000005_198660_199829 385
924 3300047470 Ga0495681_0008222 Ga0495681_0008222_903_2072 385
925 3300047470 Ga0495681_0015730 Ga0495681_0015730_1757_2926 385
926 3300047470 Ga0495681_0054108 Ga0495681_0054108_177_1346 385
927 3300047471 Ga0495684_0020175 Ga0495684_0020175_1616_2776 385
928 3300047471 Ga0495684_0046440 Ga0495684_0046440_1525_2685 385
929 3300047673 Ga0495593_0095932 Ga0495593_0095932_218_1387 385
930 3300048088 Ga0495602_0031584 Ga0495602_0031584_1924_3093 385
931 3300048089 Ga0495614_0083312 Ga0495614_0083312_146_1315 385
932 3300048091 Ga0495626_0008241 Ga0495626_0008241_263_1432 385
933 3300048091 Ga0495626_0008439 Ga0495626_0008439_2492_3661 385
934 3300048091 Ga0495626_0010810 Ga0495626_0010810_510_1679 385
935 3300048904 Ga0496101_0174015 Ga0496101_0174015_155_1315 385
936 3300048904 Ga0496101_0242092 Ga0496101_0242092_42_1202 385
937 3300048905 Ga0496102_0214595 Ga0496102_0214595_53_1213 385
938 3300048906 Ga0496103_0142093 Ga0496103_0142093_79_1248 385
939 3300048907 Ga0496104_0002357 Ga0496104_0002357_2029_3189 385
940 3300048908 Ga0496105_0019067 Ga0496105_0019067_3697_4857 385
941 3300048909 Ga0496106_0001067 Ga0496106_0001067_18757_19917 385
942 3300048909 Ga0496106_0104347 Ga0496106_0104347_941_2101 385
943 3300048910 Ga0496107_0009614 Ga0496107_0009614_292_1452 385
944 3300048910 Ga0496107_0131986 Ga0496107_0131986_431_1600 385
945 3300048911 Ga0496108_0054756 Ga0496108_0054756_207_1367 385
946 3300048911 Ga0496108_0106011 Ga0496108_0106011_649_1818 385
947 3300048911 Ga0496108_0106174 Ga0496108_0106174_756_1916 385
948 3300048913 Ga0496110_0033235 Ga0496110_0033235_1589_2758 385
949 3300048915 Ga0496112_0000755 Ga0496112_0000755_14758_15918 385
950 3300048915 Ga0496112_0066539 Ga0496112_0066539_1458_2618 385
951 3300048917 Ga0496114_0007967 Ga0496114_0007967_2633_3793 385
952 3300048917 Ga0496114_0076831 Ga0496114_0076831_293_1453 385
953 3300048918 Ga0496115_0151226 Ga0496115_0151226_194_1363 385
954 3300049571 Ga0501034_0129683 Ga0501034_0129683_45_1214 385
955 3300049574 Ga0501038_0073346 Ga0501038_0073346_939_2108 385
956 3300049575 Ga0501039_0137830 Ga0501039_0137830_115_1284 385
957 3300049578 Ga0501042_0168987 Ga0501042_0168987_342_1511 385
958 3300049580 Ga0501046_0032554 Ga0501046_0032554_1002_2171 385
959 3300049582 Ga0501048_0025493 Ga0501048_0025493_1229_2398 385
960 3300049585 Ga0501069_0023857 Ga0501069_0023857_1106_2275 385
961 3300049588 Ga0501072_0021818 Ga0501072_0021818_1877_3046 385
962 3300049592 Ga0501076_0003698 Ga0501076_0003698_3620_4789 385
963 3300049593 Ga0501077_0037063 Ga0501077_0037063_1094_2263 385
964 3300049741 Ga0501079_0020434 Ga0501079_0020434_1639_2808 385
965 3300049743 Ga0501081_0001457 Ga0501081_0001457_7337_8506 385
966 3300049823 Ga0501044_0101395 Ga0501044_0101395_1191_2351 385
967 3300050507 nmdc:mga05p37_48136_c2 nmdc:mga05p37_48136_c2_3587_4768 385
968 3300050507 nmdc:mga05p37_61459_c1 nmdc:mga05p37_61459_c1_432_1592 385
969 3300050509 nmdc:mga0qj67_173074_c1 nmdc:mga0qj67_173074_c1_347_1534 385
970 3300050509 nmdc:mga0qj67_47246_c1 nmdc:mga0qj67_47246_c1_800_1969 385
971 3300050510 nmdc:mga06r32_8310_c1 nmdc:mga06r32_8310_c1_1621_2790 385
972 3300050511 nmdc:mga08y16_221015_c1 nmdc:mga08y16_221015_c1_421_1590 385
973 3300050511 nmdc:mga08y16_29925_c1 nmdc:mga08y16_29925_c1_2721_3890 385
974 3300050511 nmdc:mga08y16_59193_c1 nmdc:mga08y16_59193_c1_722_1891 385
975 3300050514 nmdc:mga08x19_111334_c1 nmdc:mga08x19_111334_c1_624_1784 385
976 3300050514 nmdc:mga08x19_20153_c1 nmdc:mga08x19_20153_c1_2250_3410 385
977 3300050515 nmdc:mga0a205_4178_c1 nmdc:mga0a205_4178_c1_3989_5149 385
978 3300050515 nmdc:mga0a205_71885_c1 nmdc:mga0a205_71885_c1_386_1546 385
979 3300053085 Ga0495619_0007830 Ga0495619_0007830_5152_6312 385
980 3300053085 Ga0495619_0235971 Ga0495619_0235971_32_1207 385
981 3300054114 Ga0501084_0057188 Ga0501084_0057188_234_1403 385
982 iso_pu_bacteria 2511231002 2511242759 385
983 iso_pu_bacteria 2512047030 2512345957 385
984 iso_pu_bacteria 2513237150 2513952496 385
985 iso_pu_bacteria 2513237165 2514041626 385
986 iso_pu_bacteria 2515154122 2515684053 385
987 iso_pu_bacteria 2515154123 2515689306 385
988 iso_pu_bacteria 2515154189 2516018685 385
989 iso_pu_bacteria 2585428057 2587726639 385
990 iso_pu_bacteria 2585428058 2587733302 385
991 iso_pu_bacteria 2588253510 2588290900 385
992 iso_pu_bacteria 2599185292 2599904766 385
993 iso_pu_bacteria 2643221569 2643861309 385
994 iso_pu_bacteria 2643221592 2643968574 385
995 iso_pu_bacteria 2643221594 2643983092 385
996 iso_pu_bacteria 2643221621 2644120576 385
997 iso_pu_bacteria 2643221625 2644142897 385
998 iso_pu_bacteria 2643221648 2644275052 385
999 iso_pu_bacteria 2643221654 2644301462 385
1000 iso_pu_bacteria 2711768156 2712469910 385
1001 iso_pu_bacteria 2721755763 2723876951 385
1002 iso_pu_bacteria 2744054900 2746091203 385
1003 iso_pu_bacteria 2744054901 2746097636 385
1004 iso_pu_bacteria 2791355137 2792839419 385
1005 iso_pu_bacteria 2808606395 2809032861 385
1006 iso_pu_bacteria 2834641062 2834644249 385
1007 iso_pu_bacteria 2842324504 2842332292 385
1008 iso_pu_bacteria 2842348783 2842356537 385
1009 iso_pu_bacteria 2842454564 2842460871 385
1010 iso_pu_bacteria 2855730933 2855736562 385
1011 iso_pu_bacteria 2855767633 2855773499 385
1012 iso_pu_bacteria 2857537821 2857540671 385
1013 iso_pu_bacteria 2857542790 2857543454 385
1014 iso_pu_bacteria 2858950400 2858956312 385
1015 iso_pu_bacteria 2881412998 2881418506 385
1016 iso_pu_bacteria 2881927736 2881930680 385
1017 iso_pu_bacteria 2883087390 2883090215 385
1018 iso_pu_bacteria 2885192300 2885198050 385
1019 iso_pu_bacteria 2885270888 2885277959 385
1020 iso_pu_bacteria 2889790730 2889791972 385
1021 iso_pu_bacteria 2894772417 2894776130 385
1022 iso_pu_bacteria 2899275550 2899278936 385
1023 iso_pu_bacteria 2902682994 2902688414 385
1024 iso_pu_bacteria 2904449895 2904452146 385
1025 iso_pu_bacteria 2904456579 2904458708 385
1026 iso_pu_bacteria 2904615490 2904621609 385
1027 iso_pu_bacteria 2929520902 2929523317 385
1028 iso_pu_bacteria 2945972063 2945976041 385
1029 iso_pu_bacteria 2945984333 2945987415 385
1030 iso_pu_bacteria 2954767861 2954771231 385
1031 iso_pu_bacteria 644736347 644750889 385
1032 iso_pu_bacteria 8003400568 8003401958 385
1033 iso_pu_bacteria 8045864390 8045867027 385
1034 3300005347 Ga0070668_100074994 Ga0070668_1000749942 386
1035 3300005355 Ga0070671_100045096 Ga0070671_1000450964 386
1036 3300005548 Ga0070665_100053727 Ga0070665_1000537274 386
1037 3300005614 Ga0068856_100014426 Ga0068856_1000144264 386
1038 3300005841 Ga0068863_100096663 Ga0068863_1000966633 386
1039 3300005983 Ga0081540_1014864 Ga0081540_10148644 386
1040 3300006358 Ga0068871_100254005 Ga0068871_1002540051 386
1041 3300013296 Ga0157374_10197504 Ga0157374_101975042 386
1042 3300013297 Ga0157378_10006389 Ga0157378_1000638910 386
1043 3300013308 Ga0157375_10270500 Ga0157375_102705002 386
1044 3300014325 Ga0163163_10086471 Ga0163163_100864713 386
1045 3300025931 Ga0207644_10039942 Ga0207644_100399422 386
1046 3300025945 Ga0207679_10026399 Ga0207679_100263993 386
1047 3300025945 Ga0207679_10105695 Ga0207679_101056953 386
1048 3300025972 Ga0207668_10002718 Ga0207668_100027183 386
1049 3300026078 Ga0207702_10052132 Ga0207702_100521324 386
1050 3300026095 Ga0207676_10073349 Ga0207676_100733493 386
1051 3300026095 Ga0207676_10350331 Ga0207676_103503311 386
1052 3300026142 Ga0207698_10193180 Ga0207698_101931802 386
1053 3300028379 Ga0268266_10045694 Ga0268266_100456942 386
1054 3300028556 Ga0265337_1013649 Ga0265337_10136493 386
1055 3300028800 Ga0265338_10009967 Ga0265338_100099678 386
1056 3300031344 Ga0265316_10025070 Ga0265316_100250705 386
1057 3300031548 Ga0307408_100127701 Ga0307408_1001277012 386
1058 3300031852 Ga0307410_10138911 Ga0307410_101389112 386
1059 3300031903 Ga0307407_10004002 Ga0307407_100040027 386
1060 3300031995 Ga0307409_100018856 Ga0307409_1000188565 386
1061 3300032126 Ga0307415_100197221 Ga0307415_1001972212 386
1062 3300032126 Ga0307415_100235887 Ga0307415_1002358871 386
1063 3300035398 Ga0316574_0144681 Ga0316574_0144681_53_1225 386
1064 3300035692 Ga0373935_0050401 Ga0373935_0050401_507_1730 386
1065 3300036712 Ga0316584_0000192 Ga0316584_0000192_4398_5558 386
1066 3300037418 Ga0395900_0204678 Ga0395900_0204678_551_1723 386
1067 3300037466 Ga0395898_0127713 Ga0395898_0127713_321_1493 386
1068 3300048907 Ga0496104_0061783 Ga0496104_0061783_1022_2302 386
1069 3300048908 Ga0496105_0119224 Ga0496105_0119224_533_1813 386
1070 3300048911 Ga0496108_0012643 Ga0496108_0012643_856_2136 386
1071 3300048912 Ga0496109_0004300 Ga0496109_0004300_4260_5540 386
1072 3300048912 Ga0496109_0025515 Ga0496109_0025515_3299_4579 386
1073 3300048913 Ga0496110_0004061 Ga0496110_0004061_5749_7029 386
1074 3300048913 Ga0496110_0179084 Ga0496110_0179084_572_1852 386
1075 3300048914 Ga0496111_0002041 Ga0496111_0002041_4267_5547 386
1076 3300048914 Ga0496111_0175879 Ga0496111_0175879_267_1547 386
1077 3300048915 Ga0496112_0001355 Ga0496112_0001355_2157_3317 386
1078 3300048915 Ga0496112_0025394 Ga0496112_0025394_457_1737 386
1079 3300048916 Ga0496113_0013283 Ga0496113_0013283_1671_2951 386
1080 3300048916 Ga0496113_0068976 Ga0496113_0068976_1361_2641 386
1081 3300049571 Ga0501034_0116771 Ga0501034_0116771_85_1263 386
1082 3300049581 Ga0501047_0055369 Ga0501047_0055369_884_2062 386
1083 3300049585 Ga0501069_0020064 Ga0501069_0020064_299_1477 386
1084 3300049588 Ga0501072_0213969 Ga0501072_0213969_166_1332 386
1085 3300049742 Ga0501080_0059134 Ga0501080_0059134_2002_3180 386
1086 3300049823 Ga0501044_0129701 Ga0501044_0129701_94_1272 386
1087 3300050490 nmdc:mga03n38_41650_c1 nmdc:mga03n38_41650_c1_26_1240 386
1088 3300050494 nmdc:mga06z11_26354_c1 nmdc:mga06z11_26354_c1_1239_2453 386
1089 3300053108 Ga0500562_010957 Ga0500562_010957_225_1439 386
1090 3300054114 Ga0501084_0114557 Ga0501084_0114557_947_2125 386
1091 3300000546 LJNas_1001084 LJNas_10010842 387
1092 3300002704 JGI25155J39150_1000102 JGI25155J39150_100010238 387
1093 3300002705 JGI25156J39149_1000010 JGI25156J39149_1000010136 387
1094 3300002705 JGI25156J39149_1003941 JGI25156J39149_10039414 387
1095 3300002738 JGI25154J39366_1000027 JGI25154J39366_1000027136 387
1096 3300002741 JGI25157J39369_1000146 JGI25157J39369_100014630 387
1097 3300002773 JGI25152J39213_1001500 JGI25152J39213_10015009 387
1098 3300002987 JGI25159J45721_1004826 JGI25159J45721_10048263 387
1099 3300003187 JGI25151J46595_10000665 JGI25151J46595_1000066518 387
1100 3300003187 JGI25151J46595_10001147 JGI25151J46595_1000114714 387
1101 3300003187 JGI25151J46595_10001988 JGI25151J46595_100019888 387
1102 3300003187 JGI25151J46595_10006454 JGI25151J46595_100064546 387
1103 3300003187 JGI25151J46595_10037386 JGI25151J46595_100373862 387
1104 3300003203 JGI25406J46586_10000085 JGI25406J46586_1000008538 387
1105 3300003203 JGI25406J46586_10000963 JGI25406J46586_1000096310 387
1106 3300003215 JGI25153J46596_10001926 JGI25153J46596_1000192610 387
1107 3300003215 JGI25153J46596_10003713 JGI25153J46596_100037137 387
1108 3300003354 JGI25160J50197_1000129 JGI25160J50197_100012951 387
1109 3300003374 JGI25161J50226_1000080 JGI25161J50226_100008070 387
1110 3300003659 JGI25404J52841_10010033 JGI25404J52841_100100331 387
1111 3300003763 Ga0055529_1000955 Ga0055529_10009559 387
1112 3300003771 Ga0055526_1000392 Ga0055526_100039228 387
1113 3300003771 Ga0055526_1010926 Ga0055526_10109264 387
1114 3300003775 Ga0055524_1000120 Ga0055524_100012019 387
1115 3300003775 Ga0055524_1000220 Ga0055524_100022028 387
1116 3300003775 Ga0055524_1014910 Ga0055524_10149103 387
1117 3300003784 Ga0055534_1004574 Ga0055534_10045744 387
1118 3300003790 Ga0055528_1005152 Ga0055528_10051524 387
1119 3300003791 Ga0055530_10001496 Ga0055530_1000149615 387
1120 3300003792 Ga0055540_1000067 Ga0055540_100006749 387
1121 3300003792 Ga0055540_1000742 Ga0055540_100074215 387
1122 3300003794 Ga0055531_10001465 Ga0055531_1000146519 387
1123 3300004625 Ga0055543_1000782 Ga0055543_10007825 387
1124 3300005262 Ga0065165_1000089 Ga0065165_1000089123 387
1125 3300005262 Ga0065165_1003799 Ga0065165_10037993 387
1126 3300005262 Ga0065165_1010089 Ga0065165_10100893 387
1127 3300005288 Ga0065714_10096614 Ga0065714_100966142 387
1128 3300005295 Ga0065707_10005979 Ga0065707_100059793 387
1129 3300005327 Ga0070658_10033925 Ga0070658_100339252 387
1130 3300005328 Ga0070676_10035163 Ga0070676_100351633 387
1131 3300005328 Ga0070676_10053655 Ga0070676_100536552 387
1132 3300005328 Ga0070676_10091806 Ga0070676_100918063 387
1133 3300005330 Ga0070690_100000791 Ga0070690_10000079117 387
1134 3300005331 Ga0070670_100008102 Ga0070670_1000081022 387
1135 3300005331 Ga0070670_100012137 Ga0070670_1000121371 387
1136 3300005331 Ga0070670_100235863 Ga0070670_1002358632 387
1137 3300005333 Ga0070677_10023224 Ga0070677_100232242 387
1138 3300005333 Ga0070677_10096775 Ga0070677_100967751 387
1139 3300005334 Ga0068869_100001018 Ga0068869_1000010185 387
1140 3300005334 Ga0068869_100042720 Ga0068869_1000427203 387
1141 3300005334 Ga0068869_100055614 Ga0068869_1000556143 387
1142 3300005334 Ga0068869_100077594 Ga0068869_1000775941 387
1143 3300005335 Ga0070666_10028081 Ga0070666_100280813 387
1144 3300005335 Ga0070666_10036356 Ga0070666_100363563 387
1145 3300005336 Ga0070680_100009247 Ga0070680_1000092474 387
1146 3300005336 Ga0070680_100009721 Ga0070680_1000097214 387
1147 3300005336 Ga0070680_100018087 Ga0070680_1000180874 387
1148 3300005336 Ga0070680_100053041 Ga0070680_1000530412 387
1149 3300005336 Ga0070680_100061472 Ga0070680_1000614723 387
1150 3300005336 Ga0070680_100067178 Ga0070680_1000671783 387
1151 3300005336 Ga0070680_100081819 Ga0070680_1000818193 387
1152 3300005336 Ga0070680_100144337 Ga0070680_1001443373 387
1153 3300005337 Ga0070682_100013046 Ga0070682_1000130463 387
1154 3300005337 Ga0070682_100018870 Ga0070682_1000188703 387
1155 3300005338 Ga0068868_100001147 Ga0068868_10000114721 387
1156 3300005338 Ga0068868_100021806 Ga0068868_1000218065 387
1157 3300005338 Ga0068868_100099979 Ga0068868_1000999791 387
1158 3300005339 Ga0070660_100281948 Ga0070660_1002819481 387
1159 3300005340 Ga0070689_100036959 Ga0070689_1000369594 387
1160 3300005340 Ga0070689_100055599 Ga0070689_1000555992 387
1161 3300005341 Ga0070691_10008601 Ga0070691_100086012 387
1162 3300005341 Ga0070691_10011393 Ga0070691_100113934 387
1163 3300005341 Ga0070691_10068626 Ga0070691_100686262 387
1164 3300005343 Ga0070687_100000304 Ga0070687_1000003044 387
1165 3300005343 Ga0070687_100056866 Ga0070687_1000568662 387
1166 3300005344 Ga0070661_100002474 Ga0070661_10000247410 387
1167 3300005344 Ga0070661_100027259 Ga0070661_1000272593 387
1168 3300005345 Ga0070692_10003468 Ga0070692_100034683 387
1169 3300005345 Ga0070692_10003506 Ga0070692_100035068 387
1170 3300005347 Ga0070668_100002366 Ga0070668_1000023663 387
1171 3300005347 Ga0070668_100016884 Ga0070668_1000168842 387
1172 3300005347 Ga0070668_100025270 Ga0070668_1000252703 387
1173 3300005347 Ga0070668_100026967 Ga0070668_1000269674 387
1174 3300005353 Ga0070669_100047634 Ga0070669_1000476344 387
1175 3300005354 Ga0070675_100029663 Ga0070675_1000296633 387
1176 3300005354 Ga0070675_100054875 Ga0070675_1000548754 387
1177 3300005354 Ga0070675_100082426 Ga0070675_1000824262 387
1178 3300005354 Ga0070675_100197462 Ga0070675_1001974622 387
1179 3300005355 Ga0070671_100006434 Ga0070671_1000064347 387
1180 3300005355 Ga0070671_100009895 Ga0070671_1000098953 387
1181 3300005356 Ga0070674_100001631 Ga0070674_10000163111 387
1182 3300005356 Ga0070674_100012431 Ga0070674_1000124315 387
1183 3300005356 Ga0070674_100017576 Ga0070674_1000175763 387
1184 3300005356 Ga0070674_100049172 Ga0070674_1000491724 387
1185 3300005356 Ga0070674_100083748 Ga0070674_1000837482 387
1186 3300005364 Ga0070673_100055219 Ga0070673_1000552193 387
1187 3300005364 Ga0070673_100097997 Ga0070673_1000979973 387
1188 3300005366 Ga0070659_100026219 Ga0070659_1000262195 387
1189 3300005366 Ga0070659_100240271 Ga0070659_1002402712 387
1190 3300005367 Ga0070667_100002119 Ga0070667_1000021194 387
1191 3300005367 Ga0070667_100007593 Ga0070667_1000075935 387
1192 3300005367 Ga0070667_100013983 Ga0070667_1000139834 387
1193 3300005367 Ga0070667_100024190 Ga0070667_1000241903 387
1194 3300005367 Ga0070667_100052433 Ga0070667_1000524332 387
1195 3300005367 Ga0070667_100077023 Ga0070667_1000770233 387
1196 3300005367 Ga0070667_100097524 Ga0070667_1000975242 387
1197 3300005367 Ga0070667_100185192 Ga0070667_1001851922 387
1198 3300005434 Ga0070709_10060445 Ga0070709_100604453 387
1199 3300005435 Ga0070714_100006050 Ga0070714_1000060503 387
1200 3300005435 Ga0070714_100007950 Ga0070714_1000079505 387
1201 3300005435 Ga0070714_100030334 Ga0070714_1000303345 387
1202 3300005435 Ga0070714_100066445 Ga0070714_1000664453 387
1203 3300005435 Ga0070714_100154862 Ga0070714_1001548623 387
1204 3300005435 Ga0070714_100308075 Ga0070714_1003080752 387
1205 3300005436 Ga0070713_100003263 Ga0070713_1000032639 387
1206 3300005436 Ga0070713_100041234 Ga0070713_1000412344 387
1207 3300005436 Ga0070713_100181970 Ga0070713_1001819702 387
1208 3300005438 Ga0070701_10000171 Ga0070701_1000017116 387
1209 3300005440 Ga0070705_100000234 Ga0070705_1000002345 387
1210 3300005440 Ga0070705_100030916 Ga0070705_1000309163 387
1211 3300005440 Ga0070705_100179028 Ga0070705_1001790282 387
1212 3300005441 Ga0070700_100000396 Ga0070700_1000003962 387
1213 3300005441 Ga0070700_100003757 Ga0070700_1000037579 387
1214 3300005441 Ga0070700_100009762 Ga0070700_1000097622 387
1215 3300005444 Ga0070694_100000367 Ga0070694_1000003675 387
1216 3300005444 Ga0070694_100048846 Ga0070694_1000488462 387
1217 3300005444 Ga0070694_100141761 Ga0070694_1001417612 387
1218 3300005455 Ga0070663_100022478 Ga0070663_1000224784 387
1219 3300005456 Ga0070678_100004173 Ga0070678_1000041732 387
1220 3300005456 Ga0070678_100020420 Ga0070678_1000204203 387
1221 3300005456 Ga0070678_100073367 Ga0070678_1000733673 387
1222 3300005457 Ga0070662_100015884 Ga0070662_1000158844 387
1223 3300005457 Ga0070662_100018876 Ga0070662_1000188765 387
1224 3300005457 Ga0070662_100021232 Ga0070662_1000212325 387
1225 3300005457 Ga0070662_100033017 Ga0070662_1000330174 387
1226 3300005458 Ga0070681_10000270 Ga0070681_1000027018 387
1227 3300005458 Ga0070681_10004175 Ga0070681_100041759 387
1228 3300005458 Ga0070681_10018680 Ga0070681_100186805 387
1229 3300005459 Ga0068867_100001228 Ga0068867_10000122819 387
1230 3300005459 Ga0068867_100002868 Ga0068867_1000028685 387
1231 3300005459 Ga0068867_100006609 Ga0068867_1000066095 387
1232 3300005459 Ga0068867_100008399 Ga0068867_1000083992 387
1233 3300005459 Ga0068867_100014239 Ga0068867_1000142391 387
1234 3300005459 Ga0068867_100120473 Ga0068867_1001204732 387
1235 3300005459 Ga0068867_100257386 Ga0068867_1002573861 387
1236 3300005467 Ga0070706_100000916 Ga0070706_1000009163 387
1237 3300005468 Ga0070707_100054091 Ga0070707_1000540913 387
1238 3300005471 Ga0070698_100020280 Ga0070698_1000202801 387
1239 3300005471 Ga0070698_100085575 Ga0070698_1000855753 387
1240 3300005518 Ga0070699_100001364 Ga0070699_1000013646 387
1241 3300005518 Ga0070699_100027305 Ga0070699_1000273055 387
1242 3300005518 Ga0070699_100040940 Ga0070699_1000409403 387
1243 3300005530 Ga0070679_100003292 Ga0070679_1000032929 387
1244 3300005530 Ga0070679_100011541 Ga0070679_1000115415 387
1245 3300005530 Ga0070679_100016703 Ga0070679_1000167038 387
1246 3300005530 Ga0070679_100019099 Ga0070679_1000190994 387
1247 3300005530 Ga0070679_100026131 Ga0070679_1000261315 387
1248 3300005530 Ga0070679_100029306 Ga0070679_1000293065 387
1249 3300005530 Ga0070679_100059424 Ga0070679_1000594242 387
1250 3300005530 Ga0070679_100073882 Ga0070679_1000738824 387
1251 3300005530 Ga0070679_100169850 Ga0070679_1001698503 387
1252 3300005535 Ga0070684_100137869 Ga0070684_1001378692 387
1253 3300005536 Ga0070697_100074049 Ga0070697_1000740493 387
1254 3300005536 Ga0070697_100341772 Ga0070697_1003417721 387
1255 3300005539 Ga0068853_100001405 Ga0068853_1000014054 387
1256 3300005539 Ga0068853_100174994 Ga0068853_1001749942 387
1257 3300005543 Ga0070672_100010390 Ga0070672_1000103904 387
1258 3300005543 Ga0070672_100028301 Ga0070672_1000283014 387
1259 3300005543 Ga0070672_100033301 Ga0070672_1000333013 387
1260 3300005543 Ga0070672_100091418 Ga0070672_1000914183 387
1261 3300005544 Ga0070686_100000664 Ga0070686_1000006645 387
1262 3300005544 Ga0070686_100106129 Ga0070686_1001061291 387
1263 3300005545 Ga0070695_100000111 Ga0070695_10000011126 387
1264 3300005545 Ga0070695_100001361 Ga0070695_1000013616 387
1265 3300005545 Ga0070695_100011788 Ga0070695_1000117884 387
1266 3300005545 Ga0070695_100047364 Ga0070695_1000473643 387
1267 3300005545 Ga0070695_100065579 Ga0070695_1000655793 387
1268 3300005545 Ga0070695_100079680 Ga0070695_1000796803 387
1269 3300005546 Ga0070696_100000082 Ga0070696_10000008231 387
1270 3300005546 Ga0070696_100045224 Ga0070696_1000452241 387
1271 3300005547 Ga0070693_100000114 Ga0070693_10000011420 387
1272 3300005547 Ga0070693_100000865 Ga0070693_10000086510 387
1273 3300005547 Ga0070693_100001728 Ga0070693_1000017286 387
1274 3300005547 Ga0070693_100062816 Ga0070693_1000628162 387
1275 3300005548 Ga0070665_100016639 Ga0070665_1000166392 387
1276 3300005548 Ga0070665_100029771 Ga0070665_1000297714 387
1277 3300005548 Ga0070665_100099737 Ga0070665_1000997372 387
1278 3300005548 Ga0070665_100115672 Ga0070665_1001156722 387
1279 3300005548 Ga0070665_100128633 Ga0070665_1001286332 387
1280 3300005549 Ga0070704_100000018 Ga0070704_10000001835 387
1281 3300005549 Ga0070704_100001228 Ga0070704_1000012285 387
1282 3300005549 Ga0070704_100033699 Ga0070704_1000336995 387
1283 3300005549 Ga0070704_100280801 Ga0070704_1002808011 387
1284 3300005563 Ga0068855_100003278 Ga0068855_1000032786 387
1285 3300005563 Ga0068855_100005802 Ga0068855_1000058025 387
1286 3300005563 Ga0068855_100008462 Ga0068855_1000084622 387
1287 3300005563 Ga0068855_100015031 Ga0068855_1000150316 387
1288 3300005563 Ga0068855_100071639 Ga0068855_1000716392 387
1289 3300005563 Ga0068855_100102704 Ga0068855_1001027043 387
1290 3300005563 Ga0068855_100109076 Ga0068855_1001090764 387
1291 3300005563 Ga0068855_100213025 Ga0068855_1002130252 387
1292 3300005563 Ga0068855_100304165 Ga0068855_1003041651 387
1293 3300005563 Ga0068855_100313391 Ga0068855_1003133912 387
1294 3300005564 Ga0070664_100025255 Ga0070664_1000252552 387
1295 3300005578 Ga0068854_100001530 Ga0068854_10000153012 387
1296 3300005578 Ga0068854_100113346 Ga0068854_1001133462 387
1297 3300005578 Ga0068854_100197974 Ga0068854_1001979742 387
1298 3300005614 Ga0068856_100028421 Ga0068856_1000284215 387
1299 3300005615 Ga0070702_100000345 Ga0070702_1000003453 387
1300 3300005616 Ga0068852_100003212 Ga0068852_1000032128 387
1301 3300005616 Ga0068852_100020157 Ga0068852_1000201575 387
1302 3300005616 Ga0068852_100031859 Ga0068852_1000318593 387
1303 3300005616 Ga0068852_100048828 Ga0068852_1000488283 387
1304 3300005616 Ga0068852_100101955 Ga0068852_1001019551 387
1305 3300005616 Ga0068852_100179663 Ga0068852_1001796632 387
1306 3300005616 Ga0068852_100282870 Ga0068852_1002828702 387
1307 3300005617 Ga0068859_100000050 Ga0068859_10000005044 387
1308 3300005617 Ga0068859_100001261 Ga0068859_1000012615 387
1309 3300005617 Ga0068859_100020233 Ga0068859_1000202339 387
1310 3300005617 Ga0068859_100039506 Ga0068859_1000395064 387
1311 3300005617 Ga0068859_100137103 Ga0068859_1001371033 387
1312 3300005617 Ga0068859_100166988 Ga0068859_1001669883 387
1313 3300005617 Ga0068859_100242045 Ga0068859_1002420453 387
1314 3300005618 Ga0068864_100123793 Ga0068864_1001237933 387
1315 3300005618 Ga0068864_100140665 Ga0068864_1001406652 387
1316 3300005618 Ga0068864_100141225 Ga0068864_1001412253 387
1317 3300005718 Ga0068866_10000156 Ga0068866_1000015625 387
1318 3300005719 Ga0068861_100001057 Ga0068861_10000105717 387
1319 3300005719 Ga0068861_100009536 Ga0068861_1000095364 387
1320 3300005719 Ga0068861_100057676 Ga0068861_1000576763 387
1321 3300005719 Ga0068861_100078478 Ga0068861_1000784783 387
1322 3300005719 Ga0068861_100211799 Ga0068861_1002117992 387
1323 3300005834 Ga0068851_10000414 Ga0068851_1000041412 387
1324 3300005841 Ga0068863_100001068 Ga0068863_10000106820 387
1325 3300005841 Ga0068863_100025983 Ga0068863_1000259832 387
1326 3300005841 Ga0068863_100051003 Ga0068863_1000510031 387
1327 3300005841 Ga0068863_100143699 Ga0068863_1001436992 387
1328 3300005842 Ga0068858_100000509 Ga0068858_1000005095 387
1329 3300005842 Ga0068858_100000908 Ga0068858_1000009083 387
1330 3300005842 Ga0068858_100003300 Ga0068858_10000330017 387
1331 3300005842 Ga0068858_100004438 Ga0068858_10000443814 387
1332 3300005842 Ga0068858_100202702 Ga0068858_1002027022 387
1333 3300005843 Ga0068860_100000654 Ga0068860_10000065416 387
1334 3300005843 Ga0068860_100002554 Ga0068860_10000255421 387
1335 3300005843 Ga0068860_100013086 Ga0068860_1000130864 387
1336 3300005843 Ga0068860_100029150 Ga0068860_1000291504 387
1337 3300005843 Ga0068860_100132929 Ga0068860_1001329291 387
1338 3300005843 Ga0068860_100319516 Ga0068860_1003195162 387
1339 3300005844 Ga0068862_100002561 Ga0068862_1000025613 387
1340 3300005844 Ga0068862_100090908 Ga0068862_1000909082 387
1341 3300005983 Ga0081540_1000034 Ga0081540_100003424 387
1342 3300005983 Ga0081540_1000233 Ga0081540_100023326 387
1343 3300005983 Ga0081540_1044763 Ga0081540_10447632 387
1344 3300005985 Ga0081539_10000003 Ga0081539_100000039 387
1345 3300005985 Ga0081539_10000226 Ga0081539_1000022661 387
1346 3300005985 Ga0081539_10000350 Ga0081539_1000035039 387
1347 3300005985 Ga0081539_10046218 Ga0081539_100462182 387
1348 3300006038 Ga0075365_10006017 Ga0075365_100060175 387
1349 3300006038 Ga0075365_10021391 Ga0075365_100213914 387
1350 3300006038 Ga0075365_10021774 Ga0075365_100217741 387
1351 3300006048 Ga0075363_100003654 Ga0075363_1000036548 387
1352 3300006048 Ga0075363_100014909 Ga0075363_1000149093 387
1353 3300006048 Ga0075363_100047677 Ga0075363_1000476772 387
1354 3300006051 Ga0075364_10011203 Ga0075364_100112037 387
1355 3300006051 Ga0075364_10073250 Ga0075364_100732503 387
1356 3300006177 Ga0075362_10004553 Ga0075362_100045535 387
1357 3300006177 Ga0075362_10006498 Ga0075362_100064983 387
1358 3300006177 Ga0075362_10013784 Ga0075362_100137844 387
1359 3300006178 Ga0075367_10002211 Ga0075367_100022114 387
1360 3300006178 Ga0075367_10010754 Ga0075367_100107545 387
1361 3300006178 Ga0075367_10020194 Ga0075367_100201943 387
1362 3300006178 Ga0075367_10046150 Ga0075367_100461503 387
1363 3300006178 Ga0075367_10155512 Ga0075367_101555122 387
1364 3300006186 Ga0075369_10003214 Ga0075369_100032143 387
1365 3300006186 Ga0075369_10005977 Ga0075369_100059772 387
1366 3300006186 Ga0075369_10021320 Ga0075369_100213203 387
1367 3300006195 Ga0075366_10000889 Ga0075366_1000088910 387
1368 3300006195 Ga0075366_10004299 Ga0075366_100042993 387
1369 3300006195 Ga0075366_10005946 Ga0075366_100059467 387
1370 3300006195 Ga0075366_10010089 Ga0075366_100100893 387
1371 3300006195 Ga0075366_10017173 Ga0075366_100171734 387
1372 3300006195 Ga0075366_10034969 Ga0075366_100349692 387
1373 3300006195 Ga0075366_10067248 Ga0075366_100672481 387
1374 3300006195 Ga0075366_10123704 Ga0075366_101237042 387
1375 3300006237 Ga0097621_100005385 Ga0097621_1000053852 387
1376 3300006353 Ga0075370_10000260 Ga0075370_1000026016 387
1377 3300006353 Ga0075370_10003339 Ga0075370_100033393 387
1378 3300006353 Ga0075370_10004894 Ga0075370_100048943 387
1379 3300006353 Ga0075370_10020321 Ga0075370_100203213 387
1380 3300006353 Ga0075370_10043805 Ga0075370_100438052 387
1381 3300006358 Ga0068871_100002592 Ga0068871_1000025929 387
1382 3300006358 Ga0068871_100014718 Ga0068871_1000147184 387
1383 3300006358 Ga0068871_100044435 Ga0068871_1000444354 387
1384 3300006358 Ga0068871_100044872 Ga0068871_1000448724 387
1385 3300006358 Ga0068871_100165706 Ga0068871_1001657062 387
1386 3300006844 Ga0075428_100001234 Ga0075428_10000123422 387
1387 3300006844 Ga0075428_100007549 Ga0075428_1000075496 387
1388 3300006844 Ga0075428_100022830 Ga0075428_1000228306 387
1389 3300006844 Ga0075428_100025082 Ga0075428_1000250823 387
1390 3300006844 Ga0075428_100036509 Ga0075428_1000365093 387
1391 3300006844 Ga0075428_100044680 Ga0075428_1000446806 387
1392 3300006844 Ga0075428_100073981 Ga0075428_1000739812 387
1393 3300006844 Ga0075428_100178975 Ga0075428_1001789753 387
1394 3300006844 Ga0075428_100208739 Ga0075428_1002087392 387
1395 3300006846 Ga0075430_100103452 Ga0075430_1001034521 387
1396 3300006846 Ga0075430_100134215 Ga0075430_1001342152 387
1397 3300006847 Ga0075431_100005968 Ga0075431_1000059686 387
1398 3300006847 Ga0075431_100028493 Ga0075431_1000284935 387
1399 3300006847 Ga0075431_100061865 Ga0075431_1000618653 387
1400 3300006847 Ga0075431_100083839 Ga0075431_1000838393 387
1401 3300006847 Ga0075431_100115980 Ga0075431_1001159803 387
1402 3300006852 Ga0075433_10005257 Ga0075433_100052574 387
1403 3300006852 Ga0075433_10015526 Ga0075433_100155268 387
1404 3300006852 Ga0075433_10053925 Ga0075433_100539254 387
1405 3300006852 Ga0075433_10089679 Ga0075433_100896793 387
1406 3300006852 Ga0075433_10302772 Ga0075433_103027722 387
1407 3300006871 Ga0075434_100000358 Ga0075434_10000035825 387
1408 3300006871 Ga0075434_100001872 Ga0075434_10000187214 387
1409 3300006871 Ga0075434_100008875 Ga0075434_1000088756 387
1410 3300006871 Ga0075434_100038634 Ga0075434_1000386342 387
1411 3300006871 Ga0075434_100199420 Ga0075434_1001994202 387
1412 3300006880 Ga0075429_100004465 Ga0075429_1000044656 387
1413 3300006880 Ga0075429_100005055 Ga0075429_10000505511 387
1414 3300006880 Ga0075429_100020573 Ga0075429_1000205736 387
1415 3300006880 Ga0075429_100249503 Ga0075429_1002495032 387
1416 3300006881 Ga0068865_100000555 Ga0068865_1000005555 387
1417 3300006914 Ga0075436_100000499 Ga0075436_10000049924 387
1418 3300006914 Ga0075436_100001270 Ga0075436_1000012708 387
1419 3300006914 Ga0075436_100001595 Ga0075436_10000159514 387
1420 3300006914 Ga0075436_100007515 Ga0075436_1000075156 387
1421 3300006914 Ga0075436_100012218 Ga0075436_1000122183 387
1422 3300006914 Ga0075436_100033467 Ga0075436_1000334675 387
1423 3300006914 Ga0075436_100040430 Ga0075436_1000404303 387
1424 3300006914 Ga0075436_100083387 Ga0075436_1000833873 387
1425 3300006931 Ga0097620_100000050 Ga0097620_10000005044 387
1426 3300006931 Ga0097620_100001261 Ga0097620_1000012615 387
1427 3300006931 Ga0097620_100020233 Ga0097620_1000202339 387
1428 3300006931 Ga0097620_100039503 Ga0097620_1000395034 387
1429 3300006931 Ga0097620_100137100 Ga0097620_1001371002 387
1430 3300006931 Ga0097620_100166992 Ga0097620_1001669923 387
1431 3300006931 Ga0097620_100242050 Ga0097620_1002420502 387
1432 3300006948 Ga0099826_10101113 Ga0099826_101011132 387
1433 3300007076 Ga0075435_100000518 Ga0075435_1000005183 387
1434 3300007076 Ga0075435_100000614 Ga0075435_1000006147 387
1435 3300007076 Ga0075435_100005567 Ga0075435_1000055673 387
1436 3300007076 Ga0075435_100005891 Ga0075435_1000058914 387
1437 3300007076 Ga0075435_100020348 Ga0075435_1000203483 387
1438 3300007076 Ga0075435_100124014 Ga0075435_1001240141 387
1439 3300007265 Ga0099794_10045989 Ga0099794_100459892 387
1440 3300007265 Ga0099794_10093076 Ga0099794_100930761 387
1441 3300007788 Ga0099795_10011102 Ga0099795_100111021 387
1442 3300009011 Ga0105251_10008986 Ga0105251_100089863 387
1443 3300009036 Ga0105244_10002330 Ga0105244_1000233010 387
1444 3300009092 Ga0105250_10013698 Ga0105250_100136982 387
1445 3300009092 Ga0105250_10033246 Ga0105250_100332463 387
1446 3300009093 Ga0105240_10002253 Ga0105240_1000225319 387
1447 3300009093 Ga0105240_10002277 Ga0105240_1000227723 387
1448 3300009093 Ga0105240_10002317 Ga0105240_100023177 387
1449 3300009093 Ga0105240_10020031 Ga0105240_100200318 387
1450 3300009093 Ga0105240_10057621 Ga0105240_100576214 387
1451 3300009093 Ga0105240_10108454 Ga0105240_101084544 387
1452 3300009093 Ga0105240_10146957 Ga0105240_101469574 387
1453 3300009093 Ga0105240_10173518 Ga0105240_101735182 387
1454 3300009093 Ga0105240_10224480 Ga0105240_102244802 387
1455 3300009094 Ga0111539_10000774 Ga0111539_1000077414 387
1456 3300009094 Ga0111539_10004948 Ga0111539_1000494817 387
1457 3300009094 Ga0111539_10009844 Ga0111539_100098449 387
1458 3300009094 Ga0111539_10012218 Ga0111539_100122185 387
1459 3300009094 Ga0111539_10019536 Ga0111539_100195369 387
1460 3300009094 Ga0111539_10025598 Ga0111539_1002559810 387
1461 3300009094 Ga0111539_10027603 Ga0111539_1002760310 387
1462 3300009094 Ga0111539_10048101 Ga0111539_100481013 387
1463 3300009094 Ga0111539_10077382 Ga0111539_100773823 387
1464 3300009094 Ga0111539_10283886 Ga0111539_102838862 387
1465 3300009098 Ga0105245_10006058 Ga0105245_100060583 387
1466 3300009098 Ga0105245_10006192 Ga0105245_100061925 387
1467 3300009098 Ga0105245_10018143 Ga0105245_100181435 387
1468 3300009098 Ga0105245_10018998 Ga0105245_100189983 387
1469 3300009098 Ga0105245_10047958 Ga0105245_100479584 387
1470 3300009101 Ga0105247_10000096 Ga0105247_1000009635 387
1471 3300009101 Ga0105247_10007792 Ga0105247_100077922 387
1472 3300009101 Ga0105247_10026353 Ga0105247_100263533 387
1473 3300009147 Ga0114129_10012508 Ga0114129_100125089 387
1474 3300009147 Ga0114129_10076783 Ga0114129_100767834 387
1475 3300009147 Ga0114129_10244767 Ga0114129_102447673 387
1476 3300009148 Ga0105243_10002682 Ga0105243_1000268214 387
1477 3300009148 Ga0105243_10092325 Ga0105243_100923252 387
1478 3300009148 Ga0105243_10150520 Ga0105243_101505202 387
1479 3300009174 Ga0105241_10009644 Ga0105241_100096442 387
1480 3300009174 Ga0105241_10014428 Ga0105241_100144283 387
1481 3300009176 Ga0105242_10000987 Ga0105242_100009873 387
1482 3300009176 Ga0105242_10004690 Ga0105242_100046909 387
1483 3300009176 Ga0105242_10155246 Ga0105242_101552463 387
1484 3300009177 Ga0105248_10005713 Ga0105248_100057138 387
1485 3300009177 Ga0105248_10018063 Ga0105248_100180639 387
1486 3300009177 Ga0105248_10019213 Ga0105248_1001921311 387
1487 3300009177 Ga0105248_10029722 Ga0105248_100297224 387
1488 3300009177 Ga0105248_10046801 Ga0105248_100468011 387
1489 3300009177 Ga0105248_10115806 Ga0105248_101158063 387
1490 3300009177 Ga0105248_10444987 Ga0105248_104449871 387
1491 3300009545 Ga0105237_10013426 Ga0105237_100134264 387
1492 3300009545 Ga0105237_10057451 Ga0105237_100574512 387
1493 3300009545 Ga0105237_10078653 Ga0105237_100786533 387
1494 3300009545 Ga0105237_10148920 Ga0105237_101489202 387
1495 3300009551 Ga0105238_10035651 Ga0105238_100356512 387
1496 3300009551 Ga0105238_10101306 Ga0105238_101013062 387
1497 3300009551 Ga0105238_10109205 Ga0105238_101092053 387
1498 3300009551 Ga0105238_10137593 Ga0105238_101375932 387
1499 3300009553 Ga0105249_10008399 Ga0105249_100083995 387
1500 3300009553 Ga0105249_10031945 Ga0105249_100319452 387
1501 3300010375 Ga0105239_10037192 Ga0105239_100371924 387
1502 3300010375 Ga0105239_10072852 Ga0105239_100728522 387
1503 3300010375 Ga0105239_10106209 Ga0105239_101062092 387
1504 3300010375 Ga0105239_10392130 Ga0105239_103921302 387
1505 3300011119 Ga0105246_10021584 Ga0105246_100215844 387
1506 3300013100 Ga0157373_10001619 Ga0157373_1000161915 387
1507 3300013100 Ga0157373_10002312 Ga0157373_100023125 387
1508 3300013100 Ga0157373_10013368 Ga0157373_100133686 387
1509 3300013100 Ga0157373_10027369 Ga0157373_100273694 387
1510 3300013100 Ga0157373_10057905 Ga0157373_100579053 387
1511 3300013102 Ga0157371_10000248 Ga0157371_1000024820 387
1512 3300013102 Ga0157371_10059206 Ga0157371_100592062 387
1513 3300013102 Ga0157371_10072086 Ga0157371_100720862 387
1514 3300013102 Ga0157371_10113325 Ga0157371_101133252 387
1515 3300013104 Ga0157370_10002793 Ga0157370_100027932 387
1516 3300013104 Ga0157370_10017634 Ga0157370_100176343 387
1517 3300013104 Ga0157370_10046551 Ga0157370_100465514 387
1518 3300013104 Ga0157370_10058497 Ga0157370_100584973 387
1519 3300013104 Ga0157370_10090644 Ga0157370_100906443 387
1520 3300013104 Ga0157370_10251043 Ga0157370_102510431 387
1521 3300013104 Ga0157370_10279892 Ga0157370_102798922 387
1522 3300013105 Ga0157369_10002433 Ga0157369_100024333 387
1523 3300013105 Ga0157369_10017645 Ga0157369_100176454 387
1524 3300013105 Ga0157369_10028282 Ga0157369_100282824 387
1525 3300013105 Ga0157369_10068958 Ga0157369_100689582 387
1526 3300013105 Ga0157369_10442469 Ga0157369_104424691 387
1527 3300013296 Ga0157374_10000383 Ga0157374_1000038325 387
1528 3300013296 Ga0157374_10140746 Ga0157374_101407463 387
1529 3300013297 Ga0157378_10001843 Ga0157378_100018433 387
1530 3300013297 Ga0157378_10013081 Ga0157378_100130814 387
1531 3300013297 Ga0157378_10164146 Ga0157378_101641463 387
1532 3300013306 Ga0163162_10014658 Ga0163162_1001465810 387
1533 3300013306 Ga0163162_10028063 Ga0163162_100280635 387
1534 3300013306 Ga0163162_10073237 Ga0163162_100732374 387
1535 3300013306 Ga0163162_10092342 Ga0163162_100923423 387
1536 3300013306 Ga0163162_10099059 Ga0163162_100990593 387
1537 3300013306 Ga0163162_10286032 Ga0163162_102860322 387
1538 3300013307 Ga0157372_10002272 Ga0157372_1000227218 387
1539 3300013307 Ga0157372_10007773 Ga0157372_100077733 387
1540 3300013307 Ga0157372_10010528 Ga0157372_100105282 387
1541 3300013307 Ga0157372_10025906 Ga0157372_100259065 387
1542 3300013307 Ga0157372_10076391 Ga0157372_100763914 387
1543 3300013307 Ga0157372_10103094 Ga0157372_101030944 387
1544 3300013308 Ga0157375_10002420 Ga0157375_1000242011 387
1545 3300013308 Ga0157375_10010965 Ga0157375_100109652 387
1546 3300013308 Ga0157375_10015344 Ga0157375_100153445 387
1547 3300013308 Ga0157375_10082273 Ga0157375_100822733 387
1548 3300013308 Ga0157375_10124072 Ga0157375_101240724 387
1549 3300013308 Ga0157375_10425083 Ga0157375_104250831 387
1550 3300014325 Ga0163163_10002007 Ga0163163_1000200712 387
1551 3300014325 Ga0163163_10018338 Ga0163163_100183382 387
1552 3300014325 Ga0163163_10054333 Ga0163163_100543335 387
1553 3300014325 Ga0163163_10146952 Ga0163163_101469522 387
1554 3300014745 Ga0157377_10007961 Ga0157377_100079612 387
1555 3300014745 Ga0157377_10147190 Ga0157377_101471902 387
1556 3300014968 Ga0157379_10000112 Ga0157379_1000011226 387
1557 3300014968 Ga0157379_10002542 Ga0157379_1000254211 387
1558 3300014968 Ga0157379_10003708 Ga0157379_100037085 387
1559 3300014968 Ga0157379_10017141 Ga0157379_100171415 387
1560 3300014968 Ga0157379_10064873 Ga0157379_100648734 387
1561 3300014968 Ga0157379_10098574 Ga0157379_100985742 387
1562 3300014969 Ga0157376_10002564 Ga0157376_100025645 387
1563 3300014969 Ga0157376_10003872 Ga0157376_100038725 387
1564 3300014969 Ga0157376_10006926 Ga0157376_1000692612 387
1565 3300014969 Ga0157376_10058385 Ga0157376_100583854 387
1566 3300014969 Ga0157376_10168401 Ga0157376_101684013 387
1567 3300016635 Ga0183361_10020 Ga0183361_1002019 387
1568 3300017792 Ga0163161_10231188 Ga0163161_102311882 387
1569 3300017792 Ga0163161_10276995 Ga0163161_102769951 387
1570 3300021377 Ga0213874_10032583 Ga0213874_100325832 387
1571 3300021388 Ga0213875_10001830 Ga0213875_100018305 387
1572 3300025206 Ga0209435_100003 Ga0209435_100003414 387
1573 3300025208 Ga0209436_103757 Ga0209436_1037575 387
1574 3300025245 Ga0207425_1001795 Ga0207425_10017957 387
1575 3300025246 Ga0209646_1000008 Ga0209646_1000008414 387
1576 3300025250 Ga0209026_1000007 Ga0209026_1000007414 387
1577 3300025256 Ga0209759_1000019 Ga0209759_1000019135 387
1578 3300025256 Ga0209759_1000150 Ga0209759_100015036 387
1579 3300025258 Ga0209129_1000095 Ga0209129_100009547 387
1580 3300025258 Ga0209129_1002122 Ga0209129_10021227 387
1581 3300025258 Ga0209129_1002488 Ga0209129_10024885 387
1582 3300025263 Ga0209565_1000077 Ga0209565_100007760 387
1583 3300025263 Ga0209565_1000116 Ga0209565_100011620 387
1584 3300025263 Ga0209565_1004239 Ga0209565_10042394 387
1585 3300025263 Ga0209565_1005400 Ga0209565_10054003 387
1586 3300025272 Ga0209455_1001612 Ga0209455_10016126 387
1587 3300025273 Ga0209673_1001210 Ga0209673_100121016 387
1588 3300025273 Ga0209673_1009392 Ga0209673_10093925 387
1589 3300025284 Ga0209130_1000087 Ga0209130_1000087127 387
1590 3300025284 Ga0209130_1000095 Ga0209130_100009586 387
1591 3300025284 Ga0209130_1000134 Ga0209130_100013419 387
1592 3300025291 Ga0209675_1003004 Ga0209675_10030042 387
1593 3300025291 Ga0209675_1007884 Ga0209675_10078844 387
1594 3300025292 Ga0209676_1000019 Ga0209676_1000019472 387
1595 3300025292 Ga0209676_1000145 Ga0209676_1000145128 387
1596 3300025294 Ga0209025_1000040 Ga0209025_100004082 387
1597 3300025294 Ga0209025_1000231 Ga0209025_100023167 387
1598 3300025294 Ga0209025_1000406 Ga0209025_100040681 387
1599 3300025294 Ga0209025_1000762 Ga0209025_100076243 387
1600 3300025294 Ga0209025_1001626 Ga0209025_10016266 387
1601 3300025294 Ga0209025_1003068 Ga0209025_10030686 387
1602 3300025294 Ga0209025_1005742 Ga0209025_10057422 387
1603 3300025294 Ga0209025_1011730 Ga0209025_10117305 387
1604 3300025294 Ga0209025_1013094 Ga0209025_10130945 387
1605 3300025294 Ga0209025_1039569 Ga0209025_10395692 387
1606 3300025295 Ga0209564_1000062 Ga0209564_1000062171 387
1607 3300025295 Ga0209564_1000274 Ga0209564_100027460 387
1608 3300025295 Ga0209564_1000728 Ga0209564_10007282 387
1609 3300025295 Ga0209564_1007827 Ga0209564_10078275 387
1610 3300025295 Ga0209564_1012801 Ga0209564_10128013 387
1611 3300025297 Ga0209758_1000072 Ga0209758_1000072112 387
1612 3300025297 Ga0209758_1000122 Ga0209758_100012272 387
1613 3300025297 Ga0209758_1000302 Ga0209758_100030258 387
1614 3300025297 Ga0209758_1007283 Ga0209758_10072838 387
1615 3300025297 Ga0209758_1008050 Ga0209758_10080505 387
1616 3300025298 Ga0209050_1000023 Ga0209050_100002349 387
1617 3300025298 Ga0209050_1000143 Ga0209050_100014354 387
1618 3300025298 Ga0209050_1019316 Ga0209050_10193162 387
1619 3300025299 Ga0209256_1000003 Ga0209256_1000003783 387
1620 3300025299 Ga0209256_1000119 Ga0209256_100011960 387
1621 3300025299 Ga0209256_1001038 Ga0209256_100103810 387
1622 3300025299 Ga0209256_1028690 Ga0209256_10286901 387
1623 3300025302 Ga0207426_1000397 Ga0207426_100039772 387
1624 3300025302 Ga0207426_1013333 Ga0207426_10133333 387
1625 3300025303 Ga0209051_1000017 Ga0209051_100001749 387
1626 3300025303 Ga0209051_1000350 Ga0209051_100035026 387
1627 3300025303 Ga0209051_1005009 Ga0209051_10050095 387
1628 3300025303 Ga0209051_1013687 Ga0209051_10136872 387
1629 3300025303 Ga0209051_1014556 Ga0209051_10145562 387
1630 3300025304 Ga0209257_1000041 Ga0209257_100004149 387
1631 3300025315 Ga0207697_10077986 Ga0207697_100779861 387
1632 3300025321 Ga0207656_10005152 Ga0207656_100051521 387
1633 3300025321 Ga0207656_10043842 Ga0207656_100438422 387
1634 3300025728 Ga0207655_1000081 Ga0207655_100008146 387
1635 3300025735 Ga0207713_1005290 Ga0207713_10052904 387
1636 3300025893 Ga0207682_10004201 Ga0207682_100042012 387
1637 3300025893 Ga0207682_10027596 Ga0207682_100275962 387
1638 3300025893 Ga0207682_10035024 Ga0207682_100350242 387
1639 3300025899 Ga0207642_10002928 Ga0207642_100029286 387
1640 3300025900 Ga0207710_10001100 Ga0207710_100011007 387
1641 3300025906 Ga0207699_10052903 Ga0207699_100529032 387
1642 3300025906 Ga0207699_10130385 Ga0207699_101303852 387
1643 3300025907 Ga0207645_10001846 Ga0207645_100018462 387
1644 3300025907 Ga0207645_10005615 Ga0207645_100056156 387
1645 3300025907 Ga0207645_10039297 Ga0207645_100392973 387
1646 3300025907 Ga0207645_10117450 Ga0207645_101174502 387
1647 3300025908 Ga0207643_10025037 Ga0207643_100250374 387
1648 3300025909 Ga0207705_10088206 Ga0207705_100882063 387
1649 3300025910 Ga0207684_10001435 Ga0207684_1000143522 387
1650 3300025911 Ga0207654_10007099 Ga0207654_100070993 387
1651 3300025911 Ga0207654_10032026 Ga0207654_100320263 387
1652 3300025912 Ga0207707_10004047 Ga0207707_100040476 387
1653 3300025912 Ga0207707_10004182 Ga0207707_100041827 387
1654 3300025912 Ga0207707_10102264 Ga0207707_101022642 387
1655 3300025912 Ga0207707_10104201 Ga0207707_101042012 387
1656 3300025912 Ga0207707_10282263 Ga0207707_102822631 387
1657 3300025913 Ga0207695_10010633 Ga0207695_100106338 387
1658 3300025913 Ga0207695_10015435 Ga0207695_100154352 387
1659 3300025913 Ga0207695_10018070 Ga0207695_100180705 387
1660 3300025913 Ga0207695_10026095 Ga0207695_100260954 387
1661 3300025913 Ga0207695_10030199 Ga0207695_100301995 387
1662 3300025913 Ga0207695_10068579 Ga0207695_100685794 387
1663 3300025913 Ga0207695_10180178 Ga0207695_101801782 387
1664 3300025914 Ga0207671_10042375 Ga0207671_100423753 387
1665 3300025914 Ga0207671_10056265 Ga0207671_100562652 387
1666 3300025914 Ga0207671_10195766 Ga0207671_101957662 387
1667 3300025917 Ga0207660_10004490 Ga0207660_100044906 387
1668 3300025917 Ga0207660_10013388 Ga0207660_100133885 387
1669 3300025917 Ga0207660_10060572 Ga0207660_100605722 387
1670 3300025917 Ga0207660_10087926 Ga0207660_100879261 387
1671 3300025917 Ga0207660_10145920 Ga0207660_101459202 387
1672 3300025918 Ga0207662_10000269 Ga0207662_100002693 387
1673 3300025918 Ga0207662_10040377 Ga0207662_100403772 387
1674 3300025918 Ga0207662_10077594 Ga0207662_100775942 387
1675 3300025919 Ga0207657_10100815 Ga0207657_101008152 387
1676 3300025920 Ga0207649_10007671 Ga0207649_100076712 387
1677 3300025921 Ga0207652_10002789 Ga0207652_100027898 387
1678 3300025921 Ga0207652_10014053 Ga0207652_100140537 387
1679 3300025921 Ga0207652_10020495 Ga0207652_100204954 387
1680 3300025921 Ga0207652_10032606 Ga0207652_100326065 387
1681 3300025921 Ga0207652_10038737 Ga0207652_100387374 387
1682 3300025921 Ga0207652_10064636 Ga0207652_100646363 387
1683 3300025921 Ga0207652_10083693 Ga0207652_100836932 387
1684 3300025921 Ga0207652_10128589 Ga0207652_101285892 387
1685 3300025923 Ga0207681_10004029 Ga0207681_100040293 387
1686 3300025923 Ga0207681_10048133 Ga0207681_100481332 387
1687 3300025923 Ga0207681_10182015 Ga0207681_101820152 387
1688 3300025924 Ga0207694_10084650 Ga0207694_100846502 387
1689 3300025924 Ga0207694_10278506 Ga0207694_102785061 387
1690 3300025925 Ga0207650_10007082 Ga0207650_100070826 387
1691 3300025925 Ga0207650_10019133 Ga0207650_100191333 387
1692 3300025925 Ga0207650_10090302 Ga0207650_100903022 387
1693 3300025925 Ga0207650_10144783 Ga0207650_101447833 387
1694 3300025926 Ga0207659_10008786 Ga0207659_100087867 387
1695 3300025926 Ga0207659_10087462 Ga0207659_100874622 387
1696 3300025927 Ga0207687_10003693 Ga0207687_100036933 387
1697 3300025927 Ga0207687_10048895 Ga0207687_100488954 387
1698 3300025927 Ga0207687_10279393 Ga0207687_102793931 387
1699 3300025928 Ga0207700_10002806 Ga0207700_100028068 387
1700 3300025929 Ga0207664_10076163 Ga0207664_100761633 387
1701 3300025929 Ga0207664_10081040 Ga0207664_100810403 387
1702 3300025929 Ga0207664_10281259 Ga0207664_102812592 387
1703 3300025931 Ga0207644_10002009 Ga0207644_100020093 387
1704 3300025931 Ga0207644_10002533 Ga0207644_1000253311 387
1705 3300025931 Ga0207644_10012107 Ga0207644_100121078 387
1706 3300025931 Ga0207644_10019061 Ga0207644_100190614 387
1707 3300025931 Ga0207644_10142981 Ga0207644_101429812 387
1708 3300025931 Ga0207644_10207302 Ga0207644_102073022 387
1709 3300025932 Ga0207690_10021165 Ga0207690_100211652 387
1710 3300025932 Ga0207690_10060193 Ga0207690_100601932 387
1711 3300025932 Ga0207690_10162126 Ga0207690_101621261 387
1712 3300025933 Ga0207706_10017980 Ga0207706_100179804 387
1713 3300025933 Ga0207706_10034060 Ga0207706_100340605 387
1714 3300025933 Ga0207706_10085191 Ga0207706_100851912 387
1715 3300025933 Ga0207706_10112183 Ga0207706_101121833 387
1716 3300025933 Ga0207706_10136569 Ga0207706_101365692 387
1717 3300025934 Ga0207686_10003451 Ga0207686_100034513 387
1718 3300025934 Ga0207686_10004433 Ga0207686_100044331 387
1719 3300025934 Ga0207686_10013258 Ga0207686_100132583 387
1720 3300025934 Ga0207686_10153659 Ga0207686_101536592 387
1721 3300025934 Ga0207686_10193233 Ga0207686_101932332 387
1722 3300025935 Ga0207709_10000759 Ga0207709_1000075916 387
1723 3300025935 Ga0207709_10005409 Ga0207709_100054099 387
1724 3300025936 Ga0207670_10001147 Ga0207670_1000114711 387
1725 3300025936 Ga0207670_10013237 Ga0207670_100132373 387
1726 3300025936 Ga0207670_10039924 Ga0207670_100399242 387
1727 3300025936 Ga0207670_10058975 Ga0207670_100589751 387
1728 3300025937 Ga0207669_10017247 Ga0207669_100172472 387
1729 3300025937 Ga0207669_10113094 Ga0207669_101130942 387
1730 3300025938 Ga0207704_10000698 Ga0207704_100006983 387
1731 3300025938 Ga0207704_10026586 Ga0207704_100265863 387
1732 3300025938 Ga0207704_10144508 Ga0207704_101445082 387
1733 3300025939 Ga0207665_10003107 Ga0207665_100031075 387
1734 3300025940 Ga0207691_10003889 Ga0207691_100038895 387
1735 3300025940 Ga0207691_10045823 Ga0207691_100458233 387
1736 3300025941 Ga0207711_10032140 Ga0207711_100321403 387
1737 3300025941 Ga0207711_10053204 Ga0207711_100532044 387
1738 3300025941 Ga0207711_10071157 Ga0207711_100711572 387
1739 3300025941 Ga0207711_10170714 Ga0207711_101707142 387
1740 3300025942 Ga0207689_10001752 Ga0207689_100017525 387
1741 3300025942 Ga0207689_10025980 Ga0207689_100259805 387
1742 3300025942 Ga0207689_10102669 Ga0207689_101026693 387
1743 3300025942 Ga0207689_10240972 Ga0207689_102409722 387
1744 3300025942 Ga0207689_10285880 Ga0207689_102858802 387
1745 3300025944 Ga0207661_10010709 Ga0207661_100107094 387
1746 3300025945 Ga0207679_10008329 Ga0207679_100083295 387
1747 3300025945 Ga0207679_10248342 Ga0207679_102483422 387
1748 3300025949 Ga0207667_10005114 Ga0207667_1000511415 387
1749 3300025949 Ga0207667_10007810 Ga0207667_100078109 387
1750 3300025949 Ga0207667_10011686 Ga0207667_100116862 387
1751 3300025949 Ga0207667_10047830 Ga0207667_100478305 387
1752 3300025949 Ga0207667_10065289 Ga0207667_100652894 387
1753 3300025949 Ga0207667_10179921 Ga0207667_101799212 387
1754 3300025949 Ga0207667_10254061 Ga0207667_102540612 387
1755 3300025949 Ga0207667_10359671 Ga0207667_103596712 387
1756 3300025960 Ga0207651_10134288 Ga0207651_101342882 387
1757 3300025961 Ga0207712_10000914 Ga0207712_1000091418 387
1758 3300025961 Ga0207712_10050072 Ga0207712_100500723 387
1759 3300025972 Ga0207668_10006144 Ga0207668_100061442 387
1760 3300025972 Ga0207668_10191690 Ga0207668_101916902 387
1761 3300025981 Ga0207640_10007012 Ga0207640_100070126 387
1762 3300025981 Ga0207640_10014760 Ga0207640_100147603 387
1763 3300025981 Ga0207640_10025893 Ga0207640_100258932 387
1764 3300025986 Ga0207658_10027760 Ga0207658_100277603 387
1765 3300025986 Ga0207658_10034275 Ga0207658_100342754 387
1766 3300025986 Ga0207658_10072215 Ga0207658_100722152 387
1767 3300025986 Ga0207658_10171666 Ga0207658_101716662 387
1768 3300026023 Ga0207677_10005148 Ga0207677_100051482 387
1769 3300026023 Ga0207677_10011282 Ga0207677_100112826 387
1770 3300026023 Ga0207677_10012603 Ga0207677_100126035 387
1771 3300026023 Ga0207677_10014588 Ga0207677_100145885 387
1772 3300026023 Ga0207677_10063856 Ga0207677_100638561 387
1773 3300026035 Ga0207703_10000312 Ga0207703_100003123 387
1774 3300026035 Ga0207703_10000519 Ga0207703_100005196 387
1775 3300026035 Ga0207703_10001924 Ga0207703_100019243 387
1776 3300026035 Ga0207703_10004500 Ga0207703_100045001 387
1777 3300026035 Ga0207703_10234668 Ga0207703_102346682 387
1778 3300026035 Ga0207703_10356315 Ga0207703_103563151 387
1779 3300026035 Ga0207703_10364156 Ga0207703_103641562 387
1780 3300026041 Ga0207639_10019458 Ga0207639_100194584 387
1781 3300026041 Ga0207639_10133260 Ga0207639_101332603 387
1782 3300026041 Ga0207639_10140382 Ga0207639_101403821 387
1783 3300026067 Ga0207678_10026139 Ga0207678_100261392 387
1784 3300026067 Ga0207678_10055132 Ga0207678_100551322 387
1785 3300026075 Ga0207708_10000736 Ga0207708_100007365 387
1786 3300026075 Ga0207708_10014620 Ga0207708_100146206 387
1787 3300026075 Ga0207708_10081135 Ga0207708_100811352 387
1788 3300026078 Ga0207702_10011613 Ga0207702_100116135 387
1789 3300026088 Ga0207641_10002633 Ga0207641_100026333 387
1790 3300026088 Ga0207641_10003157 Ga0207641_1000315713 387
1791 3300026088 Ga0207641_10017709 Ga0207641_100177093 387
1792 3300026089 Ga0207648_10001763 Ga0207648_1000176326 387
1793 3300026089 Ga0207648_10008506 Ga0207648_100085066 387
1794 3300026089 Ga0207648_10031739 Ga0207648_100317395 387
1795 3300026089 Ga0207648_10081943 Ga0207648_100819432 387
1796 3300026095 Ga0207676_10034877 Ga0207676_100348774 387
1797 3300026095 Ga0207676_10038933 Ga0207676_100389333 387
1798 3300026095 Ga0207676_10385738 Ga0207676_103857381 387
1799 3300026116 Ga0207674_10132731 Ga0207674_101327313 387
1800 3300026118 Ga0207675_100000697 Ga0207675_1000006973 387
1801 3300026118 Ga0207675_100001316 Ga0207675_10000131626 387
1802 3300026118 Ga0207675_100013518 Ga0207675_1000135184 387
1803 3300026118 Ga0207675_100103442 Ga0207675_1001034422 387
1804 3300026118 Ga0207675_100113214 Ga0207675_1001132143 387
1805 3300026121 Ga0207683_10001219 Ga0207683_100012192 387
1806 3300026121 Ga0207683_10003890 Ga0207683_1000389011 387
1807 3300026121 Ga0207683_10020379 Ga0207683_100203797 387
1808 3300026121 Ga0207683_10039856 Ga0207683_100398563 387
1809 3300026121 Ga0207683_10066461 Ga0207683_100664613 387
1810 3300026142 Ga0207698_10001850 Ga0207698_100018508 387
1811 3300026142 Ga0207698_10002880 Ga0207698_100028805 387
1812 3300026142 Ga0207698_10018491 Ga0207698_100184914 387
1813 3300026142 Ga0207698_10020427 Ga0207698_100204273 387
1814 3300026142 Ga0207698_10031555 Ga0207698_100315553 387
1815 3300026142 Ga0207698_10126866 Ga0207698_101268662 387
1816 3300026142 Ga0207698_10171374 Ga0207698_101713742 387
1817 3300027312 Ga0209371_1007913 Ga0209371_10079133 387
1818 3300027378 Ga0209981_1000574 Ga0209981_10005744 387
1819 3300027395 Ga0209996_1000669 Ga0209996_10006692 387
1820 3300027462 Ga0210000_1001550 Ga0210000_10015505 387
1821 3300027471 Ga0209995_1012367 Ga0209995_10123671 387
1822 3300027543 Ga0209999_1000519 Ga0209999_10005194 387
1823 3300027671 Ga0209588_1028637 Ga0209588_10286373 387
1824 3300027682 Ga0209971_1006979 Ga0209971_10069793 387
1825 3300027695 Ga0209966_1012711 Ga0209966_10127112 387
1826 3300027695 Ga0209966_1012913 Ga0209966_10129132 387
1827 3300027866 Ga0209813_10000476 Ga0209813_100004766 387
1828 3300027907 Ga0207428_10003084 Ga0207428_100030848 387
1829 3300027907 Ga0207428_10003647 Ga0207428_1000364714 387
1830 3300027907 Ga0207428_10006244 Ga0207428_100062447 387
1831 3300027907 Ga0207428_10008344 Ga0207428_100083449 387
1832 3300027907 Ga0207428_10024205 Ga0207428_100242052 387
1833 3300027907 Ga0207428_10182725 Ga0207428_101827252 387
1834 3300028379 Ga0268266_10007894 Ga0268266_100078948 387
1835 3300028379 Ga0268266_10008086 Ga0268266_100080868 387
1836 3300028379 Ga0268266_10019877 Ga0268266_100198775 387
1837 3300028379 Ga0268266_10048744 Ga0268266_100487444 387
1838 3300028379 Ga0268266_10112273 Ga0268266_101122733 387
1839 3300028379 Ga0268266_10157087 Ga0268266_101570872 387
1840 3300028380 Ga0268265_10004996 Ga0268265_100049968 387
1841 3300028380 Ga0268265_10005389 Ga0268265_100053896 387
1842 3300028380 Ga0268265_10012818 Ga0268265_100128182 387
1843 3300028380 Ga0268265_10110928 Ga0268265_101109282 387
1844 3300028380 Ga0268265_10205450 Ga0268265_102054502 387
1845 3300028381 Ga0268264_10000145 Ga0268264_1000014590 387
1846 3300028381 Ga0268264_10001853 Ga0268264_100018533 387
1847 3300028381 Ga0268264_10014241 Ga0268264_100142415 387
1848 3300028381 Ga0268264_10029856 Ga0268264_100298563 387
1849 3300028381 Ga0268264_10258265 Ga0268264_102582652 387
1850 3300028794 Ga0307515_10000093 Ga0307515_1000009393 387
1851 3300028794 Ga0307515_10017976 Ga0307515_100179766 387
1852 3300028794 Ga0307515_10155276 Ga0307515_101552763 387
1853 3300028800 Ga0265338_10000045 Ga0265338_1000004523 387
1854 3300028800 Ga0265338_10000205 Ga0265338_1000020573 387
1855 3300030521 Ga0307511_10000005 Ga0307511_10000005158 387
1856 3300030521 Ga0307511_10002396 Ga0307511_100023962 387
1857 3300030521 Ga0307511_10029420 Ga0307511_100294206 387
1858 3300031235 Ga0265330_10014406 Ga0265330_100144062 387
1859 3300031235 Ga0265330_10028519 Ga0265330_100285192 387
1860 3300031235 Ga0265330_10037714 Ga0265330_100377142 387
1861 3300031241 Ga0265325_10000630 Ga0265325_100006303 387
1862 3300031241 Ga0265325_10018378 Ga0265325_100183783 387
1863 3300031247 Ga0265340_10016731 Ga0265340_100167314 387
1864 3300031249 Ga0265339_10082269 Ga0265339_100822692 387
1865 3300031250 Ga0265331_10015421 Ga0265331_100154212 387
1866 3300031250 Ga0265331_10039283 Ga0265331_100392832 387
1867 3300031344 Ga0265316_10049063 Ga0265316_100490632 387
1868 3300031456 Ga0307513_10000104 Ga0307513_1000010410 387
1869 3300031507 Ga0307509_10000002 Ga0307509_10000002450 387
1870 3300031507 Ga0307509_10023370 Ga0307509_100233705 387
1871 3300031507 Ga0307509_10040989 Ga0307509_100409896 387
1872 3300031507 Ga0307509_10049824 Ga0307509_100498241 387
1873 3300031595 Ga0265313_10074095 Ga0265313_100740952 387
1874 3300031616 Ga0307508_10112275 Ga0307508_101122753 387
1875 3300031665 Ga0316575_10006567 Ga0316575_100065673 387
1876 3300031665 Ga0316575_10016119 Ga0316575_100161193 387
1877 3300031665 Ga0316575_10016590 Ga0316575_100165903 387
1878 3300031665 Ga0316575_10035985 Ga0316575_100359852 387
1879 3300031691 Ga0316579_10007610 Ga0316579_100076103 387
1880 3300031691 Ga0316579_10009935 Ga0316579_100099354 387
1881 3300031691 Ga0316579_10064955 Ga0316579_100649552 387
1882 3300031711 Ga0265314_10001945 Ga0265314_100019455 387
1883 3300031727 Ga0316576_10019148 Ga0316576_100191482 387
1884 3300031728 Ga0316578_10004329 Ga0316578_100043296 387
1885 3300031728 Ga0316578_10009032 Ga0316578_100090323 387
1886 3300031728 Ga0316578_10012288 Ga0316578_100122885 387
1887 3300031728 Ga0316578_10039586 Ga0316578_100395864 387
1888 3300031901 Ga0307406_10002674 Ga0307406_100026746 387
1889 3300031901 Ga0307406_10141911 Ga0307406_101419112 387
1890 3300031911 Ga0307412_10014011 Ga0307412_100140113 387
1891 3300031995 Ga0307409_100000674 Ga0307409_10000067410 387
1892 3300032002 Ga0307416_100012024 Ga0307416_1000120245 387
1893 3300032002 Ga0307416_100015040 Ga0307416_1000150402 387
1894 3300032126 Ga0307415_100001423 Ga0307415_1000014239 387
1895 3300032126 Ga0307415_100094136 Ga0307415_1000941362 387
1896 3300032133 Ga0316583_10002176 Ga0316583_100021763 387
1897 3300032133 Ga0316583_10005429 Ga0316583_100054293 387
1898 3300032133 Ga0316583_10026229 Ga0316583_100262292 387
1899 3300032137 Ga0316585_10006962 Ga0316585_100069623 387
1900 3300032168 Ga0316593_10023588 Ga0316593_100235883 387
1901 3300032168 Ga0316593_10057995 Ga0316593_100579951 387
1902 3300033179 Ga0307507_10014093 Ga0307507_100140938 387
1903 3300033180 Ga0307510_10000007 Ga0307510_1000000765 387
1904 3300033180 Ga0307510_10039627 Ga0307510_100396273 387
1905 3300033524 Ga0316592_1005024 Ga0316592_10050243 387
1906 3300033527 Ga0316586_1003345 Ga0316586_10033453 387
1907 3300033528 Ga0316588_1002715 Ga0316588_10027153 387
1908 3300034957 Ga0373938_0001276 Ga0373938_0001276_1230_2399 387
1909 3300035083 Ga0373926_0004126 Ga0373926_0004126_2505_3674 387
1910 3300035086 Ga0373934_0000243 Ga0373934_0000243_8157_9332 387
1911 3300035088 Ga0373940_0005447 Ga0373940_0005447_318_1523 387
1912 3300035088 Ga0373940_0016453 Ga0373940_0016453_589_1764 387
1913 3300035091 Ga0373951_0012561 Ga0373951_0012561_542_1786 387
1914 3300035092 Ga0373952_0004182 Ga0373952_0004182_109_1314 387
1915 3300035092 Ga0373952_0020049 Ga0373952_0020049_148_1317 387
1916 3300035111 Ga0373923_0046228 Ga0373923_0046228_85_1254 387
1917 3300035112 Ga0373932_0000353 Ga0373932_0000353_8313_9482 387
1918 3300035112 Ga0373932_0009251 Ga0373932_0009251_274_1479 387
1919 3300035113 Ga0373936_0045960 Ga0373936_0045960_528_1712 387
1920 3300035114 Ga0373939_0002736 Ga0373939_0002736_1344_2549 387
1921 3300035114 Ga0373939_0003087 Ga0373939_0003087_2450_3619 387
1922 3300035116 Ga0373945_0056549 Ga0373945_0056549_105_1274 387
1923 3300035117 Ga0373953_0004970 Ga0373953_0004970_629_1798 387
1924 3300035118 Ga0373954_0000003 Ga0373954_0000003_1883_3052 387
1925 3300035118 Ga0373954_0003106 Ga0373954_0003106_5104_6321 387
1926 3300035118 Ga0373954_0009477 Ga0373954_0009477_2210_3385 387
1927 3300035118 Ga0373954_0009838 Ga0373954_0009838_1167_2342 387
1928 3300035119 Ga0373956_0005959 Ga0373956_0005959_3483_4652 387
1929 3300035121 Ga0373960_0019603 Ga0373960_0019603_320_1495 387
1930 3300035170 Ga0373943_0001697 Ga0373943_0001697_929_2146 387
1931 3300035170 Ga0373943_0011387 Ga0373943_0011387_308_1477 387
1932 3300035170 Ga0373943_0065997 Ga0373943_0065997_109_1389 387
1933 3300035171 Ga0373946_0008281 Ga0373946_0008281_1225_2394 387
1934 3300035171 Ga0373946_0026490 Ga0373946_0026490_362_1642 387
1935 3300035171 Ga0373946_0041523 Ga0373946_0041523_141_1310 387
1936 3300035172 Ga0373955_0000145 Ga0373955_0000145_594_1811 387
1937 3300035172 Ga0373955_0001607 Ga0373955_0001607_4668_5843 387
1938 3300035172 Ga0373955_0046475 Ga0373955_0046475_983_2152 387
1939 3300035172 Ga0373955_0094716 Ga0373955_0094716_499_1686 387
1940 3300035207 Ga0373942_0002017 Ga0373942_0002017_2432_3601 387
1941 3300035207 Ga0373942_0047388 Ga0373942_0047388_11_1180 387
1942 3300035398 Ga0316574_0009125 Ga0316574_0009125_817_1983 387
1943 3300035398 Ga0316574_0011818 Ga0316574_0011818_3433_4602 387
1944 3300035398 Ga0316574_0099034 Ga0316574_0099034_355_1548 387
1945 3300035398 Ga0316574_0124507 Ga0316574_0124507_121_1302 387
1946 3300035410 Ga0373924_0004607 Ga0373924_0004607_516_1733 387
1947 3300035410 Ga0373924_0006633 Ga0373924_0006633_652_1821 387
1948 3300035691 Ga0373931_0000189 Ga0373931_0000189_22409_23578 387
1949 3300035691 Ga0373931_0002113 Ga0373931_0002113_2432_3601 387
1950 3300035691 Ga0373931_0005256 Ga0373931_0005256_4763_5938 387
1951 3300035691 Ga0373931_0033728 Ga0373931_0033728_898_2067 387
1952 3300035692 Ga0373935_0000017 Ga0373935_0000017_51173_52390 387
1953 3300035692 Ga0373935_0005734 Ga0373935_0005734_3674_4843 387
1954 3300035692 Ga0373935_0009848 Ga0373935_0009848_1032_2201 387
1955 3300035692 Ga0373935_0016747 Ga0373935_0016747_2087_3256 387
1956 3300035692 Ga0373935_0033804 Ga0373935_0033804_1470_2636 387
1957 3300035692 Ga0373935_0147534 Ga0373935_0147534_174_1349 387
1958 3300035695 Ga0373927_0016477 Ga0373927_0016477_2116_3285 387
1959 3300035695 Ga0373927_0018526 Ga0373927_0018526_890_2107 387
1960 3300035695 Ga0373927_0036724 Ga0373927_0036724_1589_2773 387
1961 3300035695 Ga0373927_0079565 Ga0373927_0079565_497_1702 387
1962 3300035695 Ga0373927_0081786 Ga0373927_0081786_780_1949 387
1963 3300035724 Ga0373933_0000579 Ga0373933_0000579_7527_8702 387
1964 3300035724 Ga0373933_0001228 Ga0373933_0001228_12059_13276 387
1965 3300035724 Ga0373933_0008876 Ga0373933_0008876_3011_4180 387
1966 3300035724 Ga0373933_0057746 Ga0373933_0057746_1129_2304 387
1967 3300035725 Ga0373947_0009952 Ga0373947_0009952_29_1309 387
1968 3300035725 Ga0373947_0061412 Ga0373947_0061412_363_1538 387
1969 3300035725 Ga0373947_0135362 Ga0373947_0135362_98_1354 387
1970 3300036401 Ga0373937_0000103 Ga0373937_0000103_51102_52319 387
1971 3300036401 Ga0373937_0000131 Ga0373937_0000131_20736_21905 387
1972 3300036401 Ga0373937_0001360 Ga0373937_0001360_18158_19333 387
1973 3300036401 Ga0373937_0012811 Ga0373937_0012811_6133_7302 387
1974 3300036401 Ga0373937_0021739 Ga0373937_0021739_3412_4596 387
1975 3300036401 Ga0373937_0027437 Ga0373937_0027437_3824_4993 387
1976 3300036401 Ga0373937_0037606 Ga0373937_0037606_1615_2784 387
1977 3300036401 Ga0373937_0045372 Ga0373937_0045372_2635_3804 387
1978 3300036401 Ga0373937_0046984 Ga0373937_0046984_853_2028 387
1979 3300036647 Ga0316582_0095048 Ga0316582_0095048_137_1303 387
1980 3300036647 Ga0316582_0135484 Ga0316582_0135484_433_1620 387
1981 3300036712 Ga0316584_0042219 Ga0316584_0042219_1600_2775 387
1982 3300036712 Ga0316584_0051908 Ga0316584_0051908_698_1873 387
1983 3300036712 Ga0316584_0061049 Ga0316584_0061049_43_1209 387
1984 3300036712 Ga0316584_0070015 Ga0316584_0070015_1268_2467 387
1985 3300036712 Ga0316584_0079431 Ga0316584_0079431_1074_2240 387
1986 3300036712 Ga0316584_0089186 Ga0316584_0089186_129_1310 387
1987 3300036712 Ga0316584_0153546 Ga0316584_0153546_473_1636 387
1988 3300037068 Ga0373925_0000058 Ga0373925_0000058_93927_95144 387
1989 3300037068 Ga0373925_0043332 Ga0373925_0043332_1600_2784 387
1990 3300037068 Ga0373925_0044352 Ga0373925_0044352_1509_2708 387
1991 3300037068 Ga0373925_0054731 Ga0373925_0054731_1000_2175 387
1992 3300037068 Ga0373925_0112646 Ga0373925_0112646_376_1545 387
1993 3300037312 Ga0395899_0028085 Ga0395899_0028085_1188_2459 387
1994 3300037312 Ga0395899_0061267 Ga0395899_0061267_56_1231 387
1995 3300037312 Ga0395899_0065936 Ga0395899_0065936_444_1619 387
1996 3300037418 Ga0395900_0019231 Ga0395900_0019231_4057_5304 387
1997 3300037418 Ga0395900_0036870 Ga0395900_0036870_82_1257 387
1998 3300037418 Ga0395900_0046502 Ga0395900_0046502_1243_2412 387
1999 3300037418 Ga0395900_0059277 Ga0395900_0059277_510_1685 387
2000 3300037418 Ga0395900_0201866 Ga0395900_0201866_30_1205 387
2001 3300037418 Ga0395900_0283517 Ga0395900_0283517_84_1259 387
2002 3300037466 Ga0395898_0023421 Ga0395898_0023421_4869_6044 387
2003 3300037466 Ga0395898_0060385 Ga0395898_0060385_1680_2855 387
2004 3300037466 Ga0395898_0077240 Ga0395898_0077240_1506_2753 387
2005 3300037471 Ga0395905_0000043 Ga0395905_0000043_202513_203688 387
2006 3300037471 Ga0395905_0014552 Ga0395905_0014552_988_2157 387
2007 3300037471 Ga0395905_0049067 Ga0395905_0049067_587_1762 387
2008 3300037471 Ga0395905_0067525 Ga0395905_0067525_389_1564 387
2009 3300037471 Ga0395905_0115317 Ga0395905_0115317_96_1271 387
2010 3300037471 Ga0395905_0158564 Ga0395905_0158564_30_1205 387
2011 3300037853 Ga0436364_0207258 Ga0436364_0207258_12551_13729 387
2012 3300037853 Ga0436364_0764338 Ga0436364_0764338_7554_8735 387
2013 3300037853 Ga0436364_0988190 Ga0436364_0988190_1376_2572 387
2014 3300037853 Ga0436364_1220763 Ga0436364_1220763_3734_4990 387
2015 3300038443 Ga0395901_0011296 Ga0395901_0011296_53_1324 387
2016 3300038443 Ga0395901_0017178 Ga0395901_0017178_1422_2591 387
2017 3300038443 Ga0395901_0034121 Ga0395901_0034121_3517_4692 387
2018 3300038443 Ga0395901_0233125 Ga0395901_0233125_44_1219 387
2019 3300039062 Ga0400483_010883 Ga0400483_010883_187_1368 387
2020 3300039062 Ga0400483_192796 Ga0400483_192796_618_1799 387
2021 3300039093 Ga0400489_18675 Ga0400489_18675_7605_8768 387
2022 3300039093 Ga0400489_49853 Ga0400489_49853_7169_8332 387
2023 3300039437 Ga0436365_1865855 Ga0436365_1865855_2257_3426 387
2024 3300039447 Ga0436361_0234825 Ga0436361_0234825_221_1396 387
2025 3300039447 Ga0436361_0837620 Ga0436361_0837620_117_1334 387
2026 3300039450 Ga0436363_1334135 Ga0436363_1334135_418_1593 387
2027 3300041404 Ga0439436_0001332 Ga0439436_0001332_3011_4186 387
2028 3300041408 Ga0439453_0000481 Ga0439453_0000481_522_1691 387
2029 3300041411 Ga0439466_0019516 Ga0439466_0019516_419_1594 387
2030 3300041413 Ga0439465_0003831 Ga0439465_0003831_2899_4074 387
2031 3300041512 Ga0451853_3625268 Ga0451853_3625268_401_1576 387
2032 3300041999 Ga0439433_0002646 Ga0439433_0002646_703_1878 387
2033 3300042004 Ga0439445_0000170 Ga0439445_0000170_5718_6893 387
2034 3300042007 Ga0439449_0004416 Ga0439449_0004416_1763_2938 387
2035 3300042009 Ga0439451_020065 Ga0439451_020065_104_1273 387
2036 3300042015 Ga0439462_0010265 Ga0439462_0010265_637_1812 387
2037 3300042185 Ga0450909_001487 Ga0450909_001487_1367_2542 387
2038 3300042435 Ga0439434_0004262 Ga0439434_0004262_431_1606 387
2039 3300042435 Ga0439434_0011570 Ga0439434_0011570_1352_2521 387
2040 3300042436 Ga0439435_0000427 Ga0439435_0000427_3385_4554 387
2041 3300042437 Ga0439444_0000069 Ga0439444_0000069_837_2006 387
2042 3300042876 Ga0451577_0008711 Ga0451577_0008711_8226_9404 387
2043 3300042876 Ga0451577_0033459 Ga0451577_0033459_2759_3928 387
2044 3300042876 Ga0451577_0130421 Ga0451577_0130421_799_1968 387
2045 3300044693 Ga0466961_0012714 Ga0466961_0012714_756_1931 387
2046 3300044712 Ga0453684_0275738 Ga0453684_0275738_655_1827 387
2047 3300044901 Ga0466960_0011379 Ga0466960_0011379_1174_2349 387
2048 3300045049 Ga0466959_0008856 Ga0466959_0008856_2146_3321 387
2049 3300045049 Ga0466959_0009421 Ga0466959_0009421_118_1293 387
2050 3300045049 Ga0466959_0015485 Ga0466959_0015485_839_2014 387
2051 3300045051 Ga0451576_0001669 Ga0451576_0001669_28278_29447 387
2052 3300045051 Ga0451576_0005273 Ga0451576_0005273_11911_13080 387
2053 3300045051 Ga0451576_0086106 Ga0451576_0086106_1231_2400 387
2054 3300045051 Ga0451576_0369994 Ga0451576_0369994_254_1429 387
2055 3300045836 Ga0466958_0034236 Ga0466958_0034236_474_1643 387
2056 3300046454 Ga0495592_0000062 Ga0495592_0000062_13133_14350 387
2057 3300046454 Ga0495592_0049105 Ga0495592_0049105_1203_2372 387
2058 3300046454 Ga0495592_0072897 Ga0495592_0072897_264_1433 387
2059 3300046454 Ga0495592_0076710 Ga0495592_0076710_85_1254 387
2060 3300046457 Ga0495590_0017572 Ga0495590_0017572_1246_2421 387
2061 3300046457 Ga0495590_0056223 Ga0495590_0056223_74_1297 387
2062 3300046458 Ga0495591_002493 Ga0495591_002493_160_1335 387
2063 3300046459 Ga0495629_0000115 Ga0495629_0000115_3468_4643 387
2064 3300046459 Ga0495629_0001063 Ga0495629_0001063_12582_13757 387
2065 3300046459 Ga0495629_0001807 Ga0495629_0001807_568_1785 387
2066 3300046459 Ga0495629_0005730 Ga0495629_0005730_5759_6934 387
2067 3300046459 Ga0495629_0039433 Ga0495629_0039433_28_1203 387
2068 3300046461 Ga0495641_0003356 Ga0495641_0003356_9815_10984 387
2069 3300046462 Ga0495651_0001912 Ga0495651_0001912_9836_11053 387
2070 3300046462 Ga0495651_0003749 Ga0495651_0003749_9458_10633 387
2071 3300046462 Ga0495651_0005207 Ga0495651_0005207_7898_9067 387
2072 3300046463 Ga0495653_0000072 Ga0495653_0000072_33084_34301 387
2073 3300046463 Ga0495653_0003451 Ga0495653_0003451_3435_4610 387
2074 3300046463 Ga0495653_0004667 Ga0495653_0004667_3059_4228 387
2075 3300046463 Ga0495653_0015156 Ga0495653_0015156_1884_3059 387
2076 3300046463 Ga0495653_0100678 Ga0495653_0100678_741_1916 387
2077 3300046471 Ga0495650_0005305 Ga0495650_0005305_80_1255 387
2078 3300046472 Ga0495580_0006433 Ga0495580_0006433_2779_3954 387
2079 3300046472 Ga0495580_0038208 Ga0495580_0038208_39_1214 387
2080 3300046473 Ga0495582_0022387 Ga0495582_0022387_2067_3242 387
2081 3300046473 Ga0495582_0049259 Ga0495582_0049259_157_1344 387
2082 3300046475 Ga0495639_0003385 Ga0495639_0003385_1387_2556 387
2083 3300046475 Ga0495639_0007850 Ga0495639_0007850_595_1764 387
2084 3300046476 Ga0495662_0036717 Ga0495662_0036717_349_1518 387
2085 3300046477 Ga0495664_0000009 Ga0495664_0000009_194664_195881 387
2086 3300046477 Ga0495664_0042127 Ga0495664_0042127_1248_2417 387
2087 3300046491 Ga0495584_0043732 Ga0495584_0043732_508_1713 387
2088 3300046499 Ga0495594_0027422 Ga0495594_0027422_1818_2987 387
2089 3300046500 Ga0495596_0001312 Ga0495596_0001312_5344_6519 387
2090 3300046501 Ga0495607_0060761 Ga0495607_0060761_634_1809 387
2091 3300046506 Ga0495583_0002560 Ga0495583_0002560_6279_7454 387
2092 3300046506 Ga0495583_0019920 Ga0495583_0019920_1474_2649 387
2093 3300046506 Ga0495583_0056047 Ga0495583_0056047_144_1319 387
2094 3300046511 Ga0495608_0000061 Ga0495608_0000061_8761_9978 387
2095 3300046511 Ga0495608_0003916 Ga0495608_0003916_5772_6941 387
2096 3300046514 Ga0495618_0000061 Ga0495618_0000061_51086_52303 387
2097 3300046514 Ga0495618_0005652 Ga0495618_0005652_218_1387 387
2098 3300046515 Ga0495620_0005528 Ga0495620_0005528_973_2148 387
2099 3300046515 Ga0495620_0036549 Ga0495620_0036549_711_1886 387
2100 3300046516 Ga0495628_0000012 Ga0495628_0000012_93766_94983 387
2101 3300046516 Ga0495628_0004166 Ga0495628_0004166_2831_4000 387
2102 3300046516 Ga0495628_0005756 Ga0495628_0005756_3308_4477 387
2103 3300046516 Ga0495628_0023537 Ga0495628_0023537_1851_3026 387
2104 3300046516 Ga0495628_0034390 Ga0495628_0034390_1668_2843 387
2105 3300046516 Ga0495628_0192958 Ga0495628_0192958_188_1357 387
2106 3300046517 Ga0495630_0010670 Ga0495630_0010670_2367_3542 387
2107 3300046517 Ga0495630_0026145 Ga0495630_0026145_1239_2456 387
2108 3300046517 Ga0495630_0063049 Ga0495630_0063049_106_1305 387
2109 3300046517 Ga0495630_0081720 Ga0495630_0081720_230_1405 387
2110 3300046517 Ga0495630_0090327 Ga0495630_0090327_341_1513 387
2111 3300046523 Ga0495644_0032333 Ga0495644_0032333_109_1284 387
2112 3300046524 Ga0495648_0020006 Ga0495648_0020006_839_2014 387
2113 3300046526 Ga0495666_0005421 Ga0495666_0005421_130_1299 387
2114 3300046526 Ga0495666_0009188 Ga0495666_0009188_541_1716 387
2115 3300046529 Ga0495652_0000021 Ga0495652_0000021_129146_130363 387
2116 3300046529 Ga0495652_0004306 Ga0495652_0004306_7968_9137 387
2117 3300046529 Ga0495652_0032040 Ga0495652_0032040_1665_2828 387
2118 3300046529 Ga0495652_0072337 Ga0495652_0072337_737_1906 387
2119 3300046530 Ga0495654_0037383 Ga0495654_0037383_483_1658 387
2120 3300046531 Ga0495665_0015272 Ga0495665_0015272_1027_2202 387
2121 3300046531 Ga0495665_0026132 Ga0495665_0026132_1561_2736 387
2122 3300046531 Ga0495665_0037280 Ga0495665_0037280_838_2025 387
2123 3300046531 Ga0495665_0066116 Ga0495665_0066116_487_1656 387
2124 3300046531 Ga0495665_0072069 Ga0495665_0072069_634_1809 387
2125 3300046533 Ga0495640_0000028 Ga0495640_0000028_44881_46098 387
2126 3300046533 Ga0495640_0006679 Ga0495640_0006679_5104_6288 387
2127 3300046533 Ga0495640_0013131 Ga0495640_0013131_1601_2773 387
2128 3300046533 Ga0495640_0031348 Ga0495640_0031348_90_1259 387
2129 3300046535 Ga0495586_0007082 Ga0495586_0007082_3470_4639 387
2130 3300046535 Ga0495586_0008178 Ga0495586_0008178_4083_5252 387
2131 3300046535 Ga0495586_0009251 Ga0495586_0009251_700_1875 387
2132 3300046535 Ga0495586_0013720 Ga0495586_0013720_2735_3910 387
2133 3300046536 Ga0495587_0000033 Ga0495587_0000033_29002_30219 387
2134 3300046536 Ga0495587_0004825 Ga0495587_0004825_792_1961 387
2135 3300046536 Ga0495587_0009004 Ga0495587_0009004_273_1442 387
2136 3300046536 Ga0495587_0029072 Ga0495587_0029072_1517_2686 387
2137 3300046538 Ga0495609_0018956 Ga0495609_0018956_1904_3079 387
2138 3300046539 Ga0495621_0001657 Ga0495621_0001657_282_1451 387
2139 3300046542 Ga0495597_0000019 Ga0495597_0000019_93240_94415 387
2140 3300046542 Ga0495597_0000058 Ga0495597_0000058_30090_31313 387
2141 3300046543 Ga0495645_0000017 Ga0495645_0000017_105891_107108 387
2142 3300046543 Ga0495645_0000609 Ga0495645_0000609_3230_4399 387
2143 3300046543 Ga0495645_0000843 Ga0495645_0000843_9090_10259 387
2144 3300046543 Ga0495645_0001841 Ga0495645_0001841_699_1862 387
2145 3300046543 Ga0495645_0016307 Ga0495645_0016307_2897_4072 387
2146 3300046543 Ga0495645_0060228 Ga0495645_0060228_947_2110 387
2147 3300046543 Ga0495645_0119832 Ga0495645_0119832_232_1407 387
2148 3300046557 Ga0495622_0000196 Ga0495622_0000196_43369_44544 387
2149 3300046559 Ga0495667_0000011 Ga0495667_0000011_26454_27671 387
2150 3300046559 Ga0495667_0000672 Ga0495667_0000672_7988_9157 387
2151 3300046559 Ga0495667_0001460 Ga0495667_0001460_2040_3218 387
2152 3300046559 Ga0495667_0078757 Ga0495667_0078757_334_1509 387
2153 3300046559 Ga0495667_0098876 Ga0495667_0098876_381_1550 387
2154 3300046616 Ga0495668_0100806 Ga0495668_0100806_271_1476 387
2155 3300046642 Ga0495634_0000220 Ga0495634_0000220_26280_27497 387
2156 3300046642 Ga0495634_0001130 Ga0495634_0001130_11226_12395 387
2157 3300046642 Ga0495634_0026629 Ga0495634_0026629_940_2109 387
2158 3300046642 Ga0495634_0046247 Ga0495634_0046247_1729_2913 387
2159 3300046642 Ga0495634_0077175 Ga0495634_0077175_492_1667 387
2160 3300046660 Ga0495625_0024548 Ga0495625_0024548_1569_2744 387
2161 3300046663 Ga0495635_0000019 Ga0495635_0000019_146015_147232 387
2162 3300046663 Ga0495635_0016849 Ga0495635_0016849_2235_3404 387
2163 3300046665 Ga0495661_0086112 Ga0495661_0086112_206_1381 387
2164 3300046675 Ga0495657_0000378 Ga0495657_0000378_14089_15306 387
2165 3300046675 Ga0495657_0009256 Ga0495657_0009256_1267_2436 387
2166 3300046675 Ga0495657_0032069 Ga0495657_0032069_1461_2630 387
2167 3300046678 Ga0495599_0000024 Ga0495599_0000024_93591_94808 387
2168 3300046678 Ga0495599_0015770 Ga0495599_0015770_2496_3665 387
2169 3300046678 Ga0495599_0153466 Ga0495599_0153466_187_1356 387
2170 3300046679 Ga0495623_0000022 Ga0495623_0000022_46633_47850 387
2171 3300046679 Ga0495623_0003295 Ga0495623_0003295_5897_7072 387
2172 3300046680 Ga0495646_0000033 Ga0495646_0000033_31530_32747 387
2173 3300046680 Ga0495646_0001525 Ga0495646_0001525_7665_8840 387
2174 3300046680 Ga0495646_0025972 Ga0495646_0025972_2326_3501 387
2175 3300046680 Ga0495646_0034625 Ga0495646_0034625_357_1532 387
2176 3300046680 Ga0495646_0054051 Ga0495646_0054051_143_1318 387
2177 3300046680 Ga0495646_0064318 Ga0495646_0064318_786_1949 387
2178 3300046681 Ga0495647_0002023 Ga0495647_0002023_5039_6208 387
2179 3300046683 Ga0495658_0003278 Ga0495658_0003278_1725_2894 387
2180 3300046689 Ga0495613_0009781 Ga0495613_0009781_4913_6088 387
2181 3300046689 Ga0495613_0035495 Ga0495613_0035495_805_2004 387
2182 3300046689 Ga0495613_0038298 Ga0495613_0038298_637_1812 387
2183 3300046690 Ga0495624_0001964 Ga0495624_0001964_6395_7570 387
2184 3300046690 Ga0495624_0005770 Ga0495624_0005770_5388_6563 387
2185 3300046690 Ga0495624_0008963 Ga0495624_0008963_1795_2970 387
2186 3300046690 Ga0495624_0035255 Ga0495624_0035255_1387_2556 387
2187 3300046691 Ga0495670_0056278 Ga0495670_0056278_409_1584 387
2188 3300046692 Ga0495671_0026726 Ga0495671_0026726_827_2002 387
2189 3300046692 Ga0495671_0035825 Ga0495671_0035825_399_1574 387
2190 3300046694 Ga0495649_0084480 Ga0495649_0084480_435_1610 387
2191 3300046794 Ga0495589_0000861 Ga0495589_0000861_4501_5724 387
2192 3300046794 Ga0495589_0003845 Ga0495589_0003845_2021_3196 387
2193 3300046809 Ga0495600_0000028 Ga0495600_0000028_38340_39557 387
2194 3300046809 Ga0495600_0000657 Ga0495600_0000657_8589_9758 387
2195 3300046809 Ga0495600_0009629 Ga0495600_0009629_2185_3360 387
2196 3300046809 Ga0495600_0018548 Ga0495600_0018548_3232_4407 387
2197 3300046809 Ga0495600_0051933 Ga0495600_0051933_545_1714 387
2198 3300046810 Ga0495660_0129958 Ga0495660_0129958_33_1202 387
2199 3300047315 Ga0495581_0001914 Ga0495581_0001914_4463_5680 387
2200 3300047315 Ga0495581_0005793 Ga0495581_0005793_2766_3941 387
2201 3300047315 Ga0495581_0064417 Ga0495581_0064417_132_1307 387
2202 3300047317 Ga0495604_0000011 Ga0495604_0000011_239756_240973 387
2203 3300047317 Ga0495604_0013594 Ga0495604_0013594_2076_3245 387
2204 3300047317 Ga0495604_0015332 Ga0495604_0015332_3715_4878 387
2205 3300047317 Ga0495604_0029226 Ga0495604_0029226_884_2059 387
2206 3300047319 Ga0495674_0000015 Ga0495674_0000015_93771_94988 387
2207 3300047319 Ga0495674_0031893 Ga0495674_0031893_3364_4539 387
2208 3300047319 Ga0495674_0052325 Ga0495674_0052325_1439_2614 387
2209 3300047319 Ga0495674_0094033 Ga0495674_0094033_741_1916 387
2210 3300047319 Ga0495674_0113720 Ga0495674_0113720_244_1419 387
2211 3300047320 Ga0495672_0033356 Ga0495672_0033356_939_2114 387
2212 3300047320 Ga0495672_0050320 Ga0495672_0050320_644_1819 387
2213 3300047321 Ga0495676_0021777 Ga0495676_0021777_1000_2175 387
2214 3300047321 Ga0495676_0074109 Ga0495676_0074109_1293_2510 387
2215 3300047322 Ga0495680_0000812 Ga0495680_0000812_9114_10283 387
2216 3300047322 Ga0495680_0009066 Ga0495680_0009066_7665_8882 387
2217 3300047322 Ga0495680_0019802 Ga0495680_0019802_4159_5328 387
2218 3300047322 Ga0495680_0070190 Ga0495680_0070190_756_1931 387
2219 3300047443 Ga0495687_000350 Ga0495687_000350_54423_55598 387
2220 3300047443 Ga0495687_015375 Ga0495687_015375_1162_2337 387
2221 3300047443 Ga0495687_022160 Ga0495687_022160_50_1225 387
2222 3300047444 Ga0495675_0000295 Ga0495675_0000295_8076_9293 387
2223 3300047444 Ga0495675_0003515 Ga0495675_0003515_1675_2844 387
2224 3300047444 Ga0495675_0003662 Ga0495675_0003662_4902_6077 387
2225 3300047444 Ga0495675_0032366 Ga0495675_0032366_971_2146 387
2226 3300047446 Ga0495679_000026 Ga0495679_000026_32270_33445 387
2227 3300047446 Ga0495679_000245 Ga0495679_000245_31736_32911 387
2228 3300047446 Ga0495679_002264 Ga0495679_002264_8729_9904 387
2229 3300047446 Ga0495679_025669 Ga0495679_025669_391_1566 387
2230 3300047469 Ga0495673_0000335 Ga0495673_0000335_55953_57122 387
2231 3300047471 Ga0495684_0000036 Ga0495684_0000036_54763_55980 387
2232 3300047471 Ga0495684_0082407 Ga0495684_0082407_102_1271 387
2233 3300047673 Ga0495593_0001674 Ga0495593_0001674_8629_9846 387
2234 3300047673 Ga0495593_0007037 Ga0495593_0007037_36_1211 387
2235 3300047673 Ga0495593_0088071 Ga0495593_0088071_182_1357 387
2236 3300048088 Ga0495602_0000018 Ga0495602_0000018_51048_52265 387
2237 3300048088 Ga0495602_0033350 Ga0495602_0033350_689_1864 387
2238 3300048088 Ga0495602_0058452 Ga0495602_0058452_1681_2856 387
2239 3300048089 Ga0495614_0046053 Ga0495614_0046053_51_1226 387
2240 3300048089 Ga0495614_0063828 Ga0495614_0063828_27_1202 387
2241 3300048091 Ga0495626_0014377 Ga0495626_0014377_2111_3286 387
2242 3300048903 Ga0496100_0035629 Ga0496100_0035629_1329_2573 387
2243 3300048905 Ga0496102_0039979 Ga0496102_0039979_827_2083 387
2244 3300048905 Ga0496102_0169234 Ga0496102_0169234_195_1370 387
2245 3300048905 Ga0496102_0264863 Ga0496102_0264863_200_1375 387
2246 3300048905 Ga0496102_0365754 Ga0496102_0365754_135_1340 387
2247 3300048907 Ga0496104_0000175 Ga0496104_0000175_21779_22984 387
2248 3300048907 Ga0496104_0003379 Ga0496104_0003379_10584_11843 387
2249 3300048907 Ga0496104_0009058 Ga0496104_0009058_1499_2668 387
2250 3300048907 Ga0496104_0026761 Ga0496104_0026761_3306_4475 387
2251 3300048907 Ga0496104_0028770 Ga0496104_0028770_2443_3699 387
2252 3300048907 Ga0496104_0068986 Ga0496104_0068986_1514_2719 387
2253 3300048908 Ga0496105_0007248 Ga0496105_0007248_7228_8433 387
2254 3300048908 Ga0496105_0014273 Ga0496105_0014273_2443_3699 387
2255 3300048908 Ga0496105_0035302 Ga0496105_0035302_892_2151 387
2256 3300048908 Ga0496105_0059288 Ga0496105_0059288_688_1893 387
2257 3300048908 Ga0496105_0076042 Ga0496105_0076042_112_1296 387
2258 3300048909 Ga0496106_0000334 Ga0496106_0000334_19282_20457 387
2259 3300048909 Ga0496106_0124796 Ga0496106_0124796_16_1191 387
2260 3300048910 Ga0496107_0088487 Ga0496107_0088487_718_1974 387
2261 3300048911 Ga0496108_0001410 Ga0496108_0001410_15753_17009 387
2262 3300048911 Ga0496108_0001485 Ga0496108_0001485_16848_18107 387
2263 3300048911 Ga0496108_0001994 Ga0496108_0001994_6446_7651 387
2264 3300048911 Ga0496108_0097929 Ga0496108_0097929_20_1195 387
2265 3300048912 Ga0496109_0001151 Ga0496109_0001151_11484_12653 387
2266 3300048912 Ga0496109_0004099 Ga0496109_0004099_9134_10393 387
2267 3300048912 Ga0496109_0005509 Ga0496109_0005509_8119_9324 387
2268 3300048912 Ga0496109_0032109 Ga0496109_0032109_107_1312 387
2269 3300048912 Ga0496109_0032518 Ga0496109_0032518_983_2239 387
2270 3300048912 Ga0496109_0337966 Ga0496109_0337966_210_1379 387
2271 3300048912 Ga0496109_0385585 Ga0496109_0385585_101_1306 387
2272 3300048913 Ga0496110_0003529 Ga0496110_0003529_8293_9552 387
2273 3300048913 Ga0496110_0004114 Ga0496110_0004114_8501_9670 387
2274 3300048913 Ga0496110_0015658 Ga0496110_0015658_1704_2909 387
2275 3300048913 Ga0496110_0024070 Ga0496110_0024070_2489_3745 387
2276 3300048913 Ga0496110_0073883 Ga0496110_0073883_1180_2355 387
2277 3300048913 Ga0496110_0259005 Ga0496110_0259005_146_1351 387
2278 3300048913 Ga0496110_0276879 Ga0496110_0276879_101_1276 387
2279 3300048914 Ga0496111_0000362 Ga0496111_0000362_2473_3729 387
2280 3300048914 Ga0496111_0003573 Ga0496111_0003573_2972_4231 387
2281 3300048914 Ga0496111_0103935 Ga0496111_0103935_208_1440 387
2282 3300048914 Ga0496111_0177154 Ga0496111_0177154_35_1204 387
2283 3300048915 Ga0496112_0000056 Ga0496112_0000056_22613_23884 387
2284 3300048915 Ga0496112_0003671 Ga0496112_0003671_9931_11187 387
2285 3300048915 Ga0496112_0004153 Ga0496112_0004153_7885_9090 387
2286 3300048915 Ga0496112_0020129 Ga0496112_0020129_1150_2409 387
2287 3300048915 Ga0496112_0153912 Ga0496112_0153912_665_1840 387
2288 3300048916 Ga0496113_0004878 Ga0496113_0004878_1738_2997 387
2289 3300048916 Ga0496113_0007156 Ga0496113_0007156_3370_4575 387
2290 3300048916 Ga0496113_0021063 Ga0496113_0021063_777_2033 387
2291 3300048916 Ga0496113_0068623 Ga0496113_0068623_1431_2606 387
2292 3300048917 Ga0496114_0004949 Ga0496114_0004949_3619_4794 387
2293 3300048917 Ga0496114_0050781 Ga0496114_0050781_20_1219 387
2294 3300048917 Ga0496114_0100758 Ga0496114_0100758_1217_2422 387
2295 3300048917 Ga0496114_0342448 Ga0496114_0342448_25_1305 387
2296 3300048918 Ga0496115_0069540 Ga0496115_0069540_362_1537 387
2297 3300048918 Ga0496115_0097378 Ga0496115_0097378_447_1652 387
2298 3300048919 Ga0496116_0120025 Ga0496116_0120025_199_1374 387
2299 3300048920 Ga0496117_0006817 Ga0496117_0006817_333_1508 387
2300 3300048920 Ga0496117_0009447 Ga0496117_0009447_27_1196 387
2301 3300048920 Ga0496117_0082879 Ga0496117_0082879_667_1842 387
2302 3300048921 Ga0496118_0000401 Ga0496118_0000401_45113_46288 387
2303 3300048921 Ga0496118_0006350 Ga0496118_0006350_3987_5156 387
2304 3300048924 Ga0496121_0001952 Ga0496121_0001952_8391_9566 387
2305 3300048924 Ga0496121_0003905 Ga0496121_0003905_5962_7137 387
2306 3300048924 Ga0496121_0004910 Ga0496121_0004910_3148_4380 387
2307 3300048924 Ga0496121_0016298 Ga0496121_0016298_2878_4053 387
2308 3300048924 Ga0496121_0030946 Ga0496121_0030946_526_1701 387
2309 3300048924 Ga0496121_0068518 Ga0496121_0068518_75_1250 387
2310 3300048925 Ga0496122_0003399 Ga0496122_0003399_7992_9173 387
2311 3300048925 Ga0496122_0006573 Ga0496122_0006573_9537_10706 387
2312 3300048926 Ga0496123_0000136 Ga0496123_0000136_80007_81176 387
2313 3300048927 Ga0496124_0000103 Ga0496124_0000103_53854_55029 387
2314 3300048927 Ga0496124_0004093 Ga0496124_0004093_8318_9487 387
2315 3300048927 Ga0496124_0064437 Ga0496124_0064437_155_1330 387
2316 3300048927 Ga0496124_0186448 Ga0496124_0186448_327_1502 387
2317 3300048928 Ga0496125_0000482 Ga0496125_0000482_19025_20206 387
2318 3300048928 Ga0496125_0003169 Ga0496125_0003169_9676_10851 387
2319 3300048928 Ga0496125_0009441 Ga0496125_0009441_8115_9284 387
2320 3300048928 Ga0496125_0027805 Ga0496125_0027805_672_1847 387
2321 3300048929 Ga0496126_0000389 Ga0496126_0000389_13818_14993 387
2322 3300048929 Ga0496126_0004363 Ga0496126_0004363_3272_4504 387
2323 3300048929 Ga0496126_0258225 Ga0496126_0258225_164_1339 387
2324 3300049569 Ga0501032_0046476 Ga0501032_0046476_1375_2562 387
2325 3300049570 Ga0501033_0021452 Ga0501033_0021452_2228_3403 387
2326 3300049570 Ga0501033_0057231 Ga0501033_0057231_1392_2573 387
2327 3300049570 Ga0501033_0060320 Ga0501033_0060320_1411_2580 387
2328 3300049571 Ga0501034_0001791 Ga0501034_0001791_8571_9752 387
2329 3300049571 Ga0501034_0019580 Ga0501034_0019580_1540_2715 387
2330 3300049571 Ga0501034_0054616 Ga0501034_0054616_852_2033 387
2331 3300049571 Ga0501034_0059944 Ga0501034_0059944_2154_3341 387
2332 3300049572 Ga0501036_0005876 Ga0501036_0005876_64_1233 387
2333 3300049572 Ga0501036_0035339 Ga0501036_0035339_1121_2308 387
2334 3300049573 Ga0501037_0116821 Ga0501037_0116821_338_1543 387
2335 3300049574 Ga0501038_0001150 Ga0501038_0001150_9309_10478 387
2336 3300049574 Ga0501038_0011563 Ga0501038_0011563_1970_3139 387
2337 3300049574 Ga0501038_0026277 Ga0501038_0026277_3171_4340 387
2338 3300049574 Ga0501038_0035650 Ga0501038_0035650_373_1560 387
2339 3300049574 Ga0501038_0076393 Ga0501038_0076393_1210_2415 387
2340 3300049575 Ga0501039_0005097 Ga0501039_0005097_7209_8378 387
2341 3300049575 Ga0501039_0018526 Ga0501039_0018526_2422_3591 387
2342 3300049575 Ga0501039_0063229 Ga0501039_0063229_427_1596 387
2343 3300049576 Ga0501040_0000302 Ga0501040_0000302_8493_9662 387
2344 3300049577 Ga0501041_0000776 Ga0501041_0000776_1294_2463 387
2345 3300049577 Ga0501041_0036218 Ga0501041_0036218_1626_2795 387
2346 3300049577 Ga0501041_0050856 Ga0501041_0050856_927_2096 387
2347 3300049579 Ga0501043_0017849 Ga0501043_0017849_2188_3375 387
2348 3300049579 Ga0501043_0133179 Ga0501043_0133179_74_1249 387
2349 3300049579 Ga0501043_0192910 Ga0501043_0192910_359_1564 387
2350 3300049580 Ga0501046_0000992 Ga0501046_0000992_25306_26475 387
2351 3300049580 Ga0501046_0012729 Ga0501046_0012729_3348_4595 387
2352 3300049580 Ga0501046_0082316 Ga0501046_0082316_215_1420 387
2353 3300049581 Ga0501047_0006878 Ga0501047_0006878_144_1319 387
2354 3300049581 Ga0501047_0066749 Ga0501047_0066749_703_1878 387
2355 3300049581 Ga0501047_0068994 Ga0501047_0068994_1189_2376 387
2356 3300049581 Ga0501047_0072955 Ga0501047_0072955_770_1951 387
2357 3300049581 Ga0501047_0074314 Ga0501047_0074314_958_2133 387
2358 3300049581 Ga0501047_0091627 Ga0501047_0091627_1331_2527 387
2359 3300049582 Ga0501048_0002096 Ga0501048_0002096_6359_7528 387
2360 3300049583 Ga0501067_0015302 Ga0501067_0015302_1761_2930 387
2361 3300049583 Ga0501067_0049784 Ga0501067_0049784_373_1560 387
2362 3300049584 Ga0501068_0057009 Ga0501068_0057009_110_1279 387
2363 3300049584 Ga0501068_0063195 Ga0501068_0063195_597_1784 387
2364 3300049584 Ga0501068_0106085 Ga0501068_0106085_164_1345 387
2365 3300049585 Ga0501069_0000753 Ga0501069_0000753_7352_8521 387
2366 3300049585 Ga0501069_0002492 Ga0501069_0002492_2727_3908 387
2367 3300049586 Ga0501070_0001170 Ga0501070_0001170_1874_3055 387
2368 3300049586 Ga0501070_0004788 Ga0501070_0004788_1086_2267 387
2369 3300049586 Ga0501070_0007363 Ga0501070_0007363_1460_2629 387
2370 3300049586 Ga0501070_0037102 Ga0501070_0037102_1842_3011 387
2371 3300049586 Ga0501070_0063680 Ga0501070_0063680_71_1252 387
2372 3300049586 Ga0501070_0171365 Ga0501070_0171365_299_1546 387
2373 3300049587 Ga0501071_0005763 Ga0501071_0005763_6387_7556 387
2374 3300049588 Ga0501072_0002409 Ga0501072_0002409_11299_12468 387
2375 3300049588 Ga0501072_0030616 Ga0501072_0030616_218_1387 387
2376 3300049589 Ga0501073_0005923 Ga0501073_0005923_42_1211 387
2377 3300049589 Ga0501073_0007998 Ga0501073_0007998_1355_2524 387
2378 3300049589 Ga0501073_0009999 Ga0501073_0009999_1033_2220 387
2379 3300049589 Ga0501073_0167617 Ga0501073_0167617_75_1244 387
2380 3300049590 Ga0501074_0000574 Ga0501074_0000574_4790_5959 387
2381 3300049590 Ga0501074_0005553 Ga0501074_0005553_6457_7626 387
2382 3300049590 Ga0501074_0032692 Ga0501074_0032692_1269_2450 387
2383 3300049590 Ga0501074_0088725 Ga0501074_0088725_494_1663 387
2384 3300049590 Ga0501074_0130966 Ga0501074_0130966_164_1345 387
2385 3300049591 Ga0501075_0000045 Ga0501075_0000045_35851_37020 387
2386 3300049591 Ga0501075_0006755 Ga0501075_0006755_6665_7834 387
2387 3300049591 Ga0501075_0010485 Ga0501075_0010485_5171_6340 387
2388 3300049591 Ga0501075_0043416 Ga0501075_0043416_1391_2566 387
2389 3300049591 Ga0501075_0067208 Ga0501075_0067208_1345_2514 387
2390 3300049592 Ga0501076_0000394 Ga0501076_0000394_17109_18278 387
2391 3300049592 Ga0501076_0001383 Ga0501076_0001383_8500_9669 387
2392 3300049593 Ga0501077_0000629 Ga0501077_0000629_13505_14674 387
2393 3300049661 Ga0501217_018736 Ga0501217_018736_156_1325 387
2394 3300049741 Ga0501079_0000771 Ga0501079_0000771_4642_5841 387
2395 3300049741 Ga0501079_0003366 Ga0501079_0003366_1188_2357 387
2396 3300049741 Ga0501079_0026665 Ga0501079_0026665_1675_2844 387
2397 3300049741 Ga0501079_0110325 Ga0501079_0110325_379_1560 387
2398 3300049742 Ga0501080_0009055 Ga0501080_0009055_6808_7977 387
2399 3300049742 Ga0501080_0009317 Ga0501080_0009317_161_1330 387
2400 3300049742 Ga0501080_0011191 Ga0501080_0011191_472_1653 387
2401 3300049742 Ga0501080_0021145 Ga0501080_0021145_3479_4666 387
2402 3300049742 Ga0501080_0038140 Ga0501080_0038140_67_1236 387
2403 3300049742 Ga0501080_0045623 Ga0501080_0045623_2129_3298 387
2404 3300049742 Ga0501080_0073094 Ga0501080_0073094_1525_2724 387
2405 3300049742 Ga0501080_0121069 Ga0501080_0121069_1191_2372 387
2406 3300049742 Ga0501080_0129611 Ga0501080_0129611_1031_2212 387
2407 3300049743 Ga0501081_0002316 Ga0501081_0002316_283_1452 387
2408 3300049743 Ga0501081_0002657 Ga0501081_0002657_1352_2521 387
2409 3300049743 Ga0501081_0022931 Ga0501081_0022931_1674_2873 387
2410 3300049744 Ga0501083_0005518 Ga0501083_0005518_5930_7099 387
2411 3300049822 Ga0501035_0001502 Ga0501035_0001502_3152_4333 387
2412 3300049822 Ga0501035_0003296 Ga0501035_0003296_4206_5387 387
2413 3300049822 Ga0501035_0013856 Ga0501035_0013856_372_1553 387
2414 3300049822 Ga0501035_0055851 Ga0501035_0055851_2273_3469 387
2415 3300049822 Ga0501035_0103110 Ga0501035_0103110_122_1303 387
2416 3300049822 Ga0501035_0161886 Ga0501035_0161886_564_1745 387
2417 3300049822 Ga0501035_0165034 Ga0501035_0165034_461_1657 387
2418 3300049823 Ga0501044_0005438 Ga0501044_0005438_9246_10427 387
2419 3300049823 Ga0501044_0005924 Ga0501044_0005924_10349_11524 387
2420 3300049823 Ga0501044_0009435 Ga0501044_0009435_2646_3827 387
2421 3300049823 Ga0501044_0032581 Ga0501044_0032581_1346_2521 387
2422 3300049823 Ga0501044_0041563 Ga0501044_0041563_1535_2710 387
2423 3300049823 Ga0501044_0043991 Ga0501044_0043991_255_1451 387
2424 3300049823 Ga0501044_0044170 Ga0501044_0044170_778_1959 387
2425 3300049823 Ga0501044_0047523 Ga0501044_0047523_1561_2742 387
2426 3300049823 Ga0501044_0063388 Ga0501044_0063388_775_1962 387
2427 3300049823 Ga0501044_0064532 Ga0501044_0064532_1438_2619 387
2428 3300049823 Ga0501044_0080009 Ga0501044_0080009_1030_2226 387
2429 3300049823 Ga0501044_0138081 Ga0501044_0138081_14_1219 387
2430 3300049824 Ga0501045_0001370 Ga0501045_0001370_13397_14566 387
2431 3300049824 Ga0501045_0013789 Ga0501045_0013789_253_1422 387
2432 3300050489 nmdc:mga03683_44495_c1 nmdc:mga03683_44495_c1_431_1606 387
2433 3300050491 nmdc:mga00v17_14534_c1 nmdc:mga00v17_14534_c1_2740_3945 387
2434 3300050491 nmdc:mga00v17_50376_c1 nmdc:mga00v17_50376_c1_555_1730 387
2435 3300050492 nmdc:mga0yw44_23947_c1 nmdc:mga0yw44_23947_c1_1000_2205 387
2436 3300050492 nmdc:mga0yw44_98522_c1 nmdc:mga0yw44_98522_c1_106_1311 387
2437 3300050493 nmdc:mga0k408_11361_c1 nmdc:mga0k408_11361_c1_1267_2442 387
2438 3300050493 nmdc:mga0k408_4350_c1 nmdc:mga0k408_4350_c1_3074_4243 387
2439 3300050493 nmdc:mga0k408_47203_c1 nmdc:mga0k408_47203_c1_627_1847 387
2440 3300050493 nmdc:mga0k408_51080_c1 nmdc:mga0k408_51080_c1_1192_2367 387
2441 3300050493 nmdc:mga0k408_5246_c1 nmdc:mga0k408_5246_c1_1787_2956 387
2442 3300050493 nmdc:mga0k408_55909_c1 nmdc:mga0k408_55909_c1_387_1562 387
2443 3300050494 nmdc:mga06z11_3297_c1 nmdc:mga06z11_3297_c1_2848_4053 387
2444 3300050494 nmdc:mga06z11_7489_c1 nmdc:mga06z11_7489_c1_2691_3896 387
2445 3300050495 nmdc:mga04h51_615_c1 nmdc:mga04h51_615_c1_3136_4311 387
2446 3300050496 nmdc:mga07m45_20783_c1 nmdc:mga07m45_20783_c1_2285_3460 387
2447 3300050496 nmdc:mga07m45_3394_c1 nmdc:mga07m45_3394_c1_3301_4476 387
2448 3300050496 nmdc:mga07m45_66050_c1 nmdc:mga07m45_66050_c1_494_1669 387
2449 3300050496 nmdc:mga07m45_6981_c2 nmdc:mga07m45_6981_c2_1100_2275 387
2450 3300050496 nmdc:mga07m45_9756_c1 nmdc:mga07m45_9756_c1_1897_3072 387
2451 3300050507 nmdc:mga05p37_11294_c1 nmdc:mga05p37_11294_c1_2926_4131 387
2452 3300050507 nmdc:mga05p37_181569_c1 nmdc:mga05p37_181569_c1_498_1667 387
2453 3300050507 nmdc:mga05p37_223699_c1 nmdc:mga05p37_223699_c1_949_2151 387
2454 3300050507 nmdc:mga05p37_228563_c1 nmdc:mga05p37_228563_c1_479_1690 387
2455 3300050507 nmdc:mga05p37_3076_c1 nmdc:mga05p37_3076_c1_725_1894 387
2456 3300050507 nmdc:mga05p37_5061_c2 nmdc:mga05p37_5061_c2_256_1461 387
2457 3300050508 nmdc:mga09592_1195_c1 nmdc:mga09592_1195_c1_13242_14411 387
2458 3300050508 nmdc:mga09592_128738_c1 nmdc:mga09592_128738_c1_209_1378 387
2459 3300050508 nmdc:mga09592_158136_c1 nmdc:mga09592_158136_c1_739_1908 387
2460 3300050508 nmdc:mga09592_315_c1 nmdc:mga09592_315_c1_29544_30713 387
2461 3300050509 nmdc:mga0qj67_24464_c1 nmdc:mga0qj67_24464_c1_2818_3987 387
2462 3300050509 nmdc:mga0qj67_29101_c1 nmdc:mga0qj67_29101_c1_1432_2604 387
2463 3300050509 nmdc:mga0qj67_30531_c1 nmdc:mga0qj67_30531_c1_25_1203 387
2464 3300050509 nmdc:mga0qj67_38505_c1 nmdc:mga0qj67_38505_c1_959_2128 387
2465 3300050509 nmdc:mga0qj67_52587_c1 nmdc:mga0qj67_52587_c1_643_1848 387
2466 3300050509 nmdc:mga0qj67_64958_c1 nmdc:mga0qj67_64958_c1_1040_2209 387
2467 3300050509 nmdc:mga0qj67_8966_c1 nmdc:mga0qj67_8966_c1_2273_3442 387
2468 3300050510 nmdc:mga06r32_315564_c1 nmdc:mga06r32_315564_c1_206_1375 387
2469 3300050510 nmdc:mga06r32_4869_c1 nmdc:mga06r32_4869_c1_5854_7059 387
2470 3300050510 nmdc:mga06r32_74946_c1 nmdc:mga06r32_74946_c1_893_2062 387
2471 3300050510 nmdc:mga06r32_93662_c1 nmdc:mga06r32_93662_c1_1020_2198 387
2472 3300050511 nmdc:mga08y16_147_c1 nmdc:mga08y16_147_c1_34901_36076 387
2473 3300050511 nmdc:mga08y16_148913_c1 nmdc:mga08y16_148913_c1_1083_2252 387
2474 3300050511 nmdc:mga08y16_19131_c1 nmdc:mga08y16_19131_c1_3848_5053 387
2475 3300050511 nmdc:mga08y16_23263_c1 nmdc:mga08y16_23263_c1_4994_6199 387
2476 3300050511 nmdc:mga08y16_262278_c1 nmdc:mga08y16_262278_c1_263_1459 387
2477 3300050511 nmdc:mga08y16_303975_c1 nmdc:mga08y16_303975_c1_259_1470 387
2478 3300050511 nmdc:mga08y16_334982_c1 nmdc:mga08y16_334982_c1_158_1363 387
2479 3300050512 nmdc:mga0n895_1137_c1 nmdc:mga0n895_1137_c1_4989_6158 387
2480 3300050512 nmdc:mga0n895_1601_c1 nmdc:mga0n895_1601_c1_3124_4329 387
2481 3300050512 nmdc:mga0n895_19648_c1 nmdc:mga0n895_19648_c1_675_1880 387
2482 3300050512 nmdc:mga0n895_219621_c1 nmdc:mga0n895_219621_c1_231_1406 387
2483 3300050512 nmdc:mga0n895_281803_c1 nmdc:mga0n895_281803_c1_101_1306 387
2484 3300050512 nmdc:mga0n895_283645_c1 nmdc:mga0n895_283645_c1_40_1209 387
2485 3300050513 nmdc:mga0rr50_1387_c1 nmdc:mga0rr50_1387_c1_3848_5017 387
2486 3300050513 nmdc:mga0rr50_15574_c1 nmdc:mga0rr50_15574_c1_2622_3827 387
2487 3300050513 nmdc:mga0rr50_9578_c1 nmdc:mga0rr50_9578_c1_2821_3990 387
2488 3300050514 nmdc:mga08x19_101351_c1 nmdc:mga08x19_101351_c1_606_1775 387
2489 3300050514 nmdc:mga08x19_15247_c1 nmdc:mga08x19_15247_c1_3131_4306 387
2490 3300050514 nmdc:mga08x19_38857_c1 nmdc:mga08x19_38857_c1_644_1819 387
2491 3300050514 nmdc:mga08x19_52035_c1 nmdc:mga08x19_52035_c1_554_1723 387
2492 3300050514 nmdc:mga08x19_60938_c1 nmdc:mga08x19_60938_c1_880_2049 387
2493 3300050514 nmdc:mga08x19_9079_c1 nmdc:mga08x19_9079_c1_401_1570 387
2494 3300050515 nmdc:mga0a205_44270_c1 nmdc:mga0a205_44270_c1_2598_3767 387
2495 3300050515 nmdc:mga0a205_56652_c1 nmdc:mga0a205_56652_c1_431_1600 387
2496 3300050515 nmdc:mga0a205_91052_c1 nmdc:mga0a205_91052_c1_821_2026 387
2497 3300050516 nmdc:mga0sz30_6728_c1 nmdc:mga0sz30_6728_c1_276_1451 387
2498 3300053077 Ga0495601_0000024 Ga0495601_0000024_105915_107132 387
2499 3300053077 Ga0495601_0011833 Ga0495601_0011833_76_1245 387
2500 3300053077 Ga0495601_0052433 Ga0495601_0052433_265_1440 387
2501 3300053078 Ga0495612_0000079 Ga0495612_0000079_12820_14037 387
2502 3300053078 Ga0495612_0009187 Ga0495612_0009187_271_1551 387
2503 3300053079 Ga0500610_0000484 Ga0500610_0000484_10803_11978 387
2504 3300053079 Ga0500610_0000504 Ga0500610_0000504_5554_6729 387
2505 3300053084 Ga0495595_0000036 Ga0495595_0000036_26735_27952 387
2506 3300053084 Ga0495595_0004673 Ga0495595_0004673_3996_5165 387
2507 3300053085 Ga0495619_0000034 Ga0495619_0000034_93731_94948 387
2508 3300053085 Ga0495619_0091938 Ga0495619_0091938_483_1658 387
2509 3300053086 Ga0500578_0000085 Ga0500578_0000085_17591_18766 387
2510 3300053088 Ga0500644_0000705 Ga0500644_0000705_10107_11282 387
2511 3300053093 Ga0500651_0002090 Ga0500651_0002090_8771_9946 387
2512 3300053094 Ga0500566_0027781 Ga0500566_0027781_1337_2512 387
2513 3300053096 Ga0500641_0015280 Ga0500641_0015280_892_2061 387
2514 3300053130 Ga0500642_0034477 Ga0500642_0034477_280_1515 387
2515 3300053131 Ga0500652_000572 Ga0500652_000572_1835_3010 387
2516 3300053153 Ga0500616_0067300 Ga0500616_0067300_172_1407 387
2517 3300053153 Ga0500616_0109324 Ga0500616_0109324_19_1236 387
2518 3300053156 Ga0500622_0000080 Ga0500622_0000080_83294_84469 387
2519 3300053156 Ga0500622_0012388 Ga0500622_0012388_2949_4229 387
2520 3300053158 Ga0500627_0001388 Ga0500627_0001388_5284_6459 387
2521 3300053178 Ga0500637_0034605 Ga0500637_0034605_162_1337 387
2522 3300053178 Ga0500637_0047688 Ga0500637_0047688_422_1597 387
2523 3300054114 Ga0501084_0002016 Ga0501084_0002016_14229_15428 387
2524 3300054114 Ga0501084_0006846 Ga0501084_0006846_3481_4650 387
2525 3300054114 Ga0501084_0053845 Ga0501084_0053845_1768_2937 387
2526 3300054114 Ga0501084_0201797 Ga0501084_0201797_249_1436 387
2527 3300055283 Ga0500661_000179 Ga0500661_000179_8673_9848 387
2528 3300059424 Ga0590075_006645 Ga0590075_006645_1018_2193 387
2529 3300059426 Ga0590077_003920 Ga0590077_003920_832_2001 387
2530 3300060353 Ga0501082_0021180 Ga0501082_0021180_1331_2530 387
2531 3300060353 Ga0501082_0040245 Ga0501082_0040245_1859_3028 387
2532 3300060353 Ga0501082_0104768 Ga0501082_0104768_395_1582 387
2533 3300060353 Ga0501082_0116984 Ga0501082_0116984_634_1845 387
2534 3300060353 Ga0501082_0247636 Ga0501082_0247636_333_1502 387
2535 3300061734 Ga0530510_0000797 Ga0530510_0000797_10024_11193 387
2536 3300061734 Ga0530510_0004236 Ga0530510_0004236_4004_5173 387
2537 iso_pu_bacteria 2643221733 2644728641 387
2538 iso_pu_bacteria 2643221736 2644747271 387
2539 iso_pu_bacteria 2738541281 2738745014 387
2540 iso_pu_bacteria 2738543032 2739354244 387
2541 iso_pu_bacteria 2828305725 2828306077 387
2542 iso_pu_bacteria 2829745981 2829749646 387
2543 iso_pu_bacteria 2841760612 2841761990 387
2544 iso_pu_bacteria 2841911363 2841911893 387
2545 iso_pu_bacteria 2841917233 2841921346 387
2546 iso_pu_bacteria 2844104063 2844105015 387
2547 iso_pu_bacteria 2851182111 2851183500 387
2548 iso_pu_bacteria 2851246043 2851248003 387
2549 iso_pu_bacteria 2889306138 2889307427 387
2550 iso_pu_bacteria 643348564 643601374 387
2551 iso_pu_bacteria 8057529695 8057529846 387

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04295

GD_AH_second

D-galactarate dehydratase/Altronate hydrolase, second domain

46

171

0.98

PF20629

GD_AH_C

D-galactarate/Altronate dehydratase, C-terminal

180

426

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6u7l-assembly2.cif.gz_D 2.75 angstrom crystal structure of galactarate dehydratase from escherichia coli. 0.8662 1 382
6u7l-assembly1.cif.gz_A 2.75 angstrom crystal structure of galactarate dehydratase from escherichia coli. 0.8578 5 382
6u7l-assembly2.cif.gz_C 2.75 angstrom crystal structure of galactarate dehydratase from escherichia coli. 0.8577 1 382
6u7l-assembly1.cif.gz_B 2.75 angstrom crystal structure of galactarate dehydratase from escherichia coli. 0.8519 5 382
6u7l-assembly2.cif.gz_D 2.75 angstrom crystal structure of galactarate dehydratase from escherichia coli. 0.7718 1 382
ID Description Score Start End Superfamily
af_Q9VIG6_88_328_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.765 66 110 3.40.50.720
1yb1B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.6733 21 110 3.40.50.720
3o8qB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.6517 18 110 3.40.50.720
2ewmB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.6517 18 126 3.40.50.720
af_Q59RC4_2_267_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.6492 17 110 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2W5F9U5-F1-model_v4 deleted 0.998 8 135
AF-A0A6B1GNR9-F1-model_v4 UxaA family hydrolase 0.9968 8 126 GO:0016787
GO:0016829
GO:0019698
AF-A0A0F2SGY8-F1-model_v4 D-galactarate dehydratase 0.9968 6 122 GO:0016829
GO:0019698
AF-A0A836QDN6-F1-model_v4 D-galactarate dehydratase 0.9962 8 95 GO:0016829
GO:0019698
AF-A0A259D836-F1-model_v4 D-galactarate dehydratase 0.9947 5 145 GO:0016829
GO:0019698

Feature Viewer

pLDDT pTM Quality
94.07 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map