metagRoot

F496645

General Info

Members	Datasets	Scaffolds	Average Seq Length
2289	671	2194	289

Family's Representative Sequence

Representative Sequence	3300006358\|Ga0068871_100096655\|Ga0068871_1000966553
Length	338
Sequence	MKTYFNGRRSRCVNQSSRAGTCRTRTRFRCRAGTLQSRPPVDSHCDTRLDLSTFLVQCLNAVQYGLLLFLVASGLTLIFGIMGVINLAHGSFYMLGAYLAFALAPWFGDWFLMRLVAGVALAAIFGYLLEWVFFSFLYERDHLQQVLLTYALILVFEELRSLAVGNDVHGVAAPAWLAGGFHLGGLMEYPWYRVFASAACLVVALALYAVVNRTRLGMMIRAGASNRDMVRGLGVDIRRLYRIVFAGGVALAALAGMIAAPLSSVYPGMGSSVLIICFVVVVIGGIGSITGALVASLLVGFVDTFGKVFFAEWSGVGVYVLMAIVLVWRPEGLMKRGF

Samples

	Sample ID	Description	Type	Environment
1	2162886007	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1	Metagenome	Rhizosphere
2	2162886012	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1	Metagenome	Rhizosphere
3	2209111006	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1	Metagenome	Rhizosphere
4	2513020051	Variovorax sp. CF313	Isolate	Rhizosphere
5	2513237150	Cupriavidus taiwanensis STM6018	Isolate	Nodule
6	2513237165	Cupriavidus neocaledonicus STM6070	Isolate	Nodule
7	2534681786	Brucella suis 92/29	Isolate	Unclassified
8	2574179768	Azoarcus communis DSM 12120	Isolate	Unclassified
9	2585428057	Methylibium sp. YR605	Isolate	Rhizosphere
10	2585428058	Methylibium sp. CF468	Isolate	Rhizosphere
11	2585428062	Methylibium sp. CF059	Isolate	Rhizosphere
12	2588253510	Rhizobacter sp. OV335	Isolate	Rhizosphere
13	2599185214	Variovorax sp. NFACC26	Isolate	Rhizoplane
14	2599185226	Variovorax sp. NFACC27	Isolate	Rhizoplane
15	2599185227	Variovorax sp. NFACC28	Isolate	Rhizoplane
16	2599185229	Variovorax sp. NFACC29	Isolate	Endosphere
17	2599185292	Achromobacter sp. NFACC18-2	Isolate	Rhizoplane
18	2600255389	Pseudomonas sp. NFPP33	Isolate	Rhizoplane
19	2643221569	Achromobacter sp. Root565	Isolate	Unclassified
20	2643221592	Rhizobacter sp. Root16D2	Isolate	Unclassified
21	2643221594	Achromobacter sp. Root170	Isolate	Unclassified
22	2643221603	Noviherbaspirillum sp. Root189	Isolate	Unclassified
23	2643221621	Achromobacter sp. Root83	Isolate	Unclassified
24	2643221625	Rhizobacter sp. Root29	Isolate	Unclassified
25	2643221628	Variovorax sp. Root318D1	Isolate	Unclassified
26	2643221644	Rhizobacter sp. Root1221	Isolate	Unclassified
27	2643221648	Rhizobacter sp. Root1238	Isolate	Unclassified
28	2643221654	Rhizobacter sp. Root404	Isolate	Unclassified
29	2643221658	Variovorax sp. Root411	Isolate	Unclassified
30	2643221672	Variovorax sp. Root434	Isolate	Unclassified
31	2643221683	Variovorax sp. Root473	Isolate	Unclassified
32	2721755523	Delftia sp. HK171	Isolate	Unclassified
33	2738541277	Variovorax sp. GV051	Isolate	Unclassified
34	2738541307	Variovorax sp. GV008	Isolate	Unclassified
35	2738543013	Variovorax sp. BT01	Isolate	Unclassified
36	2738543019	Variovorax sp. GV040	Isolate	Unclassified
37	2808606379	Pseudomonas sp. SJZ079	Isolate	Rhizosphere
38	2808606395	Achromobacter sp. SLBN-14	Isolate	Unclassified
39	2818991446	Variovorax sp. 1180	Isolate	Unclassified
40	2831265667	Variovorax guangxiensis DSM 27352	Isolate	Rhizosphere
41	2834641062	Cupriavidus gilardii JZ4	Isolate	Unclassified
42	2838054893	Variovorax guangxiensis 34/80	Isolate	Nodule
43	2839138175	Delftia acidovorans B15	Isolate	Rhizosphere
44	2842677519	Variovorax sp. R-72495	Isolate	Unclassified
45	2842733646	Variovorax sp. R-72446	Isolate	Unclassified
46	2842747753	Variovorax sp. R-72060	Isolate	Unclassified
47	2854911287	Brucella lupini LUP21	Isolate	Unclassified
48	2857537821	Achromobacter sp. R-71975	Isolate	Unclassified
49	2857542790	Achromobacter sp. R-72367	Isolate	Unclassified
50	2858950400	Achromobacter sp. K91	Isolate	Unclassified
51	2881927736	Candidimonas sp. SYP-B2681	Isolate	Rhizosphere
52	2885192300	Variovorax sp. MHTC-1	Isolate	Rhizosphere
53	2885198086	Variovorax sp. 679	Isolate	Unclassified
54	2885211737	Variovorax sp. 553	Isolate	Unclassified
55	2887375801	Parapusillimonas sp. SGNA-6	Isolate	Rhizosphere
56	2894023352	Diaphorobacter ruginosibacter DSM 27467	Isolate	Nodule
57	2895511927	Pseudoxanthomonas sp. SGD-5-1	Isolate	Rhizosphere
58	2899924645	Variovorax sp. 369	Isolate	Unclassified
59	2901300506	Cupriavidus sp. UYMSc13B	Isolate	Unclassified
60	2904449895	Variovorax sp. 1763	Isolate	Rhizosphere
61	2904456579	Variovorax sp. 2002	Isolate	Unclassified
62	2904541872	Variovorax sp. 1615	Isolate	Rhizosphere
63	2919462493	Variovorax sp. 3319	Isolate	Rhizosphere
64	2928037797	Variovorax sp. 1126	Isolate	Unclassified
65	2928044640	Variovorax sp. 1128	Isolate	Unclassified
66	2928051484	Variovorax sp. 1133	Isolate	Unclassified
67	2928064002	Variovorax sp. 1140	Isolate	Rhizosphere
68	2928070936	Variovorax gossypii 1167	Isolate	Unclassified
69	2928084124	Variovorax paradoxus 1218	Isolate	Unclassified
70	2928115317	Pseudacidovorax sp. 1753	Isolate	Rhizosphere
71	2929160207	Variovorax sp. R-72349 Hybrid assembly	Isolate	Unclassified
72	2929520902	Variovorax beijingensis 502	Isolate	Unclassified
73	2941479691
74	2945909444	Variovorax sp. CRF3-Va-1 W1I1	Isolate	Rhizosphere
75	2945945610	Variovorax paradoxus W1I18	Isolate	Rhizosphere
76	2945972063	Variovorax paradoxus W2I8	Isolate	Rhizosphere
77	2945984333	Variovorax sp. W2I14	Isolate	Rhizosphere
78	2954767861	Variovorax sp. TBS-050B	Isolate	Rhizosphere
79	2996310559	Mesorhizobium zhangyense CGMCC 1.15528	Isolate	Unclassified
80	3300000041	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere	Metagenome	Rhizosphere
81	3300000042	Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young	Metagenome	Rhizosphere
82	3300000043	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere	Metagenome	Rhizosphere
83	3300000044	Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old	Metagenome	Rhizosphere
84	3300000652	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA	Metagenome	Rhizosphere
85	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
86	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
87	3300001991	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2	Metagenome	Rhizosphere
88	3300002739	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA	Metagenome	Endosphere
89	3300002773	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS	Metagenome	Endosphere
90	3300002774	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA	Metagenome	Endosphere
91	3300002987	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB	Metagenome	Endosphere
92	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
93	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
94	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
95	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
96	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
97	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
98	3300003374	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF	Metagenome	Endosphere
99	3300003759	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2	Metagenome	Endosphere
100	3300003761	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2	Metagenome	Endosphere
101	3300003762	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2	Metagenome	Endosphere
102	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
103	3300003773	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2	Metagenome	Endosphere
104	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
105	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
106	3300003784	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2	Metagenome	Endosphere
107	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
108	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
109	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
110	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
111	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
112	3300005276	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1	Metagenome	Rhizosphere
113	3300005277	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2)	Metagenome	Rhizosphere
114	3300005288	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
115	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
116	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
117	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
118	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
119	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
120	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
121	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
122	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
123	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
124	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
125	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
126	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
127	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
128	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
129	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
130	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
131	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
132	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
133	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
134	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
135	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
136	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
137	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
138	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
139	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
140	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
141	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
142	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
143	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
144	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
145	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
146	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
147	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
148	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
149	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
150	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
151	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
152	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
153	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
154	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
155	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
156	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
157	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
158	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
159	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
160	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
161	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
162	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
163	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
164	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
165	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
166	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
167	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
168	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
169	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
170	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
171	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
172	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
173	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
174	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
175	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
176	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
177	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
178	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
179	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
180	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
181	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
182	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
183	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
184	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
185	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
186	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
187	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
188	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
189	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
190	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
191	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
192	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
193	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
194	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
195	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
196	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
197	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
198	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
199	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
200	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
201	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
202	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
203	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
204	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
205	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
206	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
207	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
208	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
209	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
210	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
211	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
212	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
213	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
214	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
215	3300006948	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15	Metagenome	Nodule
216	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
217	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
218	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
219	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
220	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
221	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
222	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
223	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
224	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
225	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
226	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
227	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
228	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
229	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
230	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
231	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
232	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
233	3300012512	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510	Metagenome	Rhizosphere
234	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
235	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
236	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
237	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
238	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
239	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
240	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
241	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
242	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
243	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
244	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
245	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
246	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
247	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
248	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
249	3300015683	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04	Metagenome	Rhizosphere
250	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
251	3300020082	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
252	3300021377	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7	Metagenome	Unclassified
253	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
254	3300025208	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
255	3300025228	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
256	3300025229	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
257	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
258	3300025242	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
259	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
260	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
261	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
262	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
263	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
264	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
265	3300025290	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2)	Metagenome	Rhizosphere
266	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
267	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
268	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
269	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
270	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
271	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
272	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
273	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
274	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
275	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
276	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
277	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
278	3300025711	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
279	3300025728	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
280	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
281	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
282	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
283	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
284	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
285	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
286	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
287	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
288	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
289	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
290	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
291	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
292	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
293	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
294	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
295	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
296	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
297	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
298	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
299	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
300	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
301	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
302	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
303	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
304	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
305	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
306	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
307	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
308	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
309	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
310	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
311	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
312	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
313	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
314	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
315	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
316	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
317	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
318	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
319	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
320	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
321	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
322	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
323	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
324	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
325	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
326	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
327	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
328	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
329	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
330	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
331	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
332	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
333	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
334	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
335	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
336	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
337	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
338	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
339	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
340	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
341	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
342	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
343	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
344	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
345	3300027378	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2)	Metagenome	Rhizosphere
346	3300027395	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2)	Metagenome	Rhizosphere
347	3300027462	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2)	Metagenome	Rhizosphere
348	3300027471	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
349	3300027526	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
350	3300027543	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
351	3300027614	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
352	3300027665	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
353	3300027666	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2)	Metagenome	Nodule
354	3300027671	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2)	Metagenome	Rhizosphere
355	3300027682	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
356	3300027695	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2)	Metagenome	Rhizosphere
357	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
358	3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
359	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
360	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
361	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
362	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
363	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
364	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
365	3300029957	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG	Metagenome	Rhizosphere
366	3300030522	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM	Metagenome	Unclassified
367	3300030731	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3	Metagenome	Rhizosphere
368	3300030732	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1	Metagenome	Rhizosphere
369	3300030733	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2	Metagenome	Rhizosphere
370	3300030734	Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5	Metagenome	Rhizosphere
371	3300030735	Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4	Metagenome	Rhizosphere
372	3300030742	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9	Metagenome	Rhizosphere
373	3300030744	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7	Metagenome	Rhizosphere
374	3300030745	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8	Metagenome	Rhizosphere
375	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
376	3300031239	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG	Metagenome	Rhizosphere
377	3300031240	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG	Metagenome	Rhizosphere
378	3300031242	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG	Metagenome	Rhizosphere
379	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
380	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
381	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
382	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
383	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
384	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
385	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
386	3300031649	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM	Metagenome	Unclassified
387	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
388	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
389	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
390	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
391	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
392	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
393	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
394	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
395	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
396	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
397	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
398	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
399	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
400	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
401	3300032133	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA	Metagenome	Rhizosphere
402	3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Metagenome	Unclassified
403	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
404	3300034816	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3	Metagenome	Rhizosphere
405	3300034818	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3	Metagenome	Rhizosphere
406	3300034819	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1	Metagenome	Rhizosphere
407	3300034820	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2	Metagenome	Rhizosphere
408	3300034957	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2	Metagenome	Rhizosphere
409	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
410	3300035084	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1	Metagenome	Rhizosphere
411	3300035085	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2	Metagenome	Rhizosphere
412	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
413	3300035090	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2	Metagenome	Rhizosphere
414	3300035091	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4	Metagenome	Rhizosphere
415	3300035092	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11	Metagenome	Rhizosphere
416	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
417	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
418	3300035115	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11	Metagenome	Rhizosphere
419	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
420	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
421	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
422	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
423	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
424	3300035207	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16	Metagenome	Rhizosphere
425	3300035241	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4	Metagenome	Rhizosphere
426	3300035242	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11	Metagenome	Rhizosphere
427	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
428	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
429	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
430	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
431	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
432	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
433	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
434	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
435	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
436	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
437	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
438	3300037588	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA	Metagenome	Rhizosphere
439	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
440	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
441	3300038996	Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19	Metagenome	Rhizosphere
442	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
443	3300041404	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272	Metagenome	Rhizosphere
444	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
445	3300041452	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG	Metagenome	Rhizoplane
446	3300041456	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG	Metagenome	Rhizoplane
447	3300041459	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG	Metagenome	Rhizoplane
448	3300041460	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG	Metagenome	Rhizoplane
449	3300041463	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG	Metagenome	Rhizoplane
450	3300041505	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG	Metagenome	Unclassified
451	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
452	3300041997	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607	Metagenome	Rhizosphere
453	3300041999	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297	Metagenome	Rhizosphere
454	3300042001	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542	Metagenome	Rhizosphere
455	3300042003	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551	Metagenome	Rhizosphere
456	3300042006	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437	Metagenome	Rhizosphere
457	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
458	3300042010	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431	Metagenome	Rhizosphere
459	3300042012	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213	Metagenome	Rhizosphere
460	3300042115	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642	Metagenome	Rhizosphere
461	3300042134	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126	Metagenome	Rhizosphere
462	3300042156	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593	Metagenome	Rhizosphere
463	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
464	3300042439	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363	Metagenome	Rhizosphere
465	3300042531	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253	Metagenome	Rhizosphere
466	3300042532	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92	Metagenome	Rhizosphere
467	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
468	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
469	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
470	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
471	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
472	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
473	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
474	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
475	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
476	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
477	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
478	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
479	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
480	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
481	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
482	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
483	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
484	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
485	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
486	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
487	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
488	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
489	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
490	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
491	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
492	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
493	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
494	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
495	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
496	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
497	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
498	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
499	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
500	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
501	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
502	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
503	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
504	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
505	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
506	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
507	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
508	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
509	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
510	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
511	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
512	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
513	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
514	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
515	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
516	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
517	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
518	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
519	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
520	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
521	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
522	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
523	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
524	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
525	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
526	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
527	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
528	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
529	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
530	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
531	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
532	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
533	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
534	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
535	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
536	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
537	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
538	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
539	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
540	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
541	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
542	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
543	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
544	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
545	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
546	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
547	3300048090	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere	Metagenome	Rhizosphere
548	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
549	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
550	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
551	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
552	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
553	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
554	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
555	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
556	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
557	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
558	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
559	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
560	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
561	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
562	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
563	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
564	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
565	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
566	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
567	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
568	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
569	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
570	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
571	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
572	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
573	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
574	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
575	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
576	3300049521	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought	Metagenome	Rhizosphere
577	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
578	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
579	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
580	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
581	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
582	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
583	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
584	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
585	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
586	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
587	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
588	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
589	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
590	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
591	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
592	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
593	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
594	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
595	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
596	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
597	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
598	3300049663	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought	Metagenome	Rhizosphere
599	3300049669	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought	Metagenome	Rhizosphere
600	3300049686	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control	Metagenome	Rhizosphere
601	3300049705	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought	Metagenome	Rhizosphere
602	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
603	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
604	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
605	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
606	3300049759	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought	Metagenome	Rhizosphere
607	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
608	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
609	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
610	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
611	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
612	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
613	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
614	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
615	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
616	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
617	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
618	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
619	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
620	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
621	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
622	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
623	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
624	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
625	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
626	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
627	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
628	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
629	3300053079	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere	Metagenome	Endosphere
630	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
631	3300053086	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere	Metagenome	Endosphere
632	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
633	3300053088	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere	Metagenome	Endosphere
634	3300053090	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere	Metagenome	Endosphere
635	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
636	3300053108	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere	Metagenome	Endosphere
637	3300053110	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere	Metagenome	Endosphere
638	3300053118	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere	Metagenome	Endosphere
639	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
640	3300053121	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere	Metagenome	Endosphere
641	3300053122	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere	Metagenome	Endosphere
642	3300053125	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere	Metagenome	Endosphere
643	3300053127	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere	Metagenome	Endosphere
644	3300053129	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere	Metagenome	Endosphere
645	3300053130	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere	Metagenome	Endosphere
646	3300053131	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere	Metagenome	Endosphere
647	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
648	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
649	3300053138	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere	Metagenome	Endosphere
650	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
651	3300053148	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere	Metagenome	Endosphere
652	3300053151	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere	Metagenome	Endosphere
653	3300053154	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere	Metagenome	Endosphere
654	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
655	3300053162	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere	Metagenome	Endosphere
656	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
657	3300053724	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere	Metagenome	Endosphere
658	3300053726	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere	Metagenome	Endosphere
659	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
660	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
661	3300059421	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
662	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
663	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
664	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere
665	639633007	Azoarcus olearius BH72	Isolate	Unclassified
666	644736347	Cupriavidus taiwanensis LMG 19424	Isolate	Nodule
667	8002392321	Alcaligenes faecalis Mc250	Isolate	Rhizosphere
668	8003400568	Cupriavidus gilardii USM5	Isolate	Rhizosphere
669	8006994254	Bradyrhizobium sp. sGM-13	Isolate	Nodule
670	8048746797	Alcaligenes endophyticus DSM 100498	Isolate	Unclassified
671	8055225921	Achromobacter panacis KCTC 42751	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	95.81
Metatranscriptomes	0.04
Isolates	4.15

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	11.88
Nodule	0.57
Rhizoplane	4.5
Rhizosphere	76.32
Stem	0
Stem Tuber	0
Unclassified	6.73

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	SwRhRL2b_contig_1457626	2162886007	Bacteria	1232
2	MBSR1b_contig_4714076	2162886012	Bacteria	2491
3	2214745213	2209111006	Bacteria	14741
4	ARcpr5oldR_c000161	3300000041	Bacteria	11680
5	ARSoilYngRDRAFT_c00108	3300000042	Bacteria	14041
6	ARcpr5yngRDRAFT_c000061	3300000043	Bacteria	17653
7	ARSoilOldRDRAFT_c000117	3300000044	Bacteria	14027
8	ARCol0yngRDRAFT_1000001	3300000652	Bacteria	73871
9	JGI24740J21852_10005722	3300001979	Bacteria	5228
10	JGI24739J22299_10008813	3300001989	Bacteria	3761
11	JGI24739J22299_10009661	3300001989	Bacteria	3590
12	JGI24743J22301_10021045	3300001991	Bacteria	1244
13	JGI25158J39367_1003518	3300002739	Bacteria	2415
14	JGI25152J39213_1001253	3300002773	Bacteria	11530
15	JGI25152J39213_1001586	3300002773	Bacteria	9538
16	JGI25152J39213_1010628	3300002773	Bacteria	2091
17	JGI25152J39213_1011607	3300002773	Bacteria	1940
18	JGI25150J39212_1003160	3300002774	Bacteria	3916
19	JGI25150J39212_1011130	3300002774	Bacteria	1643
20	JGI25159J45721_1004447	3300002987	Bacteria	4655
21	JGI25159J45721_1011000	3300002987	Bacteria	2253
22	JGI25151J46595_10002972	3300003187	Bacteria	9677
23	JGI25151J46595_10006701	3300003187	Bacteria	5744
24	JGI25151J46595_10031058	3300003187	Bacteria	2091
25	JGI25151J46595_10041136	3300003187	Bacteria	1684
26	JGI25406J46586_10001181	3300003203	Bacteria	12296
27	JGI25153J46596_10000537	3300003215	Bacteria	23734
28	JGI25153J46596_10002864	3300003215	Bacteria	9800
29	JGI25153J46596_10002916	3300003215	Bacteria	9681
30	JGI25153J46596_10011695	3300003215	Bacteria	3855
31	rootH2_10037427	3300003320	Bacteria	2980
32	rootH1_10261211	3300003323	Bacteria	2239
33	JGI25160J50197_1010751	3300003354	Bacteria	3288
34	JGI25160J50197_1017638	3300003354	Bacteria	2253
35	JGI25161J50226_1002157	3300003374	Bacteria	5263
36	JGI25161J50226_1005118	3300003374	Bacteria	2608
37	Ga0055525_1000084	3300003759	Bacteria	155319
38	Ga0055535_1000214	3300003761	Bacteria	61307
39	Ga0055542_1000003	3300003762	Bacteria	582721
40	Ga0055526_1000296	3300003771	Bacteria	41724
41	Ga0055526_1003606	3300003771	Bacteria	9712
42	Ga0055526_1004146	3300003771	Bacteria	8829
43	Ga0055526_1005270	3300003771	Bacteria	7489
44	Ga0055526_1005702	3300003771	Bacteria	7057
45	Ga0055526_1021384	3300003771	Bacteria	2253
46	Ga0055526_1021418	3300003771	Bacteria	2249
47	Ga0055537_1000032	3300003773	Bacteria	98934
48	Ga0055537_1008964	3300003773	Bacteria	2253
49	Ga0055524_1002948	3300003775	Bacteria	8477
50	Ga0055524_1013650	3300003775	Bacteria	3056
51	Ga0055524_1013715	3300003775	Bacteria	3042
52	Ga0055524_1020189	3300003775	Bacteria	2253
53	Ga0055536_1000034	3300003781	Bacteria	148178
54	Ga0055536_1021843	3300003781	Bacteria	1928
55	Ga0055536_1025275	3300003781	Bacteria	1696
56	Ga0055536_1030433	3300003781	Bacteria	1432
57	Ga0055534_1000060	3300003784	Bacteria	83797
58	Ga0055534_1001438	3300003784	Bacteria	9465
59	Ga0055534_1001465	3300003784	Bacteria	9374
60	Ga0055534_1002718	3300003784	Bacteria	5959
61	Ga0055534_1007290	3300003784	Bacteria	2655
62	Ga0055528_1000709	3300003790	Bacteria	23641
63	Ga0055528_1003235	3300003790	Bacteria	8308
64	Ga0055530_10000593	3300003791	Bacteria	31324
65	Ga0055530_10013375	3300003791	Bacteria	2805
66	Ga0055540_1008887	3300003792	Bacteria	3553
67	Ga0055540_1017363	3300003792	Bacteria	2012
68	Ga0055531_10010279	3300003794	Bacteria	4673
69	Ga0055531_10024629	3300003794	Bacteria	2213
70	Ga0055531_10025954	3300003794	Bacteria	2106
71	Ga0065165_1001259	3300005262	Bacteria	28658
72	Ga0065165_1001709	3300005262	Bacteria	22025
73	Ga0065165_1020866	3300005262	Bacteria	2291
74	Ga0065717_1001950	3300005276	Bacteria	5765
75	Ga0065716_1001533	3300005277	Bacteria	8729
76	Ga0065714_10007916	3300005288	Bacteria	4545
77	Ga0065704_10070736	3300005289	Bacteria	16861
78	Ga0065704_10099840	3300005289	Bacteria	2295
79	Ga0065715_10088924	3300005293	Bacteria	28459
80	Ga0065715_10095703	3300005293	Bacteria	4023
81	Ga0065707_10087362	3300005295	Bacteria	5059
82	Ga0065707_10163286	3300005295	Bacteria	1544
83	Ga0065707_10170966	3300005295	Bacteria	1475
84	Ga0070658_10043713	3300005327	Bacteria	3619
85	Ga0070658_10050344	3300005327	Bacteria	3376
86	Ga0070676_10000391	3300005328	Bacteria	20347
87	Ga0070676_10006757	3300005328	Bacteria	6144
88	Ga0070676_10015700	3300005328	Bacteria	4179
89	Ga0070676_10021419	3300005328	Bacteria	3619
90	Ga0070676_10224696	3300005328	Bacteria	1242
91	Ga0070676_10267610	3300005328	Bacteria	1147
92	Ga0070683_100011630	3300005329	Bacteria	7618
93	Ga0070683_100023857	3300005329	Bacteria	5475
94	Ga0070683_100137095	3300005329	Bacteria	2318
95	Ga0070683_100167424	3300005329	Bacteria	2085
96	Ga0070690_100000906	3300005330	Bacteria	15097
97	Ga0070690_100049509	3300005330	Bacteria	2679
98	Ga0070690_100079841	3300005330	Bacteria	2139
99	Ga0070690_100146848	3300005330	Bacteria	1605
100	Ga0070670_100002107	3300005331	Bacteria	16321
101	Ga0070670_100002193	3300005331	Bacteria	16050
102	Ga0070670_100020501	3300005331	Bacteria	5684
103	Ga0070670_100034644	3300005331	Bacteria	4344
104	Ga0070670_100085339	3300005331	Bacteria	2712
105	Ga0070670_100090711	3300005331	Bacteria	2626
106	Ga0070670_100107258	3300005331	Bacteria	2407
107	Ga0070670_100197961	3300005331	Bacteria	1745
108	Ga0070670_100578236	3300005331	Bacteria	1004
109	Ga0070677_10000606	3300005333	Bacteria	12083
110	Ga0070677_10007362	3300005333	Bacteria	3671
111	Ga0070677_10016522	3300005333	Bacteria	2629
112	Ga0070677_10028045	3300005333	Bacteria	2124
113	Ga0068869_100000088	3300005334	Bacteria	42016
114	Ga0068869_100003548	3300005334	Bacteria	9580
115	Ga0068869_100007848	3300005334	Bacteria	6850
116	Ga0068869_100038322	3300005334	Bacteria	3415
117	Ga0068869_100050916	3300005334	Bacteria	3003
118	Ga0068869_100113851	3300005334	Bacteria	2061
119	Ga0068869_100127166	3300005334	Bacteria	1956
120	Ga0068869_100127943	3300005334	Bacteria	1949
121	Ga0068869_100338090	3300005334	Bacteria	1225
122	Ga0068869_100370697	3300005334	Bacteria	1171
123	Ga0068869_100458735	3300005334	Bacteria	1057
124	Ga0068869_100587966	3300005334	Bacteria	939
125	Ga0070666_10002459	3300005335	Bacteria	11208
126	Ga0070666_10004459	3300005335	Bacteria	8526
127	Ga0070666_10006693	3300005335	Bacteria	7091
128	Ga0070666_10010978	3300005335	Bacteria	5676
129	Ga0070666_10026283	3300005335	Bacteria	3801
130	Ga0070666_10045179	3300005335	Bacteria	2952
131	Ga0070666_10152483	3300005335	Bacteria	1612
132	Ga0070680_100043978	3300005336	Bacteria	3628
133	Ga0070680_100168843	3300005336	Bacteria	1840
134	Ga0070682_100039169	3300005337	Bacteria	2911
135	Ga0070682_100155987	3300005337	Bacteria	1572
136	Ga0070682_100185724	3300005337	Bacteria	1456
137	Ga0068868_100001375	3300005338	Bacteria	16756
138	Ga0068868_100018583	3300005338	Bacteria	5200
139	Ga0068868_100045762	3300005338	Bacteria	3424
140	Ga0068868_100073552	3300005338	Bacteria	2729
141	Ga0068868_100084513	3300005338	Bacteria	2549
142	Ga0068868_100095640	3300005338	Bacteria	2398
143	Ga0068868_100110079	3300005338	Bacteria	2237
144	Ga0068868_100123875	3300005338	Bacteria	2110
145	Ga0068868_100264438	3300005338	Bacteria	1452
146	Ga0068868_100446584	3300005338	Bacteria	1124
147	Ga0070660_100008716	3300005339	Bacteria	7101
148	Ga0070660_100017450	3300005339	Bacteria	5232
149	Ga0070660_100119348	3300005339	Bacteria	2103
150	Ga0070660_100343502	3300005339	Bacteria	1228
151	Ga0070689_100002823	3300005340	Bacteria	11423
152	Ga0070689_100005385	3300005340	Bacteria	8729
153	Ga0070689_100046213	3300005340	Bacteria	3354
154	Ga0070689_100384725	3300005340	Bacteria	1183
155	Ga0070689_100535834	3300005340	Bacteria	1007
156	Ga0070691_10067066	3300005341	Bacteria	1735
157	Ga0070687_100005340	3300005343	Bacteria	5196
158	Ga0070687_100018097	3300005343	Bacteria	3251
159	Ga0070687_100054143	3300005343	Bacteria	2089
160	Ga0070687_100151467	3300005343	Bacteria	1362
161	Ga0070687_100200182	3300005343	Bacteria	1209
162	Ga0070661_100001471	3300005344	Bacteria	16352
163	Ga0070661_100024209	3300005344	Bacteria	4354
164	Ga0070661_100024608	3300005344	Bacteria	4319
165	Ga0070661_100048358	3300005344	Bacteria	3113
166	Ga0070661_100103206	3300005344	Bacteria	2123
167	Ga0070661_100163528	3300005344	Bacteria	1686
168	Ga0070692_10014151	3300005345	Bacteria	3737
169	Ga0070692_10110906	3300005345	Bacteria	1517
170	Ga0070692_10237110	3300005345	Bacteria	1085
171	Ga0070668_100002898	3300005347	Bacteria	12665
172	Ga0070668_100043333	3300005347	Bacteria	3451
173	Ga0070668_100103415	3300005347	Bacteria	2259
174	Ga0070668_100151191	3300005347	Bacteria	1877
175	Ga0070668_100221162	3300005347	Bacteria	1562
176	Ga0070669_100003151	3300005353	Bacteria	11858
177	Ga0070669_100005505	3300005353	Bacteria	9140
178	Ga0070669_100008378	3300005353	Bacteria	7376
179	Ga0070669_100169443	3300005353	Bacteria	1701
180	Ga0070669_100265687	3300005353	Bacteria	1370
181	Ga0070675_100001304	3300005354	Bacteria	18230
182	Ga0070675_100001941	3300005354	Bacteria	15304
183	Ga0070675_100004787	3300005354	Bacteria	10320
184	Ga0070675_100022354	3300005354	Bacteria	5053
185	Ga0070675_100116465	3300005354	Bacteria	2267
186	Ga0070675_100153973	3300005354	Bacteria	1973
187	Ga0070675_100155625	3300005354	Bacteria	1962
188	Ga0070675_100168134	3300005354	Bacteria	1890
189	Ga0070671_100000593	3300005355	Bacteria	25873
190	Ga0070671_100001446	3300005355	Bacteria	17727
191	Ga0070671_100003963	3300005355	Bacteria	11657
192	Ga0070671_100016505	3300005355	Bacteria	5969
193	Ga0070671_100033190	3300005355	Bacteria	4268
194	Ga0070671_100039722	3300005355	Bacteria	3906
195	Ga0070671_100041084	3300005355	Bacteria	3843
196	Ga0070671_100044146	3300005355	Bacteria	3703
197	Ga0070671_100057993	3300005355	Bacteria	3223
198	Ga0070671_100063192	3300005355	Bacteria	3083
199	Ga0070671_100091940	3300005355	Bacteria	2542
200	Ga0070671_100092086	3300005355	Viruses	2540
201	Ga0070671_100097892	3300005355	Bacteria	2460
202	Ga0070674_100000201	3300005356	Bacteria	28830
203	Ga0070674_100007388	3300005356	Bacteria	6481
204	Ga0070674_100311724	3300005356	Bacteria	1258
205	Ga0070674_100532957	3300005356	Bacteria	983
206	Ga0070673_100003709	3300005364	Bacteria	9567
207	Ga0070673_100004425	3300005364	Bacteria	8889
208	Ga0070673_100006521	3300005364	Bacteria	7591
209	Ga0070673_100072773	3300005364	Bacteria	2765
210	Ga0070673_100137573	3300005364	Bacteria	2057
211	Ga0070673_100174122	3300005364	Bacteria	1838
212	Ga0070673_100329509	3300005364	Bacteria	1350
213	Ga0070688_100001955	3300005365	Bacteria	10357
214	Ga0070688_100005502	3300005365	Bacteria	6679
215	Ga0070688_100022181	3300005365	Bacteria	3717
216	Ga0070659_100029706	3300005366	Bacteria	4225
217	Ga0070659_100102620	3300005366	Bacteria	2303
218	Ga0070659_100108850	3300005366	Bacteria	2236
219	Ga0070659_100127094	3300005366	Bacteria	2069
220	Ga0070659_100140593	3300005366	Bacteria	1965
221	Ga0070659_100162832	3300005366	Bacteria	1825
222	Ga0070659_100185245	3300005366	Bacteria	1709
223	Ga0070659_100186590	3300005366	Bacteria	1703
224	Ga0070659_100188624	3300005366	Bacteria	1694
225	Ga0070659_100191489	3300005366	Bacteria	1681
226	Ga0070659_100258678	3300005366	Bacteria	1444
227	Ga0070667_100005618	3300005367	Bacteria	10474
228	Ga0070667_100007168	3300005367	Bacteria	9264
229	Ga0070667_100008795	3300005367	Bacteria	8366
230	Ga0070667_100013950	3300005367	Bacteria	6642
231	Ga0070667_100034428	3300005367	Bacteria	4237
232	Ga0070667_100062975	3300005367	Bacteria	3142
233	Ga0070667_100098598	3300005367	Bacteria	2522
234	Ga0070667_100241377	3300005367	Bacteria	1613
235	Ga0070667_100357336	3300005367	Bacteria	1323
236	Ga0070709_10038489	3300005434	Bacteria	2929
237	Ga0070709_10061061	3300005434	Bacteria	2398
238	Ga0070709_10183677	3300005434	Bacteria	1470
239	Ga0070714_100012691	3300005435	Bacteria	6729
240	Ga0070714_100020064	3300005435	Bacteria	5453
241	Ga0070714_100172847	3300005435	Bacteria	1962
242	Ga0070713_100000039	3300005436	Bacteria	83384
243	Ga0070713_100471617	3300005436	Bacteria	1181
244	Ga0070701_10004963	3300005438	Bacteria	5447
245	Ga0070701_10188622	3300005438	Bacteria	1212
246	Ga0070711_100040074	3300005439	Bacteria	3157
247	Ga0070711_100115323	3300005439	Bacteria	1978
248	Ga0070700_100005635	3300005441	Bacteria	6641
249	Ga0070700_100065617	3300005441	Unclassified	2302
250	Ga0070700_100158279	3300005441	Bacteria	1556
251	Ga0070700_100261710	3300005441	Bacteria	1246
252	Ga0070700_100302639	3300005441	Bacteria	1168
253	Ga0070694_100173423	3300005444	Unclassified	1590
254	Ga0070694_100253043	3300005444	Bacteria	1333
255	Ga0070694_100278332	3300005444	Bacteria	1275
256	Ga0070694_100287667	3300005444	Bacteria	1255
257	Ga0070708_100000304	3300005445	Bacteria	36884
258	Ga0070708_100000615	3300005445	Bacteria	26906
259	Ga0070708_100018056	3300005445	Bacteria	5900
260	Ga0070708_100034201	3300005445	Bacteria	4421
261	Ga0070708_100091388	3300005445	Bacteria	2772
262	Ga0070708_100476456	3300005445	Bacteria	1178
263	Ga0070663_100006193	3300005455	Bacteria	7169
264	Ga0070663_100009190	3300005455	Bacteria	6112
265	Ga0070663_100043485	3300005455	Bacteria	3162
266	Ga0070663_100103215	3300005455	Bacteria	2131
267	Ga0070663_100133553	3300005455	Bacteria	1887
268	Ga0070663_100139408	3300005455	Bacteria	1850
269	Ga0070663_100258788	3300005455	Bacteria	1380
270	Ga0070678_100001356	3300005456	Bacteria	13003
271	Ga0070678_100002691	3300005456	Bacteria	9797
272	Ga0070678_100002724	3300005456	Bacteria	9748
273	Ga0070678_100005698	3300005456	Bacteria	7236
274	Ga0070678_100008496	3300005456	Bacteria	6151
275	Ga0070678_100009176	3300005456	Bacteria	5975
276	Ga0070678_100027276	3300005456	Bacteria	3877
277	Ga0070678_100085148	3300005456	Bacteria	2408
278	Ga0070678_100401601	3300005456	Bacteria	1191
279	Ga0070662_100000588	3300005457	Bacteria	22119
280	Ga0070662_100001613	3300005457	Bacteria	13924
281	Ga0070662_100013092	3300005457	Bacteria	5513
282	Ga0070662_100014665	3300005457	Bacteria	5237
283	Ga0070662_100080620	3300005457	Bacteria	2423
284	Ga0070681_10004285	3300005458	Bacteria	13543
285	Ga0070681_10004363	3300005458	Bacteria	13453
286	Ga0070681_10007825	3300005458	Bacteria	10453
287	Ga0070681_10017118	3300005458	Bacteria	7246
288	Ga0070681_10050303	3300005458	Bacteria	4158
289	Ga0070681_10055942	3300005458	Bacteria	3927
290	Ga0070681_10066669	3300005458	Bacteria	3569
291	Ga0070681_10082095	3300005458	Bacteria	3178
292	Ga0070681_10304662	3300005458	Bacteria	1503
293	Ga0068867_100000054	3300005459	Bacteria	69032
294	Ga0068867_100001887	3300005459	Bacteria	14584
295	Ga0068867_100005899	3300005459	Bacteria	8690
296	Ga0068867_100025429	3300005459	Bacteria	4248
297	Ga0068867_100029307	3300005459	Bacteria	3965
298	Ga0068867_100188111	3300005459	Bacteria	1646
299	Ga0068867_100344712	3300005459	Bacteria	1241
300	Ga0068867_100350051	3300005459	Bacteria	1232
301	Ga0070685_10101114	3300005466	Bacteria	1761
302	Ga0070706_100000143	3300005467	Bacteria	90046
303	Ga0070706_100034247	3300005467	Bacteria	4691
304	Ga0070706_100046148	3300005467	Bacteria	4022
305	Ga0070706_100079059	3300005467	Bacteria	3044
306	Ga0070706_100124971	3300005467	Bacteria	2398
307	Ga0070707_100010752	3300005468	Bacteria	8525
308	Ga0070707_100050123	3300005468	Bacteria	4002
309	Ga0070707_100096753	3300005468	Bacteria	2859
310	Ga0070698_100025713	3300005471	Bacteria	6133
311	Ga0070698_100035249	3300005471	Bacteria	5175
312	Ga0070698_100189249	3300005471	Bacteria	1996
313	Ga0070699_100011027	3300005518	Bacteria	7817
314	Ga0070699_100021806	3300005518	Bacteria	5521
315	Ga0070699_100023015	3300005518	Bacteria	5368
316	Ga0070679_100003663	3300005530	Bacteria	14067
317	Ga0070679_100014873	3300005530	Bacteria	7476
318	Ga0070679_100028965	3300005530	Bacteria	5463
319	Ga0070679_100034687	3300005530	Bacteria	5002
320	Ga0070679_100088011	3300005530	Bacteria	3093
321	Ga0070679_100107109	3300005530	Bacteria	2781
322	Ga0070679_100161700	3300005530	Bacteria	2213
323	Ga0070679_100168851	3300005530	Bacteria	2160
324	Ga0070679_100236580	3300005530	Bacteria	1785
325	Ga0070684_100001493	3300005535	Bacteria	16888
326	Ga0070684_100012411	3300005535	Bacteria	6828
327	Ga0070684_100140178	3300005535	Bacteria	2186
328	Ga0070684_100224384	3300005535	Bacteria	1715
329	Ga0070697_100004634	3300005536	Bacteria	10553
330	Ga0070697_100008684	3300005536	Bacteria	7936
331	Ga0070697_100025833	3300005536	Bacteria	4685
332	Ga0070697_100030989	3300005536	Bacteria	4299
333	Ga0070697_100036111	3300005536	Bacteria	3991
334	Ga0070697_100320329	3300005536	Bacteria	1335
335	Ga0068853_100002256	3300005539	Bacteria	14410
336	Ga0068853_100006675	3300005539	Bacteria	9191
337	Ga0068853_100007872	3300005539	Bacteria	8547
338	Ga0068853_100010568	3300005539	Bacteria	7464
339	Ga0068853_100016500	3300005539	Bacteria	6079
340	Ga0068853_100024582	3300005539	Bacteria	5052
341	Ga0068853_100137048	3300005539	Bacteria	2195
342	Ga0068853_100228564	3300005539	Bacteria	1701
343	Ga0068853_100274503	3300005539	Bacteria	1553
344	Ga0070672_100000440	3300005543	Bacteria	24267
345	Ga0070672_100015510	3300005543	Bacteria	5428
346	Ga0070672_100049199	3300005543	Bacteria	3278
347	Ga0070672_100050586	3300005543	Bacteria	3237
348	Ga0070672_100056773	3300005543	Bacteria	3072
349	Ga0070672_100214316	3300005543	Bacteria	1614
350	Ga0070686_100008902	3300005544	Bacteria	5628
351	Ga0070686_100403204	3300005544	Bacteria	1041
352	Ga0070695_100010479	3300005545	Bacteria	5534
353	Ga0070695_100028277	3300005545	Bacteria	3478
354	Ga0070695_100036914	3300005545	Bacteria	3077
355	Ga0070695_100201031	3300005545	Bacteria	1424
356	Ga0070696_100009755	3300005546	Bacteria	6426
357	Ga0070696_100011139	3300005546	Bacteria	6017
358	Ga0070696_100025634	3300005546	Bacteria	4009
359	Ga0070696_100097466	3300005546	Bacteria	2103
360	Ga0070693_100001242	3300005547	Bacteria	11520
361	Ga0070693_100007569	3300005547	Bacteria	5314
362	Ga0070693_100017281	3300005547	Bacteria	3747
363	Ga0070693_100044192	3300005547	Bacteria	2519
364	Ga0070693_100215604	3300005547	Bacteria	1255
365	Ga0070665_100005927	3300005548	Bacteria	12519
366	Ga0070665_100011693	3300005548	Bacteria	8869
367	Ga0070665_100027097	3300005548	Bacteria	5772
368	Ga0070665_100068315	3300005548	Bacteria	3563
369	Ga0070665_100081444	3300005548	Bacteria	3243
370	Ga0070665_100226000	3300005548	Bacteria	1872
371	Ga0070704_100004576	3300005549	Bacteria	7996
372	Ga0070704_100007679	3300005549	Bacteria	6429
373	Ga0070704_100010601	3300005549	Bacteria	5612
374	Ga0070704_100094773	3300005549	Bacteria	2234
375	Ga0070704_100118977	3300005549	Bacteria	2025
376	Ga0070704_100417161	3300005549	Bacteria	1149
377	Ga0068855_100024953	3300005563	Bacteria	7154
378	Ga0068855_100026348	3300005563	Bacteria	6954
379	Ga0068855_100038488	3300005563	Bacteria	5682
380	Ga0068855_100045292	3300005563	Bacteria	5203
381	Ga0068855_100062986	3300005563	Bacteria	4329
382	Ga0068855_100094127	3300005563	Bacteria	3455
383	Ga0068855_100146689	3300005563	Bacteria	2685
384	Ga0068855_100495983	3300005563	Bacteria	1327
385	Ga0068855_100642410	3300005563	Bacteria	1140
386	Ga0070664_100001859	3300005564	Bacteria	16917
387	Ga0070664_100006403	3300005564	Bacteria	9495
388	Ga0070664_100011691	3300005564	Bacteria	7124
389	Ga0070664_100016251	3300005564	Bacteria	6101
390	Ga0070664_100058843	3300005564	Bacteria	3269
391	Ga0070664_100184729	3300005564	Bacteria	1855
392	Ga0070664_100236518	3300005564	Bacteria	1639
393	Ga0070664_100249729	3300005564	Bacteria	1594
394	Ga0070664_100265375	3300005564	Bacteria	1545
395	Ga0068857_100005684	3300005577	Bacteria	10660
396	Ga0068857_100006543	3300005577	Bacteria	9999
397	Ga0068857_100038253	3300005577	Bacteria	4249
398	Ga0068857_100084563	3300005577	Bacteria	2835
399	Ga0068857_100114396	3300005577	Bacteria	2426
400	Ga0068857_100140372	3300005577	Bacteria	2184
401	Ga0068857_100277225	3300005577	Bacteria	1542
402	Ga0068854_100032939	3300005578	Bacteria	3610
403	Ga0068854_100040539	3300005578	Bacteria	3286
404	Ga0068854_100052753	3300005578	Bacteria	2917
405	Ga0068854_100076833	3300005578	Bacteria	2455
406	Ga0068854_100169143	3300005578	Bacteria	1699
407	Ga0068854_100179586	3300005578	Bacteria	1653
408	Ga0068854_100211608	3300005578	Bacteria	1529
409	Ga0068854_100358249	3300005578	Bacteria	1196
410	Ga0068856_100000125	3300005614	Bacteria	77301
411	Ga0068856_100019198	3300005614	Bacteria	6636
412	Ga0068856_100023404	3300005614	Bacteria	6005
413	Ga0068856_100032430	3300005614	Bacteria	5114
414	Ga0068856_100040315	3300005614	Bacteria	4586
415	Ga0068856_100041028	3300005614	Bacteria	4547
416	Ga0068856_100097870	3300005614	Bacteria	2923
417	Ga0068856_100193554	3300005614	Bacteria	2047
418	Ga0068856_100509722	3300005614	Bacteria	1224
419	Ga0070702_100032028	3300005615	Bacteria	2882
420	Ga0070702_100055341	3300005615	Bacteria	2287
421	Ga0070702_100155617	3300005615	Bacteria	1472
422	Ga0070702_100222149	3300005615	Bacteria	1264
423	Ga0068852_100000927	3300005616	Bacteria	19389
424	Ga0068852_100018572	3300005616	Bacteria	5481
425	Ga0068852_100031765	3300005616	Bacteria	4364
426	Ga0068852_100046908	3300005616	Bacteria	3683
427	Ga0068852_100061107	3300005616	Bacteria	3273
428	Ga0068852_100066829	3300005616	Bacteria	3141
429	Ga0068852_100086594	3300005616	Bacteria	2793
430	Ga0068852_100112814	3300005616	Bacteria	2474
431	Ga0068852_100142779	3300005616	Bacteria	2218
432	Ga0068852_100156637	3300005616	Bacteria	2122
433	Ga0068852_100161164	3300005616	Bacteria	2095
434	Ga0068852_100302171	3300005616	Bacteria	1549
435	Ga0068852_100355038	3300005616	Bacteria	1432
436	Ga0068859_100000842	3300005617	Bacteria	31185
437	Ga0068859_100003385	3300005617	Bacteria	16220
438	Ga0068859_100039080	3300005617	Bacteria	4759
439	Ga0068859_100068523	3300005617	Bacteria	3582
440	Ga0068859_100079418	3300005617	Bacteria	3321
441	Ga0068859_100093631	3300005617	Bacteria	3056
442	Ga0068859_100110821	3300005617	Bacteria	2807
443	Ga0068859_100275875	3300005617	Bacteria	1774
444	Ga0068859_100438227	3300005617	Bacteria	1403
445	Ga0068864_100000600	3300005618	Bacteria	30574
446	Ga0068864_100002269	3300005618	Bacteria	15904
447	Ga0068864_100002962	3300005618	Bacteria	14024
448	Ga0068864_100006508	3300005618	Bacteria	9574
449	Ga0068864_100009205	3300005618	Bacteria	8145
450	Ga0068864_100011819	3300005618	Bacteria	7210
451	Ga0068864_100287776	3300005618	Bacteria	1535
452	Ga0068866_10002432	3300005718	Bacteria	7684
453	Ga0068861_100001494	3300005719	Bacteria	14837
454	Ga0068861_100005623	3300005719	Bacteria	8502
455	Ga0068861_100009410	3300005719	Bacteria	6744
456	Ga0068861_100040105	3300005719	Bacteria	3499
457	Ga0068861_100042778	3300005719	Bacteria	3396
458	Ga0068861_100077229	3300005719	Bacteria	2597
459	Ga0068861_100115188	3300005719	Bacteria	2160
460	Ga0068861_100178395	3300005719	Bacteria	1766
461	Ga0068861_100282460	3300005719	Bacteria	1430
462	Ga0068861_100475410	3300005719	Bacteria	1125
463	Ga0068861_100502828	3300005719	Bacteria	1096
464	Ga0068851_10009724	3300005834	Bacteria	4479
465	Ga0068851_10013560	3300005834	Bacteria	3857
466	Ga0068851_10022408	3300005834	Bacteria	3076
467	Ga0068851_10022951	3300005834	Bacteria	3045
468	Ga0068851_10027681	3300005834	Bacteria	2795
469	Ga0068851_10028918	3300005834	Bacteria	2740
470	Ga0068851_10034764	3300005834	Bacteria	2516
471	Ga0068851_10058348	3300005834	Bacteria	1972
472	Ga0068870_10003700	3300005840	Bacteria	6499
473	Ga0068870_10013984	3300005840	Bacteria	3782
474	Ga0068870_10055380	3300005840	Bacteria	2113
475	Ga0068870_10177068	3300005840	Bacteria	1277
476	Ga0068870_10225799	3300005840	Bacteria	1149
477	Ga0068863_100000563	3300005841	Bacteria	37653
478	Ga0068863_100003635	3300005841	Bacteria	15241
479	Ga0068863_100009243	3300005841	Bacteria	9615
480	Ga0068863_100035890	3300005841	Bacteria	4721
481	Ga0068863_100062473	3300005841	Bacteria	3522
482	Ga0068863_100094189	3300005841	Bacteria	2843
483	Ga0068863_100101250	3300005841	Bacteria	2738
484	Ga0068863_100110744	3300005841	Bacteria	2615
485	Ga0068863_100151243	3300005841	Bacteria	2221
486	Ga0068858_100001163	3300005842	Bacteria	27276
487	Ga0068858_100001205	3300005842	Bacteria	26800
488	Ga0068858_100006317	3300005842	Bacteria	11539
489	Ga0068858_100006818	3300005842	Bacteria	11109
490	Ga0068858_100011781	3300005842	Bacteria	8249
491	Ga0068858_100017199	3300005842	Bacteria	6786
492	Ga0068858_100074661	3300005842	Bacteria	3148
493	Ga0068858_100128915	3300005842	Bacteria	2371
494	Ga0068858_100169248	3300005842	Bacteria	2060
495	Ga0068858_100172541	3300005842	Bacteria	2040
496	Ga0068858_100178246	3300005842	Bacteria	2006
497	Ga0068860_100001371	3300005843	Bacteria	26459
498	Ga0068860_100004352	3300005843	Bacteria	14472
499	Ga0068860_100006557	3300005843	Bacteria	11686
500	Ga0068860_100012818	3300005843	Bacteria	8241
501	Ga0068860_100012937	3300005843	Bacteria	8198
502	Ga0068860_100016350	3300005843	Bacteria	7235
503	Ga0068860_100062535	3300005843	Bacteria	3537
504	Ga0068860_100077587	3300005843	Bacteria	3159
505	Ga0068860_100167209	3300005843	Bacteria	2123
506	Ga0068860_100201777	3300005843	Bacteria	1927
507	Ga0068860_100205011	3300005843	Bacteria	1912
508	Ga0068860_100226659	3300005843	Bacteria	1815
509	Ga0068862_100021951	3300005844	Bacteria	5339
510	Ga0068862_100027746	3300005844	Bacteria	4766
511	Ga0068862_100027751	3300005844	Bacteria	4765
512	Ga0068862_100077164	3300005844	Bacteria	2884
513	Ga0068862_100115814	3300005844	Bacteria	2357
514	Ga0081455_10000015	3300005937	Bacteria	189655
515	Ga0081455_10000029	3300005937	Bacteria	155672
516	Ga0081455_10010700	3300005937	Bacteria	9278
517	Ga0081455_10078545	3300005937	Bacteria	2712
518	Ga0081455_10206818	3300005937	Bacteria	1465
519	Ga0081540_1000048	3300005983	Bacteria	127924
520	Ga0081539_10000240	3300005985	Bacteria	128629
521	Ga0081539_10028128	3300005985	Bacteria	3542
522	Ga0081539_10032224	3300005985	Bacteria	3213
523	Ga0075368_10001254	3300006042	Bacteria	8031
524	Ga0075368_10028768	3300006042	Bacteria	2148
525	Ga0075368_10069370	3300006042	Bacteria	1422
526	Ga0075368_10124497	3300006042	Bacteria	1069
527	Ga0075363_100001766	3300006048	Bacteria	8446
528	Ga0075363_100051956	3300006048	Bacteria	2187
529	Ga0075363_100077699	3300006048	Bacteria	1812
530	Ga0075363_100104012	3300006048	Bacteria	1573
531	Ga0075363_100124762	3300006048	Bacteria	1440
532	Ga0075364_10006926	3300006051	Bacteria	6695
533	Ga0075364_10007690	3300006051	Bacteria	6412
534	Ga0075364_10020128	3300006051	Bacteria	4196
535	Ga0075364_10037081	3300006051	Bacteria	3154
536	Ga0075364_10114253	3300006051	Bacteria	1804
537	Ga0070716_100004852	3300006173	Bacteria	6466
538	Ga0070716_100287738	3300006173	Bacteria	1137
539	Ga0070712_100002121	3300006175	Bacteria	12197
540	Ga0070712_100156028	3300006175	Bacteria	1758
541	Ga0070712_100431459	3300006175	Bacteria	1094
542	Ga0075362_10000620	3300006177	Bacteria	10385
543	Ga0075362_10007525	3300006177	Bacteria	4128
544	Ga0075362_10026179	3300006177	Bacteria	2489
545	Ga0075362_10069717	3300006177	Bacteria	1603
546	Ga0075367_10007568	3300006178	Bacteria	5571
547	Ga0075367_10018096	3300006178	Bacteria	3881
548	Ga0075367_10084597	3300006178	Bacteria	1923
549	Ga0075369_10041614	3300006186	Bacteria	1967
550	Ga0075369_10045403	3300006186	Bacteria	1889
551	Ga0075366_10001800	3300006195	Bacteria	10831
552	Ga0075366_10007260	3300006195	Bacteria	6109
553	Ga0075366_10016446	3300006195	Bacteria	4252
554	Ga0075366_10022502	3300006195	Bacteria	3667
555	Ga0075366_10039835	3300006195	Bacteria	2778
556	Ga0075366_10051849	3300006195	Bacteria	2438
557	Ga0075366_10100607	3300006195	Bacteria	1735
558	Ga0075366_10112210	3300006195	Bacteria	1640
559	Ga0075366_10172658	3300006195	Bacteria	1312
560	Ga0097621_100012544	3300006237	Bacteria	6287
561	Ga0097621_100025092	3300006237	Bacteria	4661
562	Ga0097621_100030405	3300006237	Bacteria	4274
563	Ga0097621_100077553	3300006237	Bacteria	2758
564	Ga0097621_100090774	3300006237	Bacteria	2556
565	Ga0097621_100167617	3300006237	Bacteria	1891
566	Ga0097621_100199495	3300006237	Bacteria	1736
567	Ga0097621_100204994	3300006237	Bacteria	1713
568	Ga0097621_100243345	3300006237	Bacteria	1573
569	Ga0097621_100274484	3300006237	Bacteria	1482
570	Ga0075370_10000641	3300006353	Bacteria	13565
571	Ga0075370_10001516	3300006353	Bacteria	10153
572	Ga0075370_10002089	3300006353	Bacteria	9098
573	Ga0075370_10002548	3300006353	Bacteria	8479
574	Ga0075370_10024886	3300006353	Bacteria	3309
575	Ga0075370_10046360	3300006353	Bacteria	2460
576	Ga0068871_100006840	3300006358	Bacteria	8115
577	Ga0068871_100006844	3300006358	Bacteria	8114
578	Ga0068871_100022953	3300006358	Bacteria	4818
579	Ga0068871_100096655	3300006358	Bacteria	2468
580	Ga0068871_100203748	3300006358	Bacteria	1709
581	Ga0068871_100253175	3300006358	Bacteria	1534
582	Ga0068871_100282408	3300006358	Bacteria	1453
583	Ga0068871_100386863	3300006358	Bacteria	1243
584	Ga0075428_100036099	3300006844	Bacteria	5446
585	Ga0075428_100083235	3300006844	Bacteria	3491
586	Ga0075428_100361476	3300006844	Bacteria	1557
587	Ga0075428_100503804	3300006844	Bacteria	1295
588	Ga0075430_100109328	3300006846	Bacteria	2306
589	Ga0075430_100381127	3300006846	Bacteria	1164
590	Ga0075431_100007582	3300006847	Bacteria	10804
591	Ga0075431_100051213	3300006847	Bacteria	4259
592	Ga0075431_100060942	3300006847	Bacteria	3894
593	Ga0075433_10014578	3300006852	Bacteria	6426
594	Ga0075433_10017348	3300006852	Bacteria	5961
595	Ga0075433_10133522	3300006852	Bacteria	2206
596	Ga0075433_10137967	3300006852	Bacteria	2168
597	Ga0075433_10175538	3300006852	Bacteria	1907
598	Ga0075433_10195370	3300006852	Bacteria	1800
599	Ga0075433_10240037	3300006852	Bacteria	1609
600	Ga0075434_100003210	3300006871	Bacteria	14577
601	Ga0075434_100006779	3300006871	Bacteria	10528
602	Ga0075434_100009326	3300006871	Bacteria	9145
603	Ga0075434_100107085	3300006871	Bacteria	2806
604	Ga0075434_100117072	3300006871	Bacteria	2678
605	Ga0075434_100127299	3300006871	Bacteria	2564
606	Ga0075434_100406953	3300006871	Bacteria	1382
607	Ga0075434_100620293	3300006871	Bacteria	1100
608	Ga0075429_100001541	3300006880	Bacteria	18884
609	Ga0075429_100068148	3300006880	Bacteria	3097
610	Ga0075429_100106717	3300006880	Bacteria	2447
611	Ga0075429_100439610	3300006880	Unclassified	1143
612	Ga0068865_100017670	3300006881	Bacteria	4591
613	Ga0068865_100025275	3300006881	Bacteria	3904
614	Ga0068865_100046535	3300006881	Bacteria	2977
615	Ga0068865_100049945	3300006881	Bacteria	2887
616	Ga0068865_100055317	3300006881	Bacteria	2760
617	Ga0068865_100057151	3300006881	Bacteria	2721
618	Ga0068865_100202864	3300006881	Bacteria	1540
619	Ga0075436_100000758	3300006914	Bacteria	21349
620	Ga0075436_100033426	3300006914	Bacteria	3545
621	Ga0075436_100155073	3300006914	Bacteria	1613
622	Ga0097620_100000842	3300006931	Bacteria	31185
623	Ga0097620_100003385	3300006931	Bacteria	16220
624	Ga0097620_100039080	3300006931	Bacteria	4759
625	Ga0097620_100068529	3300006931	Bacteria	3582
626	Ga0097620_100079415	3300006931	Bacteria	3321
627	Ga0097620_100093631	3300006931	Bacteria	3056
628	Ga0097620_100110823	3300006931	Bacteria	2807
629	Ga0097620_100275879	3300006931	Bacteria	1774
630	Ga0097620_100438249	3300006931	Bacteria	1403
631	Ga0079104_1000008	3300006946	Bacteria	371223
632	Ga0079104_1000026	3300006946	Bacteria	216566
633	Ga0099826_10000004	3300006948	Bacteria	802669
634	Ga0075435_100011007	3300007076	Bacteria	6634
635	Ga0075435_100012216	3300007076	Bacteria	6351
636	Ga0075435_100040140	3300007076	Bacteria	3737
637	Ga0075435_100150574	3300007076	Bacteria	1956
638	Ga0075435_100266008	3300007076	Bacteria	1462
639	Ga0099794_10000102	3300007265	Bacteria	31387
640	Ga0099794_10008264	3300007265	Bacteria	4314
641	Ga0099794_10011022	3300007265	Bacteria	3861
642	Ga0099794_10049628	3300007265	Bacteria	2017
643	Ga0105250_10000043	3300009092	Bacteria	129336
644	Ga0105250_10009821	3300009092	Bacteria	4019
645	Ga0105240_10002655	3300009093	Bacteria	28451
646	Ga0105240_10014947	3300009093	Bacteria	10574
647	Ga0105240_10020324	3300009093	Bacteria	8860
648	Ga0105240_10032072	3300009093	Bacteria	6804
649	Ga0105240_10092046	3300009093	Bacteria	3703
650	Ga0105240_10099501	3300009093	Bacteria	3539
651	Ga0105240_10133853	3300009093	Bacteria	2970
652	Ga0105240_10241255	3300009093	Bacteria	2095
653	Ga0105240_10855692	3300009093	Bacteria	981
654	Ga0111539_10001182	3300009094	Bacteria	34658
655	Ga0111539_10002321	3300009094	Bacteria	25327
656	Ga0111539_10002947	3300009094	Bacteria	22580
657	Ga0111539_10037756	3300009094	Bacteria	5830
658	Ga0111539_10371572	3300009094	Bacteria	1664
659	Ga0111539_10793486	3300009094	Bacteria	1102
660	Ga0105245_10002540	3300009098	Bacteria	16450
661	Ga0105245_10012652	3300009098	Bacteria	7347
662	Ga0105245_10016178	3300009098	Bacteria	6500
663	Ga0105245_10033728	3300009098	Bacteria	4537
664	Ga0105245_10061554	3300009098	Bacteria	3384
665	Ga0105245_10215377	3300009098	Bacteria	1850
666	Ga0105245_10233392	3300009098	Bacteria	1780
667	Ga0105247_10035237	3300009101	Bacteria	3050
668	Ga0105247_10068183	3300009101	Bacteria	2218
669	Ga0114129_10006537	3300009147	Bacteria	16538
670	Ga0114129_10008335	3300009147	Bacteria	14783
671	Ga0114129_10024403	3300009147	Bacteria	8568
672	Ga0114129_10028035	3300009147	Bacteria	7977
673	Ga0114129_10044286	3300009147	Bacteria	6260
674	Ga0114129_10054390	3300009147	Bacteria	5612
675	Ga0114129_10115816	3300009147	Bacteria	3694
676	Ga0114129_10213794	3300009147	Bacteria	2605
677	Ga0114129_10307654	3300009147	Bacteria	2110
678	Ga0114129_10336713	3300009147	Bacteria	2002
679	Ga0114129_10361771	3300009147	Bacteria	1920
680	Ga0114129_10404780	3300009147	Bacteria	1798
681	Ga0114129_10443845	3300009147	Bacteria	1703
682	Ga0114129_10473037	3300009147	Bacteria	1641
683	Ga0114129_10587274	3300009147	Bacteria	1445
684	Ga0114129_10653881	3300009147	Bacteria	1356
685	Ga0105243_10002381	3300009148	Bacteria	15746
686	Ga0105243_10004681	3300009148	Bacteria	10771
687	Ga0105243_10006304	3300009148	Bacteria	9167
688	Ga0105243_10008486	3300009148	Bacteria	7888
689	Ga0105243_10015641	3300009148	Bacteria	5736
690	Ga0105243_10018080	3300009148	Bacteria	5333
691	Ga0105243_10025768	3300009148	Bacteria	4497
692	Ga0105243_10046539	3300009148	Bacteria	3413
693	Ga0105243_10098393	3300009148	Bacteria	2423
694	Ga0105243_10296610	3300009148	Bacteria	1463
695	Ga0105243_10544423	3300009148	Bacteria	1108
696	Ga0105241_10015130	3300009174	Bacteria	5651
697	Ga0105241_10074898	3300009174	Bacteria	2637
698	Ga0105241_10095134	3300009174	Bacteria	2358
699	Ga0105241_10156551	3300009174	Bacteria	1869
700	Ga0105241_10272939	3300009174	Unclassified	1441
701	Ga0105241_10443002	3300009174	Bacteria	1148
702	Ga0105242_10031545	3300009176	Bacteria	4234
703	Ga0105242_10067322	3300009176	Bacteria	2961
704	Ga0105242_10170127	3300009176	Bacteria	1914
705	Ga0105242_10271607	3300009176	Bacteria	1536
706	Ga0105248_10001562	3300009177	Bacteria	25458
707	Ga0105248_10001893	3300009177	Bacteria	23198
708	Ga0105248_10006238	3300009177	Bacteria	13070
709	Ga0105248_10019504	3300009177	Bacteria	7504
710	Ga0105248_10051818	3300009177	Bacteria	4605
711	Ga0105248_10080516	3300009177	Bacteria	3661
712	Ga0105248_10092775	3300009177	Bacteria	3400
713	Ga0105248_10105269	3300009177	Bacteria	3181
714	Ga0105248_10140257	3300009177	Bacteria	2727
715	Ga0105248_10140659	3300009177	Bacteria	2723
716	Ga0105248_10608529	3300009177	Bacteria	1233
717	Ga0105237_10002593	3300009545	Bacteria	22302
718	Ga0105237_10038743	3300009545	Bacteria	4813
719	Ga0105237_10052900	3300009545	Bacteria	4074
720	Ga0105237_10183572	3300009545	Bacteria	2092
721	Ga0105237_10259308	3300009545	Bacteria	1741
722	Ga0105237_10309497	3300009545	Bacteria	1583
723	Ga0105238_10000495	3300009551	Bacteria	41322
724	Ga0105238_10025456	3300009551	Bacteria	6032
725	Ga0105238_10119868	3300009551	Bacteria	2611
726	Ga0105238_10141124	3300009551	Bacteria	2386
727	Ga0105249_10066328	3300009553	Bacteria	3323
728	Ga0105249_10082091	3300009553	Bacteria	2999
729	Ga0105249_10105158	3300009553	Bacteria	2661
730	Ga0105249_10245639	3300009553	Bacteria	1772
731	Ga0105249_10315915	3300009553	Bacteria	1572
732	Ga0105249_10420002	3300009553	Bacteria	1371
733	Ga0105239_10009057	3300010375	Bacteria	11263
734	Ga0105239_10016753	3300010375	Bacteria	8101
735	Ga0105239_10023582	3300010375	Bacteria	6776
736	Ga0105239_10186948	3300010375	Bacteria	2318
737	Ga0105239_10293814	3300010375	Bacteria	1830
738	Ga0105239_10420616	3300010375	Bacteria	1514
739	Ga0105239_10694848	3300010375	Bacteria	1163
740	Ga0105246_10010893	3300011119	Bacteria	5637
741	Ga0105246_10023878	3300011119	Bacteria	3963
742	Ga0157327_1004310	3300012512	Bacteria	1095
743	Ga0157373_10014756	3300013100	Bacteria	5722
744	Ga0157373_10033080	3300013100	Bacteria	3722
745	Ga0157373_10037480	3300013100	Bacteria	3475
746	Ga0157373_10037772	3300013100	Bacteria	3461
747	Ga0157373_10041918	3300013100	Bacteria	3273
748	Ga0157373_10143764	3300013100	Bacteria	1677
749	Ga0157371_10001964	3300013102	Bacteria	20390
750	Ga0157371_10098400	3300013102	Bacteria	2074
751	Ga0157371_10109496	3300013102	Bacteria	1961
752	Ga0157371_10118120	3300013102	Bacteria	1885
753	Ga0157371_10375595	3300013102	Bacteria	1037
754	Ga0157370_10007420	3300013104	Bacteria	11936
755	Ga0157370_10013965	3300013104	Bacteria	8247
756	Ga0157370_10017294	3300013104	Bacteria	7279
757	Ga0157370_10022563	3300013104	Bacteria	6263
758	Ga0157370_10029385	3300013104	Bacteria	5394
759	Ga0157370_10031660	3300013104	Bacteria	5172
760	Ga0157370_10078939	3300013104	Bacteria	3100
761	Ga0157370_10130919	3300013104	Bacteria	2340
762	Ga0157369_10002424	3300013105	Bacteria	22421
763	Ga0157369_10009597	3300013105	Bacteria	11067
764	Ga0157369_10059325	3300013105	Bacteria	4126
765	Ga0157369_10113511	3300013105	Bacteria	2878
766	Ga0157369_10211306	3300013105	Bacteria	2033
767	Ga0157369_10268695	3300013105	Bacteria	1778
768	Ga0157369_10396095	3300013105	Bacteria	1433
769	Ga0157369_10402288	3300013105	Bacteria	1420
770	Ga0157369_10406345	3300013105	Bacteria	1412
771	Ga0157369_10647754	3300013105	Bacteria	1089
772	Ga0157374_10004423	3300013296	Bacteria	11817
773	Ga0157374_10090918	3300013296	Bacteria	2910
774	Ga0157374_10095637	3300013296	Bacteria	2840
775	Ga0157374_10127131	3300013296	Bacteria	2464
776	Ga0157374_10366705	3300013296	Bacteria	1433
777	Ga0157378_10039228	3300013297	Bacteria	4200
778	Ga0157378_10044669	3300013297	Bacteria	3935
779	Ga0157378_10067414	3300013297	Bacteria	3207
780	Ga0157378_10135579	3300013297	Bacteria	2282
781	Ga0157378_10149485	3300013297	Bacteria	2175
782	Ga0157378_10167350	3300013297	Bacteria	2060
783	Ga0157378_10371817	3300013297	Bacteria	1401
784	Ga0157378_10443091	3300013297	Bacteria	1288
785	Ga0157378_10460190	3300013297	Bacteria	1264
786	Ga0157378_10479869	3300013297	Bacteria	1239
787	Ga0163162_10007183	3300013306	Bacteria	10815
788	Ga0163162_10014002	3300013306	Bacteria	7839
789	Ga0163162_10020933	3300013306	Bacteria	6433
790	Ga0163162_10023312	3300013306	Bacteria	6109
791	Ga0163162_10048197	3300013306	Bacteria	4269
792	Ga0163162_10239747	3300013306	Bacteria	1944
793	Ga0163162_10287963	3300013306	Bacteria	1775
794	Ga0163162_10439195	3300013306	Bacteria	1437
795	Ga0163162_10466031	3300013306	Bacteria	1395
796	Ga0163162_10573286	3300013306	Bacteria	1256
797	Ga0157372_10003272	3300013307	Bacteria	17507
798	Ga0157372_10005319	3300013307	Bacteria	13670
799	Ga0157372_10014229	3300013307	Bacteria	8503
800	Ga0157372_10021247	3300013307	Bacteria	7011
801	Ga0157372_10055732	3300013307	Bacteria	4415
802	Ga0157372_10082225	3300013307	Bacteria	3646
803	Ga0157372_10086097	3300013307	Bacteria	3565
804	Ga0157372_10199052	3300013307	Bacteria	2320
805	Ga0157372_10244100	3300013307	Bacteria	2084
806	Ga0157372_10272963	3300013307	Bacteria	1965
807	Ga0157372_10518294	3300013307	Bacteria	1390
808	Ga0157372_10543692	3300013307	Bacteria	1354
809	Ga0157375_10013061	3300013308	Bacteria	7381
810	Ga0157375_10013698	3300013308	Bacteria	7228
811	Ga0157375_10017371	3300013308	Bacteria	6490
812	Ga0157375_10025762	3300013308	Bacteria	5472
813	Ga0157375_10030154	3300013308	Bacteria	5111
814	Ga0157375_10108943	3300013308	Bacteria	2865
815	Ga0157375_10131058	3300013308	Bacteria	2626
816	Ga0157375_10139844	3300013308	Bacteria	2547
817	Ga0157375_10141735	3300013308	Bacteria	2531
818	Ga0157375_10164288	3300013308	Bacteria	2364
819	Ga0157375_10329013	3300013308	Bacteria	1693
820	Ga0157375_10368717	3300013308	Bacteria	1602
821	Ga0157375_10399704	3300013308	Bacteria	1541
822	Ga0157375_10415321	3300013308	Bacteria	1512
823	Ga0157375_10424533	3300013308	Bacteria	1495
824	Ga0157375_10507743	3300013308	Bacteria	1370
825	Ga0157375_10523731	3300013308	Bacteria	1348
826	Ga0163163_10129929	3300014325	Bacteria	2559
827	Ga0163163_10252085	3300014325	Bacteria	1816
828	Ga0163163_10627800	3300014325	Bacteria	1138
829	Ga0157380_10016252	3300014326	Bacteria	5483
830	Ga0157380_10030281	3300014326	Bacteria	4144
831	Ga0157380_10034584	3300014326	Bacteria	3898
832	Ga0157380_10111279	3300014326	Bacteria	2302
833	Ga0157380_10184163	3300014326	Bacteria	1838
834	Ga0182008_10013286	3300014497	Bacteria	4329
835	Ga0182008_10046165	3300014497	Bacteria	2165
836	Ga0182008_10053004	3300014497	Bacteria	2009
837	Ga0157377_10000006	3300014745	Bacteria	419853
838	Ga0157377_10015859	3300014745	Bacteria	3862
839	Ga0157379_10000545	3300014968	Bacteria	30397
840	Ga0157379_10001006	3300014968	Bacteria	22858
841	Ga0157379_10010992	3300014968	Bacteria	7894
842	Ga0157379_10033934	3300014968	Bacteria	4549
843	Ga0157379_10042058	3300014968	Bacteria	4078
844	Ga0157379_10062082	3300014968	Bacteria	3342
845	Ga0157379_10101160	3300014968	Bacteria	2587
846	Ga0157379_10149145	3300014968	Bacteria	2109
847	Ga0157379_10167236	3300014968	Bacteria	1985
848	Ga0157379_10202321	3300014968	Bacteria	1796
849	Ga0157379_10255410	3300014968	Bacteria	1592
850	Ga0157379_10422148	3300014968	Viruses	1228
851	Ga0157376_10005203	3300014969	Bacteria	9077
852	Ga0157376_10006892	3300014969	Bacteria	8046
853	Ga0157376_10015446	3300014969	Bacteria	5768
854	Ga0157376_10022743	3300014969	Bacteria	4893
855	Ga0157376_10040252	3300014969	Bacteria	3819
856	Ga0157376_10058983	3300014969	Bacteria	3217
857	Ga0157376_10277697	3300014969	Bacteria	1576
858	Ga0183362_10004	3300015683	Bacteria	569303
859	Ga0163161_10000513	3300017792	Bacteria	31599
860	Ga0163161_10003747	3300017792	Bacteria	10648
861	Ga0163161_10006511	3300017792	Bacteria	8089
862	Ga0163161_10028198	3300017792	Bacteria	3985
863	Ga0163161_10030135	3300017792	Bacteria	3859
864	Ga0163161_10043937	3300017792	Bacteria	3217
865	Ga0163161_10470179	3300017792	Bacteria	1019
866	Ga0206353_10945660	3300020082	Bacteria	1808
867	Ga0213874_10018218	3300021377	Bacteria	1896
868	Ga0213876_10038935	3300021384	Bacteria	2511
869	Ga0213876_10104634	3300021384	Bacteria	1501
870	Ga0209436_106366	3300025208	Bacteria	2598
871	Ga0209436_111636	3300025208	Bacteria	1535
872	Ga0209672_100798	3300025228	Bacteria	14982
873	Ga0209147_100996	3300025229	Bacteria	12268
874	Ga0209563_100025	3300025230	Bacteria	596456
875	Ga0209258_100015	3300025242	Bacteria	706310
876	Ga0207425_1000259	3300025245	Bacteria	39126
877	Ga0207425_1000645	3300025245	Bacteria	19440
878	Ga0207425_1004902	3300025245	Bacteria	3917
879	Ga0207425_1014335	3300025245	Bacteria	1802
880	Ga0209148_1000028	3300025254	Bacteria	582773
881	Ga0209129_1000158	3300025258	Bacteria	103711
882	Ga0209129_1000175	3300025258	Bacteria	93817
883	Ga0209129_1000461	3300025258	Bacteria	29937
884	Ga0209129_1001616	3300025258	Bacteria	12222
885	Ga0209129_1003205	3300025258	Bacteria	7311
886	Ga0209129_1007683	3300025258	Bacteria	3144
887	Ga0209129_1010272	3300025258	Bacteria	2358
888	Ga0209565_1000144	3300025263	Bacteria	99074
889	Ga0209565_1000191	3300025263	Bacteria	75148
890	Ga0209565_1000972	3300025263	Bacteria	14864
891	Ga0209673_1000136	3300025273	Bacteria	159975
892	Ga0209673_1000293	3300025273	Bacteria	93142
893	Ga0209673_1000400	3300025273	Bacteria	77176
894	Ga0209673_1002375	3300025273	Bacteria	13220
895	Ga0209673_1006675	3300025273	Bacteria	5510
896	Ga0209673_1008351	3300025273	Bacteria	4617
897	Ga0209673_1010108	3300025273	Bacteria	4008
898	Ga0209673_1014731	3300025273	Bacteria	3014
899	Ga0209130_1000485	3300025284	Bacteria	40942
900	Ga0209130_1000542	3300025284	Bacteria	38002
901	Ga0209130_1005589	3300025284	Bacteria	4318
902	Ga0207673_1005958	3300025290	Bacteria	1499
903	Ga0209675_1000071	3300025291	Bacteria	168382
904	Ga0209675_1000084	3300025291	Bacteria	152066
905	Ga0209675_1000369	3300025291	Bacteria	38317
906	Ga0209675_1000544	3300025291	Bacteria	27530
907	Ga0209675_1009498	3300025291	Bacteria	3430
908	Ga0209675_1014058	3300025291	Bacteria	2460
909	Ga0209676_1000014	3300025292	Bacteria	793514
910	Ga0209676_1000241	3300025292	Bacteria	117623
911	Ga0209676_1000575	3300025292	Bacteria	55372
912	Ga0209676_1008639	3300025292	Bacteria	4511
913	Ga0209676_1023601	3300025292	Bacteria	2009
914	Ga0209025_1000305	3300025294	Bacteria	109479
915	Ga0209025_1000323	3300025294	Bacteria	106442
916	Ga0209025_1000363	3300025294	Bacteria	96763
917	Ga0209025_1000929	3300025294	Bacteria	44729
918	Ga0209025_1001135	3300025294	Bacteria	38119
919	Ga0209025_1001726	3300025294	Bacteria	26404
920	Ga0209025_1001821	3300025294	Bacteria	25096
921	Ga0209025_1017274	3300025294	Bacteria	4178
922	Ga0209025_1032887	3300025294	Bacteria	2413
923	Ga0209564_1000110	3300025295	Bacteria	212842
924	Ga0209564_1000123	3300025295	Bacteria	202487
925	Ga0209564_1000136	3300025295	Bacteria	185198
926	Ga0209564_1000282	3300025295	Bacteria	103837
927	Ga0209564_1000953	3300025295	Bacteria	36860
928	Ga0209564_1001000	3300025295	Bacteria	35296
929	Ga0209564_1001391	3300025295	Bacteria	25206
930	Ga0209758_1000039	3300025297	Bacteria	428951
931	Ga0209758_1000275	3300025297	Bacteria	102404
932	Ga0209758_1000500	3300025297	Bacteria	63618
933	Ga0209758_1000630	3300025297	Bacteria	54005
934	Ga0209758_1005047	3300025297	Bacteria	10486
935	Ga0209050_1000015	3300025298	Bacteria	759102
936	Ga0209050_1000247	3300025298	Bacteria	116514
937	Ga0209050_1001757	3300025298	Bacteria	21484
938	Ga0209050_1003750	3300025298	Bacteria	10901
939	Ga0209256_1000074	3300025299	Bacteria	236893
940	Ga0209256_1000082	3300025299	Bacteria	221491
941	Ga0209256_1000466	3300025299	Bacteria	61247
942	Ga0209256_1003519	3300025299	Bacteria	10906
943	Ga0207426_1000112	3300025302	Bacteria	231436
944	Ga0207426_1000121	3300025302	Bacteria	219007
945	Ga0209051_1000081	3300025303	Bacteria	195619
946	Ga0209051_1000120	3300025303	Bacteria	147281
947	Ga0209051_1001260	3300025303	Bacteria	22631
948	Ga0209051_1007758	3300025303	Bacteria	5807
949	Ga0209051_1010680	3300025303	Bacteria	4605
950	Ga0209051_1037105	3300025303	Bacteria	1791
951	Ga0209257_1000026	3300025304	Bacteria	723225
952	Ga0209257_1001188	3300025304	Bacteria	32794
953	Ga0209257_1001634	3300025304	Bacteria	25690
954	Ga0209257_1009055	3300025304	Bacteria	5448
955	Ga0209257_1023305	3300025304	Bacteria	2180
956	Ga0209257_1031072	3300025304	Bacteria	1713
957	Ga0207697_10000331	3300025315	Bacteria	26425
958	Ga0207697_10019698	3300025315	Bacteria	2764
959	Ga0207697_10021550	3300025315	Bacteria	2638
960	Ga0207697_10029643	3300025315	Bacteria	2240
961	Ga0207656_10001421	3300025321	Bacteria	7919
962	Ga0207656_10007387	3300025321	Bacteria	4000
963	Ga0207656_10063260	3300025321	Bacteria	1628
964	Ga0207696_1000424	3300025711	Bacteria	38612
965	Ga0207655_1003466	3300025728	Bacteria	11726
966	Ga0207682_10000010	3300025893	Bacteria	85697
967	Ga0207682_10000856	3300025893	Bacteria	14120
968	Ga0207682_10003289	3300025893	Bacteria	7063
969	Ga0207682_10016271	3300025893	Bacteria	2900
970	Ga0207682_10018345	3300025893	Bacteria	2736
971	Ga0207642_10002017	3300025899	Bacteria	6262
972	Ga0207710_10028278	3300025900	Bacteria	2433
973	Ga0207710_10145447	3300025900	Bacteria	1147
974	Ga0207688_10000190	3300025901	Bacteria	27202
975	Ga0207688_10043377	3300025901	Bacteria	2505
976	Ga0207688_10065920	3300025901	Unclassified	2047
977	Ga0207688_10250941	3300025901	Bacteria	1072
978	Ga0207680_10018526	3300025903	Bacteria	3703
979	Ga0207680_10043572	3300025903	Bacteria	2633
980	Ga0207680_10238004	3300025903	Bacteria	1253
981	Ga0207680_10259130	3300025903	Bacteria	1203
982	Ga0207680_10296564	3300025903	Bacteria	1126
983	Ga0207647_10035525	3300025904	Bacteria	3175
984	Ga0207647_10129988	3300025904	Bacteria	1481
985	Ga0207647_10182484	3300025904	Bacteria	1218
986	Ga0207685_10024371	3300025905	Bacteria	2074
987	Ga0207699_10042592	3300025906	Bacteria	2632
988	Ga0207699_10162893	3300025906	Bacteria	1486
989	Ga0207699_10265221	3300025906	Bacteria	1188
990	Ga0207645_10000445	3300025907	Bacteria	34374
991	Ga0207645_10000869	3300025907	Bacteria	25125
992	Ga0207645_10001222	3300025907	Bacteria	21187
993	Ga0207645_10001359	3300025907	Bacteria	20091
994	Ga0207645_10014507	3300025907	Bacteria	5271
995	Ga0207645_10015550	3300025907	Bacteria	5053
996	Ga0207645_10042309	3300025907	Bacteria	2915
997	Ga0207645_10087790	3300025907	Bacteria	1999
998	Ga0207645_10214399	3300025907	Bacteria	1268
999	Ga0207645_10276665	3300025907	Bacteria	1114
1000	Ga0207643_10000339	3300025908	Bacteria	31901
1001	Ga0207643_10006787	3300025908	Bacteria	6142
1002	Ga0207643_10014684	3300025908	Bacteria	4258
1003	Ga0207643_10059295	3300025908	Bacteria	2183
1004	Ga0207643_10117381	3300025908	Bacteria	1573
1005	Ga0207643_10137030	3300025908	Bacteria	1460
1006	Ga0207705_10045381	3300025909	Bacteria	3158
1007	Ga0207705_10051729	3300025909	Bacteria	2956
1008	Ga0207705_10103798	3300025909	Bacteria	2094
1009	Ga0207684_10000210	3300025910	Bacteria	90345
1010	Ga0207654_10013573	3300025911	Bacteria	4192
1011	Ga0207654_10025660	3300025911	Bacteria	3182
1012	Ga0207654_10252176	3300025911	Bacteria	1183
1013	Ga0207707_10001908	3300025912	Bacteria	18972
1014	Ga0207707_10006316	3300025912	Bacteria	10349
1015	Ga0207707_10009242	3300025912	Bacteria	8553
1016	Ga0207707_10080511	3300025912	Bacteria	2844
1017	Ga0207707_10082187	3300025912	Bacteria	2812
1018	Ga0207707_10215624	3300025912	Bacteria	1671
1019	Ga0207707_10403839	3300025912	Bacteria	1173
1020	Ga0207695_10014097	3300025913	Bacteria	9491
1021	Ga0207695_10025864	3300025913	Bacteria	6559
1022	Ga0207695_10030651	3300025913	Bacteria	5918
1023	Ga0207695_10120326	3300025913	Bacteria	2594
1024	Ga0207695_10121197	3300025913	Bacteria	2583
1025	Ga0207695_10247161	3300025913	Bacteria	1684
1026	Ga0207695_10341190	3300025913	Bacteria	1386
1027	Ga0207671_10033475	3300025914	Bacteria	3822
1028	Ga0207671_10044512	3300025914	Bacteria	3283
1029	Ga0207671_10059440	3300025914	Bacteria	2834
1030	Ga0207671_10085860	3300025914	Bacteria	2365
1031	Ga0207693_10003525	3300025915	Bacteria	13362
1032	Ga0207663_10020513	3300025916	Bacteria	3744
1033	Ga0207660_10043940	3300025917	Bacteria	3142
1034	Ga0207660_10133720	3300025917	Bacteria	1890
1035	Ga0207660_10258707	3300025917	Bacteria	1376
1036	Ga0207662_10011621	3300025918	Bacteria	4889
1037	Ga0207662_10019448	3300025918	Bacteria	3865
1038	Ga0207662_10053539	3300025918	Bacteria	2404
1039	Ga0207662_10144093	3300025918	Bacteria	1511
1040	Ga0207657_10000708	3300025919	Bacteria	35432
1041	Ga0207657_10001407	3300025919	Bacteria	25663
1042	Ga0207657_10005209	3300025919	Bacteria	13626
1043	Ga0207657_10069876	3300025919	Bacteria	2978
1044	Ga0207657_10103865	3300025919	Bacteria	2355
1045	Ga0207649_10001288	3300025920	Bacteria	14963
1046	Ga0207649_10003577	3300025920	Bacteria	8493
1047	Ga0207649_10007924	3300025920	Bacteria	5782
1048	Ga0207649_10052076	3300025920	Bacteria	2538
1049	Ga0207649_10056609	3300025920	Bacteria	2449
1050	Ga0207649_10126467	3300025920	Bacteria	1731
1051	Ga0207649_10133332	3300025920	Bacteria	1690
1052	Ga0207649_10163046	3300025920	Bacteria	1546
1053	Ga0207649_10236957	3300025920	Bacteria	1308
1054	Ga0207652_10001808	3300025921	Bacteria	18540
1055	Ga0207652_10008453	3300025921	Bacteria	8282
1056	Ga0207652_10028402	3300025921	Bacteria	4667
1057	Ga0207652_10040729	3300025921	Bacteria	3946
1058	Ga0207652_10222979	3300025921	Bacteria	1699
1059	Ga0207652_10282504	3300025921	Bacteria	1497
1060	Ga0207652_10445351	3300025921	Bacteria	1167
1061	Ga0207652_10496371	3300025921	Bacteria	1099
1062	Ga0207646_10036244	3300025922	Bacteria	4453
1063	Ga0207646_10469277	3300025922	Bacteria	1135
1064	Ga0207681_10022649	3300025923	Bacteria	4009
1065	Ga0207681_10034019	3300025923	Bacteria	3348
1066	Ga0207681_10075864	3300025923	Bacteria	2359
1067	Ga0207681_10300201	3300025923	Bacteria	1270
1068	Ga0207694_10003604	3300025924	Bacteria	12267
1069	Ga0207694_10014873	3300025924	Bacteria	5868
1070	Ga0207694_10031151	3300025924	Bacteria	4073
1071	Ga0207650_10001307	3300025925	Bacteria	18053
1072	Ga0207650_10002168	3300025925	Bacteria	13709
1073	Ga0207650_10003681	3300025925	Bacteria	10479
1074	Ga0207650_10024239	3300025925	Bacteria	4311
1075	Ga0207650_10032459	3300025925	Bacteria	3777
1076	Ga0207650_10187899	3300025925	Bacteria	1649
1077	Ga0207650_10447291	3300025925	Bacteria	1075
1078	Ga0207659_10002182	3300025926	Bacteria	11626
1079	Ga0207659_10005594	3300025926	Bacteria	7631
1080	Ga0207659_10015792	3300025926	Bacteria	4903
1081	Ga0207659_10016356	3300025926	Bacteria	4826
1082	Ga0207659_10221235	3300025926	Bacteria	1522
1083	Ga0207687_10079007	3300025927	Bacteria	2371
1084	Ga0207687_10107657	3300025927	Bacteria	2063
1085	Ga0207687_10370726	3300025927	Bacteria	1171
1086	Ga0207700_10000082	3300025928	Bacteria	58939
1087	Ga0207700_10134256	3300025928	Bacteria	2025
1088	Ga0207700_10310093	3300025928	Bacteria	1365
1089	Ga0207664_10005358	3300025929	Bacteria	8763
1090	Ga0207664_10013829	3300025929	Bacteria	5810
1091	Ga0207664_10198373	3300025929	Bacteria	1731
1092	Ga0207644_10003938	3300025931	Bacteria	9632
1093	Ga0207644_10005516	3300025931	Bacteria	8235
1094	Ga0207644_10010160	3300025931	Bacteria	6201
1095	Ga0207644_10037102	3300025931	Bacteria	3426
1096	Ga0207644_10042318	3300025931	Bacteria	3227
1097	Ga0207644_10049224	3300025931	Bacteria	3016
1098	Ga0207644_10050725	3300025931	Bacteria	2975
1099	Ga0207644_10164246	3300025931	Bacteria	1728
1100	Ga0207644_10167367	3300025931	Bacteria	1713
1101	Ga0207644_10282099	3300025931	Bacteria	1334
1102	Ga0207644_10422207	3300025931	Bacteria	1093
1103	Ga0207690_10001716	3300025932	Bacteria	13456
1104	Ga0207690_10032706	3300025932	Bacteria	3339
1105	Ga0207690_10243429	3300025932	Bacteria	1386
1106	Ga0207706_10000133	3300025933	Bacteria	80935
1107	Ga0207706_10000355	3300025933	Bacteria	49431
1108	Ga0207706_10000853	3300025933	Bacteria	31374
1109	Ga0207706_10002999	3300025933	Bacteria	16269
1110	Ga0207706_10020153	3300025933	Bacteria	5992
1111	Ga0207706_10024048	3300025933	Bacteria	5466
1112	Ga0207706_10044906	3300025933	Bacteria	3915
1113	Ga0207706_10115567	3300025933	Bacteria	2360
1114	Ga0207706_10121773	3300025933	Bacteria	2294
1115	Ga0207706_10129029	3300025933	Bacteria	2224
1116	Ga0207706_10249253	3300025933	Bacteria	1551
1117	Ga0207706_10500107	3300025933	Bacteria	1049
1118	Ga0207686_10003108	3300025934	Bacteria	8937
1119	Ga0207686_10038831	3300025934	Bacteria	2884
1120	Ga0207709_10000079	3300025935	Bacteria	166220
1121	Ga0207709_10000229	3300025935	Bacteria	70907
1122	Ga0207709_10001651	3300025935	Bacteria	15091
1123	Ga0207709_10002630	3300025935	Bacteria	11176
1124	Ga0207709_10009606	3300025935	Bacteria	5326
1125	Ga0207709_10030992	3300025935	Bacteria	3117
1126	Ga0207709_10049368	3300025935	Bacteria	2568
1127	Ga0207709_10072496	3300025935	Bacteria	2191
1128	Ga0207709_10125174	3300025935	Bacteria	1742
1129	Ga0207709_10129083	3300025935	Bacteria	1720
1130	Ga0207709_10131058	3300025935	Bacteria	1709
1131	Ga0207709_10143690	3300025935	Bacteria	1643
1132	Ga0207670_10028921	3300025936	Bacteria	3524
1133	Ga0207670_10029767	3300025936	Bacteria	3481
1134	Ga0207670_10086950	3300025936	Bacteria	2201
1135	Ga0207670_10111942	3300025936	Unclassified	1969
1136	Ga0207670_10228224	3300025936	Bacteria	1429
1137	Ga0207670_10443235	3300025936	Bacteria	1046
1138	Ga0207669_10003063	3300025937	Bacteria	7197
1139	Ga0207669_10027555	3300025937	Bacteria	3113
1140	Ga0207669_10038436	3300025937	Bacteria	2756
1141	Ga0207669_10082021	3300025937	Bacteria	2069
1142	Ga0207669_10099028	3300025937	Bacteria	1921
1143	Ga0207669_10106806	3300025937	Bacteria	1865
1144	Ga0207669_10237201	3300025937	Bacteria	1350
1145	Ga0207669_10427266	3300025937	Bacteria	1044
1146	Ga0207704_10015274	3300025938	Bacteria	3908
1147	Ga0207704_10015667	3300025938	Bacteria	3870
1148	Ga0207704_10028784	3300025938	Bacteria	3088
1149	Ga0207704_10069487	3300025938	Bacteria	2226
1150	Ga0207704_10146969	3300025938	Unclassified	1658
1151	Ga0207704_10193599	3300025938	Bacteria	1481
1152	Ga0207665_10021269	3300025939	Bacteria	4265
1153	Ga0207665_10067393	3300025939	Bacteria	2438
1154	Ga0207665_10140885	3300025939	Bacteria	1719
1155	Ga0207691_10000170	3300025940	Bacteria	60463
1156	Ga0207691_10000282	3300025940	Bacteria	50196
1157	Ga0207691_10000856	3300025940	Bacteria	30200
1158	Ga0207691_10012098	3300025940	Bacteria	8273
1159	Ga0207691_10042925	3300025940	Bacteria	4168
1160	Ga0207691_10052038	3300025940	Bacteria	3741
1161	Ga0207691_10083683	3300025940	Bacteria	2864
1162	Ga0207691_10084049	3300025940	Bacteria	2858
1163	Ga0207691_10125725	3300025940	Bacteria	2269
1164	Ga0207691_10134180	3300025940	Bacteria	2185
1165	Ga0207711_10002653	3300025941	Bacteria	15812
1166	Ga0207711_10004910	3300025941	Bacteria	11354
1167	Ga0207711_10010009	3300025941	Bacteria	7880
1168	Ga0207711_10013794	3300025941	Bacteria	6710
1169	Ga0207711_10024274	3300025941	Bacteria	5077
1170	Ga0207711_10070862	3300025941	Bacteria	3023
1171	Ga0207711_10099131	3300025941	Bacteria	2575
1172	Ga0207711_10160933	3300025941	Bacteria	2032
1173	Ga0207711_10192299	3300025941	Bacteria	1860
1174	Ga0207711_10337148	3300025941	Bacteria	1395
1175	Ga0207711_10536303	3300025941	Bacteria	1091
1176	Ga0207689_10000236	3300025942	Bacteria	49281
1177	Ga0207689_10000312	3300025942	Bacteria	44850
1178	Ga0207689_10001211	3300025942	Bacteria	24823
1179	Ga0207689_10004927	3300025942	Bacteria	12026
1180	Ga0207689_10015448	3300025942	Bacteria	6464
1181	Ga0207689_10019701	3300025942	Bacteria	5685
1182	Ga0207689_10019821	3300025942	Bacteria	5665
1183	Ga0207689_10021099	3300025942	Bacteria	5475
1184	Ga0207689_10055740	3300025942	Bacteria	3253
1185	Ga0207689_10059490	3300025942	Bacteria	3143
1186	Ga0207689_10100312	3300025942	Bacteria	2378
1187	Ga0207689_10281013	3300025942	Bacteria	1378
1188	Ga0207661_10080943	3300025944	Bacteria	2681
1189	Ga0207679_10002499	3300025945	Bacteria	11318
1190	Ga0207679_10004669	3300025945	Bacteria	8535
1191	Ga0207679_10070903	3300025945	Bacteria	2627
1192	Ga0207679_10109110	3300025945	Bacteria	2180
1193	Ga0207679_10147560	3300025945	Bacteria	1910
1194	Ga0207679_10452282	3300025945	Bacteria	1139
1195	Ga0207667_10010175	3300025949	Bacteria	11017
1196	Ga0207667_10030944	3300025949	Bacteria	5783
1197	Ga0207667_10033537	3300025949	Bacteria	5519
1198	Ga0207667_10134498	3300025949	Bacteria	2546
1199	Ga0207667_10204116	3300025949	Bacteria	2027
1200	Ga0207667_10323938	3300025949	Unclassified	1574
1201	Ga0207651_10000869	3300025960	Bacteria	13222
1202	Ga0207651_10002222	3300025960	Bacteria	9192
1203	Ga0207651_10002385	3300025960	Bacteria	8971
1204	Ga0207651_10003387	3300025960	Bacteria	7828
1205	Ga0207651_10008814	3300025960	Bacteria	5474
1206	Ga0207651_10014702	3300025960	Bacteria	4528
1207	Ga0207651_10046964	3300025960	Bacteria	2908
1208	Ga0207651_10066457	3300025960	Bacteria	2533
1209	Ga0207651_10138893	3300025960	Bacteria	1874
1210	Ga0207651_10275934	3300025960	Bacteria	1387
1211	Ga0207651_10346169	3300025960	Bacteria	1250
1212	Ga0207712_10031245	3300025961	Bacteria	3585
1213	Ga0207712_10062482	3300025961	Bacteria	2647
1214	Ga0207712_10106128	3300025961	Bacteria	2098
1215	Ga0207712_10172021	3300025961	Bacteria	1694
1216	Ga0207712_10360228	3300025961	Bacteria	1211
1217	Ga0207712_10503651	3300025961	Bacteria	1035
1218	Ga0207668_10004621	3300025972	Bacteria	8095
1219	Ga0207668_10008091	3300025972	Bacteria	6261
1220	Ga0207668_10032080	3300025972	Bacteria	3467
1221	Ga0207668_10414882	3300025972	Bacteria	1141
1222	Ga0207640_10019136	3300025981	Bacteria	4039
1223	Ga0207640_10021573	3300025981	Bacteria	3842
1224	Ga0207640_10029733	3300025981	Bacteria	3357
1225	Ga0207640_10066939	3300025981	Bacteria	2401
1226	Ga0207640_10089717	3300025981	Bacteria	2125
1227	Ga0207640_10121052	3300025981	Bacteria	1875
1228	Ga0207640_10152594	3300025981	Bacteria	1699
1229	Ga0207640_10165973	3300025981	Bacteria	1639
1230	Ga0207658_10007331	3300025986	Bacteria	7522
1231	Ga0207658_10011185	3300025986	Bacteria	6112
1232	Ga0207658_10028141	3300025986	Bacteria	3956
1233	Ga0207658_10059528	3300025986	Unclassified	2847
1234	Ga0207658_10074125	3300025986	Bacteria	2585
1235	Ga0207658_10382950	3300025986	Bacteria	1232
1236	Ga0207677_10001284	3300026023	Bacteria	13473
1237	Ga0207677_10010855	3300026023	Bacteria	5168
1238	Ga0207677_10033610	3300026023	Bacteria	3312
1239	Ga0207677_10130116	3300026023	Bacteria	1909
1240	Ga0207677_10383130	3300026023	Bacteria	1187
1241	Ga0207703_10002153	3300026035	Bacteria	17309
1242	Ga0207703_10003470	3300026035	Bacteria	13203
1243	Ga0207703_10004821	3300026035	Bacteria	10979
1244	Ga0207703_10008436	3300026035	Bacteria	8142
1245	Ga0207703_10035081	3300026035	Bacteria	3986
1246	Ga0207703_10061817	3300026035	Bacteria	3067
1247	Ga0207703_10109327	3300026035	Bacteria	2356
1248	Ga0207703_10304215	3300026035	Bacteria	1455
1249	Ga0207639_10001910	3300026041	Bacteria	13988
1250	Ga0207639_10015305	3300026041	Bacteria	5408
1251	Ga0207639_10017687	3300026041	Bacteria	5054
1252	Ga0207639_10023045	3300026041	Bacteria	4492
1253	Ga0207639_10088171	3300026041	Bacteria	2475
1254	Ga0207639_10107421	3300026041	Bacteria	2267
1255	Ga0207639_10120345	3300026041	Bacteria	2156
1256	Ga0207639_10148065	3300026041	Bacteria	1963
1257	Ga0207639_10235655	3300026041	Bacteria	1589
1258	Ga0207639_10237847	3300026041	Bacteria	1582
1259	Ga0207639_10273713	3300026041	Bacteria	1482
1260	Ga0207678_10001121	3300026067	Bacteria	24571
1261	Ga0207678_10001129	3300026067	Bacteria	24466
1262	Ga0207678_10003542	3300026067	Bacteria	14046
1263	Ga0207678_10028232	3300026067	Bacteria	4900
1264	Ga0207678_10037367	3300026067	Bacteria	4223
1265	Ga0207678_10065808	3300026067	Bacteria	3112
1266	Ga0207678_10073377	3300026067	Bacteria	2933
1267	Ga0207678_10096783	3300026067	Bacteria	2522
1268	Ga0207678_10216208	3300026067	Bacteria	1640
1269	Ga0207678_10355104	3300026067	Bacteria	1264
1270	Ga0207708_10000362	3300026075	Bacteria	35576
1271	Ga0207708_10001142	3300026075	Bacteria	19955
1272	Ga0207708_10019372	3300026075	Bacteria	5128
1273	Ga0207708_10109450	3300026075	Bacteria	2144
1274	Ga0207708_10143443	3300026075	Bacteria	1875
1275	Ga0207708_10214583	3300026075	Bacteria	1539
1276	Ga0207702_10003865	3300026078	Bacteria	13505
1277	Ga0207702_10038710	3300026078	Bacteria	3994
1278	Ga0207702_10045105	3300026078	Bacteria	3709
1279	Ga0207702_10105717	3300026078	Bacteria	2493
1280	Ga0207702_10490221	3300026078	Bacteria	1197
1281	Ga0207702_10615017	3300026078	Bacteria	1067
1282	Ga0207641_10003126	3300026088	Bacteria	14883
1283	Ga0207641_10006448	3300026088	Bacteria	9890
1284	Ga0207641_10010891	3300026088	Bacteria	7450
1285	Ga0207641_10016233	3300026088	Bacteria	6098
1286	Ga0207641_10080341	3300026088	Bacteria	2828
1287	Ga0207641_10212306	3300026088	Bacteria	1790
1288	Ga0207641_10291022	3300026088	Bacteria	1539
1289	Ga0207641_10393440	3300026088	Bacteria	1329
1290	Ga0207641_10463402	3300026088	Bacteria	1226
1291	Ga0207648_10000159	3300026089	Bacteria	69221
1292	Ga0207648_10000203	3300026089	Bacteria	63192
1293	Ga0207648_10000533	3300026089	Bacteria	42312
1294	Ga0207648_10000713	3300026089	Bacteria	37240
1295	Ga0207648_10001168	3300026089	Bacteria	29387
1296	Ga0207648_10001240	3300026089	Bacteria	28641
1297	Ga0207648_10004638	3300026089	Bacteria	14072
1298	Ga0207648_10029194	3300026089	Bacteria	4891
1299	Ga0207648_10033716	3300026089	Bacteria	4515
1300	Ga0207648_10038565	3300026089	Bacteria	4204
1301	Ga0207648_10043209	3300026089	Bacteria	3957
1302	Ga0207648_10141868	3300026089	Bacteria	2117
1303	Ga0207648_10322679	3300026089	Bacteria	1388
1304	Ga0207648_10384744	3300026089	Bacteria	1269
1305	Ga0207676_10000082	3300026095	Bacteria	92500
1306	Ga0207676_10002279	3300026095	Bacteria	13763
1307	Ga0207676_10005010	3300026095	Bacteria	9383
1308	Ga0207676_10024798	3300026095	Bacteria	4442
1309	Ga0207676_10066547	3300026095	Bacteria	2874
1310	Ga0207674_10000182	3300026116	Bacteria	77228
1311	Ga0207674_10001726	3300026116	Bacteria	27948
1312	Ga0207674_10002059	3300026116	Bacteria	25518
1313	Ga0207674_10006334	3300026116	Bacteria	13933
1314	Ga0207674_10010169	3300026116	Bacteria	10690
1315	Ga0207674_10014531	3300026116	Bacteria	8692
1316	Ga0207674_10030375	3300026116	Bacteria	5681
1317	Ga0207674_10078036	3300026116	Bacteria	3317
1318	Ga0207674_10174094	3300026116	Bacteria	2105
1319	Ga0207675_100000068	3300026118	Bacteria	78105
1320	Ga0207675_100000242	3300026118	Bacteria	52003
1321	Ga0207675_100000778	3300026118	Bacteria	31816
1322	Ga0207675_100001929	3300026118	Bacteria	20693
1323	Ga0207675_100014373	3300026118	Bacteria	7381
1324	Ga0207675_100029152	3300026118	Bacteria	5144
1325	Ga0207675_100057060	3300026118	Bacteria	3643
1326	Ga0207675_100072160	3300026118	Bacteria	3229
1327	Ga0207675_100072675	3300026118	Bacteria	3217
1328	Ga0207675_100086913	3300026118	Bacteria	2936
1329	Ga0207675_100198089	3300026118	Bacteria	1928
1330	Ga0207675_100250096	3300026118	Bacteria	1715
1331	Ga0207675_100354429	3300026118	Unclassified	1438
1332	Ga0207675_100432325	3300026118	Bacteria	1302
1333	Ga0207675_100465340	3300026118	Bacteria	1255
1334	Ga0207683_10000005	3300026121	Bacteria	187889
1335	Ga0207683_10002698	3300026121	Bacteria	15506
1336	Ga0207683_10007574	3300026121	Bacteria	9301
1337	Ga0207683_10010572	3300026121	Bacteria	7874
1338	Ga0207683_10038364	3300026121	Bacteria	4175
1339	Ga0207683_10059205	3300026121	Bacteria	3365
1340	Ga0207683_10099564	3300026121	Bacteria	2594
1341	Ga0207683_10108384	3300026121	Bacteria	2485
1342	Ga0207683_10245299	3300026121	Bacteria	1634
1343	Ga0207683_10291304	3300026121	Bacteria	1493
1344	Ga0207683_10296991	3300026121	Bacteria	1478
1345	Ga0207683_10374502	3300026121	Bacteria	1308
1346	Ga0207683_10390527	3300026121	Bacteria	1280
1347	Ga0207698_10005875	3300026142	Bacteria	7626
1348	Ga0207698_10012527	3300026142	Bacteria	5555
1349	Ga0207698_10017260	3300026142	Bacteria	4892
1350	Ga0207698_10025217	3300026142	Bacteria	4184
1351	Ga0207698_10027969	3300026142	Bacteria	4013
1352	Ga0207698_10028563	3300026142	Bacteria	3979
1353	Ga0207698_10088448	3300026142	Bacteria	2526
1354	Ga0207698_10106947	3300026142	Bacteria	2334
1355	Ga0207698_10242320	3300026142	Bacteria	1644
1356	Ga0207698_10662102	3300026142	Bacteria	1035
1357	Ga0209281_1000029	3300027111	Bacteria	431495
1358	Ga0209281_1000067	3300027111	Bacteria	284517
1359	Ga0209981_1002545	3300027378	Bacteria	2327
1360	Ga0209996_1003863	3300027395	Bacteria	1897
1361	Ga0210000_1008175	3300027462	Bacteria	1532
1362	Ga0209995_1009421	3300027471	Bacteria	1579
1363	Ga0209968_1001064	3300027526	Bacteria	4187
1364	Ga0209968_1004479	3300027526	Bacteria	2099
1365	Ga0209999_1011563	3300027543	Bacteria	1598
1366	Ga0209970_1000492	3300027614	Bacteria	6760
1367	Ga0209970_1008306	3300027614	Bacteria	1704
1368	Ga0209983_1004071	3300027665	Bacteria	3086
1369	Ga0209282_1000099	3300027666	Bacteria	59643
1370	Ga0209282_1004405	3300027666	Bacteria	8478
1371	Ga0209588_1000003	3300027671	Bacteria	308861
1372	Ga0209588_1004811	3300027671	Bacteria	3833
1373	Ga0209971_1002963	3300027682	Bacteria	4061
1374	Ga0209966_1000036	3300027695	Bacteria	55883
1375	Ga0209966_1002699	3300027695	Bacteria	2966
1376	Ga0209813_10045012	3300027866	Bacteria	1358
1377	Ga0209974_10000596	3300027876	Bacteria	12143
1378	Ga0209974_10002673	3300027876	Bacteria	6458
1379	Ga0207428_10001906	3300027907	Bacteria	21120
1380	Ga0207428_10037508	3300027907	Bacteria	3943
1381	Ga0207428_10149802	3300027907	Bacteria	1776
1382	Ga0207428_10204851	3300027907	Bacteria	1484
1383	Ga0268266_10001350	3300028379	Bacteria	29637
1384	Ga0268266_10026618	3300028379	Bacteria	4921
1385	Ga0268266_10128555	3300028379	Bacteria	2264
1386	Ga0268266_10170018	3300028379	Bacteria	1978
1387	Ga0268266_10401145	3300028379	Bacteria	1296
1388	Ga0268265_10008692	3300028380	Bacteria	6867
1389	Ga0268265_10057280	3300028380	Bacteria	2969
1390	Ga0268265_10235696	3300028380	Bacteria	1611
1391	Ga0268265_10274219	3300028380	Bacteria	1506
1392	Ga0268264_10003745	3300028381	Bacteria	13052
1393	Ga0268264_10014171	3300028381	Bacteria	6556
1394	Ga0268264_10016665	3300028381	Bacteria	6017
1395	Ga0268264_10044305	3300028381	Bacteria	3690
1396	Ga0268264_10048332	3300028381	Bacteria	3539
1397	Ga0268264_10052439	3300028381	Bacteria	3400
1398	Ga0268264_10078209	3300028381	Bacteria	2819
1399	Ga0268264_10116539	3300028381	Bacteria	2348
1400	Ga0268264_10185902	3300028381	Bacteria	1891
1401	Ga0268264_10196359	3300028381	Bacteria	1843
1402	Ga0268264_10313589	3300028381	Bacteria	1481
1403	Ga0268264_10418721	3300028381	Bacteria	1291
1404	Ga0307517_10000392	3300028786	Bacteria	74887
1405	Ga0307517_10115303	3300028786	Bacteria	2017
1406	Ga0307515_10000109	3300028794	Bacteria	195895
1407	Ga0307515_10000183	3300028794	Bacteria	154076
1408	Ga0307515_10000572	3300028794	Bacteria	86935
1409	Ga0307515_10000578	3300028794	Bacteria	86019
1410	Ga0307515_10000921	3300028794	Bacteria	67536
1411	Ga0307515_10002263	3300028794	Bacteria	42131
1412	Ga0307515_10002443	3300028794	Bacteria	40478
1413	Ga0307515_10015172	3300028794	Bacteria	14210
1414	Ga0307515_10034432	3300028794	Bacteria	8289
1415	Ga0307515_10075359	3300028794	Bacteria	4496
1416	Ga0307515_10100022	3300028794	Bacteria	3515
1417	Ga0307515_10108335	3300028794	Bacteria	3274
1418	Ga0307515_10238320	3300028794	Bacteria	1596
1419	Ga0265324_10011528	3300029957	Bacteria	3367
1420	Ga0307512_10070252	3300030522	Bacteria	2609
1421	Ga0307512_10092017	3300030522	Bacteria	2106
1422	Ga0316177_1159281	3300030731	Bacteria	1892
1423	Ga0316176_1050129	3300030732	Bacteria	1839
1424	Ga0314311_1244504	3300030733	Bacteria	1888
1425	Ga0316179_1024083	3300030734	Bacteria	2532
1426	Ga0316178_1110841	3300030735	Bacteria	3239
1427	Ga0316183_1124796	3300030742	Bacteria	3371
1428	Ga0316181_1152686	3300030744	Bacteria	2463
1429	Ga0316182_1316452	3300030745	Bacteria	4073
1430	Ga0265332_10000682	3300031238	Bacteria	21830
1431	Ga0265328_10081897	3300031239	Bacteria	1190
1432	Ga0265320_10015069	3300031240	Bacteria	4377
1433	Ga0265329_10000424	3300031242	Bacteria	22281
1434	Ga0265331_10000592	3300031250	Bacteria	32283
1435	Ga0265327_10000959	3300031251	Bacteria	41387
1436	Ga0265327_10006362	3300031251	Bacteria	9468
1437	Ga0265327_10020128	3300031251	Bacteria	4077
1438	Ga0265327_10038371	3300031251	Bacteria	2614
1439	Ga0265316_10027489	3300031344	Bacteria	4709
1440	Ga0265316_10135466	3300031344	Bacteria	1853
1441	Ga0265316_10179295	3300031344	Bacteria	1578
1442	Ga0307513_10003399	3300031456	Bacteria	21618
1443	Ga0307513_10004819	3300031456	Bacteria	17917
1444	Ga0307513_10012002	3300031456	Bacteria	10728
1445	Ga0307513_10027114	3300031456	Bacteria	6585
1446	Ga0307513_10030471	3300031456	Bacteria	6128
1447	Ga0307513_10074691	3300031456	Bacteria	3524
1448	Ga0307513_10085385	3300031456	Bacteria	3239
1449	Ga0307513_10175892	3300031456	Bacteria	2011
1450	Ga0307513_10281573	3300031456	Bacteria	1440
1451	Ga0307509_10000168	3300031507	Bacteria	103047
1452	Ga0307509_10015535	3300031507	Bacteria	8875
1453	Ga0307509_10024981	3300031507	Bacteria	6679
1454	Ga0307509_10043975	3300031507	Bacteria	4827
1455	Ga0307509_10109977	3300031507	Bacteria	2763
1456	Ga0307509_10170901	3300031507	Bacteria	2053
1457	Ga0307408_100003056	3300031548	Bacteria	11553
1458	Ga0307408_100041061	3300031548	Bacteria	3278
1459	Ga0307408_100064782	3300031548	Bacteria	2678
1460	Ga0307408_100209440	3300031548	Bacteria	1583
1461	Ga0307408_100329836	3300031548	Bacteria	1288
1462	Ga0307508_10000101	3300031616	Bacteria	100858
1463	Ga0307508_10000142	3300031616	Bacteria	85288
1464	Ga0307508_10065080	3300031616	Bacteria	3213
1465	Ga0307508_10073352	3300031616	Bacteria	2999
1466	Ga0307508_10089870	3300031616	Bacteria	2656
1467	Ga0307508_10203745	3300031616	Bacteria	1579
1468	Ga0307514_10001068	3300031649	Bacteria	38913
1469	Ga0307514_10001819	3300031649	Bacteria	23809
1470	Ga0307514_10001927	3300031649	Bacteria	22735
1471	Ga0307514_10026638	3300031649	Bacteria	4675
1472	Ga0265314_10016357	3300031711	Bacteria	5859
1473	Ga0265314_10111896	3300031711	Bacteria	1733
1474	Ga0265342_10040080	3300031712	Bacteria	2842
1475	Ga0307516_10000290	3300031730	Bacteria	65231
1476	Ga0307516_10000326	3300031730	Bacteria	61941
1477	Ga0307516_10000394	3300031730	Bacteria	57048
1478	Ga0307516_10002019	3300031730	Bacteria	27686
1479	Ga0307516_10006396	3300031730	Bacteria	13810
1480	Ga0307516_10013066	3300031730	Bacteria	8879
1481	Ga0307516_10204354	3300031730	Bacteria	1693
1482	Ga0307405_10022583	3300031731	Bacteria	3559
1483	Ga0307405_10032744	3300031731	Bacteria	3075
1484	Ga0307405_10082631	3300031731	Bacteria	2103
1485	Ga0307405_10173191	3300031731	Bacteria	1541
1486	Ga0307405_10179726	3300031731	Bacteria	1518
1487	Ga0307405_10197671	3300031731	Bacteria	1458
1488	Ga0307405_10281374	3300031731	Bacteria	1252
1489	Ga0307413_10022729	3300031824	Bacteria	3386
1490	Ga0307413_10027673	3300031824	Bacteria	3146
1491	Ga0307413_10047500	3300031824	Bacteria	2560
1492	Ga0307413_10133039	3300031824	Bacteria	1705
1493	Ga0307410_10011698	3300031852	Bacteria	5033
1494	Ga0307410_10028806	3300031852	Bacteria	3528
1495	Ga0307406_10092611	3300031901	Bacteria	2038
1496	Ga0307406_10095740	3300031901	Bacteria	2010
1497	Ga0307406_10128099	3300031901	Bacteria	1777
1498	Ga0307406_10205727	3300031901	Bacteria	1452
1499	Ga0307407_10007604	3300031903	Bacteria	4917
1500	Ga0307407_10122842	3300031903	Bacteria	1649
1501	Ga0307412_10000195	3300031911	Bacteria	41902
1502	Ga0307412_10016303	3300031911	Bacteria	4424
1503	Ga0307412_10017861	3300031911	Bacteria	4253
1504	Ga0307412_10018894	3300031911	Bacteria	4160
1505	Ga0307412_10030757	3300031911	Bacteria	3384
1506	Ga0307412_10035934	3300031911	Bacteria	3169
1507	Ga0307412_10343579	3300031911	Bacteria	1195
1508	Ga0307409_100000710	3300031995	Bacteria	14847
1509	Ga0307409_100002581	3300031995	Bacteria	9519
1510	Ga0307409_100003283	3300031995	Bacteria	8738
1511	Ga0307409_100028941	3300031995	Bacteria	3956
1512	Ga0307416_100030070	3300032002	Bacteria	4071
1513	Ga0307416_100031702	3300032002	Bacteria	3983
1514	Ga0307416_100094927	3300032002	Bacteria	2573
1515	Ga0307416_100909066	3300032002	Bacteria	980
1516	Ga0307414_10007781	3300032004	Bacteria	6041
1517	Ga0307414_10175371	3300032004	Bacteria	1718
1518	Ga0307414_10305943	3300032004	Bacteria	1347
1519	Ga0307411_10006958	3300032005	Bacteria	5709
1520	Ga0307411_10011659	3300032005	Bacteria	4757
1521	Ga0307411_10025771	3300032005	Bacteria	3529
1522	Ga0307411_10134406	3300032005	Bacteria	1813
1523	Ga0307415_100002251	3300032126	Bacteria	9555
1524	Ga0307415_100043774	3300032126	Bacteria	2989
1525	Ga0307415_100190676	3300032126	Bacteria	1617
1526	Ga0307415_100309694	3300032126	Bacteria	1312
1527	Ga0307415_100454259	3300032126	Bacteria	1108
1528	Ga0316583_10026921	3300032133	Bacteria	2052
1529	Ga0307507_10171764	3300033179	Bacteria	1573
1530	Ga0307510_10000467	3300033180	Bacteria	39376
1531	Ga0307510_10004823	3300033180	Bacteria	15940
1532	Ga0307510_10012141	3300033180	Bacteria	10210
1533	Ga0307510_10083385	3300033180	Bacteria	3086
1534	Ga0307510_10133294	3300033180	Bacteria	2149
1535	Ga0373930_0000042	3300034816	Bacteria	11263
1536	Ga0373950_0009264	3300034818	Unclassified	1567
1537	Ga0373958_0000428	3300034819	Bacteria	5135
1538	Ga0373959_0001092	3300034820	Bacteria	4442
1539	Ga0373938_0000015	3300034957	Bacteria	22545
1540	Ga0373926_0016332	3300035083	Bacteria	2537
1541	Ga0373928_0000250	3300035084	Bacteria	10594
1542	Ga0373929_0000053	3300035085	Bacteria	21958
1543	Ga0373934_0061498	3300035086	Bacteria	1496
1544	Ga0373934_0204951	3300035086	Unclassified	812
1545	Ga0373949_0002636	3300035090	Bacteria	4529
1546	Ga0373951_0000355	3300035091	Bacteria	13819
1547	Ga0373952_0057432	3300035092	Bacteria	943
1548	Ga0373932_0001223	3300035112	Bacteria	7285
1549	Ga0373932_0028880	3300035112	Bacteria	1527
1550	Ga0373932_0078609	3300035112	Bacteria	1038
1551	Ga0373939_0003892	3300035114	Bacteria	3514
1552	Ga0373941_0001480	3300035115	Bacteria	4969
1553	Ga0373941_0012449	3300035115	Bacteria	2225
1554	Ga0373941_0012932	3300035115	Bacteria	2194
1555	Ga0373941_0034728	3300035115	Unclassified	1523
1556	Ga0373945_0052838	3300035116	Unclassified	1498
1557	Ga0373960_0001791	3300035121	Bacteria	4819
1558	Ga0373960_0021353	3300035121	Unclassified	1721
1559	Ga0373960_0074644	3300035121	Bacteria	1056
1560	Ga0373943_0001794	3300035170	Bacteria	9702
1561	Ga0373943_0043647	3300035170	Bacteria	2178
1562	Ga0373943_0094541	3300035170	Bacteria	1553
1563	Ga0373943_0098899	3300035170	Bacteria	1523
1564	Ga0373943_0119146	3300035170	Bacteria	1401
1565	Ga0373946_0004428	3300035171	Bacteria	5030
1566	Ga0373946_0058845	3300035171	Bacteria	1629
1567	Ga0373946_0163398	3300035171	Bacteria	1047
1568	Ga0373955_0080450	3300035172	Unclassified	1840
1569	Ga0373942_0002858	3300035207	Bacteria	4101
1570	Ga0373961_0001674	3300035241	Bacteria	6184
1571	Ga0373961_0036297	3300035241	Bacteria	1403
1572	Ga0373962_0001032	3300035242	Bacteria	6451
1573	Ga0373962_0046770	3300035242	Bacteria	1236
1574	Ga0373962_0073075	3300035242	Bacteria	1028
1575	Ga0373931_0000143	3300035691	Bacteria	31467
1576	Ga0373931_0000857	3300035691	Bacteria	12833
1577	Ga0373931_0002552	3300035691	Bacteria	8100
1578	Ga0373931_0003888	3300035691	Bacteria	6756
1579	Ga0373931_0019014	3300035691	Bacteria	3424
1580	Ga0373931_0027283	3300035691	Bacteria	2914
1581	Ga0373935_0001994	3300035692	Bacteria	11505
1582	Ga0373935_0013065	3300035692	Bacteria	5007
1583	Ga0373935_0090262	3300035692	Bacteria	2005
1584	Ga0373927_0002994	3300035695	Bacteria	12256
1585	Ga0373927_0074587	3300035695	Bacteria	2196
1586	Ga0373927_0184422	3300035695	Bacteria	1369
1587	Ga0373927_0191164	3300035695	Bacteria	1343
1588	Ga0373933_0051563	3300035724	Bacteria	2460
1589	Ga0373933_0333053	3300035724	Bacteria	985
1590	Ga0373947_0005039	3300035725	Bacteria	7736
1591	Ga0373947_0012932	3300035725	Bacteria	4786
1592	Ga0373947_0024662	3300035725	Bacteria	3505
1593	Ga0373947_0338694	3300035725	Bacteria	1008
1594	Ga0373937_0008450	3300036401	Bacteria	8949
1595	Ga0373937_0022975	3300036401	Bacteria	5608
1596	Ga0373937_0034341	3300036401	Bacteria	4613
1597	Ga0373937_0038768	3300036401	Bacteria	4342
1598	Ga0373937_0047495	3300036401	Bacteria	3928
1599	Ga0373937_0086869	3300036401	Bacteria	2894
1600	Ga0373937_0125669	3300036401	Bacteria	2392
1601	Ga0373937_0335281	3300036401	Bacteria	1432
1602	Ga0316582_0095190	3300036647	Bacteria	1965
1603	Ga0373925_0002157	3300037068	Bacteria	16074
1604	Ga0373925_0002289	3300037068	Bacteria	15493
1605	Ga0373925_0012694	3300037068	Bacteria	6101
1606	Ga0373925_0061984	3300037068	Bacteria	2811
1607	Ga0373925_0195829	3300037068	Bacteria	1605
1608	Ga0395900_0021325	3300037418	Bacteria	6623
1609	Ga0395900_0032705	3300037418	Bacteria	5349
1610	Ga0395900_0198364	3300037418	Bacteria	2032
1611	Ga0395898_0047123	3300037466	Bacteria	4231
1612	Ga0395905_0000600	3300037471	Bacteria	48145
1613	Ga0395905_0000856	3300037471	Bacteria	39764
1614	Ga0395905_0005912	3300037471	Bacteria	12408
1615	Ga0395905_0011710	3300037471	Bacteria	8466
1616	Ga0395905_0013384	3300037471	Bacteria	7860
1617	Ga0395905_0036908	3300037471	Bacteria	4590
1618	Ga0395905_0045200	3300037471	Bacteria	4130
1619	Ga0395905_0048457	3300037471	Bacteria	3982
1620	Ga0395905_0049522	3300037471	Bacteria	3937
1621	Ga0395905_0153899	3300037471	Bacteria	2163
1622	Ga0395905_0208070	3300037471	Bacteria	1833
1623	Ga0395905_0317939	3300037471	Bacteria	1446
1624	Ga0395905_0453503	3300037471	Bacteria	1180
1625	Ga0395905_0616340	3300037471	Bacteria	987
1626	Ga0316581_0003990	3300037588	Bacteria	3726
1627	Ga0436364_1124639	3300037853	Bacteria	5607
1628	Ga0395901_0001520	3300038443	Bacteria	24066
1629	Ga0395901_0018995	3300038443	Bacteria	7027
1630	Ga0395901_0064413	3300038443	Bacteria	3816
1631	Ga0242420_000824	3300038996	Bacteria	3793
1632	Ga0436365_1766316	3300039437	Bacteria	2584
1633	Ga0439436_0005275	3300041404	Bacteria	3958
1634	Ga0439436_0009415	3300041404	Bacteria	2996
1635	Ga0439436_0023169	3300041404	Bacteria	1837
1636	Ga0439436_0034414	3300041404	Bacteria	1465
1637	Ga0439436_0049315	3300041404	Bacteria	1193
1638	Ga0439466_0021926	3300041411	Bacteria	2258
1639	Ga0451793_0442755	3300041452	Bacteria	1216
1640	Ga0451795_1432999	3300041456	Bacteria	1583
1641	Ga0451795_1668763	3300041456	Bacteria	1955
1642	Ga0451800_0396256	3300041459	Bacteria	2166
1643	Ga0451802_0836090	3300041460	Bacteria	1801
1644	Ga0451804_0743580	3300041463	Bacteria	1360
1645	Ga0451849_0193616	3300041505	Bacteria	1386
1646	Ga0451853_0311021	3300041512	Bacteria	1642
1647	Ga0451853_2369187	3300041512	Bacteria	2589
1648	Ga0451853_3262534	3300041512	Bacteria	1141
1649	Ga0451853_3860439	3300041512	Bacteria	1815
1650	Ga0439431_0024248	3300041997	Bacteria	1475
1651	Ga0439433_0000543	3300041999	Bacteria	7123
1652	Ga0439441_002130	3300042001	Bacteria	2738
1653	Ga0439443_001223	3300042003	Bacteria	2756
1654	Ga0439432_028598	3300042006	Bacteria	1814
1655	Ga0439449_0005813	3300042007	Bacteria	4718
1656	Ga0439452_021392	3300042010	Bacteria	1686
1657	Ga0439455_0035467	3300042012	Bacteria	1259
1658	Ga0450911_000710	3300042115	Bacteria	9698
1659	Ga0450898_010581	3300042134	Bacteria	1497
1660	Ga0439446_0001196	3300042156	Bacteria	5795
1661	Ga0439446_0056917	3300042156	Bacteria	1176
1662	Ga0439434_0009282	3300042435	Bacteria	2889
1663	Ga0439464_0009824	3300042439	Bacteria	2521
1664	Ga0450918_002096	3300042531	Bacteria	3809
1665	Ga0450893_0005060	3300042532	Bacteria	2107
1666	Ga0451577_0003577	3300042876	Bacteria	17119
1667	Ga0451577_0019249	3300042876	Bacteria	6278
1668	Ga0451577_0053295	3300042876	Bacteria	3611
1669	Ga0451577_0131013	3300042876	Bacteria	2249
1670	Ga0451577_0184671	3300042876	Bacteria	1880
1671	Ga0451577_0199220	3300042876	Bacteria	1807
1672	Ga0451577_0269681	3300042876	Bacteria	1541
1673	Ga0451577_0315731	3300042876	Bacteria	1417
1674	Ga0453683_0001433	3300044673	Bacteria	20726
1675	Ga0453683_0019696	3300044673	Bacteria	4319
1676	Ga0453683_0042260	3300044673	Bacteria	2862
1677	Ga0453683_0115667	3300044673	Bacteria	1687
1678	Ga0466966_0031687	3300044684	Bacteria	3428
1679	Ga0466963_0110616	3300044694	Bacteria	1886
1680	Ga0466963_0228178	3300044694	Bacteria	1305
1681	Ga0466964_0094826	3300044706	Bacteria	1305
1682	Ga0453684_0003387	3300044712	Bacteria	36051
1683	Ga0453684_0004366	3300044712	Bacteria	29999
1684	Ga0453684_0006601	3300044712	Bacteria	21945
1685	Ga0453684_0018838	3300044712	Bacteria	10562
1686	Ga0453684_0038162	3300044712	Bacteria	6574
1687	Ga0453684_0046623	3300044712	Bacteria	5761
1688	Ga0453684_0064213	3300044712	Bacteria	4690
1689	Ga0453684_0077547	3300044712	Bacteria	4163
1690	Ga0453684_0169042	3300044712	Bacteria	2578
1691	Ga0453684_0236020	3300044712	Unclassified	2108
1692	Ga0453684_0676813	3300044712	Bacteria	1123
1693	Ga0466957_0248732	3300044842	Bacteria	1182
1694	Ga0466960_0012948	3300044901	Bacteria	3533
1695	Ga0466959_0228855	3300045049	Bacteria	1287
1696	Ga0451576_0000144	3300045051	Bacteria	180439
1697	Ga0451576_0001803	3300045051	Bacteria	35010
1698	Ga0451576_0007521	3300045051	Bacteria	12996
1699	Ga0451576_0010844	3300045051	Bacteria	10428
1700	Ga0451576_0021695	3300045051	Bacteria	6976
1701	Ga0451576_0047736	3300045051	Bacteria	4500
1702	Ga0451576_0084840	3300045051	Bacteria	3295
1703	Ga0451576_0097017	3300045051	Bacteria	3066
1704	Ga0451576_0104656	3300045051	Bacteria	2944
1705	Ga0451576_0109690	3300045051	Bacteria	2872
1706	Ga0451576_0138176	3300045051	Bacteria	2541
1707	Ga0451576_0139173	3300045051	Bacteria	2532
1708	Ga0451576_0184470	3300045051	Bacteria	2178
1709	Ga0451576_0279425	3300045051	Bacteria	1746
1710	Ga0451576_0297368	3300045051	Bacteria	1688
1711	Ga0451576_0581416	3300045051	Bacteria	1177
1712	Ga0466958_0099287	3300045836	Bacteria	1809
1713	Ga0466967_0491989	3300045976	Bacteria	1203
1714	Ga0495592_0000292	3300046454	Bacteria	42696
1715	Ga0495592_0040627	3300046454	Unclassified	3490
1716	Ga0495603_0000835	3300046455	Bacteria	17675
1717	Ga0495590_0009656	3300046457	Bacteria	3659
1718	Ga0495629_0002890	3300046459	Bacteria	13114
1719	Ga0495629_0024163	3300046459	Bacteria	4328
1720	Ga0495650_0000051	3300046471	Bacteria	318297
1721	Ga0495650_0024265	3300046471	Bacteria	2866
1722	Ga0495650_0037473	3300046471	Bacteria	2111
1723	Ga0495580_0004179	3300046472	Bacteria	12148
1724	Ga0495580_0062022	3300046472	Bacteria	2624
1725	Ga0495580_0152043	3300046472	Bacteria	1603
1726	Ga0495582_0009736	3300046473	Bacteria	5293
1727	Ga0495582_0021849	3300046473	Bacteria	3500
1728	Ga0495582_0037318	3300046473	Unclassified	2673
1729	Ga0495605_0019072	3300046474	Bacteria	3670
1730	Ga0495639_0004197	3300046475	Bacteria	6180
1731	Ga0495639_0016805	3300046475	Bacteria	3178
1732	Ga0495639_0062201	3300046475	Bacteria	1712
1733	Ga0495662_0029586	3300046476	Bacteria	2645
1734	Ga0495664_0182013	3300046477	Bacteria	1274
1735	Ga0495664_0182282	3300046477	Bacteria	1273
1736	Ga0495585_0059578	3300046492	Bacteria	2103
1737	Ga0495594_0000503	3300046499	Bacteria	19974
1738	Ga0495583_0000169	3300046506	Bacteria	111114
1739	Ga0495606_0020270	3300046507	Bacteria	4909
1740	Ga0495606_0149356	3300046507	Bacteria	1373
1741	Ga0495608_0057124	3300046511	Bacteria	2576
1742	Ga0495608_0126362	3300046511	Unclassified	1638
1743	Ga0495610_0001258	3300046512	Bacteria	22728
1744	Ga0495610_0030550	3300046512	Bacteria	2822
1745	Ga0495616_0002269	3300046513	Bacteria	12855
1746	Ga0495616_0004499	3300046513	Bacteria	8773
1747	Ga0495618_0004762	3300046514	Bacteria	8297
1748	Ga0495620_0009389	3300046515	Bacteria	5207
1749	Ga0495628_0068544	3300046516	Unclassified	2768
1750	Ga0495630_0009282	3300046517	Bacteria	7072
1751	Ga0495631_0000453	3300046518	Bacteria	27874
1752	Ga0495632_0003923	3300046519	Bacteria	10332
1753	Ga0495632_0035564	3300046519	Bacteria	2540
1754	Ga0495632_0049243	3300046519	Bacteria	2083
1755	Ga0495637_0004044	3300046520	Bacteria	7660
1756	Ga0495637_0030466	3300046520	Bacteria	2394
1757	Ga0495643_0000398	3300046522	Bacteria	57089
1758	Ga0495643_0043196	3300046522	Bacteria	2454
1759	Ga0495666_0030392	3300046526	Unclassified	2651
1760	Ga0495666_0069027	3300046526	Bacteria	1682
1761	Ga0495642_0007036	3300046528	Bacteria	4318
1762	Ga0495652_0005323	3300046529	Bacteria	12134
1763	Ga0495654_0001427	3300046530	Bacteria	16466
1764	Ga0495654_0029684	3300046530	Bacteria	2787
1765	Ga0495665_0009282	3300046531	Bacteria	5328
1766	Ga0495640_0000685	3300046533	Bacteria	25287
1767	Ga0495586_0132724	3300046535	Unclassified	1394
1768	Ga0495587_0030714	3300046536	Bacteria	3258
1769	Ga0495621_0025906	3300046539	Bacteria	1974
1770	Ga0495621_0039325	3300046539	Bacteria	1654
1771	Ga0495621_0050403	3300046539	Bacteria	1488
1772	Ga0495597_0021536	3300046542	Bacteria	2996
1773	Ga0495645_0041755	3300046543	Bacteria	3344
1774	Ga0495645_0054658	3300046543	Bacteria	2901
1775	Ga0495645_0108422	3300046543	Bacteria	1967
1776	Ga0495667_0071520	3300046559	Bacteria	2262
1777	Ga0495656_0053727	3300046615	Bacteria	1731
1778	Ga0495656_0082802	3300046615	Bacteria	1451
1779	Ga0495668_0102172	3300046616	Bacteria	1568
1780	Ga0495668_0167652	3300046616	Bacteria	1203
1781	Ga0495634_0004574	3300046642	Bacteria	10804
1782	Ga0495625_0000114	3300046660	Bacteria	123268
1783	Ga0495625_0012471	3300046660	Bacteria	6887
1784	Ga0495625_0030369	3300046660	Bacteria	4033
1785	Ga0495635_0019357	3300046663	Bacteria	4746
1786	Ga0495635_0054439	3300046663	Bacteria	2756
1787	Ga0495635_0382511	3300046663	Bacteria	936
1788	Ga0495659_0074958	3300046664	Bacteria	1274
1789	Ga0495661_0000049	3300046665	Bacteria	144060
1790	Ga0495588_0025834	3300046674	Bacteria	2929
1791	Ga0495623_0055008	3300046679	Bacteria	2510
1792	Ga0495647_0000456	3300046681	Bacteria	11806
1793	Ga0495647_0002448	3300046681	Bacteria	5855
1794	Ga0495647_0010177	3300046681	Bacteria	3199
1795	Ga0495658_0018669	3300046683	Bacteria	3609
1796	Ga0495658_0043965	3300046683	Bacteria	2500
1797	Ga0495613_0000194	3300046689	Bacteria	59997
1798	Ga0495613_0057848	3300046689	Bacteria	2846
1799	Ga0495624_0089474	3300046690	Bacteria	1900
1800	Ga0495670_0033970	3300046691	Bacteria	2539
1801	Ga0495670_0103383	3300046691	Bacteria	1469
1802	Ga0495671_0002217	3300046692	Bacteria	12358
1803	Ga0495671_0016186	3300046692	Bacteria	3987
1804	Ga0495671_0057547	3300046692	Bacteria	1924
1805	Ga0495600_0028893	3300046809	Bacteria	3588
1806	Ga0495581_0004209	3300047315	Bacteria	8295
1807	Ga0495581_0008570	3300047315	Bacteria	5924
1808	Ga0495604_0316552	3300047317	Unclassified	1044
1809	Ga0495674_0004435	3300047319	Bacteria	13504
1810	Ga0495676_0016445	3300047321	Bacteria	6566
1811	Ga0495676_0028658	3300047321	Bacteria	4751
1812	Ga0495680_0095287	3300047322	Unclassified	2225
1813	Ga0495683_0041506	3300047323	Bacteria	2321
1814	Ga0495687_000523	3300047443	Bacteria	46029
1815	Ga0495677_0076653	3300047445	Bacteria	1250
1816	Ga0495681_0000235	3300047470	Bacteria	45882
1817	Ga0495684_0023721	3300047471	Bacteria	4717
1818	Ga0495684_0155710	3300047471	Bacteria	1707
1819	Ga0495686_0010823	3300047472	Bacteria	6465
1820	Ga0495686_0129142	3300047472	Bacteria	1500
1821	Ga0495593_0026289	3300047673	Bacteria	3215
1822	Ga0495593_0049990	3300047673	Bacteria	2216
1823	Ga0495602_0187191	3300048088	Bacteria	1591
1824	Ga0495602_0219559	3300048088	Bacteria	1436
1825	Ga0495614_0034410	3300048089	Bacteria	2178
1826	Ga0495615_0002219	3300048090	Bacteria	3078
1827	Ga0495615_0035501	3300048090	Bacteria	1219
1828	Ga0495626_0001091	3300048091	Bacteria	22989
1829	Ga0495626_0042453	3300048091	Bacteria	2136
1830	Ga0495626_0051793	3300048091	Bacteria	1893
1831	Ga0496100_0002476	3300048903	Bacteria	9386
1832	Ga0496100_0024511	3300048903	Bacteria	3680
1833	Ga0496100_0359750	3300048903	Bacteria	1101
1834	Ga0496101_0000519	3300048904	Bacteria	24028
1835	Ga0496101_0014120	3300048904	Bacteria	5363
1836	Ga0496101_0030475	3300048904	Bacteria	3782
1837	Ga0496101_0044500	3300048904	Bacteria	3177
1838	Ga0496101_0322416	3300048904	Bacteria	1212
1839	Ga0496102_0001128	3300048905	Bacteria	24505
1840	Ga0496102_0001291	3300048905	Bacteria	22509
1841	Ga0496102_0002766	3300048905	Bacteria	14958
1842	Ga0496102_0003580	3300048905	Bacteria	13159
1843	Ga0496102_0005926	3300048905	Bacteria	10406
1844	Ga0496102_0052734	3300048905	Bacteria	3707
1845	Ga0496102_0060814	3300048905	Bacteria	3456
1846	Ga0496102_0277318	3300048905	Bacteria	1580
1847	Ga0496102_0498632	3300048905	Bacteria	1139
1848	Ga0496102_0566687	3300048905	Bacteria	1058
1849	Ga0496103_0018781	3300048906	Bacteria	4150
1850	Ga0496103_0054783	3300048906	Bacteria	2472
1851	Ga0496103_0055591	3300048906	Bacteria	2455
1852	Ga0496103_0157651	3300048906	Bacteria	1455
1853	Ga0496104_0000132	3300048907	Bacteria	69205
1854	Ga0496104_0002481	3300048907	Bacteria	15897
1855	Ga0496104_0012567	3300048907	Bacteria	7620
1856	Ga0496104_0019371	3300048907	Bacteria	6224
1857	Ga0496104_0029138	3300048907	Bacteria	5120
1858	Ga0496104_0074360	3300048907	Bacteria	3235
1859	Ga0496104_0083877	3300048907	Bacteria	3040
1860	Ga0496104_0091405	3300048907	Bacteria	2909
1861	Ga0496104_0180068	3300048907	Bacteria	2024
1862	Ga0496104_0226930	3300048907	Bacteria	1780
1863	Ga0496105_0000375	3300048908	Bacteria	29508
1864	Ga0496105_0011471	3300048908	Bacteria	7002
1865	Ga0496105_0132032	3300048908	Bacteria	2058
1866	Ga0496106_0002941	3300048909	Bacteria	12680
1867	Ga0496106_0018307	3300048909	Bacteria	5175
1868	Ga0496106_0083996	3300048909	Bacteria	2449
1869	Ga0496106_0087751	3300048909	Bacteria	2397
1870	Ga0496106_0261972	3300048909	Bacteria	1383
1871	Ga0496107_0011654	3300048910	Bacteria	6127
1872	Ga0496107_0022728	3300048910	Bacteria	4433
1873	Ga0496107_0036066	3300048910	Bacteria	3547
1874	Ga0496107_0342501	3300048910	Bacteria	1112
1875	Ga0496108_0003801	3300048911	Bacteria	12089
1876	Ga0496108_0003908	3300048911	Bacteria	11970
1877	Ga0496108_0048859	3300048911	Bacteria	3538
1878	Ga0496108_0048993	3300048911	Bacteria	3533
1879	Ga0496108_0080763	3300048911	Bacteria	2755
1880	Ga0496108_0219205	3300048911	Bacteria	1653
1881	Ga0496108_0226414	3300048911	Bacteria	1625
1882	Ga0496108_0233488	3300048911	Bacteria	1600
1883	Ga0496108_0239927	3300048911	Bacteria	1576
1884	Ga0496108_0308909	3300048911	Bacteria	1378
1885	Ga0496108_0494065	3300048911	Bacteria	1069
1886	Ga0496109_0002100	3300048912	Bacteria	16566
1887	Ga0496109_0003930	3300048912	Bacteria	12420
1888	Ga0496109_0007278	3300048912	Bacteria	9356
1889	Ga0496109_0033663	3300048912	Bacteria	4610
1890	Ga0496109_0065661	3300048912	Bacteria	3322
1891	Ga0496109_0070571	3300048912	Bacteria	3206
1892	Ga0496109_0070811	3300048912	Bacteria	3201
1893	Ga0496109_0078656	3300048912	Bacteria	3037
1894	Ga0496109_0193901	3300048912	Bacteria	1909
1895	Ga0496109_0338025	3300048912	Bacteria	1422
1896	Ga0496110_0001501	3300048913	Bacteria	16929
1897	Ga0496110_0001854	3300048913	Bacteria	15604
1898	Ga0496110_0047364	3300048913	Bacteria	3764
1899	Ga0496110_0060665	3300048913	Bacteria	3336
1900	Ga0496110_0090413	3300048913	Bacteria	2737
1901	Ga0496110_0134763	3300048913	Bacteria	2231
1902	Ga0496110_0179363	3300048913	Bacteria	1923
1903	Ga0496110_0208776	3300048913	Bacteria	1775
1904	Ga0496110_0218439	3300048913	Bacteria	1733
1905	Ga0496110_0561157	3300048913	Bacteria	1037
1906	Ga0496111_0011663	3300048914	Bacteria	5930
1907	Ga0496111_0011972	3300048914	Bacteria	5863
1908	Ga0496111_0070509	3300048914	Bacteria	2542
1909	Ga0496111_0139367	3300048914	Bacteria	1797
1910	Ga0496111_0408398	3300048914	Bacteria	1003
1911	Ga0496112_0064070	3300048915	Bacteria	3626
1912	Ga0496112_0070235	3300048915	Bacteria	3461
1913	Ga0496112_0129970	3300048915	Bacteria	2490
1914	Ga0496112_0238066	3300048915	Bacteria	1773
1915	Ga0496112_0351127	3300048915	Bacteria	1417
1916	Ga0496113_0000915	3300048916	Bacteria	15596
1917	Ga0496113_0092980	3300048916	Bacteria	2327
1918	Ga0496113_0143289	3300048916	Bacteria	1881
1919	Ga0496113_0247752	3300048916	Bacteria	1422
1920	Ga0496114_0176104	3300048917	Bacteria	1866
1921	Ga0496114_0388956	3300048917	Bacteria	1235
1922	Ga0496115_0018816	3300048918	Bacteria	5310
1923	Ga0496116_0009204	3300048919	Bacteria	8455
1924	Ga0496116_0009355	3300048919	Bacteria	8367
1925	Ga0496116_0018533	3300048919	Bacteria	5361
1926	Ga0496116_0104700	3300048919	Bacteria	1680
1927	Ga0496117_0102380	3300048920	Bacteria	1807
1928	Ga0496118_0006592	3300048921	Bacteria	12680
1929	Ga0496118_0010441	3300048921	Bacteria	9198
1930	Ga0496118_0081522	3300048921	Bacteria	2271
1931	Ga0496119_0057133	3300048922	Bacteria	2360
1932	Ga0496120_0005454	3300048923	Bacteria	10145
1933	Ga0496120_0005550	3300048923	Bacteria	10027
1934	Ga0496121_0000164	3300048924	Bacteria	145421
1935	Ga0496121_0012360	3300048924	Bacteria	9331
1936	Ga0496121_0012578	3300048924	Bacteria	9201
1937	Ga0496121_0030572	3300048924	Bacteria	4944
1938	Ga0496121_0032725	3300048924	Bacteria	4720
1939	Ga0496122_0000227	3300048925	Bacteria	125743
1940	Ga0496122_0000552	3300048925	Bacteria	77275
1941	Ga0496122_0000618	3300048925	Bacteria	72850
1942	Ga0496122_0040432	3300048925	Bacteria	3705
1943	Ga0496123_0000265	3300048926	Bacteria	104723
1944	Ga0496123_0001031	3300048926	Bacteria	42310
1945	Ga0496123_0002222	3300048926	Bacteria	24628
1946	Ga0496123_0008404	3300048926	Bacteria	9488
1947	Ga0496124_0000088	3300048927	Bacteria	194644
1948	Ga0496124_0074523	3300048927	Bacteria	2805
1949	Ga0496124_0098534	3300048927	Bacteria	2371
1950	Ga0496125_0000241	3300048928	Bacteria	112044
1951	Ga0496125_0004458	3300048928	Bacteria	16153
1952	Ga0496125_0023660	3300048928	Bacteria	5665
1953	Ga0496125_0027021	3300048928	Bacteria	5211
1954	Ga0496125_0044699	3300048928	Bacteria	3740
1955	Ga0496125_0181346	3300048928	Bacteria	1402
1956	Ga0496126_0000674	3300048929	Bacteria	63031
1957	Ga0496126_0051602	3300048929	Bacteria	3744
1958	Ga0496126_0282690	3300048929	Bacteria	1374
1959	Ga0501298_006155	3300049521	Bacteria	1954
1960	Ga0501031_0108280	3300049568	Bacteria	1814
1961	Ga0501032_0026785	3300049569	Bacteria	3963
1962	Ga0501032_0347933	3300049569	Bacteria	955
1963	Ga0501034_0000581	3300049571	Bacteria	57797
1964	Ga0501034_0000761	3300049571	Bacteria	48401
1965	Ga0501034_0043023	3300049571	Bacteria	4572
1966	Ga0501034_0109418	3300049571	Bacteria	2754
1967	Ga0501036_0340193	3300049572	Bacteria	1253
1968	Ga0501038_0072002	3300049574	Bacteria	2930
1969	Ga0501040_0359569	3300049576	Bacteria	1043
1970	Ga0501041_0009906	3300049577	Bacteria	5613
1971	Ga0501043_0000018	3300049579	Bacteria	161101
1972	Ga0501046_0000042	3300049580	Bacteria	151850
1973	Ga0501046_0082445	3300049580	Bacteria	2484
1974	Ga0501047_0000052	3300049581	Bacteria	153448
1975	Ga0501047_0020251	3300049581	Bacteria	6388
1976	Ga0501048_0197555	3300049582	Bacteria	1425
1977	Ga0501067_0016892	3300049583	Bacteria	4032
1978	Ga0501068_0001232	3300049584	Bacteria	13570
1979	Ga0501070_0006070	3300049586	Bacteria	10293
1980	Ga0501070_0166685	3300049586	Bacteria	1815
1981	Ga0501071_0005621	3300049587	Bacteria	8080
1982	Ga0501071_0017485	3300049587	Bacteria	4946
1983	Ga0501072_0019591	3300049588	Bacteria	5232
1984	Ga0501072_0036827	3300049588	Bacteria	3836
1985	Ga0501073_0005893	3300049589	Bacteria	9144
1986	Ga0501073_0016598	3300049589	Bacteria	5335
1987	Ga0501073_0221306	3300049589	Bacteria	1308
1988	Ga0501074_0006390	3300049590	Bacteria	8508
1989	Ga0501074_0041029	3300049590	Bacteria	3351
1990	Ga0501074_0066753	3300049590	Bacteria	2587
1991	Ga0501075_0070686	3300049591	Bacteria	2637
1992	Ga0501075_0090220	3300049591	Bacteria	2325
1993	Ga0501075_0135451	3300049591	Bacteria	1876
1994	Ga0501075_0242356	3300049591	Bacteria	1374
1995	Ga0501076_0000363	3300049592	Bacteria	28178
1996	Ga0501076_0001639	3300049592	Bacteria	15093
1997	Ga0501076_0101435	3300049592	Bacteria	2320
1998	Ga0501076_0319183	3300049592	Bacteria	1274
1999	Ga0501076_0541386	3300049592	Bacteria	960
2000	Ga0501077_0003490	3300049593	Bacteria	9439
2001	Ga0501077_0026649	3300049593	Bacteria	3668
2002	Ga0501223_022356	3300049663	Bacteria	1235
2003	Ga0501235_035035	3300049669	Bacteria	1139
2004	Ga0501257_008131	3300049686	Bacteria	2352
2005	Ga0501225_0009217	3300049705	Bacteria	2815
2006	Ga0501079_0014795	3300049741	Bacteria	5948
2007	Ga0501079_0017795	3300049741	Bacteria	5430
2008	Ga0501079_0054222	3300049741	Bacteria	3092
2009	Ga0501079_0535506	3300049741	Unclassified	921
2010	Ga0501080_0000712	3300049742	Bacteria	26727
2011	Ga0501080_0115956	3300049742	Bacteria	2483
2012	Ga0501081_0014292	3300049743	Bacteria	5232
2013	Ga0501081_0023905	3300049743	Bacteria	4099
2014	Ga0501083_0007069	3300049744	Bacteria	7966
2015	Ga0501083_0029743	3300049744	Bacteria	3754
2016	Ga0501083_0051234	3300049744	Bacteria	2776
2017	Ga0501083_0105688	3300049744	Bacteria	1854
2018	Ga0501262_001489	3300049759	Bacteria	2632
2019	Ga0501035_0278086	3300049822	Bacteria	1416
2020	Ga0501044_0238129	3300049823	Bacteria	1765
2021	Ga0501044_0378307	3300049823	Bacteria	1331
2022	Ga0501045_0000910	3300049824	Bacteria	19284
2023	Ga0501045_0008619	3300049824	Bacteria	7108
2024	Ga0501045_0168918	3300049824	Unclassified	1629
2025	nmdc:mga03683_15322_c1	3300050489	Bacteria	2859
2026	nmdc:mga03683_18888_c1	3300050489	Bacteria	2626
2027	nmdc:mga03683_456_c1	3300050489	Bacteria	11780
2028	nmdc:mga03683_71474_c1	3300050489	Bacteria	1484
2029	nmdc:mga00v17_220320_c1	3300050491	Bacteria	1228
2030	nmdc:mga00v17_44662_c1	3300050491	Bacteria	2673
2031	nmdc:mga00v17_5492_c1	3300050491	Bacteria	6678
2032	nmdc:mga00v17_73511_c1	3300050491	Bacteria	2123
2033	nmdc:mga00v17_76978_c1	3300050491	Bacteria	2076
2034	nmdc:mga0yw44_1845_c1	3300050492	Bacteria	8703
2035	nmdc:mga0yw44_71457_c1	3300050492	Bacteria	1829
2036	nmdc:mga0k408_1277_c1	3300050493	Bacteria	13677
2037	nmdc:mga0k408_151406_c1	3300050493	Bacteria	1381
2038	nmdc:mga0k408_162699_c1	3300050493	Bacteria	1330
2039	nmdc:mga0k408_22992_c2	3300050493	Bacteria	2528
2040	nmdc:mga0k408_25162_c2	3300050493	Bacteria	2758
2041	nmdc:mga0k408_30297_c1	3300050493	Bacteria	3085
2042	nmdc:mga0k408_370_c1	3300050493	Bacteria	24649
2043	nmdc:mga0k408_43669_c1	3300050493	Bacteria	2584
2044	nmdc:mga0k408_73806_c1	3300050493	Bacteria	1993
2045	nmdc:mga0k408_75462_c1	3300050493	Bacteria	1970
2046	nmdc:mga06z11_135757_c1	3300050494	Bacteria	1386
2047	nmdc:mga06z11_13875_c1	3300050494	Bacteria	3552
2048	nmdc:mga06z11_1671_c1	3300050494	Bacteria	8315
2049	nmdc:mga06z11_3150_c1	3300050494	Bacteria	6364
2050	nmdc:mga06z11_84903_c1	3300050494	Bacteria	1707
2051	nmdc:mga04h51_71150_c1	3300050495	Bacteria	1214
2052	nmdc:mga07m45_1142_c2	3300050496	Bacteria	6347
2053	nmdc:mga07m45_13652_c1	3300050496	Bacteria	4313
2054	nmdc:mga07m45_143_c1	3300050496	Bacteria	28092
2055	nmdc:mga07m45_16817_c1	3300050496	Bacteria	3919
2056	nmdc:mga07m45_1728_c1	3300050496	Bacteria	10066
2057	nmdc:mga07m45_175297_c1	3300050496	Bacteria	1247
2058	nmdc:mga07m45_17605_c1	3300050496	Bacteria	3842
2059	nmdc:mga07m45_2331_c2	3300050496	Bacteria	8048
2060	nmdc:mga07m45_3061_c1	3300050496	Bacteria	7984
2061	nmdc:mga07m45_36833_c1	3300050496	Bacteria	2727
2062	nmdc:mga07m45_55492_c1	3300050496	Bacteria	2240
2063	nmdc:mga07m45_71055_c1	3300050496	Bacteria	1981
2064	nmdc:mga07m45_8289_c1	3300050496	Bacteria	5335
2065	nmdc:mga05p37_1073_c1	3300050507	Bacteria	31314
2066	nmdc:mga05p37_123241_c1	3300050507	Bacteria	3184
2067	nmdc:mga05p37_15217_c1	3300050507	Bacteria	9239
2068	nmdc:mga05p37_263424_c1	3300050507	Bacteria	2062
2069	nmdc:mga05p37_28392_c1	3300050507	Bacteria	1922
2070	nmdc:mga05p37_29620_c1	3300050507	Bacteria	6680
2071	nmdc:mga05p37_341287_c1	3300050507	Bacteria	1766
2072	nmdc:mga05p37_388292_c1	3300050507	Bacteria	1633
2073	nmdc:mga05p37_40908_c1	3300050507	Bacteria	5691
2074	nmdc:mga05p37_466337_c1	3300050507	Bacteria	1458
2075	nmdc:mga05p37_64736_c1	3300050507	Bacteria	4498
2076	nmdc:mga05p37_659296_c1	3300050507	Bacteria	1170
2077	nmdc:mga05p37_86711_c1	3300050507	Bacteria	3859
2078	nmdc:mga09592_100700_c1	3300050508	Bacteria	2474
2079	nmdc:mga09592_386707_c1	3300050508	Bacteria	1209
2080	nmdc:mga09592_414819_c1	3300050508	Bacteria	1163
2081	nmdc:mga09592_5954_c1	3300050508	Bacteria	9940
2082	nmdc:mga09592_65165_c1	3300050508	Bacteria	3085
2083	nmdc:mga09592_652_c1	3300050508	Bacteria	26433
2084	nmdc:mga0qj67_109427_c1	3300050509	Bacteria	2230
2085	nmdc:mga0qj67_448311_c1	3300050509	Bacteria	1039
2086	nmdc:mga0qj67_95442_c1	3300050509	Bacteria	2393
2087	nmdc:mga06r32_23497_c1	3300050510	Bacteria	5705
2088	nmdc:mga06r32_431269_c1	3300050510	Bacteria	1299
2089	nmdc:mga06r32_475408_c1	3300050510	Bacteria	1228
2090	nmdc:mga06r32_61639_c1	3300050510	Bacteria	3611
2091	nmdc:mga08y16_19640_c1	3300050511	Bacteria	7126
2092	nmdc:mga08y16_292063_c1	3300050511	Bacteria	1681
2093	nmdc:mga08y16_298859_c1	3300050511	Bacteria	1660
2094	nmdc:mga08y16_434467_c1	3300050511	Bacteria	1341
2095	nmdc:mga08y16_457573_c1	3300050511	Bacteria	1301
2096	nmdc:mga08y16_50704_c1	3300050511	Bacteria	4343
2097	nmdc:mga08y16_51761_c1	3300050511	Bacteria	4297
2098	nmdc:mga0n895_1012_c1	3300050512	Bacteria	20423
2099	nmdc:mga0n895_255363_c1	3300050512	Bacteria	1779
2100	nmdc:mga0n895_275946_c1	3300050512	Bacteria	1705
2101	nmdc:mga0n895_296227_c1	3300050512	Bacteria	1640
2102	nmdc:mga0n895_3033_c1	3300050512	Bacteria	13359
2103	nmdc:mga0n895_47199_c1	3300050512	Bacteria	4210
2104	nmdc:mga0n895_549068_c1	3300050512	Bacteria	1161
2105	nmdc:mga0n895_8049_c1	3300050512	Bacteria	9096
2106	nmdc:mga0n895_9838_c1	3300050512	Bacteria	8407
2107	nmdc:mga0rr50_10902_c1	3300050513	Bacteria	5795
2108	nmdc:mga0rr50_13011_c1	3300050513	Bacteria	5400
2109	nmdc:mga0rr50_35085_c1	3300050513	Bacteria	3599
2110	nmdc:mga08x19_186323_c1	3300050514	Bacteria	1418
2111	nmdc:mga08x19_20914_c1	3300050514	Bacteria	4034
2112	nmdc:mga08x19_21902_c1	3300050514	Bacteria	3951
2113	nmdc:mga08x19_932_c1	3300050514	Bacteria	18396
2114	nmdc:mga0a205_115702_c1	3300050515	Bacteria	2580
2115	nmdc:mga0a205_19758_c1	3300050515	Bacteria	6357
2116	nmdc:mga0a205_200853_c1	3300050515	Bacteria	1884
2117	nmdc:mga0a205_240922_c1	3300050515	Bacteria	1690
2118	nmdc:mga0a205_43353_c1	3300050515	Bacteria	4338
2119	nmdc:mga0a205_447173_c1	3300050515	Bacteria	1153
2120	nmdc:mga0a205_5463_c1	3300050515	Bacteria	11449
2121	nmdc:mga0a205_54672_c1	3300050515	Bacteria	3854
2122	nmdc:mga0a205_5548_c1	3300050515	Bacteria	11365
2123	nmdc:mga0a205_71668_c1	3300050515	Bacteria	3347
2124	nmdc:mga0a205_82133_c1	3300050515	Bacteria	3113
2125	nmdc:mga0a205_87696_c1	3300050515	Bacteria	3006
2126	nmdc:mga0sz30_1417_c1	3300050516	Bacteria	8565
2127	nmdc:mga0sz30_39470_c1	3300050516	Bacteria	1981
2128	Ga0495601_0002448	3300053077	Bacteria	10543
2129	Ga0495601_0004020	3300053077	Bacteria	8471
2130	Ga0495601_0006278	3300053077	Bacteria	6944
2131	Ga0495601_0080725	3300053077	Bacteria	2087
2132	Ga0495612_0023950	3300053078	Bacteria	2451
2133	Ga0500610_0131745	3300053079	Bacteria	1270
2134	Ga0495619_0003109	3300053085	Bacteria	10775
2135	Ga0495619_0018811	3300053085	Bacteria	4386
2136	Ga0495619_0041667	3300053085	Bacteria	3004
2137	Ga0495619_0042524	3300053085	Bacteria	2976
2138	Ga0495619_0102460	3300053085	Bacteria	1950
2139	Ga0500578_0000282	3300053086	Bacteria	62821
2140	Ga0500578_0228882	3300053086	Bacteria	1127
2141	Ga0500643_013146	3300053087	Bacteria	2936
2142	Ga0500644_0026433	3300053088	Bacteria	1796
2143	Ga0500644_0036514	3300053088	Bacteria	1600
2144	Ga0500644_0037610	3300053088	Bacteria	1583
2145	Ga0500646_0045488	3300053090	Bacteria	1250
2146	Ga0500646_0058632	3300053090	Bacteria	1127
2147	Ga0500651_0000287	3300053093	Bacteria	29280
2148	Ga0500651_0011376	3300053093	Bacteria	5362
2149	Ga0500562_003454	3300053108	Bacteria	3958
2150	Ga0500571_019234	3300053110	Bacteria	3813
2151	Ga0500594_0002490	3300053118	Bacteria	4004
2152	Ga0500595_011966	3300053119	Bacteria	3373
2153	Ga0500607_001396	3300053121	Bacteria	21858
2154	Ga0500608_078936	3300053122	Bacteria	1556
2155	Ga0500618_027279	3300053125	Bacteria	1360
2156	Ga0500623_027553	3300053127	Bacteria	2946
2157	Ga0500628_001726	3300053129	Bacteria	3690
2158	Ga0500642_0005123	3300053130	Bacteria	4195
2159	Ga0500642_0006046	3300053130	Bacteria	3954
2160	Ga0500642_0007124	3300053130	Bacteria	3737
2161	Ga0500652_000915	3300053131	Bacteria	9737
2162	Ga0500652_001232	3300053131	Bacteria	8133
2163	Ga0500658_0000201	3300053134	Bacteria	28349
2164	Ga0500658_0001964	3300053134	Bacteria	8037
2165	Ga0500658_0023686	3300053134	Bacteria	2346
2166	Ga0500559_0000116	3300053136	Bacteria	63080
2167	Ga0500559_0000193	3300053136	Bacteria	49137
2168	Ga0500559_0000945	3300053136	Bacteria	18296
2169	Ga0500564_114417	3300053138	Bacteria	1181
2170	Ga0500568_0004081	3300053139	Bacteria	7908
2171	Ga0500568_0040115	3300053139	Bacteria	1886
2172	Ga0500590_011775	3300053148	Bacteria	4441
2173	Ga0500604_0055584	3300053151	Bacteria	1231
2174	Ga0500619_021162	3300053154	Bacteria	1870
2175	Ga0500622_0000198	3300053156	Bacteria	63633
2176	Ga0500622_0000413	3300053156	Bacteria	40682
2177	Ga0500622_0001707	3300053156	Bacteria	17033
2178	Ga0500622_0009462	3300053156	Bacteria	5391
2179	Ga0500638_009292	3300053162	Bacteria	4244
2180	Ga0500636_0045451	3300053177	Bacteria	2590
2181	Ga0500570_070411	3300053724	Bacteria	1635
2182	Ga0500584_028299	3300053726	Bacteria	2604
2183	Ga0500645_017349	3300053730	Bacteria	2258
2184	Ga0501084_0013217	3300054114	Bacteria	6831
2185	Ga0501084_0140290	3300054114	Bacteria	2035
2186	Ga0590071_036473	3300059421	Bacteria	1179
2187	Ga0501082_0013903	3300060353	Bacteria	6921
2188	Ga0501082_0051476	3300060353	Bacteria	3550
2189	Ga0466962_0066011	3300061719	Bacteria	1727
2190	Ga0530510_0002694	3300061734	Bacteria	12211
2191	Ga0530510_0017920	3300061734	Bacteria	5021
2192	Ga0530510_0049992	3300061734	Bacteria	3020
2193	Ga0530510_0074489	3300061734	Bacteria	2465
2194	Ga0530510_0430222	3300061734	Bacteria	997

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300048906	Ga0496103_0055591	Ga0496103_0055591_15_788	230
2	3300035086	Ga0373934_0204951	Ga0373934_0204951_10_747	235
3	3300035115	Ga0373941_0034728	Ga0373941_0034728_28_798	237
4	3300035121	Ga0373960_0021353	Ga0373960_0021353_19_789	237
5	3300048917	Ga0496114_0388956	Ga0496114_0388956_410_1222	238
6	3300050512	nmdc:mga0n895_549068_c1	nmdc:mga0n895_549068_c1_405_1136	242
7	3300050515	nmdc:mga0a205_43353_c1	nmdc:mga0a205_43353_c1_3591_4322	242
8	3300033180	Ga0307510_10004823	Ga0307510_1000482312	244
9	3300048911	Ga0496108_0003801	Ga0496108_0003801_11330_12076	244
10	3300027614	Ga0209970_1000492	Ga0209970_10004924	246
11	3300035695	Ga0373927_0002994	Ga0373927_0002994_22_795	247
12	3300046517	Ga0495630_0009282	Ga0495630_0009282_38_811	247
13	3300047317	Ga0495604_0316552	Ga0495604_0316552_259_1032	247
14	3300053077	Ga0495601_0002448	Ga0495601_0002448_22_795	247
15	3300042876	Ga0451577_0184671	Ga0451577_0184671_610_1476	253
16	3300044712	Ga0453684_0004366	Ga0453684_0004366_8390_9259	253
17	3300005543	Ga0070672_100214316	Ga0070672_1002143162	254
18	3300005719	Ga0068861_100502828	Ga0068861_1005028282	254
19	3300009553	Ga0105249_10245639	Ga0105249_102456392	254
20	3300025901	Ga0207688_10250941	Ga0207688_102509411	254
21	3300025940	Ga0207691_10134180	Ga0207691_101341802	254
22	3300026118	Ga0207675_100198089	Ga0207675_1001980892	254
23	3300042876	Ga0451577_0131013	Ga0451577_0131013_62_931	254
24	3300044673	Ga0453683_0115667	Ga0453683_0115667_772_1641	254
25	3300044712	Ga0453684_0018838	Ga0453684_0018838_2348_3217	254
26	3300048909	Ga0496106_0087751	Ga0496106_0087751_731_1498	254
27	3300048915	Ga0496112_0351127	Ga0496112_0351127_192_959	254
28	3300050511	nmdc:mga08y16_457573_c1	nmdc:mga08y16_457573_c1_20_787	254
29	3300050512	nmdc:mga0n895_275946_c1	nmdc:mga0n895_275946_c1_743_1510	254
30	3300035724	Ga0373933_0333053	Ga0373933_0333053_161_958	255
31	3300048911	Ga0496108_0048993	Ga0496108_0048993_14_865	255
32	3300048929	Ga0496126_0282690	Ga0496126_0282690_585_1358	257
33	3300044684	Ga0466966_0031687	Ga0466966_0031687_2405_3271	258
34	3300044706	Ga0466964_0094826	Ga0466964_0094826_185_1051	258
35	3300044712	Ga0453684_0046623	Ga0453684_0046623_4473_5342	258
36	3300045049	Ga0466959_0228855	Ga0466959_0228855_119_985	258
37	3300048914	Ga0496111_0011972	Ga0496111_0011972_2498_3277	258
38	3300061719	Ga0466962_0066011	Ga0466962_0066011_378_1244	258
39	3300005458	Ga0070681_10066669	Ga0070681_100666694	260
40	3300014326	Ga0157380_10034584	Ga0157380_100345843	260
41	3300025912	Ga0207707_10215624	Ga0207707_102156242	260
42	3300025937	Ga0207669_10082021	Ga0207669_100820212	260
43	3300028786	Ga0307517_10000392	Ga0307517_100003922	260
44	3300046471	Ga0495650_0037473	Ga0495650_0037473_730_1551	260
45	3300046543	Ga0495645_0054658	Ga0495645_0054658_1570_2451	260
46	3300006358	Ga0068871_100203748	Ga0068871_1002037482	261
47	3300042876	Ga0451577_0199220	Ga0451577_0199220_174_1043	261
48	3300045051	Ga0451576_0184470	Ga0451576_0184470_1174_2043	261
49	3300005355	Ga0070671_100092086	Ga0070671_1000920862	262
50	3300005367	Ga0070667_100241377	Ga0070667_1002413771	262
51	3300014968	Ga0157379_10422148	Ga0157379_104221481	262
52	3300025941	Ga0207711_10337148	Ga0207711_103371481	262
53	3300025986	Ga0207658_10059528	Ga0207658_100595281	262
54	3300026121	Ga0207683_10010572	Ga0207683_100105722	262
55	3300042134	Ga0450898_010581	Ga0450898_010581_421_1302	262
56	3300042876	Ga0451577_0019249	Ga0451577_0019249_4958_5827	262
57	3300044673	Ga0453683_0042260	Ga0453683_0042260_1575_2444	262
58	3300005530	Ga0070679_100107109	Ga0070679_1001071093	263
59	3300005563	Ga0068855_100495983	Ga0068855_1004959832	263
60	3300005719	Ga0068861_100282460	Ga0068861_1002824602	263
61	3300005937	Ga0081455_10000015	Ga0081455_10000015101	263
62	3300025921	Ga0207652_10282504	Ga0207652_102825042	263
63	3300026075	Ga0207708_10214583	Ga0207708_102145832	263
64	3300026118	Ga0207675_100432325	Ga0207675_1004323252	263
65	3300035692	Ga0373935_0090262	Ga0373935_0090262_57_923	263
66	3300045051	Ga0451576_0021695	Ga0451576_0021695_5771_6637	263
67	3300005457	Ga0070662_100000588	Ga0070662_10000058823	264
68	3300035086	Ga0373934_0061498	Ga0373934_0061498_488_1354	264
69	3300035170	Ga0373943_0043647	Ga0373943_0043647_1298_2164	264
70	3300035692	Ga0373935_0013065	Ga0373935_0013065_1781_2647	264
71	3300035695	Ga0373927_0074587	Ga0373927_0074587_334_1200	264
72	3300035725	Ga0373947_0005039	Ga0373947_0005039_5775_6641	264
73	3300037068	Ga0373925_0012694	Ga0373925_0012694_3631_4497	264
74	3300046473	Ga0495582_0009736	Ga0495582_0009736_1239_2105	264
75	3300046476	Ga0495662_0029586	Ga0495662_0029586_647_1513	264
76	3300046526	Ga0495666_0069027	Ga0495666_0069027_78_944	264
77	3300046559	Ga0495667_0071520	Ga0495667_0071520_1240_2106	264
78	3300046663	Ga0495635_0054439	Ga0495635_0054439_1245_2111	264
79	3300046683	Ga0495658_0043965	Ga0495658_0043965_368_1234	264
80	3300046689	Ga0495613_0057848	Ga0495613_0057848_538_1404	264
81	3300046809	Ga0495600_0028893	Ga0495600_0028893_409_1275	264
82	3300047315	Ga0495581_0004209	Ga0495581_0004209_5066_5932	264
83	3300047471	Ga0495684_0023721	Ga0495684_0023721_3442_4308	264
84	3300061734	Ga0530510_0049992	Ga0530510_0049992_740_1597	264
85	iso_pu_bacteria	2885192300	2885195746	264
86	3300005719	Ga0068861_100115188	Ga0068861_1001151882	265
87	3300006847	Ga0075431_100051213	Ga0075431_1000512132	265
88	3300006880	Ga0075429_100106717	Ga0075429_1001067171	265
89	3300009094	Ga0111539_10001182	Ga0111539_1000118217	265
90	3300009147	Ga0114129_10044286	Ga0114129_100442865	265
91	3300025933	Ga0207706_10000355	Ga0207706_1000035516	265
92	3300025933	Ga0207706_10115567	Ga0207706_101155672	265
93	3300026118	Ga0207675_100072160	Ga0207675_1000721603	265
94	3300027907	Ga0207428_10149802	Ga0207428_101498022	265
95	3300050507	nmdc:mga05p37_123241_c1	nmdc:mga05p37_123241_c1_577_1446	265
96	3300050508	nmdc:mga09592_65165_c1	nmdc:mga09592_65165_c1_1800_2669	265
97	3300050510	nmdc:mga06r32_61639_c1	nmdc:mga06r32_61639_c1_129_998	265
98	3300050511	nmdc:mga08y16_434467_c1	nmdc:mga08y16_434467_c1_220_1089	265
99	3300050511	nmdc:mga08y16_51761_c1	nmdc:mga08y16_51761_c1_581_1450	265
100	3300005985	Ga0081539_10028128	Ga0081539_100281282	266
101	3300006852	Ga0075433_10240037	Ga0075433_102400371	266
102	3300013297	Ga0157378_10135579	Ga0157378_101355792	266
103	3300013297	Ga0157378_10479869	Ga0157378_104798691	266
104	3300025920	Ga0207649_10163046	Ga0207649_101630462	266
105	3300025933	Ga0207706_10500107	Ga0207706_105001072	266
106	3300025937	Ga0207669_10038436	Ga0207669_100384361	266
107	3300031548	Ga0307408_100041061	Ga0307408_1000410612	266
108	3300031911	Ga0307412_10030757	Ga0307412_100307572	266
109	3300032002	Ga0307416_100094927	Ga0307416_1000949272	266
110	3300041404	Ga0439436_0009415	Ga0439436_0009415_1411_2283	266
111	3300042006	Ga0439432_028598	Ga0439432_028598_870_1742	266
112	3300042007	Ga0439449_0005813	Ga0439449_0005813_1530_2402	266
113	3300042010	Ga0439452_021392	Ga0439452_021392_423_1295	266
114	3300042156	Ga0439446_0001196	Ga0439446_0001196_2449_3321	266
115	3300042435	Ga0439434_0009282	Ga0439434_0009282_519_1391	266
116	3300006852	Ga0075433_10137967	Ga0075433_101379672	267
117	3300006871	Ga0075434_100406953	Ga0075434_1004069532	267
118	3300007076	Ga0075435_100040140	Ga0075435_1000401402	267
119	3300027907	Ga0207428_10037508	Ga0207428_100375082	267
120	3300028794	Ga0307515_10015172	Ga0307515_1001517212	267
121	3300031730	Ga0307516_10002019	Ga0307516_100020192	267
122	3300037471	Ga0395905_0000600	Ga0395905_0000600_41581_42396	267
123	3300044712	Ga0453684_0064213	Ga0453684_0064213_2168_3037	267
124	3300050512	nmdc:mga0n895_9838_c1	nmdc:mga0n895_9838_c1_396_1265	267
125	3300050513	nmdc:mga0rr50_35085_c1	nmdc:mga0rr50_35085_c1_483_1352	267
126	3300050515	nmdc:mga0a205_82133_c1	nmdc:mga0a205_82133_c1_293_1162	267
127	3300003203	JGI25406J46586_10001181	JGI25406J46586_1000118112	268
128	3300005985	Ga0081539_10000240	Ga0081539_1000024026	268
129	3300035170	Ga0373943_0098899	Ga0373943_0098899_19_828	268
130	3300035695	Ga0373927_0184422	Ga0373927_0184422_169_1038	268
131	3300041404	Ga0439436_0034414	Ga0439436_0034414_622_1428	268
132	3300048905	Ga0496102_0566687	Ga0496102_0566687_16_825	268
133	3300049590	Ga0501074_0006390	Ga0501074_0006390_2027_2899	268
134	3300049591	Ga0501075_0090220	Ga0501075_0090220_436_1308	268
135	3300049592	Ga0501076_0001639	Ga0501076_0001639_1780_2652	268
136	3300049593	Ga0501077_0026649	Ga0501077_0026649_2616_3488	268
137	3300049741	Ga0501079_0017795	Ga0501079_0017795_3398_4270	268
138	3300049744	Ga0501083_0105688	Ga0501083_0105688_69_941	268
139	3300049824	Ga0501045_0168918	Ga0501045_0168918_387_1259	268
140	3300054114	Ga0501084_0013217	Ga0501084_0013217_1338_2210	268
141	3300060353	Ga0501082_0013903	Ga0501082_0013903_5533_6405	268
142	3300003320	rootH2_10037427	rootH2_100374272	269
143	3300003323	rootH1_10261211	rootH1_102612112	269
144	3300005343	Ga0070687_100054143	Ga0070687_1000541432	269
145	3300006177	Ga0075362_10069717	Ga0075362_100697172	269
146	3300006195	Ga0075366_10016446	Ga0075366_100164462	269
147	3300007076	Ga0075435_100150574	Ga0075435_1001505742	269
148	3300009177	Ga0105248_10105269	Ga0105248_101052692	269
149	3300013306	Ga0163162_10573286	Ga0163162_105732862	269
150	3300014968	Ga0157379_10167236	Ga0157379_101672362	269
151	3300025949	Ga0207667_10323938	Ga0207667_103239381	269
152	3300026118	Ga0207675_100465340	Ga0207675_1004653402	269
153	3300026121	Ga0207683_10108384	Ga0207683_101083842	269
154	3300031548	Ga0307408_100329836	Ga0307408_1003298361	269
155	3300046472	Ga0495580_0152043	Ga0495580_0152043_694_1560	269
156	3300046473	Ga0495582_0021849	Ga0495582_0021849_513_1379	269
157	3300046531	Ga0495665_0009282	Ga0495665_0009282_2097_2963	269
158	3300046663	Ga0495635_0382511	Ga0495635_0382511_33_899	269
159	3300046681	Ga0495647_0002448	Ga0495647_0002448_2494_3360	269
160	3300046683	Ga0495658_0018669	Ga0495658_0018669_1477_2343	269
161	3300048905	Ga0496102_0060814	Ga0496102_0060814_2495_3364	269
162	3300048907	Ga0496104_0180068	Ga0496104_0180068_1088_1957	269
163	3300048911	Ga0496108_0080763	Ga0496108_0080763_846_1715	269
164	3300048912	Ga0496109_0070811	Ga0496109_0070811_1144_2013	269
165	3300048913	Ga0496110_0047364	Ga0496110_0047364_2084_2953	269
166	3300050489	nmdc:mga03683_15322_c1	nmdc:mga03683_15322_c1_1458_2330	269
167	3300050515	nmdc:mga0a205_200853_c1	nmdc:mga0a205_200853_c1_961_1830	269
168	3300053085	Ga0495619_0042524	Ga0495619_0042524_474_1340	269
169	3300003773	Ga0055537_1000032	Ga0055537_10000328	270
170	3300003784	Ga0055534_1000060	Ga0055534_100006085	270
171	3300003790	Ga0055528_1000709	Ga0055528_100070928	270
172	3300005347	Ga0070668_100151191	Ga0070668_1001511912	270
173	3300006048	Ga0075363_100051956	Ga0075363_1000519562	270
174	3300006051	Ga0075364_10020128	Ga0075364_100201282	270
175	3300009176	Ga0105242_10067322	Ga0105242_100673222	270
176	3300025263	Ga0209565_1000144	Ga0209565_1000144102	270
177	3300025273	Ga0209673_1000136	Ga0209673_10001368	270
178	3300025291	Ga0209675_1000071	Ga0209675_10000718	270
179	3300026078	Ga0207702_10038710	Ga0207702_100387102	270
180	3300026118	Ga0207675_100057060	Ga0207675_1000570602	270
181	3300027666	Ga0209282_1004405	Ga0209282_100440510	270
182	3300035114	Ga0373939_0003892	Ga0373939_0003892_1912_2781	270
183	3300035242	Ga0373962_0073075	Ga0373962_0073075_105_974	270
184	3300035691	Ga0373931_0002552	Ga0373931_0002552_5661_6530	270
185	3300046616	Ga0495668_0167652	Ga0495668_0167652_221_1093	270
186	3300049587	Ga0501071_0017485	Ga0501071_0017485_81_938	270
187	3300049591	Ga0501075_0135451	Ga0501075_0135451_702_1559	270
188	3300049592	Ga0501076_0101435	Ga0501076_0101435_304_1161	270
189	3300049741	Ga0501079_0054222	Ga0501079_0054222_1285_2142	270
190	3300049743	Ga0501081_0014292	Ga0501081_0014292_722_1579	270
191	3300050492	nmdc:mga0yw44_1845_c1	nmdc:mga0yw44_1845_c1_4490_5362	270
192	3300050496	nmdc:mga07m45_143_c1	nmdc:mga07m45_143_c1_20360_21232	270
193	3300050511	nmdc:mga08y16_292063_c1	nmdc:mga08y16_292063_c1_172_1104	270
194	3300050515	nmdc:mga0a205_5548_c1	nmdc:mga0a205_5548_c1_18_887	270
195	3300054114	Ga0501084_0140290	Ga0501084_0140290_315_1172	270
196	3300003215	JGI25153J46596_10002916	JGI25153J46596_100029162	271
197	3300005937	Ga0081455_10000029	Ga0081455_10000029135	271
198	3300005985	Ga0081539_10032224	Ga0081539_100322242	271
199	3300006871	Ga0075434_100127299	Ga0075434_1001272993	271
200	3300027866	Ga0209813_10045012	Ga0209813_100450122	271
201	3300041404	Ga0439436_0005275	Ga0439436_0005275_2270_3085	271
202	3300041999	Ga0439433_0000543	Ga0439433_0000543_4231_5046	271
203	3300044712	Ga0453684_0169042	Ga0453684_0169042_502_1368	271
204	3300045051	Ga0451576_0109690	Ga0451576_0109690_632_1498	271
205	3300050494	nmdc:mga06z11_3150_c1	nmdc:mga06z11_3150_c1_3659_4531	271
206	3300050495	nmdc:mga04h51_71150_c1	nmdc:mga04h51_71150_c1_316_1188	271
207	3300050512	nmdc:mga0n895_296227_c1	nmdc:mga0n895_296227_c1_57_914	271
208	3300005328	Ga0070676_10267610	Ga0070676_102676101	272
209	3300005334	Ga0068869_100370697	Ga0068869_1003706971	272
210	3300005343	Ga0070687_100151467	Ga0070687_1001514672	272
211	3300005355	Ga0070671_100091940	Ga0070671_1000919403	272
212	3300005441	Ga0070700_100302639	Ga0070700_1003026392	272
213	3300005548	Ga0070665_100027097	Ga0070665_1000270973	272
214	3300005617	Ga0068859_100275875	Ga0068859_1002758752	272
215	3300005843	Ga0068860_100201777	Ga0068860_1002017772	272
216	3300006237	Ga0097621_100030405	Ga0097621_1000304052	272
217	3300006237	Ga0097621_100077553	Ga0097621_1000775533	272
218	3300006358	Ga0068871_100022953	Ga0068871_1000229533	272
219	3300006914	Ga0075436_100155073	Ga0075436_1001550732	272
220	3300006931	Ga0097620_100275879	Ga0097620_1002758791	272
221	3300009177	Ga0105248_10608529	Ga0105248_106085291	272
222	3300013105	Ga0157369_10113511	Ga0157369_101135111	272
223	3300013297	Ga0157378_10460190	Ga0157378_104601902	272
224	3300013308	Ga0157375_10131058	Ga0157375_101310581	272
225	3300014325	Ga0163163_10627800	Ga0163163_106278001	272
226	3300014968	Ga0157379_10101160	Ga0157379_101011603	272
227	3300014968	Ga0157379_10202321	Ga0157379_102023212	272
228	3300014969	Ga0157376_10006892	Ga0157376_100068922	272
229	3300014969	Ga0157376_10058983	Ga0157376_100589832	272
230	3300025938	Ga0207704_10069487	Ga0207704_100694872	272
231	3300025942	Ga0207689_10004927	Ga0207689_1000492713	272
232	3300025986	Ga0207658_10382950	Ga0207658_103829501	272
233	3300026088	Ga0207641_10393440	Ga0207641_103934402	272
234	3300026118	Ga0207675_100029152	Ga0207675_1000291525	272
235	3300031238	Ga0265332_10000682	Ga0265332_100006824	272
236	3300031239	Ga0265328_10081897	Ga0265328_100818971	272
237	3300031242	Ga0265329_10000424	Ga0265329_100004245	272
238	3300031250	Ga0265331_10000592	Ga0265331_1000059230	272
239	3300031344	Ga0265316_10027489	Ga0265316_100274892	272
240	3300031712	Ga0265342_10040080	Ga0265342_100400802	272
241	3300037471	Ga0395905_0000856	Ga0395905_0000856_28925_29806	272
242	3300042876	Ga0451577_0315731	Ga0451577_0315731_307_1173	272
243	3300050514	nmdc:mga08x19_20914_c1	nmdc:mga08x19_20914_c1_2362_3219	272
244	3300006353	Ga0075370_10046360	Ga0075370_100463602	273
245	3300041404	Ga0439436_0023169	Ga0439436_0023169_621_1487	273
246	3300046530	Ga0495654_0029684	Ga0495654_0029684_830_1651	273
247	3300046692	Ga0495671_0002217	Ga0495671_0002217_4386_5252	273
248	3300053090	Ga0500646_0045488	Ga0500646_0045488_189_1010	273
249	3300061734	Ga0530510_0430222	Ga0530510_0430222_51_908	273
250	3300005614	Ga0068856_100509722	Ga0068856_1005097222	274
251	3300006195	Ga0075366_10039835	Ga0075366_100398353	274
252	3300009094	Ga0111539_10037756	Ga0111539_100377561	274
253	3300009177	Ga0105248_10140659	Ga0105248_101406592	274
254	3300010375	Ga0105239_10420616	Ga0105239_104206162	274
255	3300013306	Ga0163162_10239747	Ga0163162_102397472	274
256	3300025904	Ga0207647_10182484	Ga0207647_101824841	274
257	3300025928	Ga0207700_10134256	Ga0207700_101342562	274
258	3300025933	Ga0207706_10020153	Ga0207706_100201532	274
259	3300025936	Ga0207670_10086950	Ga0207670_100869502	274
260	3300025941	Ga0207711_10099131	Ga0207711_100991312	274
261	3300026078	Ga0207702_10490221	Ga0207702_104902212	274
262	3300031251	Ga0265327_10006362	Ga0265327_100063624	274
263	3300031731	Ga0307405_10197671	Ga0307405_101976712	274
264	3300036401	Ga0373937_0086869	Ga0373937_0086869_1818_2687	274
265	3300048088	Ga0495602_0219559	Ga0495602_0219559_543_1412	274
266	3300050491	nmdc:mga00v17_5492_c1	nmdc:mga00v17_5492_c1_798_1718	274
267	3300050493	nmdc:mga0k408_75462_c1	nmdc:mga0k408_75462_c1_699_1580	274
268	3300050515	nmdc:mga0a205_19758_c1	nmdc:mga0a205_19758_c1_64_921	274
269	3300061734	Ga0530510_0017920	Ga0530510_0017920_4106_4963	274
270	3300005339	Ga0070660_100119348	Ga0070660_1001193482	275
271	3300005366	Ga0070659_100102620	Ga0070659_1001026202	275
272	3300005530	Ga0070679_100236580	Ga0070679_1002365802	275
273	3300005563	Ga0068855_100146689	Ga0068855_1001466892	275
274	3300005616	Ga0068852_100142779	Ga0068852_1001427792	275
275	3300013105	Ga0157369_10211306	Ga0157369_102113061	275
276	3300013307	Ga0157372_10199052	Ga0157372_101990522	275
277	3300025919	Ga0207657_10103865	Ga0207657_101038652	275
278	3300025921	Ga0207652_10222979	Ga0207652_102229792	275
279	3300025949	Ga0207667_10134498	Ga0207667_101344982	275
280	3300026142	Ga0207698_10027969	Ga0207698_100279692	275
281	3300028794	Ga0307515_10075359	Ga0307515_100753592	275
282	3300031730	Ga0307516_10006396	Ga0307516_100063968	275
283	3300037418	Ga0395900_0198364	Ga0395900_0198364_622_1491	275
284	3300041456	Ga0451795_1432999	Ga0451795_1432999_661_1533	275
285	3300041505	Ga0451849_0193616	Ga0451849_0193616_238_1110	275
286	3300048905	Ga0496102_0001291	Ga0496102_0001291_13191_14132	275
287	3300048911	Ga0496108_0308909	Ga0496108_0308909_445_1347	275
288	3300048927	Ga0496124_0000088	Ga0496124_0000088_165946_166866	275
289	3300050491	nmdc:mga00v17_220320_c1	nmdc:mga00v17_220320_c1_85_1005	275
290	3300050493	nmdc:mga0k408_162699_c1	nmdc:mga0k408_162699_c1_82_963	275
291	3300050496	nmdc:mga07m45_175297_c1	nmdc:mga07m45_175297_c1_364_1236	275
292	3300053085	Ga0495619_0018811	Ga0495619_0018811_2859_3728	275
293	3300005344	Ga0070661_100024209	Ga0070661_1000242092	276
294	3300005347	Ga0070668_100043333	Ga0070668_1000433332	276
295	3300005364	Ga0070673_100006521	Ga0070673_1000065212	276
296	3300005367	Ga0070667_100005618	Ga0070667_1000056189	276
297	3300005458	Ga0070681_10004363	Ga0070681_1000436310	276
298	3300005530	Ga0070679_100014873	Ga0070679_1000148732	276
299	3300005539	Ga0068853_100002256	Ga0068853_1000022568	276
300	3300005545	Ga0070695_100201031	Ga0070695_1002010312	276
301	3300005577	Ga0068857_100277225	Ga0068857_1002772252	276
302	3300005617	Ga0068859_100438227	Ga0068859_1004382272	276
303	3300005842	Ga0068858_100172541	Ga0068858_1001725411	276
304	3300005843	Ga0068860_100062535	Ga0068860_1000625354	276
305	3300006931	Ga0097620_100438249	Ga0097620_1004382492	276
306	3300009101	Ga0105247_10035237	Ga0105247_100352373	276
307	3300013100	Ga0157373_10037480	Ga0157373_100374802	276
308	3300013104	Ga0157370_10078939	Ga0157370_100789392	276
309	3300013297	Ga0157378_10149485	Ga0157378_101494852	276
310	3300025912	Ga0207707_10001908	Ga0207707_100019088	276
311	3300025920	Ga0207649_10001288	Ga0207649_100012884	276
312	3300025921	Ga0207652_10001808	Ga0207652_100018088	276
313	3300025960	Ga0207651_10002385	Ga0207651_100023852	276
314	3300025972	Ga0207668_10032080	Ga0207668_100320802	276
315	3300026041	Ga0207639_10023045	Ga0207639_100230452	276
316	3300026089	Ga0207648_10001240	Ga0207648_100012406	276
317	3300026116	Ga0207674_10174094	Ga0207674_101740942	276
318	3300028381	Ga0268264_10044305	Ga0268264_100443054	276
319	3300046454	Ga0495592_0000292	Ga0495592_0000292_2284_3117	276
320	3300003759	Ga0055525_1000084	Ga0055525_1000084150	277
321	3300025230	Ga0209563_100025	Ga0209563_100025151	277
322	3300025931	Ga0207644_10422207	Ga0207644_104222071	277
323	3300046689	Ga0495613_0000194	Ga0495613_0000194_41033_41974	277
324	3300047470	Ga0495681_0000235	Ga0495681_0000235_10401_11342	277
325	3300048905	Ga0496102_0277318	Ga0496102_0277318_562_1428	277
326	3300048915	Ga0496112_0064070	Ga0496112_0064070_1080_1952	277
327	3300048919	Ga0496116_0018533	Ga0496116_0018533_3882_4748	277
328	3300048929	Ga0496126_0000674	Ga0496126_0000674_41250_42191	277
329	3300050515	nmdc:mga0a205_447173_c1	nmdc:mga0a205_447173_c1_114_971	277
330	3300002773	JGI25152J39213_1001586	JGI25152J39213_10015862	278
331	3300003215	JGI25153J46596_10000537	JGI25153J46596_100005374	278
332	3300003771	Ga0055526_1000296	Ga0055526_100029629	278
333	3300025245	Ga0207425_1000259	Ga0207425_100025930	278
334	3300025258	Ga0209129_1000175	Ga0209129_100017546	278
335	3300025273	Ga0209673_1008351	Ga0209673_10083515	278
336	3300025295	Ga0209564_1000136	Ga0209564_1000136120	278
337	3300025297	Ga0209758_1000275	Ga0209758_100027569	278
338	3300025304	Ga0209257_1031072	Ga0209257_10310722	278
339	3300037471	Ga0395905_0011710	Ga0395905_0011710_5449_6330	278
340	3300037471	Ga0395905_0153899	Ga0395905_0153899_54_926	278
341	3300053726	Ga0500584_028299	Ga0500584_028299_1112_2053	278
342	3300006051	Ga0075364_10006926	Ga0075364_100069264	279
343	3300042001	Ga0439441_002130	Ga0439441_002130_943_1824	279
344	3300049571	Ga0501034_0043023	Ga0501034_0043023_3559_4440	279
345	3300049581	Ga0501047_0020251	Ga0501047_0020251_4230_5111	279
346	3300049586	Ga0501070_0006070	Ga0501070_0006070_5946_6827	279
347	3300049588	Ga0501072_0019591	Ga0501072_0019591_1061_1942	279
348	3300049589	Ga0501073_0016598	Ga0501073_0016598_4043_4924	279
349	3300049592	Ga0501076_0541386	Ga0501076_0541386_75_944	279
350	3300049744	Ga0501083_0051234	Ga0501083_0051234_1763_2644	279
351	3300060353	Ga0501082_0051476	Ga0501082_0051476_1753_2634	279
352	3300003791	Ga0055530_10013375	Ga0055530_100133752	280
353	3300005262	Ga0065165_1001709	Ga0065165_10017095	280
354	3300025273	Ga0209673_1014731	Ga0209673_10147313	280
355	3300025298	Ga0209050_1000247	Ga0209050_100024763	280
356	3300026142	Ga0207698_10662102	Ga0207698_106621021	280
357	3300035116	Ga0373945_0052838	Ga0373945_0052838_183_1055	280
358	3300035170	Ga0373943_0001794	Ga0373943_0001794_2762_3634	280
359	3300035171	Ga0373946_0004428	Ga0373946_0004428_3607_4479	280
360	3300035172	Ga0373955_0080450	Ga0373955_0080450_897_1769	280
361	3300035692	Ga0373935_0001994	Ga0373935_0001994_8863_9735	280
362	3300035725	Ga0373947_0012932	Ga0373947_0012932_3072_3944	280
363	3300037068	Ga0373925_0002289	Ga0373925_0002289_8986_9858	280
364	3300046454	Ga0495592_0040627	Ga0495592_0040627_1369_2241	280
365	3300046455	Ga0495603_0000835	Ga0495603_0000835_6772_7644	280
366	3300046459	Ga0495629_0002890	Ga0495629_0002890_2682_3554	280
367	3300046472	Ga0495580_0004179	Ga0495580_0004179_8190_9062	280
368	3300046473	Ga0495582_0037318	Ga0495582_0037318_185_1057	280
369	3300046475	Ga0495639_0004197	Ga0495639_0004197_5148_6020	280
370	3300046499	Ga0495594_0000503	Ga0495594_0000503_9489_10361	280
371	3300046511	Ga0495608_0126362	Ga0495608_0126362_704_1576	280
372	3300046514	Ga0495618_0004762	Ga0495618_0004762_1125_1997	280
373	3300046516	Ga0495628_0068544	Ga0495628_0068544_1778_2650	280
374	3300046526	Ga0495666_0030392	Ga0495666_0030392_183_1055	280
375	3300046529	Ga0495652_0005323	Ga0495652_0005323_1798_2670	280
376	3300046533	Ga0495640_0000685	Ga0495640_0000685_10198_11070	280
377	3300046535	Ga0495586_0132724	Ga0495586_0132724_469_1341	280
378	3300046642	Ga0495634_0004574	Ga0495634_0004574_184_1056	280
379	3300046663	Ga0495635_0019357	Ga0495635_0019357_1869_2741	280
380	3300046681	Ga0495647_0000456	Ga0495647_0000456_10200_11072	280
381	3300047315	Ga0495581_0008570	Ga0495581_0008570_1341_2213	280
382	3300047319	Ga0495674_0004435	Ga0495674_0004435_3092_3964	280
383	3300047321	Ga0495676_0016445	Ga0495676_0016445_2021_2893	280
384	3300047322	Ga0495680_0095287	Ga0495680_0095287_1267_2139	280
385	3300048905	Ga0496102_0498632	Ga0496102_0498632_26_868	280
386	3300048911	Ga0496108_0048859	Ga0496108_0048859_2158_3099	280
387	3300048912	Ga0496109_0070571	Ga0496109_0070571_394_1335	280
388	3300048913	Ga0496110_0060665	Ga0496110_0060665_2376_3317	280
389	3300053085	Ga0495619_0003109	Ga0495619_0003109_5643_6515	280
390	3300053086	Ga0500578_0000282	Ga0500578_0000282_29975_30916	280
391	3300053151	Ga0500604_0055584	Ga0500604_0055584_252_1193	280
392	3300005436	Ga0070713_100000039	Ga0070713_10000003932	281
393	3300006948	Ga0099826_10000004	Ga0099826_10000004297	281
394	3300025928	Ga0207700_10000082	Ga0207700_1000008252	281
395	3300027666	Ga0209282_1000099	Ga0209282_10000994	281
396	3300037471	Ga0395905_0045200	Ga0395905_0045200_3233_4114	281
397	3300037471	Ga0395905_0453503	Ga0395905_0453503_264_1145	281
398	3300046474	Ga0495605_0019072	Ga0495605_0019072_2196_3062	281
399	3300046512	Ga0495610_0001258	Ga0495610_0001258_19378_20244	281
400	3300046513	Ga0495616_0004499	Ga0495616_0004499_440_1306	281
401	3300047472	Ga0495686_0010823	Ga0495686_0010823_4225_5097	281
402	3300048919	Ga0496116_0009355	Ga0496116_0009355_494_1360	281
403	3300048924	Ga0496121_0012360	Ga0496121_0012360_3932_4798	281
404	iso_pu_bacteria	2534681786	2535486025	281
405	iso_pu_bacteria	2585428057	2587730924	281
406	iso_pu_bacteria	2585428058	2587736041	281
407	iso_pu_bacteria	2585428062	2587756351	281
408	iso_pu_bacteria	2588253510	2588295812	281
409	iso_pu_bacteria	2600255389	2602011728	281
410	iso_pu_bacteria	2738543013	2739250696	281
411	iso_pu_bacteria	2808606379	2808942724	281
412	iso_pu_bacteria	2854911287	2854916105	281
413	iso_pu_bacteria	2887375801	2887376197	281
414	iso_pu_bacteria	2996310559	2996314177	281
415	iso_pu_bacteria	8006994254	8007001657	281
416	3300005366	Ga0070659_100191489	Ga0070659_1001914892	282
417	3300006051	Ga0075364_10007690	Ga0075364_100076902	282
418	3300009177	Ga0105248_10092775	Ga0105248_100927752	282
419	3300025960	Ga0207651_10346169	Ga0207651_103461691	282
420	3300005293	Ga0065715_10088924	Ga0065715_1008892421	283
421	3300005295	Ga0065707_10170966	Ga0065707_101709662	283
422	3300005330	Ga0070690_100146848	Ga0070690_1001468481	283
423	3300005331	Ga0070670_100034644	Ga0070670_1000346443	283
424	3300005331	Ga0070670_100578236	Ga0070670_1005782361	283
425	3300005333	Ga0070677_10007362	Ga0070677_100073622	283
426	3300005334	Ga0068869_100113851	Ga0068869_1001138512	283
427	3300005335	Ga0070666_10152483	Ga0070666_101524832	283
428	3300005336	Ga0070680_100043978	Ga0070680_1000439783	283
429	3300005337	Ga0070682_100039169	Ga0070682_1000391692	283
430	3300005338	Ga0068868_100123875	Ga0068868_1001238752	283
431	3300005340	Ga0070689_100384725	Ga0070689_1003847252	283
432	3300005340	Ga0070689_100535834	Ga0070689_1005358341	283
433	3300005345	Ga0070692_10110906	Ga0070692_101109062	283
434	3300005347	Ga0070668_100221162	Ga0070668_1002211622	283
435	3300005353	Ga0070669_100003151	Ga0070669_1000031516	283
436	3300005354	Ga0070675_100155625	Ga0070675_1001556252	283
437	3300005355	Ga0070671_100033190	Ga0070671_1000331904	283
438	3300005356	Ga0070674_100311724	Ga0070674_1003117241	283
439	3300005364	Ga0070673_100072773	Ga0070673_1000727733	283
440	3300005366	Ga0070659_100140593	Ga0070659_1001405931	283
441	3300005367	Ga0070667_100034428	Ga0070667_1000344282	283
442	3300005444	Ga0070694_100278332	Ga0070694_1002783322	283
443	3300005445	Ga0070708_100000615	Ga0070708_10000061522	283
444	3300005455	Ga0070663_100043485	Ga0070663_1000434852	283
445	3300005456	Ga0070678_100002724	Ga0070678_1000027248	283
446	3300005458	Ga0070681_10004285	Ga0070681_1000428512	283
447	3300005459	Ga0068867_100025429	Ga0068867_1000254293	283
448	3300005459	Ga0068867_100188111	Ga0068867_1001881112	283
449	3300005467	Ga0070706_100000143	Ga0070706_10000014371	283
450	3300005468	Ga0070707_100010752	Ga0070707_1000107522	283
451	3300005518	Ga0070699_100011027	Ga0070699_1000110272	283
452	3300005536	Ga0070697_100008684	Ga0070697_1000086846	283
453	3300005536	Ga0070697_100025833	Ga0070697_1000258331	283
454	3300005536	Ga0070697_100030989	Ga0070697_1000309892	283
455	3300005536	Ga0070697_100320329	Ga0070697_1003203292	283
456	3300005543	Ga0070672_100056773	Ga0070672_1000567732	283
457	3300005544	Ga0070686_100403204	Ga0070686_1004032041	283
458	3300005545	Ga0070695_100010479	Ga0070695_1000104796	283
459	3300005545	Ga0070695_100036914	Ga0070695_1000369142	283
460	3300005546	Ga0070696_100011139	Ga0070696_1000111392	283
461	3300005547	Ga0070693_100017281	Ga0070693_1000172812	283
462	3300005549	Ga0070704_100094773	Ga0070704_1000947732	283
463	3300005549	Ga0070704_100417161	Ga0070704_1004171612	283
464	3300005563	Ga0068855_100026348	Ga0068855_1000263487	283
465	3300005564	Ga0070664_100001859	Ga0070664_1000018593	283
466	3300005564	Ga0070664_100236518	Ga0070664_1002365182	283
467	3300005577	Ga0068857_100038253	Ga0068857_1000382533	283
468	3300005578	Ga0068854_100211608	Ga0068854_1002116081	283
469	3300005614	Ga0068856_100041028	Ga0068856_1000410282	283
470	3300005617	Ga0068859_100079418	Ga0068859_1000794182	283
471	3300005617	Ga0068859_100093631	Ga0068859_1000936312	283
472	3300005840	Ga0068870_10013984	Ga0068870_100139842	283
473	3300005840	Ga0068870_10177068	Ga0068870_101770682	283
474	3300005843	Ga0068860_100205011	Ga0068860_1002050112	283
475	3300005937	Ga0081455_10010700	Ga0081455_100107006	283
476	3300006051	Ga0075364_10037081	Ga0075364_100370813	283
477	3300006844	Ga0075428_100503804	Ga0075428_1005038041	283
478	3300006846	Ga0075430_100381127	Ga0075430_1003811271	283
479	3300006847	Ga0075431_100007582	Ga0075431_1000075829	283
480	3300006847	Ga0075431_100060942	Ga0075431_1000609423	283
481	3300006852	Ga0075433_10014578	Ga0075433_100145783	283
482	3300006852	Ga0075433_10175538	Ga0075433_101755382	283
483	3300006871	Ga0075434_100006779	Ga0075434_1000067797	283
484	3300006871	Ga0075434_100009326	Ga0075434_1000093264	283
485	3300006871	Ga0075434_100107085	Ga0075434_1001070853	283
486	3300006880	Ga0075429_100439610	Ga0075429_1004396102	283
487	3300006881	Ga0068865_100017670	Ga0068865_1000176703	283
488	3300006881	Ga0068865_100049945	Ga0068865_1000499454	283
489	3300006931	Ga0097620_100079415	Ga0097620_1000794152	283
490	3300006931	Ga0097620_100093631	Ga0097620_1000936313	283
491	3300007076	Ga0075435_100266008	Ga0075435_1002660082	283
492	3300009093	Ga0105240_10241255	Ga0105240_102412552	283
493	3300009094	Ga0111539_10371572	Ga0111539_103715722	283
494	3300009094	Ga0111539_10793486	Ga0111539_107934861	283
495	3300009147	Ga0114129_10008335	Ga0114129_100083352	283
496	3300009147	Ga0114129_10213794	Ga0114129_102137942	283
497	3300009147	Ga0114129_10307654	Ga0114129_103076542	283
498	3300009147	Ga0114129_10361771	Ga0114129_103617711	283
499	3300009147	Ga0114129_10473037	Ga0114129_104730372	283
500	3300009147	Ga0114129_10587274	Ga0114129_105872742	283
501	3300009147	Ga0114129_10653881	Ga0114129_106538812	283
502	3300009148	Ga0105243_10296610	Ga0105243_102966102	283
503	3300009174	Ga0105241_10156551	Ga0105241_101565512	283
504	3300009176	Ga0105242_10031545	Ga0105242_100315452	283
505	3300009553	Ga0105249_10315915	Ga0105249_103159152	283
506	3300010375	Ga0105239_10293814	Ga0105239_102938142	283
507	3300011119	Ga0105246_10010893	Ga0105246_100108932	283
508	3300013100	Ga0157373_10033080	Ga0157373_100330802	283
509	3300013296	Ga0157374_10366705	Ga0157374_103667051	283
510	3300013297	Ga0157378_10039228	Ga0157378_100392285	283
511	3300013297	Ga0157378_10443091	Ga0157378_104430912	283
512	3300013306	Ga0163162_10020933	Ga0163162_100209334	283
513	3300013306	Ga0163162_10466031	Ga0163162_104660311	283
514	3300013308	Ga0157375_10025762	Ga0157375_100257626	283
515	3300013308	Ga0157375_10329013	Ga0157375_103290132	283
516	3300013308	Ga0157375_10523731	Ga0157375_105237312	283
517	3300014969	Ga0157376_10040252	Ga0157376_100402525	283
518	3300025315	Ga0207697_10029643	Ga0207697_100296433	283
519	3300025893	Ga0207682_10016271	Ga0207682_100162713	283
520	3300025893	Ga0207682_10018345	Ga0207682_100183452	283
521	3300025907	Ga0207645_10000869	Ga0207645_1000086926	283
522	3300025908	Ga0207643_10006787	Ga0207643_100067873	283
523	3300025910	Ga0207684_10000210	Ga0207684_1000021072	283
524	3300025912	Ga0207707_10006316	Ga0207707_100063169	283
525	3300025917	Ga0207660_10133720	Ga0207660_101337201	283
526	3300025919	Ga0207657_10069876	Ga0207657_100698763	283
527	3300025920	Ga0207649_10126467	Ga0207649_101264672	283
528	3300025921	Ga0207652_10040729	Ga0207652_100407291	283
529	3300025923	Ga0207681_10300201	Ga0207681_103002012	283
530	3300025925	Ga0207650_10187899	Ga0207650_101878992	283
531	3300025925	Ga0207650_10447291	Ga0207650_104472911	283
532	3300025933	Ga0207706_10000853	Ga0207706_1000085324	283
533	3300025933	Ga0207706_10129029	Ga0207706_101290292	283
534	3300025936	Ga0207670_10111942	Ga0207670_101119422	283
535	3300025940	Ga0207691_10012098	Ga0207691_1001209810	283
536	3300025940	Ga0207691_10042925	Ga0207691_100429253	283
537	3300025942	Ga0207689_10019701	Ga0207689_100197014	283
538	3300025942	Ga0207689_10059490	Ga0207689_100594902	283
539	3300025945	Ga0207679_10004669	Ga0207679_100046692	283
540	3300025960	Ga0207651_10003387	Ga0207651_100033873	283
541	3300026023	Ga0207677_10130116	Ga0207677_101301162	283
542	3300026067	Ga0207678_10028232	Ga0207678_100282322	283
543	3300026075	Ga0207708_10143443	Ga0207708_101434432	283
544	3300026078	Ga0207702_10105717	Ga0207702_101057172	283
545	3300026089	Ga0207648_10038565	Ga0207648_100385653	283
546	3300026089	Ga0207648_10043209	Ga0207648_100432092	283
547	3300026116	Ga0207674_10010169	Ga0207674_100101697	283
548	3300026121	Ga0207683_10002698	Ga0207683_1000269812	283
549	3300027907	Ga0207428_10204851	Ga0207428_102048511	283
550	3300031731	Ga0307405_10179726	Ga0307405_101797262	283
551	3300031824	Ga0307413_10022729	Ga0307413_100227293	283
552	3300031903	Ga0307407_10007604	Ga0307407_100076043	283
553	3300031911	Ga0307412_10018894	Ga0307412_100188945	283
554	3300031995	Ga0307409_100002581	Ga0307409_1000025815	283
555	3300032126	Ga0307415_100190676	Ga0307415_1001906762	283
556	3300032126	Ga0307415_100309694	Ga0307415_1003096942	283
557	3300035170	Ga0373943_0094541	Ga0373943_0094541_47_904	283
558	3300035241	Ga0373961_0036297	Ga0373961_0036297_148_1005	283
559	3300035691	Ga0373931_0027283	Ga0373931_0027283_1381_2238	283
560	3300036401	Ga0373937_0125669	Ga0373937_0125669_421_1278	283
561	3300041456	Ga0451795_1668763	Ga0451795_1668763_724_1665	283
562	3300041459	Ga0451800_0396256	Ga0451800_0396256_188_1129	283
563	3300041463	Ga0451804_0743580	Ga0451804_0743580_50_991	283
564	3300041512	Ga0451853_3262534	Ga0451853_3262534_84_1025	283
565	3300042876	Ga0451577_0269681	Ga0451577_0269681_521_1378	283
566	3300044712	Ga0453684_0038162	Ga0453684_0038162_3688_4545	283
567	3300045051	Ga0451576_0084840	Ga0451576_0084840_1246_2103	283
568	3300045051	Ga0451576_0138176	Ga0451576_0138176_1227_2084	283
569	3300045051	Ga0451576_0139173	Ga0451576_0139173_1630_2487	283
570	3300046472	Ga0495580_0062022	Ga0495580_0062022_1466_2323	283
571	3300046519	Ga0495632_0003923	Ga0495632_0003923_4938_5879	283
572	3300048088	Ga0495602_0187191	Ga0495602_0187191_664_1521	283
573	3300048907	Ga0496104_0226930	Ga0496104_0226930_420_1277	283
574	3300048912	Ga0496109_0338025	Ga0496109_0338025_381_1238	283
575	3300049521	Ga0501298_006155	Ga0501298_006155_521_1378	283
576	3300049580	Ga0501046_0082445	Ga0501046_0082445_250_1107	283
577	3300049593	Ga0501077_0003490	Ga0501077_0003490_40_897	283
578	3300049669	Ga0501235_035035	Ga0501235_035035_199_1056	283
579	3300049822	Ga0501035_0278086	Ga0501035_0278086_501_1394	283
580	3300050507	nmdc:mga05p37_15217_c1	nmdc:mga05p37_15217_c1_1191_2048	283
581	3300050507	nmdc:mga05p37_263424_c1	nmdc:mga05p37_263424_c1_76_933	283
582	3300050507	nmdc:mga05p37_28392_c1	nmdc:mga05p37_28392_c1_453_1310	283
583	3300050507	nmdc:mga05p37_29620_c1	nmdc:mga05p37_29620_c1_838_1695	283
584	3300050507	nmdc:mga05p37_659296_c1	nmdc:mga05p37_659296_c1_104_961	283
585	3300050508	nmdc:mga09592_100700_c1	nmdc:mga09592_100700_c1_1323_2180	283
586	3300050508	nmdc:mga09592_386707_c1	nmdc:mga09592_386707_c1_261_1118	283
587	3300050509	nmdc:mga0qj67_448311_c1	nmdc:mga0qj67_448311_c1_150_1007	283
588	3300050509	nmdc:mga0qj67_95442_c1	nmdc:mga0qj67_95442_c1_227_1084	283
589	3300050510	nmdc:mga06r32_23497_c1	nmdc:mga06r32_23497_c1_988_1845	283
590	3300050510	nmdc:mga06r32_431269_c1	nmdc:mga06r32_431269_c1_359_1216	283
591	3300050511	nmdc:mga08y16_298859_c1	nmdc:mga08y16_298859_c1_80_937	283
592	3300050512	nmdc:mga0n895_1012_c1	nmdc:mga0n895_1012_c1_17743_18600	283
593	3300050512	nmdc:mga0n895_255363_c1	nmdc:mga0n895_255363_c1_505_1362	283
594	3300050512	nmdc:mga0n895_8049_c1	nmdc:mga0n895_8049_c1_5610_6467	283
595	3300050513	nmdc:mga0rr50_13011_c1	nmdc:mga0rr50_13011_c1_321_1178	283
596	3300050514	nmdc:mga08x19_186323_c1	nmdc:mga08x19_186323_c1_446_1303	283
597	3300050514	nmdc:mga08x19_21902_c1	nmdc:mga08x19_21902_c1_365_1222	283
598	3300050515	nmdc:mga0a205_240922_c1	nmdc:mga0a205_240922_c1_419_1276	283
599	3300050515	nmdc:mga0a205_5463_c1	nmdc:mga0a205_5463_c1_3569_4426	283
600	3300050515	nmdc:mga0a205_87696_c1	nmdc:mga0a205_87696_c1_1092_1949	283
601	3300053078	Ga0495612_0023950	Ga0495612_0023950_50_907	283
602	3300053088	Ga0500644_0036514	Ga0500644_0036514_323_1264	283
603	3300053130	Ga0500642_0006046	Ga0500642_0006046_611_1552	283
604	3300053131	Ga0500652_001232	Ga0500652_001232_1022_1963	283
605	3300053139	Ga0500568_0040115	Ga0500568_0040115_379_1320	283
606	3300053156	Ga0500622_0001707	Ga0500622_0001707_12841_13782	283
607	3300061734	Ga0530510_0074489	Ga0530510_0074489_614_1471	283
608	iso_pu_bacteria	2513237150	2513952753	283
609	iso_pu_bacteria	2574179768	2574430381	283
610	iso_pu_bacteria	2834641062	2834641960	283
611	iso_pu_bacteria	2901300506	2901301850	283
612	iso_pu_bacteria	639633007	639788205	283
613	iso_pu_bacteria	644736347	644747642	283
614	iso_pu_bacteria	8003400568	8003404495	283
615	3300006175	Ga0070712_100431459	Ga0070712_1004314592	284
616	3300025935	Ga0207709_10143690	Ga0207709_101436902	284
617	3300053162	Ga0500638_009292	Ga0500638_009292_1876_2730	284
618	iso_pu_bacteria	2721755523	2722883043	284
619	iso_pu_bacteria	2839138175	2839143841	284
620	iso_pu_bacteria	2857542790	2857547512	284
621	iso_pu_bacteria	2895511927	2895516237	284
622	iso_pu_bacteria	2895511927	2895517438	284
623	iso_pu_bacteria	8002392321	8002392968	284
624	3300005367	Ga0070667_100357336	Ga0070667_1003573362	285
625	3300005615	Ga0070702_100155617	Ga0070702_1001556172	285
626	3300009093	Ga0105240_10092046	Ga0105240_100920463	285
627	3300009147	Ga0114129_10443845	Ga0114129_104438452	285
628	3300017792	Ga0163161_10003747	Ga0163161_100037472	285
629	3300017792	Ga0163161_10470179	Ga0163161_104701791	285
630	3300025913	Ga0207695_10120326	Ga0207695_101203262	285
631	3300025986	Ga0207658_10028141	Ga0207658_100281412	285
632	3300026121	Ga0207683_10245299	Ga0207683_102452992	285
633	3300026121	Ga0207683_10374502	Ga0207683_103745022	285
634	3300031240	Ga0265320_10015069	Ga0265320_100150692	285
635	3300031711	Ga0265314_10016357	Ga0265314_100163573	285
636	3300031711	Ga0265314_10111896	Ga0265314_101118962	285
637	3300031730	Ga0307516_10013066	Ga0307516_100130664	285
638	3300038443	Ga0395901_0064413	Ga0395901_0064413_1230_2171	285
639	3300041452	Ga0451793_0442755	Ga0451793_0442755_265_1206	285
640	3300046475	Ga0495639_0016805	Ga0495639_0016805_1058_1999	285
641	3300046512	Ga0495610_0030550	Ga0495610_0030550_62_1003	285
642	3300046615	Ga0495656_0082802	Ga0495656_0082802_415_1356	285
643	3300046674	Ga0495588_0025834	Ga0495588_0025834_1445_2386	285
644	3300047472	Ga0495686_0129142	Ga0495686_0129142_75_1016	285
645	3300048903	Ga0496100_0002476	Ga0496100_0002476_2846_3787	285
646	3300048904	Ga0496101_0000519	Ga0496101_0000519_14439_15380	285
647	3300048905	Ga0496102_0003580	Ga0496102_0003580_9434_10375	285
648	3300048907	Ga0496104_0002481	Ga0496104_0002481_12164_13105	285
649	3300048908	Ga0496105_0000375	Ga0496105_0000375_9261_10202	285
650	3300048909	Ga0496106_0002941	Ga0496106_0002941_8401_9342	285
651	3300048909	Ga0496106_0083996	Ga0496106_0083996_834_1775	285
652	3300048910	Ga0496107_0022728	Ga0496107_0022728_816_1757	285
653	3300048913	Ga0496110_0001501	Ga0496110_0001501_15595_16536	285
654	3300048916	Ga0496113_0247752	Ga0496113_0247752_301_1242	285
655	3300049741	Ga0501079_0535506	Ga0501079_0535506_40_900	285
656	3300050507	nmdc:mga05p37_388292_c1	nmdc:mga05p37_388292_c1_535_1404	285
657	3300053088	Ga0500644_0026433	Ga0500644_0026433_449_1390	285
658	3300053119	Ga0500595_011966	Ga0500595_011966_1257_2201	285
659	3300053136	Ga0500559_0000193	Ga0500559_0000193_27563_28504	285
660	3300053156	Ga0500622_0000413	Ga0500622_0000413_12204_13145	285
661	iso_pu_bacteria	2585428057	2587725897	285
662	iso_pu_bacteria	2585428058	2587736189	285
663	iso_pu_bacteria	2585428062	2587756909	285
664	iso_pu_bacteria	2588253510	2588292890	285
665	iso_pu_bacteria	2599185292	2599903894	285
666	iso_pu_bacteria	2643221569	2643863512	285
667	iso_pu_bacteria	2643221592	2643967999	285
668	iso_pu_bacteria	2643221592	2643971048	285
669	iso_pu_bacteria	2643221594	2643982657	285
670	iso_pu_bacteria	2643221603	2644031662	285
671	iso_pu_bacteria	2643221621	2644120707	285
672	iso_pu_bacteria	2643221625	2644143077	285
673	iso_pu_bacteria	2643221625	2644144211	285
674	iso_pu_bacteria	2643221644	2644246742	285
675	iso_pu_bacteria	2643221648	2644271835	285
676	iso_pu_bacteria	2643221648	2644275233	285
677	iso_pu_bacteria	2643221654	2644303597	285
678	iso_pu_bacteria	2808606395	2809034765	285
679	iso_pu_bacteria	2857537821	2857541549	285
680	iso_pu_bacteria	2858950400	2858956642	285
681	iso_pu_bacteria	2881927736	2881931170	285
682	iso_pu_bacteria	2887375801	2887377642	285
683	iso_pu_bacteria	2941479691	2941480526	285
684	iso_pu_bacteria	8048746797	8048746938	285
685	3300005295	Ga0065707_10163286	Ga0065707_101632861	286
686	3300005334	Ga0068869_100587966	Ga0068869_1005879661	286
687	3300005338	Ga0068868_100446584	Ga0068868_1004465841	286
688	3300005340	Ga0070689_100046213	Ga0070689_1000462133	286
689	3300005343	Ga0070687_100005340	Ga0070687_1000053403	286
690	3300005438	Ga0070701_10188622	Ga0070701_101886222	286
691	3300005466	Ga0070685_10101114	Ga0070685_101011142	286
692	3300005546	Ga0070696_100097466	Ga0070696_1000974662	286
693	3300005549	Ga0070704_100004576	Ga0070704_1000045763	286
694	3300005549	Ga0070704_100118977	Ga0070704_1001189772	286
695	3300005842	Ga0068858_100169248	Ga0068858_1001692482	286
696	3300006844	Ga0075428_100083235	Ga0075428_1000832352	286
697	3300006880	Ga0075429_100001541	Ga0075429_1000015418	286
698	3300009098	Ga0105245_10033728	Ga0105245_100337284	286
699	3300009147	Ga0114129_10054390	Ga0114129_100543905	286
700	3300009148	Ga0105243_10046539	Ga0105243_100465393	286
701	3300009553	Ga0105249_10105158	Ga0105249_101051583	286
702	3300013297	Ga0157378_10067414	Ga0157378_100674142	286
703	3300013308	Ga0157375_10141735	Ga0157375_101417352	286
704	3300014326	Ga0157380_10184163	Ga0157380_101841632	286
705	3300021384	Ga0213876_10104634	Ga0213876_101046342	286
706	3300025918	Ga0207662_10011621	Ga0207662_100116213	286
707	3300025936	Ga0207670_10029767	Ga0207670_100297673	286
708	3300025961	Ga0207712_10062482	Ga0207712_100624822	286
709	3300026075	Ga0207708_10109450	Ga0207708_101094502	286
710	3300027462	Ga0210000_1008175	Ga0210000_10081752	286
711	3300035115	Ga0373941_0012449	Ga0373941_0012449_100_966	286
712	3300037588	Ga0316581_0003990	Ga0316581_0003990_1609_2475	286
713	3300037853	Ga0436364_1124639	Ga0436364_1124639_1786_2649	286
714	3300045051	Ga0451576_0010844	Ga0451576_0010844_5564_6430	286
715	3300050507	nmdc:mga05p37_1073_c1	nmdc:mga05p37_1073_c1_25878_26744	286
716	3300050508	nmdc:mga09592_652_c1	nmdc:mga09592_652_c1_20997_21863	286
717	3300050510	nmdc:mga06r32_475408_c1	nmdc:mga06r32_475408_c1_58_924	286
718	3300050511	nmdc:mga08y16_50704_c1	nmdc:mga08y16_50704_c1_2624_3490	286
719	iso_pu_bacteria	2513020051	2513228894	286
720	iso_pu_bacteria	2599185214	2599621415	286
721	iso_pu_bacteria	2599185226	2599670901	286
722	iso_pu_bacteria	2599185227	2599679391	286
723	iso_pu_bacteria	2599185229	2599690926	286
724	iso_pu_bacteria	2643221628	2644163446	286
725	iso_pu_bacteria	2643221658	2644327336	286
726	iso_pu_bacteria	2643221672	2644401942	286
727	iso_pu_bacteria	2643221683	2644465634	286
728	iso_pu_bacteria	2721755523	2722880893	286
729	iso_pu_bacteria	2738541277	2738722742	286
730	iso_pu_bacteria	2738541307	2738883660	286
731	iso_pu_bacteria	2738543013	2739248648	286
732	iso_pu_bacteria	2738543019	2739283313	286
733	iso_pu_bacteria	2818991446	2819597592	286
734	iso_pu_bacteria	2831265667	2831268583	286
735	iso_pu_bacteria	2838054893	2838058008	286
736	iso_pu_bacteria	2839138175	2839139636	286
737	iso_pu_bacteria	2842677519	2842681661	286
738	iso_pu_bacteria	2842733646	2842735276	286
739	iso_pu_bacteria	2842747753	2842749955	286
740	iso_pu_bacteria	2885198086	2885200127	286
741	iso_pu_bacteria	2885211737	2885213779	286
742	iso_pu_bacteria	2894023352	2894024205	286
743	iso_pu_bacteria	2899924645	2899929015	286
744	iso_pu_bacteria	2904449895	2904451420	286
745	iso_pu_bacteria	2904456579	2904458282	286
746	iso_pu_bacteria	2904541872	2904543073	286
747	iso_pu_bacteria	2919462493	2919466592	286
748	iso_pu_bacteria	2928037797	2928040553	286
749	iso_pu_bacteria	2928044640	2928046698	286
750	iso_pu_bacteria	2928051484	2928058117	286
751	iso_pu_bacteria	2928064002	2928067547	286
752	iso_pu_bacteria	2928070936	2928072074	286
753	iso_pu_bacteria	2928084124	2928085292	286
754	iso_pu_bacteria	2928115317	2928116658	286
755	iso_pu_bacteria	2929160207	2929160302	286
756	iso_pu_bacteria	2929520902	2929526100	286
757	iso_pu_bacteria	2945909444	2945915342	286
758	iso_pu_bacteria	2945945610	2945950648	286
759	iso_pu_bacteria	2945972063	2945974711	286
760	iso_pu_bacteria	2945984333	2945989255	286
761	iso_pu_bacteria	2954767861	2954769914	286
762	2162886012	MBSR1b_contig_4714076	MBSR1b_0124.00002860	287
763	2209111006	2214745213	2213754837	287
764	3300000041	ARcpr5oldR_c000161	ARcpr5oldR_0001612	287
765	3300000042	ARSoilYngRDRAFT_c00108	ARSoilYngRDRAFT_001084	287
766	3300000043	ARcpr5yngRDRAFT_c000061	ARcpr5yngRDRAFT_0000619	287
767	3300000044	ARSoilOldRDRAFT_c000117	ARSoilOldRDRAFT_0001174	287
768	3300000652	ARCol0yngRDRAFT_1000001	ARCol0yngRDRAFT_100000169	287
769	3300003187	JGI25151J46595_10002972	JGI25151J46595_100029722	287
770	3300003187	JGI25151J46595_10006701	JGI25151J46595_100067013	287
771	3300003187	JGI25151J46595_10041136	JGI25151J46595_100411362	287
772	3300003771	Ga0055526_1003606	Ga0055526_10036063	287
773	3300003771	Ga0055526_1004146	Ga0055526_10041467	287
774	3300003771	Ga0055526_1005702	Ga0055526_10057023	287
775	3300003775	Ga0055524_1002948	Ga0055524_10029485	287
776	3300003775	Ga0055524_1013715	Ga0055524_10137152	287
777	3300003781	Ga0055536_1000034	Ga0055536_1000034105	287
778	3300003784	Ga0055534_1001465	Ga0055534_10014652	287
779	3300003784	Ga0055534_1002718	Ga0055534_10027185	287
780	3300005276	Ga0065717_1001950	Ga0065717_10019503	287
781	3300005277	Ga0065716_1001533	Ga0065716_10015336	287
782	3300005289	Ga0065704_10070736	Ga0065704_1007073618	287
783	3300005293	Ga0065715_10095703	Ga0065715_100957033	287
784	3300005334	Ga0068869_100458735	Ga0068869_1004587351	287
785	3300005335	Ga0070666_10026283	Ga0070666_100262833	287
786	3300005345	Ga0070692_10014151	Ga0070692_100141513	287
787	3300005365	Ga0070688_100005502	Ga0070688_1000055024	287
788	3300005366	Ga0070659_100029706	Ga0070659_1000297064	287
789	3300005367	Ga0070667_100098598	Ga0070667_1000985983	287
790	3300005441	Ga0070700_100065617	Ga0070700_1000656172	287
791	3300005444	Ga0070694_100173423	Ga0070694_1001734232	287
792	3300005445	Ga0070708_100018056	Ga0070708_1000180566	287
793	3300005456	Ga0070678_100085148	Ga0070678_1000851482	287
794	3300005457	Ga0070662_100014665	Ga0070662_1000146654	287
795	3300005458	Ga0070681_10082095	Ga0070681_100820952	287
796	3300005459	Ga0068867_100005899	Ga0068867_1000058997	287
797	3300005467	Ga0070706_100034247	Ga0070706_1000342475	287
798	3300005467	Ga0070706_100046148	Ga0070706_1000461484	287
799	3300005468	Ga0070707_100050123	Ga0070707_1000501232	287
800	3300005468	Ga0070707_100096753	Ga0070707_1000967533	287
801	3300005471	Ga0070698_100025713	Ga0070698_1000257133	287
802	3300005471	Ga0070698_100035249	Ga0070698_1000352495	287
803	3300005518	Ga0070699_100023015	Ga0070699_1000230153	287
804	3300005536	Ga0070697_100036111	Ga0070697_1000361111	287
805	3300005548	Ga0070665_100081444	Ga0070665_1000814442	287
806	3300005549	Ga0070704_100010601	Ga0070704_1000106015	287
807	3300005719	Ga0068861_100178395	Ga0068861_1001783952	287
808	3300005844	Ga0068862_100021951	Ga0068862_1000219513	287
809	3300006173	Ga0070716_100004852	Ga0070716_1000048526	287
810	3300006173	Ga0070716_100287738	Ga0070716_1002877381	287
811	3300006175	Ga0070712_100002121	Ga0070712_1000021217	287
812	3300006844	Ga0075428_100036099	Ga0075428_1000360992	287
813	3300006852	Ga0075433_10133522	Ga0075433_101335222	287
814	3300006852	Ga0075433_10195370	Ga0075433_101953703	287
815	3300006871	Ga0075434_100117072	Ga0075434_1001170722	287
816	3300006881	Ga0068865_100046535	Ga0068865_1000465352	287
817	3300006914	Ga0075436_100033426	Ga0075436_1000334263	287
818	3300007076	Ga0075435_100011007	Ga0075435_1000110072	287
819	3300007265	Ga0099794_10000102	Ga0099794_1000010210	287
820	3300009094	Ga0111539_10002321	Ga0111539_1000232124	287
821	3300009147	Ga0114129_10404780	Ga0114129_104047802	287
822	3300009148	Ga0105243_10098393	Ga0105243_100983932	287
823	3300009174	Ga0105241_10272939	Ga0105241_102729392	287
824	3300009177	Ga0105248_10080516	Ga0105248_100805162	287
825	3300010375	Ga0105239_10016753	Ga0105239_100167535	287
826	3300010375	Ga0105239_10694848	Ga0105239_106948481	287
827	3300013297	Ga0157378_10167350	Ga0157378_101673502	287
828	3300013306	Ga0163162_10014002	Ga0163162_100140024	287
829	3300013306	Ga0163162_10439195	Ga0163162_104391952	287
830	3300025263	Ga0209565_1000191	Ga0209565_100019133	287
831	3300025291	Ga0209675_1000084	Ga0209675_100008432	287
832	3300025291	Ga0209675_1009498	Ga0209675_10094984	287
833	3300025292	Ga0209676_1000014	Ga0209676_1000014278	287
834	3300025294	Ga0209025_1000323	Ga0209025_100032331	287
835	3300025294	Ga0209025_1000363	Ga0209025_100036310	287
836	3300025294	Ga0209025_1001726	Ga0209025_100172618	287
837	3300025294	Ga0209025_1001821	Ga0209025_100182120	287
838	3300025294	Ga0209025_1032887	Ga0209025_10328872	287
839	3300025295	Ga0209564_1000953	Ga0209564_100095313	287
840	3300025295	Ga0209564_1001000	Ga0209564_100100021	287
841	3300025295	Ga0209564_1001391	Ga0209564_100139120	287
842	3300025299	Ga0209256_1000466	Ga0209256_100046623	287
843	3300025299	Ga0209256_1003519	Ga0209256_10035194	287
844	3300025303	Ga0209051_1010680	Ga0209051_10106802	287
845	3300025901	Ga0207688_10065920	Ga0207688_100659202	287
846	3300025915	Ga0207693_10003525	Ga0207693_100035257	287
847	3300025922	Ga0207646_10036244	Ga0207646_100362446	287
848	3300025922	Ga0207646_10469277	Ga0207646_104692771	287
849	3300025928	Ga0207700_10310093	Ga0207700_103100932	287
850	3300025932	Ga0207690_10032706	Ga0207690_100327062	287
851	3300025935	Ga0207709_10030992	Ga0207709_100309922	287
852	3300025938	Ga0207704_10146969	Ga0207704_101469692	287
853	3300025939	Ga0207665_10021269	Ga0207665_100212693	287
854	3300025941	Ga0207711_10192299	Ga0207711_101922992	287
855	3300025972	Ga0207668_10008091	Ga0207668_100080913	287
856	3300026041	Ga0207639_10148065	Ga0207639_101480652	287
857	3300026118	Ga0207675_100354429	Ga0207675_1003544292	287
858	3300026121	Ga0207683_10099564	Ga0207683_100995643	287
859	3300027671	Ga0209588_1000003	Ga0209588_1000003215	287
860	3300027907	Ga0207428_10001906	Ga0207428_1000190620	287
861	3300028379	Ga0268266_10128555	Ga0268266_101285552	287
862	3300028380	Ga0268265_10057280	Ga0268265_100572802	287
863	3300028381	Ga0268264_10185902	Ga0268264_101859022	287
864	3300029957	Ga0265324_10011528	Ga0265324_100115283	287
865	3300031344	Ga0265316_10135466	Ga0265316_101354662	287
866	3300031344	Ga0265316_10179295	Ga0265316_101792952	287
867	3300031616	Ga0307508_10203745	Ga0307508_102037452	287
868	3300031649	Ga0307514_10001819	Ga0307514_100018194	287
869	3300032133	Ga0316583_10026921	Ga0316583_100269212	287
870	3300034816	Ga0373930_0000042	Ga0373930_0000042_8356_9222	287
871	3300034818	Ga0373950_0009264	Ga0373950_0009264_511_1377	287
872	3300034819	Ga0373958_0000428	Ga0373958_0000428_2368_3234	287
873	3300034820	Ga0373959_0001092	Ga0373959_0001092_2821_3687	287
874	3300034957	Ga0373938_0000015	Ga0373938_0000015_4538_5404	287
875	3300035083	Ga0373926_0016332	Ga0373926_0016332_1647_2513	287
876	3300035084	Ga0373928_0000250	Ga0373928_0000250_71_937	287
877	3300035085	Ga0373929_0000053	Ga0373929_0000053_10418_11284	287
878	3300035090	Ga0373949_0002636	Ga0373949_0002636_1921_2787	287
879	3300035091	Ga0373951_0000355	Ga0373951_0000355_3169_4035	287
880	3300035112	Ga0373932_0001223	Ga0373932_0001223_1074_1940	287
881	3300035115	Ga0373941_0001480	Ga0373941_0001480_3138_4004	287
882	3300035121	Ga0373960_0001791	Ga0373960_0001791_812_1678	287
883	3300035170	Ga0373943_0119146	Ga0373943_0119146_131_997	287
884	3300035171	Ga0373946_0058845	Ga0373946_0058845_605_1471	287
885	3300035207	Ga0373942_0002858	Ga0373942_0002858_115_981	287
886	3300035241	Ga0373961_0001674	Ga0373961_0001674_3167_4033	287
887	3300035242	Ga0373962_0001032	Ga0373962_0001032_2443_3309	287
888	3300035691	Ga0373931_0000857	Ga0373931_0000857_10894_11760	287
889	3300035695	Ga0373927_0191164	Ga0373927_0191164_62_928	287
890	3300035725	Ga0373947_0024662	Ga0373947_0024662_1095_1961	287
891	3300036647	Ga0316582_0095190	Ga0316582_0095190_44_913	287
892	3300037068	Ga0373925_0195829	Ga0373925_0195829_46_912	287
893	3300037471	Ga0395905_0013384	Ga0395905_0013384_5685_6557	287
894	3300037471	Ga0395905_0049522	Ga0395905_0049522_1024_1893	287
895	3300037471	Ga0395905_0317939	Ga0395905_0317939_112_984	287
896	3300038996	Ga0242420_000824	Ga0242420_000824_207_1073	287
897	3300042003	Ga0439443_001223	Ga0439443_001223_1396_2313	287
898	3300042876	Ga0451577_0053295	Ga0451577_0053295_2315_3181	287
899	3300044712	Ga0453684_0236020	Ga0453684_0236020_719_1585	287
900	3300044901	Ga0466960_0012948	Ga0466960_0012948_1556_2428	287
901	3300045051	Ga0451576_0297368	Ga0451576_0297368_233_1102	287
902	3300045051	Ga0451576_0581416	Ga0451576_0581416_275_1141	287
903	3300046492	Ga0495585_0059578	Ga0495585_0059578_1054_1926	287
904	3300047471	Ga0495684_0155710	Ga0495684_0155710_456_1322	287
905	3300048924	Ga0496121_0012578	Ga0496121_0012578_7094_7963	287
906	3300049571	Ga0501034_0000761	Ga0501034_0000761_7425_8291	287
907	3300049823	Ga0501044_0378307	Ga0501044_0378307_333_1199	287
908	3300050507	nmdc:mga05p37_341287_c1	nmdc:mga05p37_341287_c1_382_1254	287
909	3300050511	nmdc:mga08y16_19640_c1	nmdc:mga08y16_19640_c1_1744_2610	287
910	3300050512	nmdc:mga0n895_47199_c1	nmdc:mga0n895_47199_c1_1264_2136	287
911	3300050515	nmdc:mga0a205_115702_c1	nmdc:mga0a205_115702_c1_727_1599	287
912	3300050515	nmdc:mga0a205_54672_c1	nmdc:mga0a205_54672_c1_311_1183	287
913	3300053077	Ga0495601_0006278	Ga0495601_0006278_1340_2209	287
914	3300053085	Ga0495619_0041667	Ga0495619_0041667_1519_2388	287
915	3300053130	Ga0500642_0007124	Ga0500642_0007124_163_1029	287
916	iso_pu_bacteria	2513237165	2514045126	287
917	3300005330	Ga0070690_100000906	Ga0070690_10000090613	288
918	3300005334	Ga0068869_100127943	Ga0068869_1001279432	288
919	3300005338	Ga0068868_100095640	Ga0068868_1000956402	288
920	3300005340	Ga0070689_100005385	Ga0070689_1000053853	288
921	3300005341	Ga0070691_10067066	Ga0070691_100670662	288
922	3300005345	Ga0070692_10237110	Ga0070692_102371101	288
923	3300005366	Ga0070659_100258678	Ga0070659_1002586782	288
924	3300005434	Ga0070709_10183677	Ga0070709_101836771	288
925	3300005438	Ga0070701_10004963	Ga0070701_100049632	288
926	3300005441	Ga0070700_100005635	Ga0070700_1000056352	288
927	3300005444	Ga0070694_100253043	Ga0070694_1002530431	288
928	3300005444	Ga0070694_100287667	Ga0070694_1002876672	288
929	3300005445	Ga0070708_100000304	Ga0070708_10000030433	288
930	3300005445	Ga0070708_100034201	Ga0070708_1000342012	288
931	3300005445	Ga0070708_100091388	Ga0070708_1000913882	288
932	3300005456	Ga0070678_100008496	Ga0070678_1000084964	288
933	3300005458	Ga0070681_10055942	Ga0070681_100559424	288
934	3300005518	Ga0070699_100021806	Ga0070699_1000218063	288
935	3300005535	Ga0070684_100140178	Ga0070684_1001401781	288
936	3300005536	Ga0070697_100004634	Ga0070697_10000463412	288
937	3300005539	Ga0068853_100228564	Ga0068853_1002285642	288
938	3300005545	Ga0070695_100028277	Ga0070695_1000282772	288
939	3300005546	Ga0070696_100025634	Ga0070696_1000256342	288
940	3300005547	Ga0070693_100007569	Ga0070693_1000075692	288
941	3300005547	Ga0070693_100215604	Ga0070693_1002156042	288
942	3300005549	Ga0070704_100007679	Ga0070704_1000076794	288
943	3300005578	Ga0068854_100358249	Ga0068854_1003582492	288
944	3300005617	Ga0068859_100039080	Ga0068859_1000390804	288
945	3300005718	Ga0068866_10002432	Ga0068866_100024328	288
946	3300005719	Ga0068861_100009410	Ga0068861_1000094105	288
947	3300005719	Ga0068861_100042778	Ga0068861_1000427783	288
948	3300005842	Ga0068858_100011781	Ga0068858_1000117817	288
949	3300005843	Ga0068860_100016350	Ga0068860_1000163504	288
950	3300005937	Ga0081455_10078545	Ga0081455_100785452	288
951	3300005937	Ga0081455_10206818	Ga0081455_102068182	288
952	3300005983	Ga0081540_1000048	Ga0081540_100004895	288
953	3300006042	Ga0075368_10001254	Ga0075368_100012545	288
954	3300006048	Ga0075363_100104012	Ga0075363_1001040122	288
955	3300006175	Ga0070712_100156028	Ga0070712_1001560282	288
956	3300006178	Ga0075367_10018096	Ga0075367_100180963	288
957	3300006237	Ga0097621_100243345	Ga0097621_1002433452	288
958	3300006237	Ga0097621_100274484	Ga0097621_1002744842	288
959	3300006844	Ga0075428_100361476	Ga0075428_1003614762	288
960	3300006852	Ga0075433_10017348	Ga0075433_100173482	288
961	3300006871	Ga0075434_100003210	Ga0075434_1000032103	288
962	3300006871	Ga0075434_100620293	Ga0075434_1006202932	288
963	3300006931	Ga0097620_100039080	Ga0097620_1000390804	288
964	3300006946	Ga0079104_1000026	Ga0079104_1000026227	288
965	3300007076	Ga0075435_100012216	Ga0075435_1000122167	288
966	3300007265	Ga0099794_10008264	Ga0099794_100082642	288
967	3300007265	Ga0099794_10011022	Ga0099794_100110223	288
968	3300007265	Ga0099794_10049628	Ga0099794_100496282	288
969	3300009092	Ga0105250_10009821	Ga0105250_100098212	288
970	3300009098	Ga0105245_10002540	Ga0105245_1000254014	288
971	3300009101	Ga0105247_10068183	Ga0105247_100681832	288
972	3300009147	Ga0114129_10006537	Ga0114129_100065375	288
973	3300009147	Ga0114129_10028035	Ga0114129_100280356	288
974	3300009147	Ga0114129_10115816	Ga0114129_101158162	288
975	3300009148	Ga0105243_10015641	Ga0105243_100156412	288
976	3300009148	Ga0105243_10018080	Ga0105243_100180805	288
977	3300009176	Ga0105242_10271607	Ga0105242_102716072	288
978	3300009177	Ga0105248_10051818	Ga0105248_100518182	288
979	3300009551	Ga0105238_10141124	Ga0105238_101411243	288
980	3300009553	Ga0105249_10082091	Ga0105249_100820912	288
981	3300013105	Ga0157369_10268695	Ga0157369_102686952	288
982	3300013297	Ga0157378_10044669	Ga0157378_100446693	288
983	3300013306	Ga0163162_10287963	Ga0163162_102879632	288
984	3300013307	Ga0157372_10518294	Ga0157372_105182942	288
985	3300014325	Ga0163163_10129929	Ga0163163_101299292	288
986	3300014325	Ga0163163_10252085	Ga0163163_102520852	288
987	3300014326	Ga0157380_10030281	Ga0157380_100302813	288
988	3300014326	Ga0157380_10111279	Ga0157380_101112792	288
989	3300014968	Ga0157379_10042058	Ga0157379_100420582	288
990	3300014968	Ga0157379_10255410	Ga0157379_102554102	288
991	3300017792	Ga0163161_10030135	Ga0163161_100301352	288
992	3300025899	Ga0207642_10002017	Ga0207642_100020176	288
993	3300025900	Ga0207710_10145447	Ga0207710_101454471	288
994	3300025906	Ga0207699_10162893	Ga0207699_101628931	288
995	3300025918	Ga0207662_10053539	Ga0207662_100535393	288
996	3300025921	Ga0207652_10496371	Ga0207652_104963712	288
997	3300025927	Ga0207687_10079007	Ga0207687_100790073	288
998	3300025934	Ga0207686_10003108	Ga0207686_100031088	288
999	3300025935	Ga0207709_10000079	Ga0207709_100000796	288
1000	3300025935	Ga0207709_10049368	Ga0207709_100493683	288
1001	3300025938	Ga0207704_10015667	Ga0207704_100156672	288
1002	3300025942	Ga0207689_10021099	Ga0207689_100210992	288
1003	3300025961	Ga0207712_10172021	Ga0207712_101720212	288
1004	3300026035	Ga0207703_10004821	Ga0207703_100048213	288
1005	3300026041	Ga0207639_10235655	Ga0207639_102356552	288
1006	3300026075	Ga0207708_10000362	Ga0207708_1000036224	288
1007	3300026089	Ga0207648_10000159	Ga0207648_100001592	288
1008	3300026118	Ga0207675_100000068	Ga0207675_1000000689	288
1009	3300026118	Ga0207675_100250096	Ga0207675_1002500962	288
1010	3300027111	Ga0209281_1000067	Ga0209281_1000067285	288
1011	3300027671	Ga0209588_1004811	Ga0209588_10048112	288
1012	3300028380	Ga0268265_10274219	Ga0268265_102742192	288
1013	3300028381	Ga0268264_10048332	Ga0268264_100483322	288
1014	3300031251	Ga0265327_10020128	Ga0265327_100201282	288
1015	3300031251	Ga0265327_10038371	Ga0265327_100383712	288
1016	3300031911	Ga0307412_10000195	Ga0307412_1000019539	288
1017	3300035115	Ga0373941_0012932	Ga0373941_0012932_1020_1889	288
1018	3300035121	Ga0373960_0074644	Ga0373960_0074644_29_925	288
1019	3300035691	Ga0373931_0000143	Ga0373931_0000143_27677_28546	288
1020	3300036401	Ga0373937_0047495	Ga0373937_0047495_532_1407	288
1021	3300037068	Ga0373925_0002157	Ga0373925_0002157_13959_14828	288
1022	3300037418	Ga0395900_0021325	Ga0395900_0021325_96_1016	288
1023	3300044712	Ga0453684_0676813	Ga0453684_0676813_151_1029	288
1024	3300044842	Ga0466957_0248732	Ga0466957_0248732_67_936	288
1025	3300045051	Ga0451576_0000144	Ga0451576_0000144_30656_31525	288
1026	3300045836	Ga0466958_0099287	Ga0466958_0099287_103_972	288
1027	3300045976	Ga0466967_0491989	Ga0466967_0491989_258_1127	288
1028	3300046471	Ga0495650_0000051	Ga0495650_0000051_171973_172842	288
1029	3300046471	Ga0495650_0024265	Ga0495650_0024265_1510_2379	288
1030	3300046506	Ga0495583_0000169	Ga0495583_0000169_63228_64097	288
1031	3300046539	Ga0495621_0050403	Ga0495621_0050403_403_1275	288
1032	3300047323	Ga0495683_0041506	Ga0495683_0041506_757_1662	288
1033	3300048090	Ga0495615_0002219	Ga0495615_0002219_224_1096	288
1034	3300048904	Ga0496101_0322416	Ga0496101_0322416_232_1101	288
1035	3300048907	Ga0496104_0000132	Ga0496104_0000132_60999_61871	288
1036	3300048907	Ga0496104_0012567	Ga0496104_0012567_1811_2680	288
1037	3300048907	Ga0496104_0019371	Ga0496104_0019371_2506_3375	288
1038	3300048910	Ga0496107_0036066	Ga0496107_0036066_1995_2864	288
1039	3300048911	Ga0496108_0003908	Ga0496108_0003908_7899_8771	288
1040	3300048911	Ga0496108_0219205	Ga0496108_0219205_212_1081	288
1041	3300048912	Ga0496109_0007278	Ga0496109_0007278_5373_6245	288
1042	3300048913	Ga0496110_0001854	Ga0496110_0001854_14648_15520	288
1043	3300048913	Ga0496110_0090413	Ga0496110_0090413_538_1407	288
1044	3300048913	Ga0496110_0179363	Ga0496110_0179363_293_1162	288
1045	3300048914	Ga0496111_0011663	Ga0496111_0011663_43_915	288
1046	3300048918	Ga0496115_0018816	Ga0496115_0018816_1685_2554	288
1047	3300048923	Ga0496120_0005454	Ga0496120_0005454_4528_5496	288
1048	3300049569	Ga0501032_0347933	Ga0501032_0347933_41_937	288
1049	3300049571	Ga0501034_0000581	Ga0501034_0000581_13771_14667	288
1050	3300049571	Ga0501034_0109418	Ga0501034_0109418_879_1751	288
1051	3300049572	Ga0501036_0340193	Ga0501036_0340193_309_1208	288
1052	3300049574	Ga0501038_0072002	Ga0501038_0072002_505_1404	288
1053	3300049576	Ga0501040_0359569	Ga0501040_0359569_48_947	288
1054	3300049577	Ga0501041_0009906	Ga0501041_0009906_44_943	288
1055	3300049583	Ga0501067_0016892	Ga0501067_0016892_240_1112	288
1056	3300049584	Ga0501068_0001232	Ga0501068_0001232_3013_3909	288
1057	3300049586	Ga0501070_0166685	Ga0501070_0166685_896_1792	288
1058	3300049587	Ga0501071_0005621	Ga0501071_0005621_3135_4034	288
1059	3300049588	Ga0501072_0036827	Ga0501072_0036827_2748_3644	288
1060	3300049589	Ga0501073_0005893	Ga0501073_0005893_1049_1945	288
1061	3300049589	Ga0501073_0221306	Ga0501073_0221306_101_973	288
1062	3300049590	Ga0501074_0041029	Ga0501074_0041029_1435_2334	288
1063	3300049590	Ga0501074_0066753	Ga0501074_0066753_47_943	288
1064	3300049591	Ga0501075_0070686	Ga0501075_0070686_1495_2394	288
1065	3300049591	Ga0501075_0242356	Ga0501075_0242356_63_962	288
1066	3300049592	Ga0501076_0000363	Ga0501076_0000363_12038_12937	288
1067	3300049592	Ga0501076_0319183	Ga0501076_0319183_346_1245	288
1068	3300049741	Ga0501079_0014795	Ga0501079_0014795_3167_4066	288
1069	3300049742	Ga0501080_0000712	Ga0501080_0000712_23098_23994	288
1070	3300049742	Ga0501080_0115956	Ga0501080_0115956_597_1496	288
1071	3300049743	Ga0501081_0023905	Ga0501081_0023905_3139_4038	288
1072	3300049744	Ga0501083_0029743	Ga0501083_0029743_33_929	288
1073	3300049824	Ga0501045_0008619	Ga0501045_0008619_3030_3929	288
1074	3300050494	nmdc:mga06z11_13875_c1	nmdc:mga06z11_13875_c1_254_1126	288
1075	3300050507	nmdc:mga05p37_64736_c1	nmdc:mga05p37_64736_c1_750_1622	288
1076	3300050507	nmdc:mga05p37_86711_c1	nmdc:mga05p37_86711_c1_821_1699	288
1077	3300050512	nmdc:mga0n895_3033_c1	nmdc:mga0n895_3033_c1_12242_13111	288
1078	3300050513	nmdc:mga0rr50_10902_c1	nmdc:mga0rr50_10902_c1_3543_4412	288
1079	3300050515	nmdc:mga0a205_71668_c1	nmdc:mga0a205_71668_c1_169_1047	288
1080	3300061734	Ga0530510_0002694	Ga0530510_0002694_9363_10262	288
1081	iso_pu_bacteria	8055225921	8055227540	288
1082	3300001991	JGI24743J22301_10021045	JGI24743J22301_100210452	289
1083	3300002773	JGI25152J39213_1001253	JGI25152J39213_10012536	289
1084	3300002774	JGI25150J39212_1011130	JGI25150J39212_10111302	289
1085	3300003215	JGI25153J46596_10002864	JGI25153J46596_100028642	289
1086	3300003771	Ga0055526_1005270	Ga0055526_10052703	289
1087	3300005262	Ga0065165_1001259	Ga0065165_100125927	289
1088	3300005295	Ga0065707_10087362	Ga0065707_100873622	289
1089	3300005327	Ga0070658_10043713	Ga0070658_100437132	289
1090	3300005327	Ga0070658_10050344	Ga0070658_100503443	289
1091	3300005328	Ga0070676_10000391	Ga0070676_100003919	289
1092	3300005328	Ga0070676_10006757	Ga0070676_100067572	289
1093	3300005328	Ga0070676_10015700	Ga0070676_100157004	289
1094	3300005328	Ga0070676_10021419	Ga0070676_100214192	289
1095	3300005328	Ga0070676_10224696	Ga0070676_102246961	289
1096	3300005329	Ga0070683_100011630	Ga0070683_1000116308	289
1097	3300005329	Ga0070683_100023857	Ga0070683_1000238572	289
1098	3300005329	Ga0070683_100137095	Ga0070683_1001370951	289
1099	3300005329	Ga0070683_100167424	Ga0070683_1001674242	289
1100	3300005330	Ga0070690_100049509	Ga0070690_1000495092	289
1101	3300005330	Ga0070690_100079841	Ga0070690_1000798412	289
1102	3300005331	Ga0070670_100002107	Ga0070670_10000210712	289
1103	3300005331	Ga0070670_100002193	Ga0070670_1000021937	289
1104	3300005331	Ga0070670_100020501	Ga0070670_1000205013	289
1105	3300005331	Ga0070670_100085339	Ga0070670_1000853393	289
1106	3300005331	Ga0070670_100090711	Ga0070670_1000907111	289
1107	3300005331	Ga0070670_100107258	Ga0070670_1001072581	289
1108	3300005331	Ga0070670_100197961	Ga0070670_1001979612	289
1109	3300005333	Ga0070677_10000606	Ga0070677_1000060613	289
1110	3300005333	Ga0070677_10016522	Ga0070677_100165222	289
1111	3300005333	Ga0070677_10028045	Ga0070677_100280452	289
1112	3300005334	Ga0068869_100000088	Ga0068869_10000008832	289
1113	3300005334	Ga0068869_100003548	Ga0068869_1000035486	289
1114	3300005334	Ga0068869_100007848	Ga0068869_1000078485	289
1115	3300005334	Ga0068869_100038322	Ga0068869_1000383223	289
1116	3300005334	Ga0068869_100050916	Ga0068869_1000509163	289
1117	3300005334	Ga0068869_100127166	Ga0068869_1001271661	289
1118	3300005334	Ga0068869_100338090	Ga0068869_1003380902	289
1119	3300005335	Ga0070666_10002459	Ga0070666_100024597	289
1120	3300005335	Ga0070666_10004459	Ga0070666_100044593	289
1121	3300005335	Ga0070666_10006693	Ga0070666_100066936	289
1122	3300005335	Ga0070666_10010978	Ga0070666_100109783	289
1123	3300005335	Ga0070666_10045179	Ga0070666_100451793	289
1124	3300005336	Ga0070680_100168843	Ga0070680_1001688431	289
1125	3300005337	Ga0070682_100155987	Ga0070682_1001559871	289
1126	3300005337	Ga0070682_100185724	Ga0070682_1001857242	289
1127	3300005338	Ga0068868_100001375	Ga0068868_1000013758	289
1128	3300005338	Ga0068868_100018583	Ga0068868_1000185833	289
1129	3300005338	Ga0068868_100045762	Ga0068868_1000457623	289
1130	3300005338	Ga0068868_100073552	Ga0068868_1000735522	289
1131	3300005338	Ga0068868_100084513	Ga0068868_1000845132	289
1132	3300005338	Ga0068868_100110079	Ga0068868_1001100791	289
1133	3300005338	Ga0068868_100264438	Ga0068868_1002644382	289
1134	3300005339	Ga0070660_100008716	Ga0070660_1000087165	289
1135	3300005339	Ga0070660_100017450	Ga0070660_1000174505	289
1136	3300005339	Ga0070660_100343502	Ga0070660_1003435022	289
1137	3300005340	Ga0070689_100002823	Ga0070689_1000028232	289
1138	3300005343	Ga0070687_100018097	Ga0070687_1000180971	289
1139	3300005343	Ga0070687_100200182	Ga0070687_1002001822	289
1140	3300005344	Ga0070661_100001471	Ga0070661_1000014716	289
1141	3300005344	Ga0070661_100024608	Ga0070661_1000246085	289
1142	3300005344	Ga0070661_100048358	Ga0070661_1000483582	289
1143	3300005344	Ga0070661_100103206	Ga0070661_1001032062	289
1144	3300005344	Ga0070661_100163528	Ga0070661_1001635282	289
1145	3300005347	Ga0070668_100002898	Ga0070668_1000028985	289
1146	3300005347	Ga0070668_100103415	Ga0070668_1001034152	289
1147	3300005353	Ga0070669_100005505	Ga0070669_1000055052	289
1148	3300005353	Ga0070669_100008378	Ga0070669_1000083786	289
1149	3300005353	Ga0070669_100169443	Ga0070669_1001694432	289
1150	3300005353	Ga0070669_100265687	Ga0070669_1002656872	289
1151	3300005354	Ga0070675_100001304	Ga0070675_10000130415	289
1152	3300005354	Ga0070675_100001941	Ga0070675_1000019413	289
1153	3300005354	Ga0070675_100004787	Ga0070675_1000047877	289
1154	3300005354	Ga0070675_100022354	Ga0070675_1000223544	289
1155	3300005354	Ga0070675_100116465	Ga0070675_1001164652	289
1156	3300005354	Ga0070675_100153973	Ga0070675_1001539732	289
1157	3300005354	Ga0070675_100168134	Ga0070675_1001681342	289
1158	3300005355	Ga0070671_100000593	Ga0070671_10000059324	289
1159	3300005355	Ga0070671_100001446	Ga0070671_1000014467	289
1160	3300005355	Ga0070671_100003963	Ga0070671_1000039632	289
1161	3300005355	Ga0070671_100016505	Ga0070671_1000165055	289
1162	3300005355	Ga0070671_100039722	Ga0070671_1000397222	289
1163	3300005355	Ga0070671_100041084	Ga0070671_1000410842	289
1164	3300005355	Ga0070671_100044146	Ga0070671_1000441464	289
1165	3300005355	Ga0070671_100057993	Ga0070671_1000579933	289
1166	3300005355	Ga0070671_100063192	Ga0070671_1000631922	289
1167	3300005355	Ga0070671_100097892	Ga0070671_1000978922	289
1168	3300005356	Ga0070674_100000201	Ga0070674_1000002015	289
1169	3300005356	Ga0070674_100007388	Ga0070674_1000073886	289
1170	3300005356	Ga0070674_100532957	Ga0070674_1005329571	289
1171	3300005364	Ga0070673_100003709	Ga0070673_1000037093	289
1172	3300005364	Ga0070673_100004425	Ga0070673_1000044258	289
1173	3300005364	Ga0070673_100137573	Ga0070673_1001375732	289
1174	3300005364	Ga0070673_100174122	Ga0070673_1001741221	289
1175	3300005364	Ga0070673_100329509	Ga0070673_1003295092	289
1176	3300005365	Ga0070688_100001955	Ga0070688_10000195513	289
1177	3300005365	Ga0070688_100022181	Ga0070688_1000221812	289
1178	3300005366	Ga0070659_100108850	Ga0070659_1001088501	289
1179	3300005366	Ga0070659_100127094	Ga0070659_1001270942	289
1180	3300005366	Ga0070659_100162832	Ga0070659_1001628322	289
1181	3300005366	Ga0070659_100185245	Ga0070659_1001852452	289
1182	3300005366	Ga0070659_100188624	Ga0070659_1001886242	289
1183	3300005367	Ga0070667_100007168	Ga0070667_1000071683	289
1184	3300005367	Ga0070667_100008795	Ga0070667_1000087959	289
1185	3300005367	Ga0070667_100013950	Ga0070667_1000139502	289
1186	3300005367	Ga0070667_100062975	Ga0070667_1000629754	289
1187	3300005434	Ga0070709_10038489	Ga0070709_100384893	289
1188	3300005434	Ga0070709_10061061	Ga0070709_100610613	289
1189	3300005435	Ga0070714_100012691	Ga0070714_1000126914	289
1190	3300005435	Ga0070714_100020064	Ga0070714_1000200643	289
1191	3300005435	Ga0070714_100172847	Ga0070714_1001728471	289
1192	3300005436	Ga0070713_100471617	Ga0070713_1004716171	289
1193	3300005439	Ga0070711_100040074	Ga0070711_1000400742	289
1194	3300005439	Ga0070711_100115323	Ga0070711_1001153232	289
1195	3300005441	Ga0070700_100158279	Ga0070700_1001582792	289
1196	3300005441	Ga0070700_100261710	Ga0070700_1002617101	289
1197	3300005445	Ga0070708_100476456	Ga0070708_1004764562	289
1198	3300005455	Ga0070663_100006193	Ga0070663_1000061934	289
1199	3300005455	Ga0070663_100009190	Ga0070663_1000091904	289
1200	3300005455	Ga0070663_100103215	Ga0070663_1001032152	289
1201	3300005455	Ga0070663_100133553	Ga0070663_1001335531	289
1202	3300005455	Ga0070663_100139408	Ga0070663_1001394083	289
1203	3300005455	Ga0070663_100258788	Ga0070663_1002587882	289
1204	3300005456	Ga0070678_100001356	Ga0070678_10000135613	289
1205	3300005456	Ga0070678_100002691	Ga0070678_1000026912	289
1206	3300005456	Ga0070678_100009176	Ga0070678_1000091767	289
1207	3300005456	Ga0070678_100027276	Ga0070678_1000272764	289
1208	3300005457	Ga0070662_100001613	Ga0070662_10000161311	289
1209	3300005457	Ga0070662_100013092	Ga0070662_1000130922	289
1210	3300005458	Ga0070681_10007825	Ga0070681_100078254	289
1211	3300005458	Ga0070681_10017118	Ga0070681_100171185	289
1212	3300005458	Ga0070681_10050303	Ga0070681_100503031	289
1213	3300005458	Ga0070681_10304662	Ga0070681_103046622	289
1214	3300005459	Ga0068867_100000054	Ga0068867_10000005413	289
1215	3300005459	Ga0068867_100001887	Ga0068867_1000018876	289
1216	3300005459	Ga0068867_100029307	Ga0068867_1000293074	289
1217	3300005459	Ga0068867_100344712	Ga0068867_1003447122	289
1218	3300005459	Ga0068867_100350051	Ga0068867_1003500511	289
1219	3300005467	Ga0070706_100079059	Ga0070706_1000790593	289
1220	3300005467	Ga0070706_100124971	Ga0070706_1001249712	289
1221	3300005471	Ga0070698_100189249	Ga0070698_1001892492	289
1222	3300005530	Ga0070679_100003663	Ga0070679_1000036633	289
1223	3300005530	Ga0070679_100028965	Ga0070679_1000289652	289
1224	3300005530	Ga0070679_100034687	Ga0070679_1000346875	289
1225	3300005530	Ga0070679_100088011	Ga0070679_1000880112	289
1226	3300005530	Ga0070679_100161700	Ga0070679_1001617002	289
1227	3300005530	Ga0070679_100168851	Ga0070679_1001688512	289
1228	3300005535	Ga0070684_100001493	Ga0070684_1000014939	289
1229	3300005535	Ga0070684_100012411	Ga0070684_1000124115	289
1230	3300005535	Ga0070684_100224384	Ga0070684_1002243842	289
1231	3300005539	Ga0068853_100006675	Ga0068853_1000066753	289
1232	3300005539	Ga0068853_100007872	Ga0068853_1000078722	289
1233	3300005539	Ga0068853_100010568	Ga0068853_1000105682	289
1234	3300005539	Ga0068853_100016500	Ga0068853_1000165004	289
1235	3300005539	Ga0068853_100137048	Ga0068853_1001370482	289
1236	3300005539	Ga0068853_100274503	Ga0068853_1002745032	289
1237	3300005543	Ga0070672_100000440	Ga0070672_10000044026	289
1238	3300005543	Ga0070672_100015510	Ga0070672_1000155104	289
1239	3300005543	Ga0070672_100049199	Ga0070672_1000491993	289
1240	3300005543	Ga0070672_100050586	Ga0070672_1000505863	289
1241	3300005544	Ga0070686_100008902	Ga0070686_1000089025	289
1242	3300005546	Ga0070696_100009755	Ga0070696_1000097554	289
1243	3300005547	Ga0070693_100001242	Ga0070693_10000124213	289
1244	3300005547	Ga0070693_100044192	Ga0070693_1000441922	289
1245	3300005548	Ga0070665_100005927	Ga0070665_1000059279	289
1246	3300005548	Ga0070665_100068315	Ga0070665_1000683152	289
1247	3300005548	Ga0070665_100226000	Ga0070665_1002260002	289
1248	3300005563	Ga0068855_100024953	Ga0068855_1000249536	289
1249	3300005563	Ga0068855_100038488	Ga0068855_1000384883	289
1250	3300005563	Ga0068855_100045292	Ga0068855_1000452924	289
1251	3300005563	Ga0068855_100094127	Ga0068855_1000941273	289
1252	3300005563	Ga0068855_100642410	Ga0068855_1006424102	289
1253	3300005564	Ga0070664_100011691	Ga0070664_1000116914	289
1254	3300005564	Ga0070664_100016251	Ga0070664_1000162514	289
1255	3300005564	Ga0070664_100058843	Ga0070664_1000588432	289
1256	3300005564	Ga0070664_100184729	Ga0070664_1001847292	289
1257	3300005564	Ga0070664_100249729	Ga0070664_1002497292	289
1258	3300005564	Ga0070664_100265375	Ga0070664_1002653752	289
1259	3300005577	Ga0068857_100005684	Ga0068857_1000056846	289
1260	3300005577	Ga0068857_100006543	Ga0068857_1000065432	289
1261	3300005577	Ga0068857_100084563	Ga0068857_1000845633	289
1262	3300005577	Ga0068857_100114396	Ga0068857_1001143962	289
1263	3300005577	Ga0068857_100140372	Ga0068857_1001403722	289
1264	3300005578	Ga0068854_100032939	Ga0068854_1000329394	289
1265	3300005578	Ga0068854_100040539	Ga0068854_1000405393	289
1266	3300005578	Ga0068854_100052753	Ga0068854_1000527533	289
1267	3300005578	Ga0068854_100076833	Ga0068854_1000768332	289
1268	3300005578	Ga0068854_100169143	Ga0068854_1001691432	289
1269	3300005578	Ga0068854_100179586	Ga0068854_1001795862	289
1270	3300005614	Ga0068856_100000125	Ga0068856_10000012511	289
1271	3300005614	Ga0068856_100019198	Ga0068856_1000191984	289
1272	3300005614	Ga0068856_100023404	Ga0068856_1000234043	289
1273	3300005614	Ga0068856_100032430	Ga0068856_1000324303	289
1274	3300005614	Ga0068856_100040315	Ga0068856_1000403152	289
1275	3300005614	Ga0068856_100097870	Ga0068856_1000978702	289
1276	3300005614	Ga0068856_100193554	Ga0068856_1001935542	289
1277	3300005615	Ga0070702_100032028	Ga0070702_1000320283	289
1278	3300005615	Ga0070702_100055341	Ga0070702_1000553412	289
1279	3300005615	Ga0070702_100222149	Ga0070702_1002221491	289
1280	3300005616	Ga0068852_100000927	Ga0068852_10000092718	289
1281	3300005616	Ga0068852_100018572	Ga0068852_1000185724	289
1282	3300005616	Ga0068852_100031765	Ga0068852_1000317652	289
1283	3300005616	Ga0068852_100046908	Ga0068852_1000469083	289
1284	3300005616	Ga0068852_100061107	Ga0068852_1000611073	289
1285	3300005616	Ga0068852_100066829	Ga0068852_1000668293	289
1286	3300005616	Ga0068852_100086594	Ga0068852_1000865944	289
1287	3300005616	Ga0068852_100112814	Ga0068852_1001128142	289
1288	3300005616	Ga0068852_100156637	Ga0068852_1001566372	289
1289	3300005616	Ga0068852_100161164	Ga0068852_1001611642	289
1290	3300005616	Ga0068852_100355038	Ga0068852_1003550382	289
1291	3300005617	Ga0068859_100000842	Ga0068859_10000084212	289
1292	3300005617	Ga0068859_100003385	Ga0068859_1000033856	289
1293	3300005617	Ga0068859_100068523	Ga0068859_1000685233	289
1294	3300005617	Ga0068859_100110821	Ga0068859_1001108213	289
1295	3300005618	Ga0068864_100000600	Ga0068864_1000006007	289
1296	3300005618	Ga0068864_100002269	Ga0068864_1000022697	289
1297	3300005618	Ga0068864_100002962	Ga0068864_10000296215	289
1298	3300005618	Ga0068864_100006508	Ga0068864_1000065082	289
1299	3300005618	Ga0068864_100009205	Ga0068864_1000092052	289
1300	3300005618	Ga0068864_100011819	Ga0068864_1000118195	289
1301	3300005618	Ga0068864_100287776	Ga0068864_1002877762	289
1302	3300005719	Ga0068861_100001494	Ga0068861_1000014949	289
1303	3300005719	Ga0068861_100005623	Ga0068861_1000056232	289
1304	3300005719	Ga0068861_100040105	Ga0068861_1000401052	289
1305	3300005719	Ga0068861_100077229	Ga0068861_1000772294	289
1306	3300005719	Ga0068861_100475410	Ga0068861_1004754102	289
1307	3300005834	Ga0068851_10009724	Ga0068851_100097244	289
1308	3300005834	Ga0068851_10013560	Ga0068851_100135602	289
1309	3300005834	Ga0068851_10022951	Ga0068851_100229512	289
1310	3300005834	Ga0068851_10027681	Ga0068851_100276812	289
1311	3300005834	Ga0068851_10028918	Ga0068851_100289183	289
1312	3300005834	Ga0068851_10034764	Ga0068851_100347642	289
1313	3300005834	Ga0068851_10058348	Ga0068851_100583482	289
1314	3300005840	Ga0068870_10003700	Ga0068870_100037002	289
1315	3300005840	Ga0068870_10055380	Ga0068870_100553802	289
1316	3300005840	Ga0068870_10225799	Ga0068870_102257992	289
1317	3300005841	Ga0068863_100000563	Ga0068863_10000056318	289
1318	3300005841	Ga0068863_100003635	Ga0068863_10000363514	289
1319	3300005841	Ga0068863_100009243	Ga0068863_1000092438	289
1320	3300005841	Ga0068863_100035890	Ga0068863_1000358903	289
1321	3300005841	Ga0068863_100062473	Ga0068863_1000624732	289
1322	3300005841	Ga0068863_100094189	Ga0068863_1000941892	289
1323	3300005841	Ga0068863_100101250	Ga0068863_1001012502	289
1324	3300005841	Ga0068863_100110744	Ga0068863_1001107443	289
1325	3300005842	Ga0068858_100001163	Ga0068858_10000116327	289
1326	3300005842	Ga0068858_100001205	Ga0068858_10000120518	289
1327	3300005842	Ga0068858_100006317	Ga0068858_10000631711	289
1328	3300005842	Ga0068858_100006818	Ga0068858_1000068185	289
1329	3300005842	Ga0068858_100017199	Ga0068858_1000171994	289
1330	3300005842	Ga0068858_100074661	Ga0068858_1000746613	289
1331	3300005842	Ga0068858_100128915	Ga0068858_1001289152	289
1332	3300005842	Ga0068858_100178246	Ga0068858_1001782462	289
1333	3300005843	Ga0068860_100001371	Ga0068860_10000137112	289
1334	3300005843	Ga0068860_100004352	Ga0068860_1000043526	289
1335	3300005843	Ga0068860_100006557	Ga0068860_1000065577	289
1336	3300005843	Ga0068860_100012818	Ga0068860_1000128183	289
1337	3300005843	Ga0068860_100012937	Ga0068860_1000129379	289
1338	3300005843	Ga0068860_100077587	Ga0068860_1000775872	289
1339	3300005843	Ga0068860_100167209	Ga0068860_1001672092	289
1340	3300005843	Ga0068860_100226659	Ga0068860_1002266592	289
1341	3300005844	Ga0068862_100027746	Ga0068862_1000277463	289
1342	3300005844	Ga0068862_100077164	Ga0068862_1000771642	289
1343	3300005844	Ga0068862_100115814	Ga0068862_1001158142	289
1344	3300006042	Ga0075368_10028768	Ga0075368_100287682	289
1345	3300006042	Ga0075368_10124497	Ga0075368_101244971	289
1346	3300006048	Ga0075363_100001766	Ga0075363_1000017666	289
1347	3300006048	Ga0075363_100077699	Ga0075363_1000776992	289
1348	3300006051	Ga0075364_10114253	Ga0075364_101142532	289
1349	3300006177	Ga0075362_10000620	Ga0075362_100006206	289
1350	3300006178	Ga0075367_10007568	Ga0075367_100075683	289
1351	3300006178	Ga0075367_10084597	Ga0075367_100845972	289
1352	3300006186	Ga0075369_10041614	Ga0075369_100416142	289
1353	3300006195	Ga0075366_10001800	Ga0075366_1000180012	289
1354	3300006195	Ga0075366_10007260	Ga0075366_100072603	289
1355	3300006195	Ga0075366_10051849	Ga0075366_100518492	289
1356	3300006195	Ga0075366_10100607	Ga0075366_101006072	289
1357	3300006195	Ga0075366_10112210	Ga0075366_101122102	289
1358	3300006195	Ga0075366_10172658	Ga0075366_101726582	289
1359	3300006237	Ga0097621_100012544	Ga0097621_1000125444	289
1360	3300006237	Ga0097621_100025092	Ga0097621_1000250922	289
1361	3300006237	Ga0097621_100090774	Ga0097621_1000907742	289
1362	3300006237	Ga0097621_100167617	Ga0097621_1001676172	289
1363	3300006237	Ga0097621_100199495	Ga0097621_1001994952	289
1364	3300006237	Ga0097621_100204994	Ga0097621_1002049942	289
1365	3300006353	Ga0075370_10000641	Ga0075370_100006417	289
1366	3300006353	Ga0075370_10001516	Ga0075370_100015163	289
1367	3300006353	Ga0075370_10002089	Ga0075370_100020897	289
1368	3300006353	Ga0075370_10002548	Ga0075370_100025487	289
1369	3300006353	Ga0075370_10024886	Ga0075370_100248862	289
1370	3300006358	Ga0068871_100006840	Ga0068871_1000068402	289
1371	3300006358	Ga0068871_100006844	Ga0068871_1000068446	289
1372	3300006358	Ga0068871_100096655	Ga0068871_1000966553	289
1373	3300006358	Ga0068871_100253175	Ga0068871_1002531752	289
1374	3300006358	Ga0068871_100282408	Ga0068871_1002824082	289
1375	3300006358	Ga0068871_100386863	Ga0068871_1003868631	289
1376	3300006881	Ga0068865_100025275	Ga0068865_1000252753	289
1377	3300006881	Ga0068865_100055317	Ga0068865_1000553172	289
1378	3300006881	Ga0068865_100057151	Ga0068865_1000571513	289
1379	3300006881	Ga0068865_100202864	Ga0068865_1002028641	289
1380	3300006914	Ga0075436_100000758	Ga0075436_10000075819	289
1381	3300006931	Ga0097620_100000842	Ga0097620_10000084212	289
1382	3300006931	Ga0097620_100003385	Ga0097620_1000033856	289
1383	3300006931	Ga0097620_100068529	Ga0097620_1000685293	289
1384	3300006931	Ga0097620_100110823	Ga0097620_1001108233	289
1385	3300009093	Ga0105240_10002655	Ga0105240_1000265524	289
1386	3300009093	Ga0105240_10014947	Ga0105240_100149475	289
1387	3300009093	Ga0105240_10020324	Ga0105240_100203242	289
1388	3300009093	Ga0105240_10032072	Ga0105240_100320725	289
1389	3300009093	Ga0105240_10099501	Ga0105240_100995013	289
1390	3300009093	Ga0105240_10133853	Ga0105240_101338533	289
1391	3300009094	Ga0111539_10002947	Ga0111539_1000294724	289
1392	3300009098	Ga0105245_10012652	Ga0105245_100126522	289
1393	3300009098	Ga0105245_10016178	Ga0105245_100161788	289
1394	3300009098	Ga0105245_10061554	Ga0105245_100615544	289
1395	3300009098	Ga0105245_10215377	Ga0105245_102153772	289
1396	3300009098	Ga0105245_10233392	Ga0105245_102333922	289
1397	3300009147	Ga0114129_10024403	Ga0114129_100244034	289
1398	3300009147	Ga0114129_10336713	Ga0114129_103367132	289
1399	3300009148	Ga0105243_10004681	Ga0105243_1000468111	289
1400	3300009148	Ga0105243_10025768	Ga0105243_100257682	289
1401	3300009148	Ga0105243_10544423	Ga0105243_105444231	289
1402	3300009174	Ga0105241_10015130	Ga0105241_100151302	289
1403	3300009174	Ga0105241_10074898	Ga0105241_100748982	289
1404	3300009174	Ga0105241_10095134	Ga0105241_100951342	289
1405	3300009174	Ga0105241_10443002	Ga0105241_104430022	289
1406	3300009176	Ga0105242_10170127	Ga0105242_101701272	289
1407	3300009177	Ga0105248_10001562	Ga0105248_1000156222	289
1408	3300009177	Ga0105248_10001893	Ga0105248_1000189312	289
1409	3300009177	Ga0105248_10006238	Ga0105248_1000623810	289
1410	3300009177	Ga0105248_10019504	Ga0105248_100195046	289
1411	3300009177	Ga0105248_10140257	Ga0105248_101402573	289
1412	3300009545	Ga0105237_10002593	Ga0105237_100025933	289
1413	3300009545	Ga0105237_10038743	Ga0105237_100387434	289
1414	3300009545	Ga0105237_10052900	Ga0105237_100529002	289
1415	3300009545	Ga0105237_10183572	Ga0105237_101835722	289
1416	3300009545	Ga0105237_10259308	Ga0105237_102593082	289
1417	3300009545	Ga0105237_10309497	Ga0105237_103094972	289
1418	3300009551	Ga0105238_10000495	Ga0105238_1000049522	289
1419	3300009551	Ga0105238_10025456	Ga0105238_100254562	289
1420	3300009553	Ga0105249_10066328	Ga0105249_100663282	289
1421	3300009553	Ga0105249_10420002	Ga0105249_104200022	289
1422	3300010375	Ga0105239_10009057	Ga0105239_100090574	289
1423	3300010375	Ga0105239_10023582	Ga0105239_100235823	289
1424	3300010375	Ga0105239_10186948	Ga0105239_101869483	289
1425	3300012512	Ga0157327_1004310	Ga0157327_10043102	289
1426	3300013100	Ga0157373_10014756	Ga0157373_100147563	289
1427	3300013100	Ga0157373_10037772	Ga0157373_100377722	289
1428	3300013100	Ga0157373_10041918	Ga0157373_100419183	289
1429	3300013100	Ga0157373_10143764	Ga0157373_101437642	289
1430	3300013102	Ga0157371_10001964	Ga0157371_100019642	289
1431	3300013102	Ga0157371_10098400	Ga0157371_100984002	289
1432	3300013102	Ga0157371_10109496	Ga0157371_101094962	289
1433	3300013102	Ga0157371_10118120	Ga0157371_101181202	289
1434	3300013104	Ga0157370_10007420	Ga0157370_100074205	289
1435	3300013104	Ga0157370_10013965	Ga0157370_100139652	289
1436	3300013104	Ga0157370_10022563	Ga0157370_100225632	289
1437	3300013104	Ga0157370_10029385	Ga0157370_100293854	289
1438	3300013104	Ga0157370_10031660	Ga0157370_100316604	289
1439	3300013104	Ga0157370_10130919	Ga0157370_101309192	289
1440	3300013105	Ga0157369_10002424	Ga0157369_1000242415	289
1441	3300013105	Ga0157369_10009597	Ga0157369_100095972	289
1442	3300013105	Ga0157369_10059325	Ga0157369_100593254	289
1443	3300013105	Ga0157369_10402288	Ga0157369_104022882	289
1444	3300013105	Ga0157369_10406345	Ga0157369_104063452	289
1445	3300013105	Ga0157369_10647754	Ga0157369_106477541	289
1446	3300013296	Ga0157374_10004423	Ga0157374_100044237	289
1447	3300013296	Ga0157374_10090918	Ga0157374_100909183	289
1448	3300013296	Ga0157374_10095637	Ga0157374_100956372	289
1449	3300013296	Ga0157374_10127131	Ga0157374_101271312	289
1450	3300013297	Ga0157378_10371817	Ga0157378_103718172	289
1451	3300013306	Ga0163162_10007183	Ga0163162_100071835	289
1452	3300013306	Ga0163162_10023312	Ga0163162_100233124	289
1453	3300013306	Ga0163162_10048197	Ga0163162_100481973	289
1454	3300013307	Ga0157372_10003272	Ga0157372_100032726	289
1455	3300013307	Ga0157372_10005319	Ga0157372_1000531910	289
1456	3300013307	Ga0157372_10014229	Ga0157372_100142294	289
1457	3300013307	Ga0157372_10021247	Ga0157372_100212475	289
1458	3300013307	Ga0157372_10055732	Ga0157372_100557321	289
1459	3300013307	Ga0157372_10082225	Ga0157372_100822254	289
1460	3300013307	Ga0157372_10086097	Ga0157372_100860974	289
1461	3300013307	Ga0157372_10272963	Ga0157372_102729633	289
1462	3300013307	Ga0157372_10543692	Ga0157372_105436921	289
1463	3300013308	Ga0157375_10013061	Ga0157375_100130616	289
1464	3300013308	Ga0157375_10013698	Ga0157375_100136982	289
1465	3300013308	Ga0157375_10017371	Ga0157375_100173718	289
1466	3300013308	Ga0157375_10030154	Ga0157375_100301544	289
1467	3300013308	Ga0157375_10108943	Ga0157375_101089433	289
1468	3300013308	Ga0157375_10139844	Ga0157375_101398442	289
1469	3300013308	Ga0157375_10164288	Ga0157375_101642883	289
1470	3300013308	Ga0157375_10368717	Ga0157375_103687171	289
1471	3300013308	Ga0157375_10399704	Ga0157375_103997042	289
1472	3300013308	Ga0157375_10415321	Ga0157375_104153212	289
1473	3300013308	Ga0157375_10424533	Ga0157375_104245332	289
1474	3300013308	Ga0157375_10507743	Ga0157375_105077431	289
1475	3300014326	Ga0157380_10016252	Ga0157380_100162526	289
1476	3300014745	Ga0157377_10000006	Ga0157377_10000006345	289
1477	3300014745	Ga0157377_10015859	Ga0157377_100158595	289
1478	3300014968	Ga0157379_10000545	Ga0157379_100005458	289
1479	3300014968	Ga0157379_10001006	Ga0157379_100010066	289
1480	3300014968	Ga0157379_10010992	Ga0157379_100109924	289
1481	3300014968	Ga0157379_10033934	Ga0157379_100339344	289
1482	3300014968	Ga0157379_10062082	Ga0157379_100620822	289
1483	3300014968	Ga0157379_10149145	Ga0157379_101491452	289
1484	3300014969	Ga0157376_10005203	Ga0157376_100052034	289
1485	3300014969	Ga0157376_10015446	Ga0157376_100154463	289
1486	3300014969	Ga0157376_10022743	Ga0157376_100227434	289
1487	3300014969	Ga0157376_10277697	Ga0157376_102776972	289
1488	3300017792	Ga0163161_10006511	Ga0163161_100065114	289
1489	3300017792	Ga0163161_10028198	Ga0163161_100281985	289
1490	3300017792	Ga0163161_10043937	Ga0163161_100439374	289
1491	3300020082	Ga0206353_10945660	Ga0206353_109456602	289
1492	3300021377	Ga0213874_10018218	Ga0213874_100182182	289
1493	3300021384	Ga0213876_10038935	Ga0213876_100389352	289
1494	3300025245	Ga0207425_1000645	Ga0207425_100064517	289
1495	3300025258	Ga0209129_1000158	Ga0209129_100015875	289
1496	3300025273	Ga0209673_1002375	Ga0209673_10023752	289
1497	3300025273	Ga0209673_1006675	Ga0209673_10066753	289
1498	3300025290	Ga0207673_1005958	Ga0207673_10059582	289
1499	3300025295	Ga0209564_1000282	Ga0209564_100028275	289
1500	3300025297	Ga0209758_1000500	Ga0209758_100050021	289
1501	3300025297	Ga0209758_1000630	Ga0209758_100063021	289
1502	3300025298	Ga0209050_1003750	Ga0209050_10037506	289
1503	3300025304	Ga0209257_1023305	Ga0209257_10233052	289
1504	3300025315	Ga0207697_10000331	Ga0207697_100003312	289
1505	3300025315	Ga0207697_10019698	Ga0207697_100196983	289
1506	3300025315	Ga0207697_10021550	Ga0207697_100215503	289
1507	3300025321	Ga0207656_10007387	Ga0207656_100073872	289
1508	3300025321	Ga0207656_10063260	Ga0207656_100632602	289
1509	3300025893	Ga0207682_10000010	Ga0207682_1000001017	289
1510	3300025893	Ga0207682_10000856	Ga0207682_100008566	289
1511	3300025893	Ga0207682_10003289	Ga0207682_100032892	289
1512	3300025900	Ga0207710_10028278	Ga0207710_100282782	289
1513	3300025901	Ga0207688_10000190	Ga0207688_1000019023	289
1514	3300025901	Ga0207688_10043377	Ga0207688_100433772	289
1515	3300025903	Ga0207680_10018526	Ga0207680_100185263	289
1516	3300025903	Ga0207680_10043572	Ga0207680_100435722	289
1517	3300025903	Ga0207680_10238004	Ga0207680_102380042	289
1518	3300025903	Ga0207680_10259130	Ga0207680_102591302	289
1519	3300025903	Ga0207680_10296564	Ga0207680_102965641	289
1520	3300025904	Ga0207647_10129988	Ga0207647_101299881	289
1521	3300025905	Ga0207685_10024371	Ga0207685_100243712	289
1522	3300025906	Ga0207699_10042592	Ga0207699_100425923	289
1523	3300025906	Ga0207699_10265221	Ga0207699_102652212	289
1524	3300025907	Ga0207645_10000445	Ga0207645_1000044513	289
1525	3300025907	Ga0207645_10001222	Ga0207645_1000122223	289
1526	3300025907	Ga0207645_10001359	Ga0207645_100013594	289
1527	3300025907	Ga0207645_10014507	Ga0207645_100145072	289
1528	3300025907	Ga0207645_10015550	Ga0207645_100155505	289
1529	3300025907	Ga0207645_10042309	Ga0207645_100423093	289
1530	3300025907	Ga0207645_10087790	Ga0207645_100877902	289
1531	3300025907	Ga0207645_10214399	Ga0207645_102143991	289
1532	3300025907	Ga0207645_10276665	Ga0207645_102766651	289
1533	3300025908	Ga0207643_10000339	Ga0207643_100003394	289
1534	3300025908	Ga0207643_10014684	Ga0207643_100146842	289
1535	3300025908	Ga0207643_10059295	Ga0207643_100592952	289
1536	3300025908	Ga0207643_10117381	Ga0207643_101173811	289
1537	3300025908	Ga0207643_10137030	Ga0207643_101370302	289
1538	3300025909	Ga0207705_10045381	Ga0207705_100453813	289
1539	3300025909	Ga0207705_10051729	Ga0207705_100517293	289
1540	3300025909	Ga0207705_10103798	Ga0207705_101037982	289
1541	3300025911	Ga0207654_10013573	Ga0207654_100135733	289
1542	3300025911	Ga0207654_10025660	Ga0207654_100256603	289
1543	3300025911	Ga0207654_10252176	Ga0207654_102521761	289
1544	3300025912	Ga0207707_10009242	Ga0207707_100092424	289
1545	3300025912	Ga0207707_10080511	Ga0207707_100805113	289
1546	3300025912	Ga0207707_10082187	Ga0207707_100821871	289
1547	3300025912	Ga0207707_10403839	Ga0207707_104038392	289
1548	3300025913	Ga0207695_10014097	Ga0207695_100140974	289
1549	3300025913	Ga0207695_10025864	Ga0207695_100258645	289
1550	3300025913	Ga0207695_10030651	Ga0207695_100306512	289
1551	3300025913	Ga0207695_10121197	Ga0207695_101211971	289
1552	3300025913	Ga0207695_10247161	Ga0207695_102471612	289
1553	3300025913	Ga0207695_10341190	Ga0207695_103411902	289
1554	3300025914	Ga0207671_10033475	Ga0207671_100334754	289
1555	3300025914	Ga0207671_10059440	Ga0207671_100594402	289
1556	3300025914	Ga0207671_10085860	Ga0207671_100858603	289
1557	3300025916	Ga0207663_10020513	Ga0207663_100205132	289
1558	3300025917	Ga0207660_10043940	Ga0207660_100439402	289
1559	3300025917	Ga0207660_10258707	Ga0207660_102587072	289
1560	3300025918	Ga0207662_10019448	Ga0207662_100194484	289
1561	3300025918	Ga0207662_10144093	Ga0207662_101440932	289
1562	3300025919	Ga0207657_10000708	Ga0207657_1000070826	289
1563	3300025919	Ga0207657_10001407	Ga0207657_1000140720	289
1564	3300025919	Ga0207657_10005209	Ga0207657_1000520910	289
1565	3300025920	Ga0207649_10003577	Ga0207649_100035775	289
1566	3300025920	Ga0207649_10007924	Ga0207649_100079246	289
1567	3300025920	Ga0207649_10052076	Ga0207649_100520762	289
1568	3300025920	Ga0207649_10056609	Ga0207649_100566092	289
1569	3300025920	Ga0207649_10133332	Ga0207649_101333321	289
1570	3300025921	Ga0207652_10008453	Ga0207652_100084533	289
1571	3300025921	Ga0207652_10028402	Ga0207652_100284024	289
1572	3300025921	Ga0207652_10445351	Ga0207652_104453511	289
1573	3300025923	Ga0207681_10022649	Ga0207681_100226492	289
1574	3300025923	Ga0207681_10034019	Ga0207681_100340193	289
1575	3300025923	Ga0207681_10075864	Ga0207681_100758642	289
1576	3300025924	Ga0207694_10003604	Ga0207694_100036046	289
1577	3300025924	Ga0207694_10014873	Ga0207694_100148735	289
1578	3300025924	Ga0207694_10031151	Ga0207694_100311512	289
1579	3300025925	Ga0207650_10001307	Ga0207650_100013073	289
1580	3300025925	Ga0207650_10002168	Ga0207650_100021689	289
1581	3300025925	Ga0207650_10003681	Ga0207650_100036816	289
1582	3300025925	Ga0207650_10024239	Ga0207650_100242395	289
1583	3300025925	Ga0207650_10032459	Ga0207650_100324594	289
1584	3300025926	Ga0207659_10002182	Ga0207659_1000218211	289
1585	3300025926	Ga0207659_10005594	Ga0207659_100055946	289
1586	3300025926	Ga0207659_10015792	Ga0207659_100157922	289
1587	3300025926	Ga0207659_10016356	Ga0207659_100163564	289
1588	3300025926	Ga0207659_10221235	Ga0207659_102212352	289
1589	3300025927	Ga0207687_10107657	Ga0207687_101076572	289
1590	3300025927	Ga0207687_10370726	Ga0207687_103707262	289
1591	3300025929	Ga0207664_10005358	Ga0207664_100053585	289
1592	3300025929	Ga0207664_10013829	Ga0207664_100138294	289
1593	3300025929	Ga0207664_10198373	Ga0207664_101983732	289
1594	3300025931	Ga0207644_10003938	Ga0207644_100039382	289
1595	3300025931	Ga0207644_10005516	Ga0207644_100055162	289
1596	3300025931	Ga0207644_10010160	Ga0207644_100101604	289
1597	3300025931	Ga0207644_10037102	Ga0207644_100371024	289
1598	3300025931	Ga0207644_10042318	Ga0207644_100423182	289
1599	3300025931	Ga0207644_10049224	Ga0207644_100492242	289
1600	3300025931	Ga0207644_10050725	Ga0207644_100507253	289
1601	3300025931	Ga0207644_10164246	Ga0207644_101642461	289
1602	3300025931	Ga0207644_10167367	Ga0207644_101673672	289
1603	3300025931	Ga0207644_10282099	Ga0207644_102820992	289
1604	3300025932	Ga0207690_10001716	Ga0207690_100017163	289
1605	3300025932	Ga0207690_10243429	Ga0207690_102434292	289
1606	3300025933	Ga0207706_10000133	Ga0207706_1000013324	289
1607	3300025933	Ga0207706_10024048	Ga0207706_100240482	289
1608	3300025933	Ga0207706_10044906	Ga0207706_100449063	289
1609	3300025933	Ga0207706_10121773	Ga0207706_101217732	289
1610	3300025933	Ga0207706_10249253	Ga0207706_102492532	289
1611	3300025934	Ga0207686_10038831	Ga0207686_100388312	289
1612	3300025935	Ga0207709_10009606	Ga0207709_100096064	289
1613	3300025935	Ga0207709_10072496	Ga0207709_100724962	289
1614	3300025935	Ga0207709_10125174	Ga0207709_101251742	289
1615	3300025935	Ga0207709_10129083	Ga0207709_101290833	289
1616	3300025935	Ga0207709_10131058	Ga0207709_101310582	289
1617	3300025936	Ga0207670_10028921	Ga0207670_100289214	289
1618	3300025936	Ga0207670_10228224	Ga0207670_102282242	289
1619	3300025936	Ga0207670_10443235	Ga0207670_104432351	289
1620	3300025937	Ga0207669_10003063	Ga0207669_100030632	289
1621	3300025937	Ga0207669_10027555	Ga0207669_100275553	289
1622	3300025937	Ga0207669_10099028	Ga0207669_100990282	289
1623	3300025937	Ga0207669_10106806	Ga0207669_101068062	289
1624	3300025937	Ga0207669_10427266	Ga0207669_104272661	289
1625	3300025938	Ga0207704_10015274	Ga0207704_100152743	289
1626	3300025938	Ga0207704_10028784	Ga0207704_100287842	289
1627	3300025938	Ga0207704_10193599	Ga0207704_101935992	289
1628	3300025939	Ga0207665_10067393	Ga0207665_100673932	289
1629	3300025939	Ga0207665_10140885	Ga0207665_101408851	289
1630	3300025940	Ga0207691_10000170	Ga0207691_1000017018	289
1631	3300025940	Ga0207691_10000282	Ga0207691_1000028215	289
1632	3300025940	Ga0207691_10000856	Ga0207691_1000085630	289
1633	3300025940	Ga0207691_10052038	Ga0207691_100520382	289
1634	3300025940	Ga0207691_10084049	Ga0207691_100840491	289
1635	3300025940	Ga0207691_10125725	Ga0207691_101257252	289
1636	3300025941	Ga0207711_10002653	Ga0207711_1000265314	289
1637	3300025941	Ga0207711_10004910	Ga0207711_100049109	289
1638	3300025941	Ga0207711_10010009	Ga0207711_100100095	289
1639	3300025941	Ga0207711_10013794	Ga0207711_100137942	289
1640	3300025941	Ga0207711_10024274	Ga0207711_100242743	289
1641	3300025941	Ga0207711_10070862	Ga0207711_100708622	289
1642	3300025941	Ga0207711_10160933	Ga0207711_101609332	289
1643	3300025941	Ga0207711_10536303	Ga0207711_105363031	289
1644	3300025942	Ga0207689_10000236	Ga0207689_1000023626	289
1645	3300025942	Ga0207689_10000312	Ga0207689_100003127	289
1646	3300025942	Ga0207689_10001211	Ga0207689_1000121117	289
1647	3300025942	Ga0207689_10015448	Ga0207689_100154482	289
1648	3300025942	Ga0207689_10019821	Ga0207689_100198212	289
1649	3300025942	Ga0207689_10055740	Ga0207689_100557402	289
1650	3300025942	Ga0207689_10100312	Ga0207689_101003122	289
1651	3300025942	Ga0207689_10281013	Ga0207689_102810131	289
1652	3300025944	Ga0207661_10080943	Ga0207661_100809432	289
1653	3300025945	Ga0207679_10002499	Ga0207679_100024993	289
1654	3300025945	Ga0207679_10109110	Ga0207679_101091102	289
1655	3300025945	Ga0207679_10147560	Ga0207679_101475602	289
1656	3300025945	Ga0207679_10452282	Ga0207679_104522822	289
1657	3300025949	Ga0207667_10010175	Ga0207667_100101759	289
1658	3300025949	Ga0207667_10030944	Ga0207667_100309442	289
1659	3300025949	Ga0207667_10033537	Ga0207667_100335374	289
1660	3300025949	Ga0207667_10204116	Ga0207667_102041162	289
1661	3300025960	Ga0207651_10000869	Ga0207651_100008692	289
1662	3300025960	Ga0207651_10002222	Ga0207651_100022223	289
1663	3300025960	Ga0207651_10008814	Ga0207651_100088144	289
1664	3300025960	Ga0207651_10014702	Ga0207651_100147024	289
1665	3300025960	Ga0207651_10046964	Ga0207651_100469642	289
1666	3300025960	Ga0207651_10066457	Ga0207651_100664571	289
1667	3300025960	Ga0207651_10138893	Ga0207651_101388932	289
1668	3300025960	Ga0207651_10275934	Ga0207651_102759342	289
1669	3300025961	Ga0207712_10031245	Ga0207712_100312453	289
1670	3300025961	Ga0207712_10106128	Ga0207712_101061282	289
1671	3300025961	Ga0207712_10360228	Ga0207712_103602282	289
1672	3300025972	Ga0207668_10004621	Ga0207668_1000462110	289
1673	3300025972	Ga0207668_10414882	Ga0207668_104148821	289
1674	3300025981	Ga0207640_10019136	Ga0207640_100191362	289
1675	3300025981	Ga0207640_10021573	Ga0207640_100215735	289
1676	3300025981	Ga0207640_10029733	Ga0207640_100297334	289
1677	3300025981	Ga0207640_10066939	Ga0207640_100669392	289
1678	3300025981	Ga0207640_10089717	Ga0207640_100897172	289
1679	3300025981	Ga0207640_10121052	Ga0207640_101210522	289
1680	3300025981	Ga0207640_10152594	Ga0207640_101525942	289
1681	3300025986	Ga0207658_10007331	Ga0207658_100073316	289
1682	3300025986	Ga0207658_10011185	Ga0207658_100111855	289
1683	3300025986	Ga0207658_10074125	Ga0207658_100741251	289
1684	3300026023	Ga0207677_10001284	Ga0207677_100012846	289
1685	3300026023	Ga0207677_10010855	Ga0207677_100108554	289
1686	3300026023	Ga0207677_10033610	Ga0207677_100336103	289
1687	3300026023	Ga0207677_10383130	Ga0207677_103831302	289
1688	3300026035	Ga0207703_10002153	Ga0207703_100021537	289
1689	3300026035	Ga0207703_10003470	Ga0207703_100034702	289
1690	3300026035	Ga0207703_10008436	Ga0207703_100084361	289
1691	3300026035	Ga0207703_10035081	Ga0207703_100350813	289
1692	3300026035	Ga0207703_10061817	Ga0207703_100618172	289
1693	3300026035	Ga0207703_10109327	Ga0207703_101093272	289
1694	3300026035	Ga0207703_10304215	Ga0207703_103042152	289
1695	3300026041	Ga0207639_10001910	Ga0207639_1000191012	289
1696	3300026041	Ga0207639_10015305	Ga0207639_100153054	289
1697	3300026041	Ga0207639_10017687	Ga0207639_100176874	289
1698	3300026041	Ga0207639_10088171	Ga0207639_100881712	289
1699	3300026041	Ga0207639_10107421	Ga0207639_101074212	289
1700	3300026041	Ga0207639_10120345	Ga0207639_101203453	289
1701	3300026041	Ga0207639_10237847	Ga0207639_102378472	289
1702	3300026041	Ga0207639_10273713	Ga0207639_102737132	289
1703	3300026067	Ga0207678_10001121	Ga0207678_1000112116	289
1704	3300026067	Ga0207678_10001129	Ga0207678_1000112916	289
1705	3300026067	Ga0207678_10003542	Ga0207678_100035423	289
1706	3300026067	Ga0207678_10037367	Ga0207678_100373672	289
1707	3300026067	Ga0207678_10065808	Ga0207678_100658082	289
1708	3300026067	Ga0207678_10073377	Ga0207678_100733772	289
1709	3300026067	Ga0207678_10096783	Ga0207678_100967832	289
1710	3300026067	Ga0207678_10216208	Ga0207678_102162083	289
1711	3300026067	Ga0207678_10355104	Ga0207678_103551041	289
1712	3300026075	Ga0207708_10001142	Ga0207708_100011422	289
1713	3300026075	Ga0207708_10019372	Ga0207708_100193724	289
1714	3300026078	Ga0207702_10003865	Ga0207702_100038656	289
1715	3300026078	Ga0207702_10045105	Ga0207702_100451054	289
1716	3300026078	Ga0207702_10615017	Ga0207702_106150171	289
1717	3300026088	Ga0207641_10003126	Ga0207641_1000312613	289
1718	3300026088	Ga0207641_10006448	Ga0207641_100064483	289
1719	3300026088	Ga0207641_10010891	Ga0207641_100108913	289
1720	3300026088	Ga0207641_10016233	Ga0207641_100162334	289
1721	3300026088	Ga0207641_10080341	Ga0207641_100803412	289
1722	3300026088	Ga0207641_10212306	Ga0207641_102123062	289
1723	3300026088	Ga0207641_10291022	Ga0207641_102910221	289
1724	3300026088	Ga0207641_10463402	Ga0207641_104634022	289
1725	3300026089	Ga0207648_10000203	Ga0207648_1000020347	289
1726	3300026089	Ga0207648_10000533	Ga0207648_1000053310	289
1727	3300026089	Ga0207648_10000713	Ga0207648_100007139	289
1728	3300026089	Ga0207648_10001168	Ga0207648_1000116822	289
1729	3300026089	Ga0207648_10004638	Ga0207648_100046385	289
1730	3300026089	Ga0207648_10029194	Ga0207648_100291945	289
1731	3300026089	Ga0207648_10033716	Ga0207648_100337162	289
1732	3300026089	Ga0207648_10322679	Ga0207648_103226792	289
1733	3300026095	Ga0207676_10000082	Ga0207676_1000008269	289
1734	3300026095	Ga0207676_10002279	Ga0207676_100022799	289
1735	3300026095	Ga0207676_10005010	Ga0207676_100050107	289
1736	3300026095	Ga0207676_10024798	Ga0207676_100247982	289
1737	3300026095	Ga0207676_10066547	Ga0207676_100665471	289
1738	3300026116	Ga0207674_10000182	Ga0207674_1000018223	289
1739	3300026116	Ga0207674_10001726	Ga0207674_1000172622	289
1740	3300026116	Ga0207674_10002059	Ga0207674_100020598	289
1741	3300026116	Ga0207674_10006334	Ga0207674_100063344	289
1742	3300026116	Ga0207674_10014531	Ga0207674_100145319	289
1743	3300026116	Ga0207674_10030375	Ga0207674_100303757	289
1744	3300026116	Ga0207674_10078036	Ga0207674_100780363	289
1745	3300026118	Ga0207675_100000242	Ga0207675_10000024239	289
1746	3300026118	Ga0207675_100000778	Ga0207675_10000077820	289
1747	3300026118	Ga0207675_100001929	Ga0207675_10000192915	289
1748	3300026118	Ga0207675_100014373	Ga0207675_1000143738	289
1749	3300026118	Ga0207675_100072675	Ga0207675_1000726753	289
1750	3300026118	Ga0207675_100086913	Ga0207675_1000869132	289
1751	3300026121	Ga0207683_10000005	Ga0207683_10000005154	289
1752	3300026121	Ga0207683_10007574	Ga0207683_100075744	289
1753	3300026121	Ga0207683_10038364	Ga0207683_100383644	289
1754	3300026121	Ga0207683_10291304	Ga0207683_102913042	289
1755	3300026121	Ga0207683_10390527	Ga0207683_103905272	289
1756	3300026142	Ga0207698_10005875	Ga0207698_100058752	289
1757	3300026142	Ga0207698_10012527	Ga0207698_100125272	289
1758	3300026142	Ga0207698_10017260	Ga0207698_100172604	289
1759	3300026142	Ga0207698_10025217	Ga0207698_100252173	289
1760	3300026142	Ga0207698_10028563	Ga0207698_100285632	289
1761	3300026142	Ga0207698_10106947	Ga0207698_101069471	289
1762	3300026142	Ga0207698_10242320	Ga0207698_102423202	289
1763	3300027378	Ga0209981_1002545	Ga0209981_10025453	289
1764	3300027395	Ga0209996_1003863	Ga0209996_10038631	289
1765	3300027471	Ga0209995_1009421	Ga0209995_10094212	289
1766	3300027526	Ga0209968_1001064	Ga0209968_10010643	289
1767	3300027526	Ga0209968_1004479	Ga0209968_10044791	289
1768	3300027543	Ga0209999_1011563	Ga0209999_10115632	289
1769	3300027614	Ga0209970_1008306	Ga0209970_10083062	289
1770	3300027665	Ga0209983_1004071	Ga0209983_10040711	289
1771	3300027682	Ga0209971_1002963	Ga0209971_10029633	289
1772	3300027695	Ga0209966_1000036	Ga0209966_100003647	289
1773	3300027695	Ga0209966_1002699	Ga0209966_10026993	289
1774	3300027876	Ga0209974_10000596	Ga0209974_1000059610	289
1775	3300027876	Ga0209974_10002673	Ga0209974_100026734	289
1776	3300028379	Ga0268266_10001350	Ga0268266_1000135024	289
1777	3300028379	Ga0268266_10170018	Ga0268266_101700182	289
1778	3300028379	Ga0268266_10401145	Ga0268266_104011451	289
1779	3300028380	Ga0268265_10235696	Ga0268265_102356962	289
1780	3300028381	Ga0268264_10003745	Ga0268264_100037457	289
1781	3300028381	Ga0268264_10014171	Ga0268264_100141716	289
1782	3300028381	Ga0268264_10016665	Ga0268264_100166652	289
1783	3300028381	Ga0268264_10052439	Ga0268264_100524392	289
1784	3300028381	Ga0268264_10078209	Ga0268264_100782091	289
1785	3300028381	Ga0268264_10116539	Ga0268264_101165392	289
1786	3300028381	Ga0268264_10196359	Ga0268264_101963592	289
1787	3300028381	Ga0268264_10313589	Ga0268264_103135892	289
1788	3300028381	Ga0268264_10418721	Ga0268264_104187211	289
1789	3300028786	Ga0307517_10115303	Ga0307517_101153032	289
1790	3300028794	Ga0307515_10000109	Ga0307515_1000010981	289
1791	3300028794	Ga0307515_10000183	Ga0307515_1000018351	289
1792	3300028794	Ga0307515_10000921	Ga0307515_1000092158	289
1793	3300028794	Ga0307515_10002263	Ga0307515_1000226328	289
1794	3300028794	Ga0307515_10002443	Ga0307515_1000244332	289
1795	3300028794	Ga0307515_10034432	Ga0307515_100344322	289
1796	3300028794	Ga0307515_10100022	Ga0307515_101000223	289
1797	3300028794	Ga0307515_10108335	Ga0307515_101083355	289
1798	3300030522	Ga0307512_10070252	Ga0307512_100702522	289
1799	3300031456	Ga0307513_10003399	Ga0307513_1000339920	289
1800	3300031456	Ga0307513_10004819	Ga0307513_1000481916	289
1801	3300031456	Ga0307513_10027114	Ga0307513_100271144	289
1802	3300031456	Ga0307513_10030471	Ga0307513_100304716	289
1803	3300031456	Ga0307513_10085385	Ga0307513_100853853	289
1804	3300031456	Ga0307513_10281573	Ga0307513_102815732	289
1805	3300031507	Ga0307509_10000168	Ga0307509_1000016812	289
1806	3300031507	Ga0307509_10015535	Ga0307509_100155355	289
1807	3300031507	Ga0307509_10024981	Ga0307509_100249816	289
1808	3300031507	Ga0307509_10043975	Ga0307509_100439752	289
1809	3300031507	Ga0307509_10109977	Ga0307509_101099772	289
1810	3300031507	Ga0307509_10170901	Ga0307509_101709012	289
1811	3300031548	Ga0307408_100003056	Ga0307408_1000030561	289
1812	3300031548	Ga0307408_100064782	Ga0307408_1000647822	289
1813	3300031616	Ga0307508_10000101	Ga0307508_1000010159	289
1814	3300031616	Ga0307508_10000142	Ga0307508_100001425	289
1815	3300031616	Ga0307508_10065080	Ga0307508_100650803	289
1816	3300031616	Ga0307508_10073352	Ga0307508_100733522	289
1817	3300031616	Ga0307508_10089870	Ga0307508_100898702	289
1818	3300031649	Ga0307514_10026638	Ga0307514_100266383	289
1819	3300031730	Ga0307516_10000290	Ga0307516_1000029044	289
1820	3300031730	Ga0307516_10000326	Ga0307516_1000032652	289
1821	3300031730	Ga0307516_10000394	Ga0307516_1000039442	289
1822	3300031730	Ga0307516_10204354	Ga0307516_102043542	289
1823	3300031731	Ga0307405_10022583	Ga0307405_100225832	289
1824	3300031731	Ga0307405_10032744	Ga0307405_100327442	289
1825	3300031824	Ga0307413_10027673	Ga0307413_100276734	289
1826	3300031824	Ga0307413_10047500	Ga0307413_100475002	289
1827	3300031824	Ga0307413_10133039	Ga0307413_101330391	289
1828	3300031852	Ga0307410_10011698	Ga0307410_100116984	289
1829	3300031852	Ga0307410_10028806	Ga0307410_100288062	289
1830	3300031901	Ga0307406_10092611	Ga0307406_100926111	289
1831	3300031901	Ga0307406_10095740	Ga0307406_100957402	289
1832	3300031901	Ga0307406_10128099	Ga0307406_101280993	289
1833	3300031901	Ga0307406_10205727	Ga0307406_102057272	289
1834	3300031903	Ga0307407_10122842	Ga0307407_101228422	289
1835	3300031911	Ga0307412_10016303	Ga0307412_100163034	289
1836	3300031911	Ga0307412_10035934	Ga0307412_100359343	289
1837	3300031911	Ga0307412_10343579	Ga0307412_103435792	289
1838	3300031995	Ga0307409_100000710	Ga0307409_1000007105	289
1839	3300031995	Ga0307409_100003283	Ga0307409_1000032835	289
1840	3300031995	Ga0307409_100028941	Ga0307409_1000289413	289
1841	3300032002	Ga0307416_100030070	Ga0307416_1000300704	289
1842	3300032002	Ga0307416_100031702	Ga0307416_1000317023	289
1843	3300032002	Ga0307416_100909066	Ga0307416_1009090661	289
1844	3300032004	Ga0307414_10007781	Ga0307414_100077817	289
1845	3300032004	Ga0307414_10305943	Ga0307414_103059432	289
1846	3300032005	Ga0307411_10011659	Ga0307411_100116593	289
1847	3300032005	Ga0307411_10134406	Ga0307411_101344063	289
1848	3300032126	Ga0307415_100002251	Ga0307415_1000022516	289
1849	3300032126	Ga0307415_100043774	Ga0307415_1000437741	289
1850	3300032126	Ga0307415_100454259	Ga0307415_1004542592	289
1851	3300033179	Ga0307507_10171764	Ga0307507_101717642	289
1852	3300033180	Ga0307510_10000467	Ga0307510_1000046734	289
1853	3300033180	Ga0307510_10012141	Ga0307510_100121417	289
1854	3300033180	Ga0307510_10083385	Ga0307510_100833852	289
1855	3300033180	Ga0307510_10133294	Ga0307510_101332942	289
1856	3300035092	Ga0373952_0057432	Ga0373952_0057432_50_922	289
1857	3300035112	Ga0373932_0028880	Ga0373932_0028880_146_1018	289
1858	3300035112	Ga0373932_0078609	Ga0373932_0078609_46_927	289
1859	3300035171	Ga0373946_0163398	Ga0373946_0163398_107_988	289
1860	3300035242	Ga0373962_0046770	Ga0373962_0046770_314_1186	289
1861	3300035691	Ga0373931_0003888	Ga0373931_0003888_1720_2592	289
1862	3300035691	Ga0373931_0019014	Ga0373931_0019014_2335_3207	289
1863	3300035724	Ga0373933_0051563	Ga0373933_0051563_777_1649	289
1864	3300035725	Ga0373947_0338694	Ga0373947_0338694_20_892	289
1865	3300036401	Ga0373937_0008450	Ga0373937_0008450_3040_3912	289
1866	3300036401	Ga0373937_0022975	Ga0373937_0022975_3488_4369	289
1867	3300036401	Ga0373937_0034341	Ga0373937_0034341_435_1316	289
1868	3300036401	Ga0373937_0038768	Ga0373937_0038768_1792_2664	289
1869	3300036401	Ga0373937_0335281	Ga0373937_0335281_513_1385	289
1870	3300037068	Ga0373925_0061984	Ga0373925_0061984_1857_2729	289
1871	3300037418	Ga0395900_0032705	Ga0395900_0032705_1491_2372	289
1872	3300037466	Ga0395898_0047123	Ga0395898_0047123_1480_2361	289
1873	3300037471	Ga0395905_0005912	Ga0395905_0005912_11019_11891	289
1874	3300037471	Ga0395905_0036908	Ga0395905_0036908_947_1819	289
1875	3300037471	Ga0395905_0048457	Ga0395905_0048457_1491_2372	289
1876	3300037471	Ga0395905_0208070	Ga0395905_0208070_68_949	289
1877	3300037471	Ga0395905_0616340	Ga0395905_0616340_69_941	289
1878	3300038443	Ga0395901_0001520	Ga0395901_0001520_10769_11641	289
1879	3300038443	Ga0395901_0018995	Ga0395901_0018995_4018_4899	289
1880	3300039437	Ga0436365_1766316	Ga0436365_1766316_1305_2177	289
1881	3300041404	Ga0439436_0049315	Ga0439436_0049315_224_1105	289
1882	3300041460	Ga0451802_0836090	Ga0451802_0836090_134_1018	289
1883	3300041512	Ga0451853_0311021	Ga0451853_0311021_523_1404	289
1884	3300041512	Ga0451853_2369187	Ga0451853_2369187_1209_2081	289
1885	3300041512	Ga0451853_3860439	Ga0451853_3860439_75_956	289
1886	3300041997	Ga0439431_0024248	Ga0439431_0024248_390_1262	289
1887	3300042012	Ga0439455_0035467	Ga0439455_0035467_97_969	289
1888	3300042156	Ga0439446_0056917	Ga0439446_0056917_171_1043	289
1889	3300042439	Ga0439464_0009824	Ga0439464_0009824_1422_2294	289
1890	3300042532	Ga0450893_0005060	Ga0450893_0005060_307_1188	289
1891	3300042876	Ga0451577_0003577	Ga0451577_0003577_2067_2948	289
1892	3300044673	Ga0453683_0001433	Ga0453683_0001433_16074_16955	289
1893	3300044673	Ga0453683_0019696	Ga0453683_0019696_2002_2883	289
1894	3300044694	Ga0466963_0110616	Ga0466963_0110616_221_1102	289
1895	3300044694	Ga0466963_0228178	Ga0466963_0228178_252_1169	289
1896	3300044712	Ga0453684_0003387	Ga0453684_0003387_11341_12213	289
1897	3300044712	Ga0453684_0006601	Ga0453684_0006601_17860_18741	289
1898	3300044712	Ga0453684_0077547	Ga0453684_0077547_1305_2186	289
1899	3300045051	Ga0451576_0001803	Ga0451576_0001803_3430_4311	289
1900	3300045051	Ga0451576_0007521	Ga0451576_0007521_5348_6229	289
1901	3300045051	Ga0451576_0047736	Ga0451576_0047736_1642_2523	289
1902	3300045051	Ga0451576_0097017	Ga0451576_0097017_1450_2331	289
1903	3300045051	Ga0451576_0104656	Ga0451576_0104656_2041_2922	289
1904	3300045051	Ga0451576_0279425	Ga0451576_0279425_67_948	289
1905	3300046457	Ga0495590_0009656	Ga0495590_0009656_1051_1932	289
1906	3300046459	Ga0495629_0024163	Ga0495629_0024163_3399_4271	289
1907	3300046477	Ga0495664_0182013	Ga0495664_0182013_39_923	289
1908	3300046477	Ga0495664_0182282	Ga0495664_0182282_135_1007	289
1909	3300046507	Ga0495606_0020270	Ga0495606_0020270_1416_2288	289
1910	3300046507	Ga0495606_0149356	Ga0495606_0149356_235_1107	289
1911	3300046511	Ga0495608_0057124	Ga0495608_0057124_897_1769	289
1912	3300046519	Ga0495632_0035564	Ga0495632_0035564_348_1220	289
1913	3300046519	Ga0495632_0049243	Ga0495632_0049243_666_1538	289
1914	3300046522	Ga0495643_0000398	Ga0495643_0000398_39814_40701	289
1915	3300046522	Ga0495643_0043196	Ga0495643_0043196_1207_2088	289
1916	3300046528	Ga0495642_0007036	Ga0495642_0007036_1655_2524	289
1917	3300046536	Ga0495587_0030714	Ga0495587_0030714_558_1439	289
1918	3300046539	Ga0495621_0039325	Ga0495621_0039325_381_1253	289
1919	3300046542	Ga0495597_0021536	Ga0495597_0021536_1143_2012	289
1920	3300046543	Ga0495645_0041755	Ga0495645_0041755_528_1409	289
1921	3300046543	Ga0495645_0108422	Ga0495645_0108422_1044_1916	289
1922	3300046616	Ga0495668_0102172	Ga0495668_0102172_429_1298	289
1923	3300046660	Ga0495625_0012471	Ga0495625_0012471_3612_4484	289
1924	3300046665	Ga0495661_0000049	Ga0495661_0000049_108339_109211	289
1925	3300046679	Ga0495623_0055008	Ga0495623_0055008_1608_2489	289
1926	3300046681	Ga0495647_0010177	Ga0495647_0010177_2308_3180	289
1927	3300046690	Ga0495624_0089474	Ga0495624_0089474_181_1053	289
1928	3300046692	Ga0495671_0057547	Ga0495671_0057547_306_1178	289
1929	3300047443	Ga0495687_000523	Ga0495687_000523_19814_20686	289
1930	3300047445	Ga0495677_0076653	Ga0495677_0076653_186_1058	289
1931	3300047673	Ga0495593_0026289	Ga0495593_0026289_2082_2954	289
1932	3300048090	Ga0495615_0035501	Ga0495615_0035501_161_1033	289
1933	3300048091	Ga0495626_0001091	Ga0495626_0001091_19766_20638	289
1934	3300048091	Ga0495626_0042453	Ga0495626_0042453_445_1317	289
1935	3300048091	Ga0495626_0051793	Ga0495626_0051793_213_1085	289
1936	3300048903	Ga0496100_0024511	Ga0496100_0024511_327_1199	289
1937	3300048903	Ga0496100_0359750	Ga0496100_0359750_188_1060	289
1938	3300048904	Ga0496101_0014120	Ga0496101_0014120_1477_2358	289
1939	3300048904	Ga0496101_0044500	Ga0496101_0044500_164_1036	289
1940	3300048905	Ga0496102_0001128	Ga0496102_0001128_13411_14286	289
1941	3300048905	Ga0496102_0005926	Ga0496102_0005926_3183_4064	289
1942	3300048905	Ga0496102_0052734	Ga0496102_0052734_1003_1875	289
1943	3300048906	Ga0496103_0054783	Ga0496103_0054783_1364_2302	289
1944	3300048906	Ga0496103_0157651	Ga0496103_0157651_569_1438	289
1945	3300048907	Ga0496104_0029138	Ga0496104_0029138_1193_2065	289
1946	3300048907	Ga0496104_0074360	Ga0496104_0074360_1222_2103	289
1947	3300048907	Ga0496104_0083877	Ga0496104_0083877_1201_2082	289
1948	3300048907	Ga0496104_0091405	Ga0496104_0091405_1966_2838	289
1949	3300048908	Ga0496105_0132032	Ga0496105_0132032_175_1056	289
1950	3300048909	Ga0496106_0018307	Ga0496106_0018307_2381_3262	289
1951	3300048909	Ga0496106_0261972	Ga0496106_0261972_213_1085	289
1952	3300048910	Ga0496107_0011654	Ga0496107_0011654_1389_2270	289
1953	3300048910	Ga0496107_0342501	Ga0496107_0342501_164_1036	289
1954	3300048911	Ga0496108_0226414	Ga0496108_0226414_207_1088	289
1955	3300048911	Ga0496108_0233488	Ga0496108_0233488_162_1031	289
1956	3300048911	Ga0496108_0239927	Ga0496108_0239927_187_1068	289
1957	3300048911	Ga0496108_0494065	Ga0496108_0494065_128_1000	289
1958	3300048912	Ga0496109_0002100	Ga0496109_0002100_3007_3888	289
1959	3300048912	Ga0496109_0003930	Ga0496109_0003930_6408_7280	289
1960	3300048912	Ga0496109_0033663	Ga0496109_0033663_2027_2899	289
1961	3300048912	Ga0496109_0065661	Ga0496109_0065661_1064_1945	289
1962	3300048912	Ga0496109_0078656	Ga0496109_0078656_476_1345	289
1963	3300048912	Ga0496109_0193901	Ga0496109_0193901_985_1857	289
1964	3300048913	Ga0496110_0208776	Ga0496110_0208776_128_1000	289
1965	3300048913	Ga0496110_0218439	Ga0496110_0218439_28_900	289
1966	3300048913	Ga0496110_0561157	Ga0496110_0561157_115_984	289
1967	3300048914	Ga0496111_0139367	Ga0496111_0139367_396_1277	289
1968	3300048914	Ga0496111_0408398	Ga0496111_0408398_35_907	289
1969	3300048915	Ga0496112_0070235	Ga0496112_0070235_2011_2883	289
1970	3300048915	Ga0496112_0129970	Ga0496112_0129970_175_1047	289
1971	3300048915	Ga0496112_0238066	Ga0496112_0238066_118_999	289
1972	3300048916	Ga0496113_0000915	Ga0496113_0000915_14670_15542	289
1973	3300048916	Ga0496113_0143289	Ga0496113_0143289_37_918	289
1974	3300048917	Ga0496114_0176104	Ga0496114_0176104_19_891	289
1975	3300048919	Ga0496116_0009204	Ga0496116_0009204_7144_8025	289
1976	3300048919	Ga0496116_0104700	Ga0496116_0104700_233_1114	289
1977	3300048921	Ga0496118_0006592	Ga0496118_0006592_8107_8988	289
1978	3300048921	Ga0496118_0010441	Ga0496118_0010441_960_1841	289
1979	3300048922	Ga0496119_0057133	Ga0496119_0057133_690_1571	289
1980	3300048923	Ga0496120_0005550	Ga0496120_0005550_8834_9715	289
1981	3300048924	Ga0496121_0000164	Ga0496121_0000164_30073_30954	289
1982	3300048924	Ga0496121_0030572	Ga0496121_0030572_1112_1993	289
1983	3300048925	Ga0496122_0000227	Ga0496122_0000227_52932_53813	289
1984	3300048925	Ga0496122_0000552	Ga0496122_0000552_32348_33220	289
1985	3300048925	Ga0496122_0040432	Ga0496122_0040432_780_1661	289
1986	3300048926	Ga0496123_0000265	Ga0496123_0000265_30309_31190	289
1987	3300048926	Ga0496123_0001031	Ga0496123_0001031_32355_33227	289
1988	3300048926	Ga0496123_0008404	Ga0496123_0008404_5629_6510	289
1989	3300048927	Ga0496124_0098534	Ga0496124_0098534_1316_2197	289
1990	3300048928	Ga0496125_0000241	Ga0496125_0000241_108484_109365	289
1991	3300048928	Ga0496125_0004458	Ga0496125_0004458_6424_7296	289
1992	3300048928	Ga0496125_0027021	Ga0496125_0027021_2368_3249	289
1993	3300048928	Ga0496125_0044699	Ga0496125_0044699_1807_2688	289
1994	3300048929	Ga0496126_0051602	Ga0496126_0051602_1537_2418	289
1995	3300049568	Ga0501031_0108280	Ga0501031_0108280_627_1508	289
1996	3300049569	Ga0501032_0026785	Ga0501032_0026785_1182_2051	289
1997	3300049579	Ga0501043_0000018	Ga0501043_0000018_6077_6946	289
1998	3300049580	Ga0501046_0000042	Ga0501046_0000042_6077_6946	289
1999	3300049581	Ga0501047_0000052	Ga0501047_0000052_146503_147372	289
2000	3300049582	Ga0501048_0197555	Ga0501048_0197555_394_1263	289
2001	3300049686	Ga0501257_008131	Ga0501257_008131_915_1796	289
2002	3300049744	Ga0501083_0007069	Ga0501083_0007069_4422_5303	289
2003	3300049823	Ga0501044_0238129	Ga0501044_0238129_194_1063	289
2004	3300049824	Ga0501045_0000910	Ga0501045_0000910_2275_3144	289
2005	3300050489	nmdc:mga03683_18888_c1	nmdc:mga03683_18888_c1_1104_1985	289
2006	3300050489	nmdc:mga03683_71474_c1	nmdc:mga03683_71474_c1_13_894	289
2007	3300050491	nmdc:mga00v17_73511_c1	nmdc:mga00v17_73511_c1_805_1686	289
2008	3300050491	nmdc:mga00v17_76978_c1	nmdc:mga00v17_76978_c1_833_1714	289
2009	3300050493	nmdc:mga0k408_1277_c1	nmdc:mga0k408_1277_c1_2312_3184	289
2010	3300050493	nmdc:mga0k408_151406_c1	nmdc:mga0k408_151406_c1_304_1185	289
2011	3300050493	nmdc:mga0k408_22992_c2	nmdc:mga0k408_22992_c2_1034_1906	289
2012	3300050493	nmdc:mga0k408_25162_c2	nmdc:mga0k408_25162_c2_1245_2126	289
2013	3300050493	nmdc:mga0k408_30297_c1	nmdc:mga0k408_30297_c1_807_1688	289
2014	3300050493	nmdc:mga0k408_370_c1	nmdc:mga0k408_370_c1_11535_12416	289
2015	3300050493	nmdc:mga0k408_43669_c1	nmdc:mga0k408_43669_c1_1184_2056	289
2016	3300050494	nmdc:mga06z11_1671_c1	nmdc:mga06z11_1671_c1_7002_7874	289
2017	3300050494	nmdc:mga06z11_84903_c1	nmdc:mga06z11_84903_c1_641_1522	289
2018	3300050496	nmdc:mga07m45_1142_c2	nmdc:mga07m45_1142_c2_1788_2660	289
2019	3300050496	nmdc:mga07m45_13652_c1	nmdc:mga07m45_13652_c1_1382_2266	289
2020	3300050496	nmdc:mga07m45_1728_c1	nmdc:mga07m45_1728_c1_6102_6974	289
2021	3300050496	nmdc:mga07m45_17605_c1	nmdc:mga07m45_17605_c1_58_939	289
2022	3300050496	nmdc:mga07m45_2331_c2	nmdc:mga07m45_2331_c2_6081_6953	289
2023	3300050496	nmdc:mga07m45_3061_c1	nmdc:mga07m45_3061_c1_1692_2564	289
2024	3300050496	nmdc:mga07m45_36833_c1	nmdc:mga07m45_36833_c1_1550_2422	289
2025	3300050496	nmdc:mga07m45_55492_c1	nmdc:mga07m45_55492_c1_921_1802	289
2026	3300050496	nmdc:mga07m45_71055_c1	nmdc:mga07m45_71055_c1_819_1733	289
2027	3300050496	nmdc:mga07m45_8289_c1	nmdc:mga07m45_8289_c1_4062_4934	289
2028	3300050507	nmdc:mga05p37_40908_c1	nmdc:mga05p37_40908_c1_2485_3357	289
2029	3300050507	nmdc:mga05p37_466337_c1	nmdc:mga05p37_466337_c1_488_1369	289
2030	3300050508	nmdc:mga09592_414819_c1	nmdc:mga09592_414819_c1_63_944	289
2031	3300050514	nmdc:mga08x19_932_c1	nmdc:mga08x19_932_c1_14957_15838	289
2032	3300050516	nmdc:mga0sz30_1417_c1	nmdc:mga0sz30_1417_c1_6173_7045	289
2033	3300050516	nmdc:mga0sz30_39470_c1	nmdc:mga0sz30_39470_c1_873_1754	289
2034	3300053077	Ga0495601_0004020	Ga0495601_0004020_4356_5237	289
2035	3300053077	Ga0495601_0080725	Ga0495601_0080725_421_1293	289
2036	3300053085	Ga0495619_0102460	Ga0495619_0102460_965_1846	289
2037	3300053086	Ga0500578_0228882	Ga0500578_0228882_108_980	289
2038	3300053088	Ga0500644_0037610	Ga0500644_0037610_527_1399	289
2039	3300053093	Ga0500651_0011376	Ga0500651_0011376_4471_5343	289
2040	3300053118	Ga0500594_0002490	Ga0500594_0002490_951_1823	289
2041	3300053127	Ga0500623_027553	Ga0500623_027553_1389_2261	289
2042	3300053129	Ga0500628_001726	Ga0500628_001726_2013_2885	289
2043	3300053130	Ga0500642_0005123	Ga0500642_0005123_2358_3230	289
2044	3300053131	Ga0500652_000915	Ga0500652_000915_2677_3549	289
2045	3300053134	Ga0500658_0023686	Ga0500658_0023686_1130_2002	289
2046	3300053136	Ga0500559_0000116	Ga0500559_0000116_15667_16539	289
2047	3300053138	Ga0500564_114417	Ga0500564_114417_291_1163	289
2048	3300053139	Ga0500568_0004081	Ga0500568_0004081_6468_7340	289
2049	3300053154	Ga0500619_021162	Ga0500619_021162_62_934	289
2050	3300053156	Ga0500622_0000198	Ga0500622_0000198_18088_18960	289
2051	3300053156	Ga0500622_0009462	Ga0500622_0009462_3207_4079	289
2052	3300053177	Ga0500636_0045451	Ga0500636_0045451_225_1097	289
2053	3300053724	Ga0500570_070411	Ga0500570_070411_638_1510	289
2054	3300053730	Ga0500645_017349	Ga0500645_017349_1300_2172	289
2055	3300059421	Ga0590071_036473	Ga0590071_036473_111_992	289
2056	2162886007	SwRhRL2b_contig_1457626	SwRhRL2b_0110.00002990	290
2057	3300001979	JGI24740J21852_10005722	JGI24740J21852_100057225	290
2058	3300001989	JGI24739J22299_10008813	JGI24739J22299_100088133	290
2059	3300001989	JGI24739J22299_10009661	JGI24739J22299_100096613	290
2060	3300002739	JGI25158J39367_1003518	JGI25158J39367_10035183	290
2061	3300002773	JGI25152J39213_1010628	JGI25152J39213_10106282	290
2062	3300002773	JGI25152J39213_1011607	JGI25152J39213_10116072	290
2063	3300002774	JGI25150J39212_1003160	JGI25150J39212_10031602	290
2064	3300002987	JGI25159J45721_1004447	JGI25159J45721_10044474	290
2065	3300002987	JGI25159J45721_1011000	JGI25159J45721_10110002	290
2066	3300003187	JGI25151J46595_10031058	JGI25151J46595_100310582	290
2067	3300003215	JGI25153J46596_10011695	JGI25153J46596_100116952	290
2068	3300003354	JGI25160J50197_1010751	JGI25160J50197_10107512	290
2069	3300003354	JGI25160J50197_1017638	JGI25160J50197_10176382	290
2070	3300003374	JGI25161J50226_1002157	JGI25161J50226_10021574	290
2071	3300003374	JGI25161J50226_1005118	JGI25161J50226_10051182	290
2072	3300003761	Ga0055535_1000214	Ga0055535_10002147	290
2073	3300003762	Ga0055542_1000003	Ga0055542_1000003457	290
2074	3300003771	Ga0055526_1021384	Ga0055526_10213842	290
2075	3300003771	Ga0055526_1021418	Ga0055526_10214182	290
2076	3300003773	Ga0055537_1008964	Ga0055537_10089642	290
2077	3300003775	Ga0055524_1013650	Ga0055524_10136504	290
2078	3300003775	Ga0055524_1020189	Ga0055524_10201892	290
2079	3300003781	Ga0055536_1021843	Ga0055536_10218432	290
2080	3300003781	Ga0055536_1025275	Ga0055536_10252752	290
2081	3300003781	Ga0055536_1030433	Ga0055536_10304332	290
2082	3300003784	Ga0055534_1001438	Ga0055534_100143810	290
2083	3300003784	Ga0055534_1007290	Ga0055534_10072902	290
2084	3300003790	Ga0055528_1003235	Ga0055528_10032358	290
2085	3300003791	Ga0055530_10000593	Ga0055530_100005932	290
2086	3300003792	Ga0055540_1008887	Ga0055540_10088873	290
2087	3300003792	Ga0055540_1017363	Ga0055540_10173632	290
2088	3300003794	Ga0055531_10010279	Ga0055531_100102793	290
2089	3300003794	Ga0055531_10024629	Ga0055531_100246292	290
2090	3300003794	Ga0055531_10025954	Ga0055531_100259542	290
2091	3300005262	Ga0065165_1020866	Ga0065165_10208662	290
2092	3300005288	Ga0065714_10007916	Ga0065714_100079164	290
2093	3300005289	Ga0065704_10099840	Ga0065704_100998403	290
2094	3300005366	Ga0070659_100186590	Ga0070659_1001865902	290
2095	3300005456	Ga0070678_100005698	Ga0070678_1000056984	290
2096	3300005456	Ga0070678_100401601	Ga0070678_1004016011	290
2097	3300005457	Ga0070662_100080620	Ga0070662_1000806202	290
2098	3300005539	Ga0068853_100024582	Ga0068853_1000245824	290
2099	3300005548	Ga0070665_100011693	Ga0070665_1000116934	290
2100	3300005563	Ga0068855_100062986	Ga0068855_1000629863	290
2101	3300005564	Ga0070664_100006403	Ga0070664_1000064038	290
2102	3300005616	Ga0068852_100302171	Ga0068852_1003021712	290
2103	3300005834	Ga0068851_10022408	Ga0068851_100224083	290
2104	3300005841	Ga0068863_100151243	Ga0068863_1001512432	290
2105	3300005844	Ga0068862_100027751	Ga0068862_1000277512	290
2106	3300006042	Ga0075368_10069370	Ga0075368_100693702	290
2107	3300006048	Ga0075363_100124762	Ga0075363_1001247622	290
2108	3300006177	Ga0075362_10007525	Ga0075362_100075254	290
2109	3300006177	Ga0075362_10026179	Ga0075362_100261792	290
2110	3300006186	Ga0075369_10045403	Ga0075369_100454032	290
2111	3300006195	Ga0075366_10022502	Ga0075366_100225023	290
2112	3300006846	Ga0075430_100109328	Ga0075430_1001093282	290
2113	3300006880	Ga0075429_100068148	Ga0075429_1000681482	290
2114	3300006946	Ga0079104_1000008	Ga0079104_1000008156	290
2115	3300009092	Ga0105250_10000043	Ga0105250_1000004334	290
2116	3300009093	Ga0105240_10855692	Ga0105240_108556921	290
2117	3300009148	Ga0105243_10002381	Ga0105243_100023814	290
2118	3300009148	Ga0105243_10006304	Ga0105243_100063042	290
2119	3300009148	Ga0105243_10008486	Ga0105243_100084864	290
2120	3300009551	Ga0105238_10119868	Ga0105238_101198683	290
2121	3300011119	Ga0105246_10023878	Ga0105246_100238783	290
2122	3300013102	Ga0157371_10375595	Ga0157371_103755951	290
2123	3300013104	Ga0157370_10017294	Ga0157370_100172946	290
2124	3300013105	Ga0157369_10396095	Ga0157369_103960952	290
2125	3300013307	Ga0157372_10244100	Ga0157372_102441002	290
2126	3300014497	Ga0182008_10013286	Ga0182008_100132862	290
2127	3300014497	Ga0182008_10046165	Ga0182008_100461652	290
2128	3300014497	Ga0182008_10053004	Ga0182008_100530042	290
2129	3300015683	Ga0183362_10004	Ga0183362_10004333	290
2130	3300017792	Ga0163161_10000513	Ga0163161_1000051323	290
2131	3300025208	Ga0209436_106366	Ga0209436_1063663	290
2132	3300025208	Ga0209436_111636	Ga0209436_1116361	290
2133	3300025228	Ga0209672_100798	Ga0209672_10079811	290
2134	3300025229	Ga0209147_100996	Ga0209147_10099611	290
2135	3300025242	Ga0209258_100015	Ga0209258_100015577	290
2136	3300025245	Ga0207425_1004902	Ga0207425_10049024	290
2137	3300025245	Ga0207425_1014335	Ga0207425_10143352	290
2138	3300025254	Ga0209148_1000028	Ga0209148_100002892	290
2139	3300025258	Ga0209129_1000461	Ga0209129_100046128	290
2140	3300025258	Ga0209129_1001616	Ga0209129_10016164	290
2141	3300025258	Ga0209129_1003205	Ga0209129_10032052	290
2142	3300025258	Ga0209129_1007683	Ga0209129_10076832	290
2143	3300025258	Ga0209129_1010272	Ga0209129_10102722	290
2144	3300025263	Ga0209565_1000972	Ga0209565_10009727	290
2145	3300025273	Ga0209673_1000293	Ga0209673_100029386	290
2146	3300025273	Ga0209673_1000400	Ga0209673_100040011	290
2147	3300025273	Ga0209673_1010108	Ga0209673_10101083	290
2148	3300025284	Ga0209130_1000485	Ga0209130_100048529	290
2149	3300025284	Ga0209130_1000542	Ga0209130_100054227	290
2150	3300025284	Ga0209130_1005589	Ga0209130_10055893	290
2151	3300025291	Ga0209675_1000369	Ga0209675_10003699	290
2152	3300025291	Ga0209675_1000544	Ga0209675_100054424	290
2153	3300025291	Ga0209675_1014058	Ga0209675_10140582	290
2154	3300025292	Ga0209676_1000241	Ga0209676_10002419	290
2155	3300025292	Ga0209676_1000575	Ga0209676_100057529	290
2156	3300025292	Ga0209676_1008639	Ga0209676_10086393	290
2157	3300025292	Ga0209676_1023601	Ga0209676_10236012	290
2158	3300025294	Ga0209025_1000305	Ga0209025_100030580	290
2159	3300025294	Ga0209025_1000929	Ga0209025_10009292	290
2160	3300025294	Ga0209025_1001135	Ga0209025_10011359	290
2161	3300025294	Ga0209025_1017274	Ga0209025_10172742	290
2162	3300025295	Ga0209564_1000110	Ga0209564_100011090	290
2163	3300025295	Ga0209564_1000123	Ga0209564_100012360	290
2164	3300025297	Ga0209758_1000039	Ga0209758_100003990	290
2165	3300025297	Ga0209758_1005047	Ga0209758_10050478	290
2166	3300025298	Ga0209050_1000015	Ga0209050_1000015626	290
2167	3300025298	Ga0209050_1001757	Ga0209050_100175714	290
2168	3300025299	Ga0209256_1000074	Ga0209256_100007490	290
2169	3300025299	Ga0209256_1000082	Ga0209256_100008278	290
2170	3300025302	Ga0207426_1000112	Ga0207426_1000112123	290
2171	3300025302	Ga0207426_1000121	Ga0207426_100012189	290
2172	3300025303	Ga0209051_1000081	Ga0209051_100008196	290
2173	3300025303	Ga0209051_1000120	Ga0209051_100012067	290
2174	3300025303	Ga0209051_1001260	Ga0209051_100126014	290
2175	3300025303	Ga0209051_1007758	Ga0209051_10077586	290
2176	3300025303	Ga0209051_1037105	Ga0209051_10371052	290
2177	3300025304	Ga0209257_1000026	Ga0209257_100002651	290
2178	3300025304	Ga0209257_1001188	Ga0209257_100118829	290
2179	3300025304	Ga0209257_1001634	Ga0209257_10016348	290
2180	3300025304	Ga0209257_1009055	Ga0209257_10090552	290
2181	3300025321	Ga0207656_10001421	Ga0207656_100014215	290
2182	3300025711	Ga0207696_1000424	Ga0207696_100042427	290
2183	3300025728	Ga0207655_1003466	Ga0207655_10034668	290
2184	3300025904	Ga0207647_10035525	Ga0207647_100355252	290
2185	3300025914	Ga0207671_10044512	Ga0207671_100445123	290
2186	3300025920	Ga0207649_10236957	Ga0207649_102369572	290
2187	3300025933	Ga0207706_10002999	Ga0207706_100029997	290
2188	3300025935	Ga0207709_10000229	Ga0207709_100002299	290
2189	3300025935	Ga0207709_10001651	Ga0207709_100016514	290
2190	3300025935	Ga0207709_10002630	Ga0207709_100026304	290
2191	3300025937	Ga0207669_10237201	Ga0207669_102372011	290
2192	3300025940	Ga0207691_10083683	Ga0207691_100836834	290
2193	3300025945	Ga0207679_10070903	Ga0207679_100709032	290
2194	3300025961	Ga0207712_10503651	Ga0207712_105036511	290
2195	3300025981	Ga0207640_10165973	Ga0207640_101659732	290
2196	3300026089	Ga0207648_10141868	Ga0207648_101418682	290
2197	3300026089	Ga0207648_10384744	Ga0207648_103847442	290
2198	3300026121	Ga0207683_10059205	Ga0207683_100592054	290
2199	3300026121	Ga0207683_10296991	Ga0207683_102969911	290
2200	3300026142	Ga0207698_10088448	Ga0207698_100884482	290
2201	3300027111	Ga0209281_1000029	Ga0209281_1000029241	290
2202	3300028379	Ga0268266_10026618	Ga0268266_100266184	290
2203	3300028380	Ga0268265_10008692	Ga0268265_100086922	290
2204	3300028794	Ga0307515_10000572	Ga0307515_1000057249	290
2205	3300028794	Ga0307515_10000578	Ga0307515_1000057833	290
2206	3300028794	Ga0307515_10238320	Ga0307515_102383202	290
2207	3300030522	Ga0307512_10092017	Ga0307512_100920172	290
2208	3300030731	Ga0316177_1159281	Ga0316177_11592812	290
2209	3300030732	Ga0316176_1050129	Ga0316176_10501292	290
2210	3300030733	Ga0314311_1244504	Ga0314311_12445042	290
2211	3300030734	Ga0316179_1024083	Ga0316179_10240832	290
2212	3300030735	Ga0316178_1110841	Ga0316178_11108412	290
2213	3300030742	Ga0316183_1124796	Ga0316183_11247962	290
2214	3300030744	Ga0316181_1152686	Ga0316181_11526862	290
2215	3300030745	Ga0316182_1316452	Ga0316182_13164523	290
2216	3300031251	Ga0265327_10000959	Ga0265327_1000095914	290
2217	3300031456	Ga0307513_10012002	Ga0307513_100120027	290
2218	3300031456	Ga0307513_10074691	Ga0307513_100746912	290
2219	3300031456	Ga0307513_10175892	Ga0307513_101758922	290
2220	3300031548	Ga0307408_100209440	Ga0307408_1002094402	290
2221	3300031649	Ga0307514_10001068	Ga0307514_1000106820	290
2222	3300031649	Ga0307514_10001927	Ga0307514_100019277	290
2223	3300031731	Ga0307405_10082631	Ga0307405_100826312	290
2224	3300031731	Ga0307405_10173191	Ga0307405_101731911	290
2225	3300031731	Ga0307405_10281374	Ga0307405_102813742	290
2226	3300031911	Ga0307412_10017861	Ga0307412_100178614	290
2227	3300032004	Ga0307414_10175371	Ga0307414_101753712	290
2228	3300032005	Ga0307411_10006958	Ga0307411_100069584	290
2229	3300032005	Ga0307411_10025771	Ga0307411_100257714	290
2230	3300041411	Ga0439466_0021926	Ga0439466_0021926_102_974	290
2231	3300042115	Ga0450911_000710	Ga0450911_000710_7912_8784	290
2232	3300042531	Ga0450918_002096	Ga0450918_002096_1053_1925	290
2233	3300046475	Ga0495639_0062201	Ga0495639_0062201_453_1325	290
2234	3300046513	Ga0495616_0002269	Ga0495616_0002269_7457_8329	290
2235	3300046515	Ga0495620_0009389	Ga0495620_0009389_1825_2697	290
2236	3300046518	Ga0495631_0000453	Ga0495631_0000453_7649_8521	290
2237	3300046520	Ga0495637_0004044	Ga0495637_0004044_4254_5126	290
2238	3300046520	Ga0495637_0030466	Ga0495637_0030466_1032_1904	290
2239	3300046530	Ga0495654_0001427	Ga0495654_0001427_2528_3400	290
2240	3300046539	Ga0495621_0025906	Ga0495621_0025906_275_1147	290
2241	3300046615	Ga0495656_0053727	Ga0495656_0053727_578_1450	290
2242	3300046660	Ga0495625_0000114	Ga0495625_0000114_9281_10153	290
2243	3300046660	Ga0495625_0030369	Ga0495625_0030369_1768_2640	290
2244	3300046664	Ga0495659_0074958	Ga0495659_0074958_80_952	290
2245	3300046691	Ga0495670_0033970	Ga0495670_0033970_239_1111	290
2246	3300046691	Ga0495670_0103383	Ga0495670_0103383_124_996	290
2247	3300046692	Ga0495671_0016186	Ga0495671_0016186_991_1863	290
2248	3300047321	Ga0495676_0028658	Ga0495676_0028658_3860_4732	290
2249	3300047673	Ga0495593_0049990	Ga0495593_0049990_187_1059	290
2250	3300048089	Ga0495614_0034410	Ga0495614_0034410_356_1228	290
2251	3300048904	Ga0496101_0030475	Ga0496101_0030475_128_1000	290
2252	3300048905	Ga0496102_0002766	Ga0496102_0002766_8899_9771	290
2253	3300048906	Ga0496103_0018781	Ga0496103_0018781_2629_3501	290
2254	3300048908	Ga0496105_0011471	Ga0496105_0011471_5121_5993	290
2255	3300048913	Ga0496110_0134763	Ga0496110_0134763_654_1526	290
2256	3300048914	Ga0496111_0070509	Ga0496111_0070509_1229_2101	290
2257	3300048916	Ga0496113_0092980	Ga0496113_0092980_300_1172	290
2258	3300048920	Ga0496117_0102380	Ga0496117_0102380_132_1004	290
2259	3300048921	Ga0496118_0081522	Ga0496118_0081522_324_1196	290
2260	3300048924	Ga0496121_0032725	Ga0496121_0032725_1947_2819	290
2261	3300048925	Ga0496122_0000618	Ga0496122_0000618_9144_10016	290
2262	3300048926	Ga0496123_0002222	Ga0496123_0002222_9054_9926	290
2263	3300048927	Ga0496124_0074523	Ga0496124_0074523_1328_2200	290
2264	3300048928	Ga0496125_0023660	Ga0496125_0023660_3694_4566	290
2265	3300048928	Ga0496125_0181346	Ga0496125_0181346_182_1108	290
2266	3300049663	Ga0501223_022356	Ga0501223_022356_231_1103	290
2267	3300049705	Ga0501225_0009217	Ga0501225_0009217_983_1855	290
2268	3300049759	Ga0501262_001489	Ga0501262_001489_729_1601	290
2269	3300050489	nmdc:mga03683_456_c1	nmdc:mga03683_456_c1_8557_9429	290
2270	3300050491	nmdc:mga00v17_44662_c1	nmdc:mga00v17_44662_c1_229_1101	290
2271	3300050492	nmdc:mga0yw44_71457_c1	nmdc:mga0yw44_71457_c1_620_1492	290
2272	3300050493	nmdc:mga0k408_73806_c1	nmdc:mga0k408_73806_c1_1102_1974	290
2273	3300050494	nmdc:mga06z11_135757_c1	nmdc:mga06z11_135757_c1_347_1219	290
2274	3300050496	nmdc:mga07m45_16817_c1	nmdc:mga07m45_16817_c1_2444_3316	290
2275	3300050508	nmdc:mga09592_5954_c1	nmdc:mga09592_5954_c1_1148_2020	290
2276	3300050509	nmdc:mga0qj67_109427_c1	nmdc:mga0qj67_109427_c1_325_1197	290
2277	3300053079	Ga0500610_0131745	Ga0500610_0131745_35_907	290
2278	3300053087	Ga0500643_013146	Ga0500643_013146_959_1831	290
2279	3300053090	Ga0500646_0058632	Ga0500646_0058632_238_1110	290
2280	3300053093	Ga0500651_0000287	Ga0500651_0000287_8894_9766	290
2281	3300053108	Ga0500562_003454	Ga0500562_003454_891_1763	290
2282	3300053110	Ga0500571_019234	Ga0500571_019234_1049_1921	290
2283	3300053121	Ga0500607_001396	Ga0500607_001396_12070_12942	290
2284	3300053122	Ga0500608_078936	Ga0500608_078936_290_1162	290
2285	3300053125	Ga0500618_027279	Ga0500618_027279_11_883	290
2286	3300053134	Ga0500658_0000201	Ga0500658_0000201_17159_18031	290
2287	3300053134	Ga0500658_0001964	Ga0500658_0001964_5996_6868	290
2288	3300053136	Ga0500559_0000945	Ga0500559_0000945_4133_5005	290
2289	3300053148	Ga0500590_011775	Ga0500590_011775_483_1358	290

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02653

BPD_transp_2

Branched-chain amino acid transport system / permease component

57

326

0.83 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
4dbl-assembly1.cif.gz_B	crystal structure of e159q mutant of btucdf	0.5634	9	280
4g1u-assembly1.cif.gz_B	x-ray structure of the bacterial heme transporter hmuuv from yersinia pestis	0.5466	9	280
7kyo-assembly1.cif.gz_C-2	psabc from streptococcus pneumoniae in complex with fab	0.5349	12	288
7lb8-assembly1.cif.gz_B	structure of a ferrichrome importer fhucdb from e. coli	0.5336	6	281
7kyo-assembly1.cif.gz_C-2	psabc from streptococcus pneumoniae in complex with fab	0.525	12	288

ID	Description	Score	Start	End	Superfamily
af_P0AEX7_11_292_1.10.3470.10	Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC	0.911	10	278	1.10.3470.10
af_P0AEX7_11_292_1.10.3470.10	Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC	0.868	10	278	1.10.3470.10
af_Q58665_14_295_1.10.3470.10	Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC	0.8223	11	279	1.10.3470.10
af_P77672_36_301_1.10.3470.10	Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC	0.8003	13	278	1.10.3470.10
af_P0AGI1_45_314_1.10.3470.10	Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC	0.7881	11	280	1.10.3470.10

ID	Description	Score	Start	End	GO Terms
AF-A0A7Y7I630-F1-model_v4	Branched-chain amino acid transport system permease protein	0.9972	1	290	GO:0005886 GO:0006865 GO:0022857
AF-A0A6I6GZY3-F1-model_v4	Branched-chain amino acid ABC transporter permease	0.997	1	290	GO:0005886 GO:0006865 GO:0022857
AF-A0A257LTC6-F1-model_v4	Branched-chain amino acid ABC transporter permease	0.9969	1	289	GO:0005886 GO:0006865 GO:0022857
AF-A0A0Q7LKM5-F1-model_v4	ABC transporter permease	0.9963	1	290	GO:0005886 GO:0006865 GO:0022857
AF-A0A2W5R5N7-F1-model_v4	Branched-chain amino acid ABC transporter permease	0.9962	2	290	GO:0005886 GO:0006865 GO:0022857

Feature Viewer

pLDDT	pTM	Quality
88.73	0.87	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F496645

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF02653

BPD_transp_2

Branched-chain amino acid transport system / permease component

57

326

0.83

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map