F496598
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 2247 | 751 | 4492 | 66 |
Family's Representative Sequence
| Representative Sequence | 3300044693|Ga0466961_0728462|Ga0466961_0728462_244_471 |
| Length | 75 |
| Sequence | VRIEKPGVVVAQGTVKWFNAEKGYGFIAVDGGSDVFVHYSAIQMDGYKSLEEGQRVEFEVTQGQKGPQADAVRAV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 2 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 3 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 4 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 5 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 6 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 7 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 8 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 9 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 10 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 11 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 12 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 13 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 14 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 15 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 16 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 17 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 18 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 19 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 20 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 21 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 22 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 28 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 32 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 45 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 62 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 63 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 69 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 70 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 72 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 80 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 82 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 83 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 84 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 86 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 87 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 88 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 89 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 90 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 91 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 92 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 93 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 94 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 95 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 96 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 97 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 98 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 99 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 100 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 102 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 103 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 104 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 105 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 106 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 108 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 109 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 110 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 111 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 112 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 113 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 114 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 116 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 117 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 118 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 119 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 135 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300012473 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 | Metagenome | Rhizosphere |
| 138 | 3300012477 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 | Metagenome | Rhizosphere |
| 139 | 3300012480 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 | Metagenome | Rhizosphere |
| 140 | 3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Metagenome | Rhizosphere |
| 141 | 3300012485 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 | Metagenome | Rhizosphere |
| 142 | 3300012491 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 | Metagenome | Rhizosphere |
| 143 | 3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Metagenome | Rhizosphere |
| 144 | 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Metagenome | Rhizosphere |
| 145 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 146 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 147 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 148 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 149 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 150 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 151 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 152 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 153 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 154 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 155 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 156 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 168 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 172 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 173 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 174 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 175 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 176 | 3300019183 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA1 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 177 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 178 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 179 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 180 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 181 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 182 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 183 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 184 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 185 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 186 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 187 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 188 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 189 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 190 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 191 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 192 | 3300023552 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 193 | 3300023680 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 194 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 195 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 196 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 197 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 198 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 199 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 200 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 201 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 202 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 203 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 204 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 273 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 277 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 278 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 279 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 280 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 281 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 282 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 283 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 284 | 3300029282 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.stcc.R1 | Metatranscriptome | Rhizosphere |
| 285 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 286 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 287 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 288 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 289 | 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 290 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 291 | 3300030882 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 292 | 3300030889 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 293 | 3300030963 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 294 | 3300031010 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 295 | 3300031011 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 296 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 297 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 298 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 299 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 300 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 301 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 302 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 303 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 304 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 305 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 306 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 307 | 3300031592 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 308 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 309 | 3300031615 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 310 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 311 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 312 | 3300031667 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 313 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 314 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 315 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 316 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 317 | 3300031810 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Unclassified |
| 318 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 319 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 320 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 321 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 322 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 323 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 324 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 325 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 326 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 327 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 328 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 329 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 330 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 331 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 332 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 333 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 334 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 335 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 336 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 337 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 338 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 339 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 340 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 341 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 342 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 343 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 344 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 345 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 346 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 347 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 348 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 349 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 350 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 351 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 352 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 353 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 354 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 355 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 356 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 357 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 358 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 359 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 360 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 361 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 362 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 363 | 3300036242 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 364 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 365 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 366 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 367 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 368 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 369 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 370 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 371 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 372 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 373 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 374 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 375 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 376 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 377 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 378 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 379 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 380 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 381 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 382 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 383 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 384 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 385 | 3300041461 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT | Metatranscriptome | Rhizoplane |
| 386 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 387 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 388 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 389 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 390 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 391 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 392 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 393 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 394 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 395 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 396 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 397 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 398 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 399 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 400 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 401 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 402 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 403 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 404 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 405 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 406 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 407 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 408 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 409 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 410 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 411 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 412 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 413 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 414 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 415 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 416 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 417 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 418 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 419 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 420 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 421 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 422 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 423 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 424 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 425 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 426 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 427 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 428 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 429 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 430 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 431 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 432 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 433 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 434 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 435 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 436 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 437 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 438 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 439 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 440 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 489 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 491 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 492 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 493 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 494 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 495 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 498 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 499 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 500 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 501 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 502 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 503 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 504 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 505 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 506 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 507 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 508 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 509 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 510 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 511 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 512 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 513 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 514 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 515 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 516 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 517 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 518 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 519 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 520 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 521 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 522 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 523 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 524 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 525 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 526 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 527 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 528 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 529 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 530 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 531 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 532 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 533 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 534 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 535 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 536 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 537 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 538 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 539 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 540 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 541 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 542 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 543 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 544 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 545 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 546 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 547 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 548 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 549 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 550 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 551 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 552 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 553 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 554 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 555 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 556 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 557 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 558 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 559 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 560 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 561 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 562 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 563 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 564 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 565 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 566 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 567 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 568 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 569 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 570 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 571 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 572 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 573 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 574 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 575 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 576 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 577 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 578 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 579 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 580 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 581 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 582 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 583 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 584 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 585 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 586 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 587 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 588 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 589 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 590 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 591 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 592 | 3300053101 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere | Metagenome | Endosphere |
| 593 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 594 | 3300053106 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere | Metagenome | Endosphere |
| 595 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 596 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 597 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 598 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 599 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 600 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 601 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 602 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 603 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 604 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 605 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 606 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 607 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 608 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 609 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 610 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 611 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 612 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 613 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 614 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 615 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 616 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 617 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 618 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 619 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 620 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 621 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 622 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 623 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 624 | 2527291627 | Frankia casuarinae Thr | Isolate | Nodule |
| 625 | 2527291629 | Frankia sp. BMG5.23 | Isolate | Nodule |
| 626 | 2537561592 | Arthrobacter crystallopoietes BAB-32 | Isolate | Rhizosphere |
| 627 | 2546825537 | Frankia sp. CcI6 | Isolate | Rhizoplane |
| 628 | 2547132111 | Streptomyces sp. TOR3209 | Isolate | Rhizosphere |
| 629 | 2554235005 | Streptomyces violaceusniger SPC6 | Isolate | Rhizosphere |
| 630 | 2576861822 | Frankia sp. CeD | Isolate | Nodule |
| 631 | 2579778521 | Frankia torreyi CpI1-S | Isolate | Unclassified |
| 632 | 2582581312 | Streptomyces atratus OK008 | Isolate | Rhizosphere |
| 633 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 634 | 2599185353 | Staphylococcus sp. NFPP34 | Isolate | Rhizoplane |
| 635 | 2616644941 | Streptomyces atratus OK807 | Isolate | Rhizosphere |
| 636 | 2619618881 | Frankia sp. ACN1ag | Isolate | Unclassified |
| 637 | 2619619003 | Frankia sp. CpI1-P | Isolate | Nodule |
| 638 | 2626541554 | Frankia sp. AvcI.1 | Isolate | Nodule |
| 639 | 2643221548 | Streptomyces sp. Root55 | Isolate | Unclassified |
| 640 | 2643221578 | Streptomyces sp. Root63 | Isolate | Unclassified |
| 641 | 2643221587 | Streptomyces sp. Root66D1 | Isolate | Unclassified |
| 642 | 2643221601 | Kitasatospora sp. Root187 | Isolate | Unclassified |
| 643 | 2643221631 | Kitasatospora sp. Root107 | Isolate | Unclassified |
| 644 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 645 | 2643221670 | Streptomyces sp. Root431 | Isolate | Unclassified |
| 646 | 2643221673 | Streptomyces sp. Root1295 | Isolate | Unclassified |
| 647 | 2643221677 | Streptomyces sp. Root1304 | Isolate | Unclassified |
| 648 | 2643221682 | Streptomyces sp. Root1319 | Isolate | Unclassified |
| 649 | 2675903060 | Nonomuraea wenchangensis CGMCC 4.5598 | Isolate | Rhizosphere |
| 650 | 2684623035 | Frankia sp. NRRL B-16219 | Isolate | Rhizosphere |
| 651 | 2684623036 | Frankia sp. CgIM4 | Isolate | Nodule |
| 652 | 2710264753 | Frankia sp. KB5 | Isolate | Nodule |
| 653 | 2767802112 | Streptomyces avicenniae NRRL B-24776 | Isolate | Rhizosphere |
| 654 | 2773857924 | Frankia sp. CgIS1 | Isolate | Nodule |
| 655 | 2784132148 | Streptomyces sp. E5N91 SAI-083 | Isolate | Unclassified |
| 656 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 657 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 658 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 659 | 2788500588 | Lysinibacillus sp. YS11 | Isolate | Unclassified |
| 660 | 2791355406 | Streptomyces rhizosphaericus NRRL B-24304 | Isolate | Unclassified |
| 661 | 2802429296 | Streptomyces sampsonii KJ40 | Isolate | Rhizosphere |
| 662 | 2808606448 | Streptomyces sp. 193411 | Isolate | Unclassified |
| 663 | 2808606982 | Streptomyces sp. SLBN-118 | Isolate | Unclassified |
| 664 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 665 | 2811994917 | Streptomyces sp. SLBN-134 | Isolate | Unclassified |
| 666 | 2818991451 | Lysinibacillus fusiformis 3193 | Isolate | Unclassified |
| 667 | 2818991463 | Streptomyces argenteolus 3259 | Isolate | Rhizosphere |
| 668 | 2818991472 | Kitasatospora viridis DSM 44826 | Isolate | Rhizosphere |
| 669 | 2844849076 | Arthrobacter cupressi DSM 24664 | Isolate | Rhizosphere |
| 670 | 2847085930 | Erwinia persicina B64 | Isolate | Bulb |
| 671 | 2852635781 | Streptomyces sp. AK010 | Isolate | Rhizosphere |
| 672 | 2856741275 | Microbispora triticiradicis NEAU-HRDPA2-9 | Isolate | Unclassified |
| 673 | 2862178590 | Streptomyces sp. SDr-06 | Isolate | Rhizosphere |
| 674 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 675 | 2862290372 | Streptomyces triticagri NEAU-YY421 | Isolate | Rhizosphere |
| 676 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 677 | 2862507626 | Streptomyces sp. NWU339 | Isolate | Unclassified |
| 678 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 679 | 2862705112 | Streptomyces triticirhizae NEAU-YY642 | Isolate | Rhizosphere |
| 680 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 681 | 2867346516 | Streptomyces radicis AZ1-7 | Isolate | Unclassified |
| 682 | 2867369537 | Streptomyces sp. Z26 | Isolate | Unclassified |
| 683 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 684 | 2867475112 | Streptomyces sp. TM32 | Isolate | Unclassified |
| 685 | 2873151551 | Streptomyces silaceus ACCC40021 | Isolate | Rhizosphere |
| 686 | 2873314349 | Sphaerisporangium siamense DSM 45784 | Isolate | Rhizosphere |
| 687 | 2875391855 | Streptomyces cavourensis 1AS2a | Isolate | Rhizosphere |
| 688 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 689 | 2884693830 | Nonomuraea phyllanthi WYY166 | Isolate | Unclassified |
| 690 | 2891395885 | Microbispora catharanthi CR1-09 | Isolate | Unclassified |
| 691 | 2891554331 | Microbispora sp. CL1-1 | Isolate | Unclassified |
| 692 | 2891562705 | Microbispora tritici MT50 | Isolate | Unclassified |
| 693 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 694 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 695 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 696 | 2904497146 | Arthrobacter sp. 1276 | Isolate | Rhizosphere |
| 697 | 2904606771 | Lysinibacillus macroides 1284 | Isolate | Rhizosphere |
| 698 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 699 | 2912757875 | Streptomyces sp. S4.7 | Isolate | Rhizosphere |
| 700 | 2918501144 | Streptomyces sp. PvR006 | Isolate | Rhizosphere |
| 701 | 2919034639 | Paenarthrobacter nitroguajacolicus 247 | Isolate | Rhizosphere |
| 702 | 2935390628 | Streptomyces sp. PvR034 | Isolate | Rhizosphere |
| 703 | 2946045630 | Streptomyces sp. W4I9-2 | Isolate | Rhizosphere |
| 704 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 705 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 706 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 707 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 708 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 709 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 710 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 711 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 712 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 713 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 714 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 715 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 716 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 717 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 718 | 2966598605 | Kitasatospora papulosa SLBN-177 | Isolate | Rhizosphere |
| 719 | 2990044586 | Streptomyces sedi JCM 16909 | Isolate | Unclassified |
| 720 | 2990059506 | Streptomyces sp. CAP261 | Isolate | Unclassified |
| 721 | 2995463766 | Streptacidiphilus fuscans NEAU-YB345 | Isolate | Unclassified |
| 722 | 2997451912 | Streptomyces piniterrae jys28 | Isolate | Rhizosphere |
| 723 | 2997600082 | Streptomyces coffeae CA1R205 | Isolate | Unclassified |
| 724 | 3002998708 | Actinomadura barringtoniae GKU 128 | Isolate | Unclassified |
| 725 | 3006321560 | Actinacidiphila epipremni PRB2-1 | Isolate | Unclassified |
| 726 | 3006393351 | Streptomyces sp. SID4985 | Isolate | Unclassified |
| 727 | 3006425503 | Streptomyces zingiberis PLAI1-29 | Isolate | Unclassified |
| 728 | 3006486233 | Streptomyces sp. BR123 | Isolate | Rhizosphere |
| 729 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 730 | 637000116 | Frankia casuarinae CcI3 | Isolate | Nodule |
| 731 | 8007375930 | Clostridium sp. YIM B02565 | Isolate | Unclassified |
| 732 | 8008485437 | Streptomyces mimosae 3MP-10 | Isolate | Unclassified |
| 733 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 734 | 8008574985 | Streptomyces sp. Jing01 | Isolate | Rhizosphere |
| 735 | 8023623736 | Streptomyces sp. 111WW2 | Isolate | Unclassified |
| 736 | 8025413630 | Streptomyces sp. CAI-17 | Isolate | Rhizosphere |
| 737 | 8025478263 | Streptomyces telluris AA8 | Isolate | Rhizosphere |
| 738 | 8025524527 | Streptomyces sp. 3MP-14 | Isolate | Unclassified |
| 739 | 8025530807 | Streptomyces sp. 4R-3d | Isolate | Unclassified |
| 740 | 8033684223 | Streptomyces phytophilus PIP175 | Isolate | Unclassified |
| 741 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 742 | 8048127548 | Streptomyces samsunensis DSM 42010 | Isolate | Rhizosphere |
| 743 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 744 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 745 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
| 746 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 747 | 8054160619 | Streptomyces rhizoryzae RS10V-4 | Isolate | Rhizosphere |
| 748 | 8055066027 | Sphaerisporangium corydalis NEAU-YHS15 | Isolate | Unclassified |
| 749 | 8055172936 | Sphaerisporangium perillae NEAU-ZS1 | Isolate | Unclassified |
| 750 | 8056447290 | Streptomyces huiliensis SCA2-4 | Isolate | Rhizosphere |
| 751 | 8056667051 | Streptomyces sichuanensis SCA3-4 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.3 |
| Metatranscriptomes | 3.96 |
| Isolates | 5.74 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0.04 |
| Endosphere | 2.05 |
| Nodule | 0.58 |
| Rhizoplane | 3.78 |
| Rhizosphere | 88.07 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.13 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0466961_0728462 | 3300044693 | Bacteria | 593 |
| 2 | JGI24741J21665_1068614 | 3300001915 | Bacteria | 525 |
| 3 | JGI24752J21851_1053559 | 3300001976 | Bacteria | 550 |
| 4 | JGI24747J21853_1048214 | 3300001978 | Bacteria | 515 |
| 5 | JGI24740J21852_10144583 | 3300001979 | Bacteria | 591 |
| 6 | JGI24743J22301_10063866 | 3300001991 | Bacteria | 761 |
| 7 | JGI24745J21846_1054131 | 3300002073 | Bacteria | 512 |
| 8 | JGI24033J26618_1075896 | 3300002155 | Bacteria | 510 |
| 9 | JGI24751J29686_10011389 | 3300002459 | Bacteria | 1834 |
| 10 | JGI25152J39213_1000431 | 3300002773 | Bacteria | 25240 |
| 11 | Ga0006759J45824_1010939 | 3300003163 | Bacteria | 545 |
| 12 | JGI25151J46595_10048603 | 3300003187 | Bacteria | 1464 |
| 13 | rootH1_10054865 | 3300003316 | Bacteria | 1982 |
| 14 | rootL2_10002354 | 3300003322 | Bacteria | 3195 |
| 15 | rootH1_10077154 | 3300003323 | Bacteria | 1378 |
| 16 | Ga0007417J51691_1031744 | 3300003544 | Bacteria | 541 |
| 17 | Ga0007416J51690_1039243 | 3300003577 | Bacteria | 538 |
| 18 | Ga0006562J51391_1013573 | 3300003578 | Bacteria | 2369 |
| 19 | Ga0007429J51699_1029739 | 3300003579 | Bacteria | 514 |
| 20 | JGI25404J52841_10004078 | 3300003659 | Bacteria | 2936 |
| 21 | Ga0058859_11593662 | 3300004798 | Bacteria | 695 |
| 22 | Ga0070658_10080675 | 3300005327 | Bacteria | 2672 |
| 23 | Ga0070658_10109176 | 3300005327 | Bacteria | 2291 |
| 24 | Ga0070658_10126206 | 3300005327 | Bacteria | 2130 |
| 25 | Ga0070658_10384459 | 3300005327 | Bacteria | 1204 |
| 26 | Ga0070658_10467407 | 3300005327 | Bacteria | 1088 |
| 27 | Ga0070658_10489431 | 3300005327 | Bacteria | 1062 |
| 28 | Ga0070658_10573142 | 3300005327 | Bacteria | 977 |
| 29 | Ga0070658_11618769 | 3300005327 | Bacteria | 561 |
| 30 | Ga0070676_10132525 | 3300005328 | Bacteria | 1578 |
| 31 | Ga0070676_10199801 | 3300005328 | Bacteria | 1310 |
| 32 | Ga0070683_100086548 | 3300005329 | Bacteria | 2938 |
| 33 | Ga0070683_100236714 | 3300005329 | Bacteria | 1736 |
| 34 | Ga0070683_100242651 | 3300005329 | Bacteria | 1714 |
| 35 | Ga0070683_100319737 | 3300005329 | Bacteria | 1477 |
| 36 | Ga0070683_100649829 | 3300005329 | Bacteria | 1010 |
| 37 | Ga0070683_100769179 | 3300005329 | Bacteria | 923 |
| 38 | Ga0070683_100933785 | 3300005329 | Bacteria | 832 |
| 39 | Ga0070683_100993534 | 3300005329 | Bacteria | 806 |
| 40 | Ga0070690_100074092 | 3300005330 | Bacteria | 2216 |
| 41 | Ga0070690_100728694 | 3300005330 | Bacteria | 764 |
| 42 | Ga0070670_100116948 | 3300005331 | Bacteria | 2299 |
| 43 | Ga0070670_100304737 | 3300005331 | Bacteria | 1394 |
| 44 | Ga0070670_100714487 | 3300005331 | Bacteria | 902 |
| 45 | Ga0068869_100102951 | 3300005334 | Bacteria | 2162 |
| 46 | Ga0068869_100415167 | 3300005334 | Bacteria | 1109 |
| 47 | Ga0070666_10354187 | 3300005335 | Bacteria | 1051 |
| 48 | Ga0070666_10956143 | 3300005335 | Bacteria | 634 |
| 49 | Ga0070680_100046686 | 3300005336 | Bacteria | 3524 |
| 50 | Ga0070680_100538264 | 3300005336 | Bacteria | 1000 |
| 51 | Ga0070680_100606669 | 3300005336 | Bacteria | 939 |
| 52 | Ga0070680_100610347 | 3300005336 | Bacteria | 936 |
| 53 | Ga0070680_100698235 | 3300005336 | Bacteria | 873 |
| 54 | Ga0070680_101025375 | 3300005336 | Bacteria | 713 |
| 55 | Ga0070682_100156042 | 3300005337 | Bacteria | 1571 |
| 56 | Ga0070682_100393943 | 3300005337 | Bacteria | 1045 |
| 57 | Ga0070682_100538345 | 3300005337 | Bacteria | 912 |
| 58 | Ga0068868_100047482 | 3300005338 | Bacteria | 3365 |
| 59 | Ga0068868_100124661 | 3300005338 | Bacteria | 2103 |
| 60 | Ga0068868_100147618 | 3300005338 | Bacteria | 1935 |
| 61 | Ga0068868_100284076 | 3300005338 | Bacteria | 1401 |
| 62 | Ga0068868_100542797 | 3300005338 | Bacteria | 1024 |
| 63 | Ga0068868_100858346 | 3300005338 | Bacteria | 823 |
| 64 | Ga0068868_102239428 | 3300005338 | Bacteria | 521 |
| 65 | Ga0070660_100056154 | 3300005339 | Bacteria | 3045 |
| 66 | Ga0070660_100205642 | 3300005339 | Bacteria | 1598 |
| 67 | Ga0070660_100263905 | 3300005339 | Bacteria | 1406 |
| 68 | Ga0070660_100354618 | 3300005339 | Bacteria | 1208 |
| 69 | Ga0070660_100510441 | 3300005339 | Bacteria | 1000 |
| 70 | Ga0070660_101554158 | 3300005339 | Bacteria | 563 |
| 71 | Ga0070689_100023700 | 3300005340 | Bacteria | 4598 |
| 72 | Ga0070689_100077283 | 3300005340 | Bacteria | 2608 |
| 73 | Ga0070691_10011376 | 3300005341 | Bacteria | 4063 |
| 74 | Ga0070691_10102607 | 3300005341 | Bacteria | 1422 |
| 75 | Ga0070687_100030344 | 3300005343 | Bacteria | 2642 |
| 76 | Ga0070687_100063632 | 3300005343 | Bacteria | 1957 |
| 77 | Ga0070661_100021766 | 3300005344 | Bacteria | 4585 |
| 78 | Ga0070661_100124775 | 3300005344 | Bacteria | 1931 |
| 79 | Ga0070661_100334839 | 3300005344 | Bacteria | 1184 |
| 80 | Ga0070661_101843976 | 3300005344 | Bacteria | 514 |
| 81 | Ga0070692_10041379 | 3300005345 | Bacteria | 2360 |
| 82 | Ga0070692_10055692 | 3300005345 | Bacteria | 2068 |
| 83 | Ga0070692_10254029 | 3300005345 | Bacteria | 1053 |
| 84 | Ga0070692_11110272 | 3300005345 | Bacteria | 559 |
| 85 | Ga0070692_11233403 | 3300005345 | Bacteria | 534 |
| 86 | Ga0070668_100125509 | 3300005347 | Bacteria | 2055 |
| 87 | Ga0070668_101289281 | 3300005347 | Bacteria | 664 |
| 88 | Ga0070669_100198950 | 3300005353 | Bacteria | 1576 |
| 89 | Ga0070669_100614344 | 3300005353 | Bacteria | 912 |
| 90 | Ga0070675_100014849 | 3300005354 | Bacteria | 6147 |
| 91 | Ga0070675_100412316 | 3300005354 | Bacteria | 1207 |
| 92 | Ga0070671_100079033 | 3300005355 | Bacteria | 2749 |
| 93 | Ga0070671_100093054 | 3300005355 | Bacteria | 2526 |
| 94 | Ga0070671_100984026 | 3300005355 | Bacteria | 739 |
| 95 | Ga0070671_101505015 | 3300005355 | Bacteria | 596 |
| 96 | Ga0070674_100106617 | 3300005356 | Bacteria | 2051 |
| 97 | Ga0070674_100420697 | 3300005356 | Bacteria | 1096 |
| 98 | Ga0070674_100474125 | 3300005356 | Bacteria | 1037 |
| 99 | Ga0070674_100928262 | 3300005356 | Bacteria | 760 |
| 100 | Ga0070673_100104251 | 3300005364 | Bacteria | 2341 |
| 101 | Ga0070673_100154142 | 3300005364 | Bacteria | 1948 |
| 102 | Ga0070673_100870359 | 3300005364 | Bacteria | 834 |
| 103 | Ga0070673_102250448 | 3300005364 | Bacteria | 518 |
| 104 | Ga0070688_100871259 | 3300005365 | Bacteria | 709 |
| 105 | Ga0070659_100122200 | 3300005366 | Bacteria | 2110 |
| 106 | Ga0070659_100498801 | 3300005366 | Bacteria | 1037 |
| 107 | Ga0070659_102159688 | 3300005366 | Bacteria | 501 |
| 108 | Ga0070667_100120475 | 3300005367 | Bacteria | 2282 |
| 109 | Ga0070667_100600987 | 3300005367 | Bacteria | 1014 |
| 110 | Ga0070667_101238485 | 3300005367 | Bacteria | 699 |
| 111 | Ga0070667_101365278 | 3300005367 | Bacteria | 664 |
| 112 | Ga0070667_101456044 | 3300005367 | Bacteria | 643 |
| 113 | Ga0070703_10180095 | 3300005406 | Bacteria | 815 |
| 114 | Ga0070709_10001280 | 3300005434 | Bacteria | 13735 |
| 115 | Ga0070709_10006908 | 3300005434 | Bacteria | 6195 |
| 116 | Ga0070709_10063516 | 3300005434 | Bacteria | 2359 |
| 117 | Ga0070709_10087255 | 3300005434 | Bacteria | 2050 |
| 118 | Ga0070709_10174334 | 3300005434 | Bacteria | 1505 |
| 119 | Ga0070709_10202510 | 3300005434 | Bacteria | 1406 |
| 120 | Ga0070709_10778168 | 3300005434 | Bacteria | 749 |
| 121 | Ga0070714_100001940 | 3300005435 | Bacteria | 15105 |
| 122 | Ga0070714_100034995 | 3300005435 | Bacteria | 4207 |
| 123 | Ga0070714_100037342 | 3300005435 | Bacteria | 4081 |
| 124 | Ga0070714_100095332 | 3300005435 | Bacteria | 2613 |
| 125 | Ga0070714_100377177 | 3300005435 | Bacteria | 1336 |
| 126 | Ga0070714_100988991 | 3300005435 | Bacteria | 818 |
| 127 | Ga0070714_101171864 | 3300005435 | Bacteria | 749 |
| 128 | Ga0070714_101177506 | 3300005435 | Bacteria | 747 |
| 129 | Ga0070714_101715283 | 3300005435 | Bacteria | 613 |
| 130 | Ga0070713_100004434 | 3300005436 | Bacteria | 9431 |
| 131 | Ga0070713_100012635 | 3300005436 | Bacteria | 6204 |
| 132 | Ga0070713_100013221 | 3300005436 | Bacteria | 6085 |
| 133 | Ga0070713_100049348 | 3300005436 | Bacteria | 3472 |
| 134 | Ga0070713_100088315 | 3300005436 | Bacteria | 2660 |
| 135 | Ga0070713_100147071 | 3300005436 | Bacteria | 2092 |
| 136 | Ga0070713_100649696 | 3300005436 | Bacteria | 1004 |
| 137 | Ga0070713_100841886 | 3300005436 | Bacteria | 880 |
| 138 | Ga0070713_100898909 | 3300005436 | Bacteria | 852 |
| 139 | Ga0070713_101061230 | 3300005436 | Bacteria | 782 |
| 140 | Ga0070713_101255139 | 3300005436 | Bacteria | 718 |
| 141 | Ga0070713_101653296 | 3300005436 | Bacteria | 622 |
| 142 | Ga0070713_101710907 | 3300005436 | Bacteria | 610 |
| 143 | Ga0070713_102016839 | 3300005436 | Bacteria | 560 |
| 144 | Ga0070710_10001003 | 3300005437 | Bacteria | 13427 |
| 145 | Ga0070710_10023246 | 3300005437 | Bacteria | 3255 |
| 146 | Ga0070710_10040445 | 3300005437 | Bacteria | 2570 |
| 147 | Ga0070710_10092801 | 3300005437 | Bacteria | 1784 |
| 148 | Ga0070710_10788568 | 3300005437 | Bacteria | 678 |
| 149 | Ga0070701_10002382 | 3300005438 | Bacteria | 7225 |
| 150 | Ga0070701_10017082 | 3300005438 | Bacteria | 3387 |
| 151 | Ga0070701_10383669 | 3300005438 | Bacteria | 886 |
| 152 | Ga0070711_100002980 | 3300005439 | Bacteria | 9778 |
| 153 | Ga0070711_100012494 | 3300005439 | Bacteria | 5308 |
| 154 | Ga0070711_100032246 | 3300005439 | Bacteria | 3482 |
| 155 | Ga0070711_100047988 | 3300005439 | Bacteria | 2917 |
| 156 | Ga0070711_100305332 | 3300005439 | Bacteria | 1267 |
| 157 | Ga0070711_100360005 | 3300005439 | Bacteria | 1172 |
| 158 | Ga0070711_100463276 | 3300005439 | Bacteria | 1039 |
| 159 | Ga0070711_100914197 | 3300005439 | Bacteria | 749 |
| 160 | Ga0070711_100989946 | 3300005439 | Bacteria | 721 |
| 161 | Ga0070705_100117944 | 3300005440 | Bacteria | 1708 |
| 162 | Ga0070705_100253250 | 3300005440 | Bacteria | 1237 |
| 163 | Ga0070705_100676564 | 3300005440 | Bacteria | 808 |
| 164 | Ga0070700_100084167 | 3300005441 | Bacteria | 2061 |
| 165 | Ga0070700_100126695 | 3300005441 | Bacteria | 1718 |
| 166 | Ga0070694_100159574 | 3300005444 | Bacteria | 1653 |
| 167 | Ga0070694_101185010 | 3300005444 | Bacteria | 640 |
| 168 | Ga0070708_100025343 | 3300005445 | Bacteria | 5069 |
| 169 | Ga0070708_100224558 | 3300005445 | Bacteria | 1762 |
| 170 | Ga0070708_100530524 | 3300005445 | Bacteria | 1110 |
| 171 | Ga0070708_101258753 | 3300005445 | Bacteria | 691 |
| 172 | Ga0070663_100054987 | 3300005455 | Bacteria | 2847 |
| 173 | Ga0070663_100188437 | 3300005455 | Bacteria | 1604 |
| 174 | Ga0070663_100257789 | 3300005455 | Bacteria | 1382 |
| 175 | Ga0070663_100496541 | 3300005455 | Bacteria | 1013 |
| 176 | Ga0070663_100524603 | 3300005455 | Bacteria | 986 |
| 177 | Ga0070663_101374622 | 3300005455 | Bacteria | 625 |
| 178 | Ga0070678_100001635 | 3300005456 | Bacteria | 11996 |
| 179 | Ga0070678_100096431 | 3300005456 | Bacteria | 2281 |
| 180 | Ga0070678_100977622 | 3300005456 | Bacteria | 777 |
| 181 | Ga0070678_101473509 | 3300005456 | Bacteria | 637 |
| 182 | Ga0070662_100222732 | 3300005457 | Bacteria | 1506 |
| 183 | Ga0070662_101195085 | 3300005457 | Bacteria | 654 |
| 184 | Ga0070662_101293285 | 3300005457 | Bacteria | 628 |
| 185 | Ga0070681_10010877 | 3300005458 | Bacteria | 8995 |
| 186 | Ga0070681_10108042 | 3300005458 | Bacteria | 2723 |
| 187 | Ga0070681_10137321 | 3300005458 | Bacteria | 2375 |
| 188 | Ga0070681_10196105 | 3300005458 | Bacteria | 1938 |
| 189 | Ga0070681_10337063 | 3300005458 | Bacteria | 1417 |
| 190 | Ga0070681_10553769 | 3300005458 | Bacteria | 1064 |
| 191 | Ga0070681_11172480 | 3300005458 | Bacteria | 690 |
| 192 | Ga0070681_11596470 | 3300005458 | Bacteria | 578 |
| 193 | Ga0068867_100319689 | 3300005459 | Bacteria | 1285 |
| 194 | Ga0068867_100732792 | 3300005459 | Bacteria | 875 |
| 195 | Ga0068867_101855960 | 3300005459 | Bacteria | 568 |
| 196 | Ga0070685_10035130 | 3300005466 | Bacteria | 2827 |
| 197 | Ga0070706_100003283 | 3300005467 | Bacteria | 15999 |
| 198 | Ga0070706_100057923 | 3300005467 | Bacteria | 3575 |
| 199 | Ga0070706_100068689 | 3300005467 | Bacteria | 3277 |
| 200 | Ga0070706_100122297 | 3300005467 | Bacteria | 2426 |
| 201 | Ga0070706_100149776 | 3300005467 | Bacteria | 2178 |
| 202 | Ga0070706_100176547 | 3300005467 | Bacteria | 1994 |
| 203 | Ga0070706_100535921 | 3300005467 | Bacteria | 1089 |
| 204 | Ga0070707_100000759 | 3300005468 | Bacteria | 31807 |
| 205 | Ga0070707_100038811 | 3300005468 | Bacteria | 4549 |
| 206 | Ga0070707_100365192 | 3300005468 | Bacteria | 1402 |
| 207 | Ga0070707_100508407 | 3300005468 | Bacteria | 1166 |
| 208 | Ga0070707_100591905 | 3300005468 | Bacteria | 1071 |
| 209 | Ga0070698_100001019 | 3300005471 | Bacteria | 30816 |
| 210 | Ga0070698_100002343 | 3300005471 | Bacteria | 20941 |
| 211 | Ga0070698_100015778 | 3300005471 | Bacteria | 7979 |
| 212 | Ga0070698_100061092 | 3300005471 | Bacteria | 3801 |
| 213 | Ga0070698_100080895 | 3300005471 | Bacteria | 3243 |
| 214 | Ga0070698_100120956 | 3300005471 | Bacteria | 2578 |
| 215 | Ga0070698_100322503 | 3300005471 | Bacteria | 1475 |
| 216 | Ga0070698_101133924 | 3300005471 | Bacteria | 731 |
| 217 | Ga0070699_100145669 | 3300005518 | Bacteria | 2092 |
| 218 | Ga0070679_100010387 | 3300005530 | Bacteria | 8830 |
| 219 | Ga0070679_100025712 | 3300005530 | Bacteria | 5777 |
| 220 | Ga0070679_100106370 | 3300005530 | Bacteria | 2791 |
| 221 | Ga0070679_100271602 | 3300005530 | Bacteria | 1649 |
| 222 | Ga0070679_100298098 | 3300005530 | Bacteria | 1563 |
| 223 | Ga0070679_100345874 | 3300005530 | Bacteria | 1435 |
| 224 | Ga0070679_101406517 | 3300005530 | Bacteria | 644 |
| 225 | Ga0070684_100206692 | 3300005535 | Bacteria | 1789 |
| 226 | Ga0070684_100212168 | 3300005535 | Bacteria | 1764 |
| 227 | Ga0070684_100312069 | 3300005535 | Bacteria | 1444 |
| 228 | Ga0070684_100443196 | 3300005535 | Bacteria | 1200 |
| 229 | Ga0070684_100584887 | 3300005535 | Bacteria | 1037 |
| 230 | Ga0070684_100729378 | 3300005535 | Bacteria | 924 |
| 231 | Ga0070684_100984099 | 3300005535 | Bacteria | 791 |
| 232 | Ga0070697_100004357 | 3300005536 | Bacteria | 10859 |
| 233 | Ga0070697_100010938 | 3300005536 | Bacteria | 7089 |
| 234 | Ga0070697_100190470 | 3300005536 | Bacteria | 1741 |
| 235 | Ga0070697_100608698 | 3300005536 | Bacteria | 961 |
| 236 | Ga0070697_101160348 | 3300005536 | Bacteria | 688 |
| 237 | Ga0068853_100325991 | 3300005539 | Bacteria | 1424 |
| 238 | Ga0068853_100600049 | 3300005539 | Bacteria | 1045 |
| 239 | Ga0070672_100025168 | 3300005543 | Bacteria | 4411 |
| 240 | Ga0070672_100264280 | 3300005543 | Bacteria | 1452 |
| 241 | Ga0070672_100491634 | 3300005543 | Bacteria | 1060 |
| 242 | Ga0070672_100668898 | 3300005543 | Bacteria | 908 |
| 243 | Ga0070686_100908941 | 3300005544 | Bacteria | 717 |
| 244 | Ga0070695_100050897 | 3300005545 | Bacteria | 2656 |
| 245 | Ga0070695_100342472 | 3300005545 | Bacteria | 1118 |
| 246 | Ga0070695_101709408 | 3300005545 | Bacteria | 527 |
| 247 | Ga0070696_100060268 | 3300005546 | Bacteria | 2654 |
| 248 | Ga0070696_100177283 | 3300005546 | Bacteria | 1579 |
| 249 | Ga0070696_101169569 | 3300005546 | Bacteria | 649 |
| 250 | Ga0070696_101407026 | 3300005546 | Bacteria | 595 |
| 251 | Ga0070696_101819046 | 3300005546 | Bacteria | 527 |
| 252 | Ga0070693_100005092 | 3300005547 | Bacteria | 6280 |
| 253 | Ga0070693_100598680 | 3300005547 | Bacteria | 795 |
| 254 | Ga0070693_101049708 | 3300005547 | Bacteria | 619 |
| 255 | Ga0070665_100030159 | 3300005548 | Bacteria | 5457 |
| 256 | Ga0070665_100260984 | 3300005548 | Bacteria | 1734 |
| 257 | Ga0070665_100396212 | 3300005548 | Bacteria | 1388 |
| 258 | Ga0070665_100447186 | 3300005548 | Bacteria | 1302 |
| 259 | Ga0070704_100265991 | 3300005549 | Bacteria | 1414 |
| 260 | Ga0070704_100874040 | 3300005549 | Bacteria | 807 |
| 261 | Ga0070704_101940956 | 3300005549 | Bacteria | 546 |
| 262 | Ga0068855_100121025 | 3300005563 | Bacteria | 2996 |
| 263 | Ga0068855_100158059 | 3300005563 | Bacteria | 2574 |
| 264 | Ga0068855_100678137 | 3300005563 | Bacteria | 1105 |
| 265 | Ga0068855_100919154 | 3300005563 | Bacteria | 923 |
| 266 | Ga0068855_101817696 | 3300005563 | Bacteria | 619 |
| 267 | Ga0068855_102212485 | 3300005563 | Bacteria | 552 |
| 268 | Ga0070664_100074926 | 3300005564 | Bacteria | 2905 |
| 269 | Ga0070664_101325913 | 3300005564 | Bacteria | 680 |
| 270 | Ga0070664_101414514 | 3300005564 | Bacteria | 658 |
| 271 | Ga0070664_101589521 | 3300005564 | Bacteria | 619 |
| 272 | Ga0068857_100272546 | 3300005577 | Bacteria | 1555 |
| 273 | Ga0068857_100609823 | 3300005577 | Bacteria | 1032 |
| 274 | Ga0068857_100728433 | 3300005577 | Bacteria | 943 |
| 275 | Ga0068857_101054175 | 3300005577 | Bacteria | 784 |
| 276 | Ga0068857_101174897 | 3300005577 | Bacteria | 742 |
| 277 | Ga0068857_101876973 | 3300005577 | Bacteria | 587 |
| 278 | Ga0068854_100056428 | 3300005578 | Bacteria | 2830 |
| 279 | Ga0068854_100393090 | 3300005578 | Bacteria | 1145 |
| 280 | Ga0068854_101826830 | 3300005578 | Bacteria | 557 |
| 281 | Ga0068856_100105265 | 3300005614 | Bacteria | 2815 |
| 282 | Ga0068856_101059653 | 3300005614 | Bacteria | 828 |
| 283 | Ga0068856_101851418 | 3300005614 | Bacteria | 615 |
| 284 | Ga0070702_100068800 | 3300005615 | Bacteria | 2084 |
| 285 | Ga0070702_100213681 | 3300005615 | Bacteria | 1285 |
| 286 | Ga0068852_100000497 | 3300005616 | Bacteria | 25765 |
| 287 | Ga0068852_100075312 | 3300005616 | Bacteria | 2977 |
| 288 | Ga0068852_100096999 | 3300005616 | Bacteria | 2651 |
| 289 | Ga0068852_100340080 | 3300005616 | Bacteria | 1462 |
| 290 | Ga0068852_100602885 | 3300005616 | Bacteria | 1103 |
| 291 | Ga0068852_102172148 | 3300005616 | Bacteria | 577 |
| 292 | Ga0068859_100246961 | 3300005617 | Bacteria | 1874 |
| 293 | Ga0068859_100273218 | 3300005617 | Bacteria | 1782 |
| 294 | Ga0068859_100889388 | 3300005617 | Bacteria | 976 |
| 295 | Ga0068859_101870180 | 3300005617 | Bacteria | 663 |
| 296 | Ga0068864_100003244 | 3300005618 | Bacteria | 13439 |
| 297 | Ga0068864_100127348 | 3300005618 | Bacteria | 2283 |
| 298 | Ga0068864_101623856 | 3300005618 | Bacteria | 651 |
| 299 | Ga0068864_101662577 | 3300005618 | Bacteria | 643 |
| 300 | Ga0068864_101764136 | 3300005618 | Bacteria | 624 |
| 301 | Ga0068866_10032583 | 3300005718 | Bacteria | 2521 |
| 302 | Ga0068866_10386663 | 3300005718 | Bacteria | 899 |
| 303 | Ga0068861_100358099 | 3300005719 | Bacteria | 1282 |
| 304 | Ga0068851_10081316 | 3300005834 | Bacteria | 1692 |
| 305 | Ga0068851_10356563 | 3300005834 | Bacteria | 852 |
| 306 | Ga0068870_10021137 | 3300005840 | Bacteria | 3179 |
| 307 | Ga0068870_10563046 | 3300005840 | Bacteria | 769 |
| 308 | Ga0068870_10732648 | 3300005840 | Bacteria | 685 |
| 309 | Ga0068870_10906967 | 3300005840 | Bacteria | 623 |
| 310 | Ga0068863_100003332 | 3300005841 | Bacteria | 15867 |
| 311 | Ga0068863_100519231 | 3300005841 | Bacteria | 1174 |
| 312 | Ga0068863_100565331 | 3300005841 | Bacteria | 1124 |
| 313 | Ga0068863_100819907 | 3300005841 | Bacteria | 928 |
| 314 | Ga0068858_100214839 | 3300005842 | Bacteria | 1820 |
| 315 | Ga0068858_100246158 | 3300005842 | Bacteria | 1697 |
| 316 | Ga0068858_100398373 | 3300005842 | Bacteria | 1322 |
| 317 | Ga0068858_100422857 | 3300005842 | Bacteria | 1281 |
| 318 | Ga0068858_100748928 | 3300005842 | Bacteria | 952 |
| 319 | Ga0068860_100371807 | 3300005843 | Bacteria | 1410 |
| 320 | Ga0068860_101451373 | 3300005843 | Bacteria | 707 |
| 321 | Ga0068860_102725001 | 3300005843 | Bacteria | 513 |
| 322 | Ga0068862_100020590 | 3300005844 | Bacteria | 5509 |
| 323 | Ga0081455_10181061 | 3300005937 | Bacteria | 1595 |
| 324 | Ga0081538_10035881 | 3300005981 | Bacteria | 3248 |
| 325 | Ga0081540_1000193 | 3300005983 | Bacteria | 63248 |
| 326 | Ga0081540_1000355 | 3300005983 | Bacteria | 46352 |
| 327 | Ga0081540_1078394 | 3300005983 | Bacteria | 1498 |
| 328 | Ga0081539_10389280 | 3300005985 | Bacteria | 581 |
| 329 | Ga0070717_10017503 | 3300006028 | Bacteria | 5578 |
| 330 | Ga0070717_10107833 | 3300006028 | Bacteria | 2372 |
| 331 | Ga0070717_10156341 | 3300006028 | Bacteria | 1976 |
| 332 | Ga0070717_10303179 | 3300006028 | Bacteria | 1420 |
| 333 | Ga0070717_10314830 | 3300006028 | Bacteria | 1393 |
| 334 | Ga0070717_10403326 | 3300006028 | Bacteria | 1228 |
| 335 | Ga0070717_10608322 | 3300006028 | Bacteria | 991 |
| 336 | Ga0070717_10761132 | 3300006028 | Bacteria | 880 |
| 337 | Ga0070717_10812605 | 3300006028 | Bacteria | 851 |
| 338 | Ga0070717_11141430 | 3300006028 | Bacteria | 709 |
| 339 | Ga0070717_11528065 | 3300006028 | Bacteria | 605 |
| 340 | Ga0070717_11741542 | 3300006028 | Bacteria | 563 |
| 341 | Ga0075363_100138181 | 3300006048 | Bacteria | 1370 |
| 342 | Ga0075363_100647093 | 3300006048 | Bacteria | 636 |
| 343 | Ga0075432_10260394 | 3300006058 | Bacteria | 707 |
| 344 | Ga0070715_10018614 | 3300006163 | Bacteria | 2650 |
| 345 | Ga0070715_10083546 | 3300006163 | Bacteria | 1454 |
| 346 | Ga0070715_10131122 | 3300006163 | Bacteria | 1206 |
| 347 | Ga0070716_100003676 | 3300006173 | Bacteria | 7258 |
| 348 | Ga0070716_100013747 | 3300006173 | Bacteria | 4133 |
| 349 | Ga0070716_100018980 | 3300006173 | Bacteria | 3589 |
| 350 | Ga0070716_100149237 | 3300006173 | Bacteria | 1501 |
| 351 | Ga0070716_100575500 | 3300006173 | Bacteria | 843 |
| 352 | Ga0070712_100001764 | 3300006175 | Bacteria | 13234 |
| 353 | Ga0070712_100220805 | 3300006175 | Bacteria | 1500 |
| 354 | Ga0070712_100330101 | 3300006175 | Bacteria | 1242 |
| 355 | Ga0070712_100396209 | 3300006175 | Bacteria | 1139 |
| 356 | Ga0070712_100808737 | 3300006175 | Bacteria | 804 |
| 357 | Ga0070712_101487354 | 3300006175 | Bacteria | 592 |
| 358 | Ga0070712_101693509 | 3300006175 | Bacteria | 553 |
| 359 | Ga0097621_100028657 | 3300006237 | Bacteria | 4390 |
| 360 | Ga0097621_100138272 | 3300006237 | Bacteria | 2079 |
| 361 | Ga0097621_100467346 | 3300006237 | Bacteria | 1138 |
| 362 | Ga0068871_100116304 | 3300006358 | Bacteria | 2254 |
| 363 | Ga0068871_100192461 | 3300006358 | Bacteria | 1758 |
| 364 | Ga0068871_100934828 | 3300006358 | Bacteria | 805 |
| 365 | Ga0075428_100116954 | 3300006844 | Bacteria | 2904 |
| 366 | Ga0075428_100248314 | 3300006844 | Bacteria | 1918 |
| 367 | Ga0075428_100875814 | 3300006844 | Bacteria | 953 |
| 368 | Ga0075433_10004667 | 3300006852 | Bacteria | 10683 |
| 369 | Ga0075433_10058534 | 3300006852 | Bacteria | 3370 |
| 370 | Ga0075433_10212584 | 3300006852 | Bacteria | 1718 |
| 371 | Ga0075433_10302864 | 3300006852 | Bacteria | 1415 |
| 372 | Ga0075433_10487249 | 3300006852 | Bacteria | 1086 |
| 373 | Ga0075434_100004126 | 3300006871 | Bacteria | 13026 |
| 374 | Ga0075434_100121257 | 3300006871 | Bacteria | 2630 |
| 375 | Ga0075434_100295990 | 3300006871 | Bacteria | 1638 |
| 376 | Ga0075434_100381904 | 3300006871 | Bacteria | 1429 |
| 377 | Ga0075434_100509932 | 3300006871 | Bacteria | 1223 |
| 378 | Ga0075429_100032855 | 3300006880 | Bacteria | 4509 |
| 379 | Ga0075429_100995142 | 3300006880 | Bacteria | 733 |
| 380 | Ga0068865_100197174 | 3300006881 | Bacteria | 1561 |
| 381 | Ga0068865_100223398 | 3300006881 | Bacteria | 1473 |
| 382 | Ga0068865_100226394 | 3300006881 | Bacteria | 1465 |
| 383 | Ga0075436_100005351 | 3300006914 | Bacteria | 8832 |
| 384 | Ga0075436_100130030 | 3300006914 | Bacteria | 1765 |
| 385 | Ga0075436_100214031 | 3300006914 | Bacteria | 1366 |
| 386 | Ga0075436_100370472 | 3300006914 | Bacteria | 1034 |
| 387 | Ga0097620_100246968 | 3300006931 | Bacteria | 1874 |
| 388 | Ga0097620_100273204 | 3300006931 | Bacteria | 1782 |
| 389 | Ga0097620_100889376 | 3300006931 | Bacteria | 976 |
| 390 | Ga0097620_101869838 | 3300006931 | Bacteria | 663 |
| 391 | Ga0099826_10129515 | 3300006948 | Bacteria | 1473 |
| 392 | Ga0075435_100008998 | 3300007076 | Bacteria | 7203 |
| 393 | Ga0075435_100137120 | 3300007076 | Bacteria | 2050 |
| 394 | Ga0075435_100184646 | 3300007076 | Bacteria | 1763 |
| 395 | Ga0075435_100853002 | 3300007076 | Bacteria | 794 |
| 396 | Ga0075435_101056291 | 3300007076 | Bacteria | 710 |
| 397 | Ga0099794_10376727 | 3300007265 | Bacteria | 740 |
| 398 | Ga0099794_10501751 | 3300007265 | Bacteria | 639 |
| 399 | Ga0099795_10015129 | 3300007788 | Bacteria | 2409 |
| 400 | Ga0099795_10346424 | 3300007788 | Bacteria | 664 |
| 401 | Ga0105251_10009748 | 3300009011 | Bacteria | 5639 |
| 402 | Ga0105251_10038963 | 3300009011 | Bacteria | 2324 |
| 403 | Ga0105244_10227262 | 3300009036 | Bacteria | 874 |
| 404 | Ga0105244_10254694 | 3300009036 | Bacteria | 818 |
| 405 | Ga0105244_10362605 | 3300009036 | Bacteria | 668 |
| 406 | Ga0105250_10114222 | 3300009092 | Bacteria | 1107 |
| 407 | Ga0105250_10351630 | 3300009092 | Bacteria | 645 |
| 408 | Ga0105250_10417671 | 3300009092 | Bacteria | 597 |
| 409 | Ga0105240_10535477 | 3300009093 | Bacteria | 1298 |
| 410 | Ga0105240_10639032 | 3300009093 | Bacteria | 1168 |
| 411 | Ga0105240_10733600 | 3300009093 | Bacteria | 1075 |
| 412 | Ga0105240_11127334 | 3300009093 | Bacteria | 834 |
| 413 | Ga0111539_10088965 | 3300009094 | Bacteria | 3628 |
| 414 | Ga0111539_10189764 | 3300009094 | Bacteria | 2398 |
| 415 | Ga0111539_13273931 | 3300009094 | Bacteria | 522 |
| 416 | Ga0105245_10001105 | 3300009098 | Bacteria | 24416 |
| 417 | Ga0105245_10103611 | 3300009098 | Bacteria | 2637 |
| 418 | Ga0105245_10251416 | 3300009098 | Bacteria | 1717 |
| 419 | Ga0105245_10423434 | 3300009098 | Bacteria | 1335 |
| 420 | Ga0105245_10443110 | 3300009098 | Bacteria | 1306 |
| 421 | Ga0105245_10541536 | 3300009098 | Bacteria | 1185 |
| 422 | Ga0105245_10784209 | 3300009098 | Bacteria | 990 |
| 423 | Ga0105245_11488914 | 3300009098 | Bacteria | 728 |
| 424 | Ga0105245_11818852 | 3300009098 | Bacteria | 662 |
| 425 | Ga0105245_12683201 | 3300009098 | Bacteria | 551 |
| 426 | Ga0105247_10000156 | 3300009101 | Bacteria | 67016 |
| 427 | Ga0105247_10004622 | 3300009101 | Bacteria | 8774 |
| 428 | Ga0105247_10212950 | 3300009101 | Bacteria | 1304 |
| 429 | Ga0105247_10448552 | 3300009101 | Bacteria | 930 |
| 430 | Ga0105247_10674909 | 3300009101 | Bacteria | 775 |
| 431 | Ga0105247_10716612 | 3300009101 | Bacteria | 755 |
| 432 | Ga0114129_10003727 | 3300009147 | Bacteria | 21488 |
| 433 | Ga0114129_10176253 | 3300009147 | Unclassified | 2912 |
| 434 | Ga0114129_10672238 | 3300009147 | Bacteria | 1334 |
| 435 | Ga0114129_10818495 | 3300009147 | Unclassified | 1187 |
| 436 | Ga0114129_10905906 | 3300009147 | Bacteria | 1117 |
| 437 | Ga0114129_11140280 | 3300009147 | Bacteria | 974 |
| 438 | Ga0114129_11520112 | 3300009147 | Bacteria | 822 |
| 439 | Ga0114129_13415871 | 3300009147 | Bacteria | 510 |
| 440 | Ga0105243_10011592 | 3300009148 | Bacteria | 6669 |
| 441 | Ga0105243_10081732 | 3300009148 | Bacteria | 2639 |
| 442 | Ga0105243_10132867 | 3300009148 | Bacteria | 2114 |
| 443 | Ga0105243_10329695 | 3300009148 | Bacteria | 1394 |
| 444 | Ga0105243_10641639 | 3300009148 | Bacteria | 1028 |
| 445 | Ga0105243_11886270 | 3300009148 | Bacteria | 630 |
| 446 | Ga0105241_10131584 | 3300009174 | Bacteria | 2026 |
| 447 | Ga0105241_10185322 | 3300009174 | Bacteria | 1729 |
| 448 | Ga0105241_10687614 | 3300009174 | Bacteria | 933 |
| 449 | Ga0105241_10793881 | 3300009174 | Bacteria | 872 |
| 450 | Ga0105241_10989007 | 3300009174 | Bacteria | 786 |
| 451 | Ga0105242_10103963 | 3300009176 | Bacteria | 2410 |
| 452 | Ga0105242_10222383 | 3300009176 | Bacteria | 1688 |
| 453 | Ga0105242_10410322 | 3300009176 | Bacteria | 1266 |
| 454 | Ga0105242_11683134 | 3300009176 | Bacteria | 670 |
| 455 | Ga0105242_12045705 | 3300009176 | Bacteria | 616 |
| 456 | Ga0105242_12307653 | 3300009176 | Bacteria | 584 |
| 457 | Ga0105248_10001256 | 3300009177 | Bacteria | 28350 |
| 458 | Ga0105248_10039623 | 3300009177 | Bacteria | 5279 |
| 459 | Ga0105248_10184254 | 3300009177 | Bacteria | 2353 |
| 460 | Ga0105248_10288636 | 3300009177 | Bacteria | 1847 |
| 461 | Ga0105248_11215465 | 3300009177 | Bacteria | 852 |
| 462 | Ga0105248_12343562 | 3300009177 | Bacteria | 608 |
| 463 | Ga0105237_10365688 | 3300009545 | Bacteria | 1447 |
| 464 | Ga0105237_10426969 | 3300009545 | Bacteria | 1331 |
| 465 | Ga0105237_10591198 | 3300009545 | Bacteria | 1117 |
| 466 | Ga0105237_10797391 | 3300009545 | Bacteria | 951 |
| 467 | Ga0105237_11081608 | 3300009545 | Bacteria | 809 |
| 468 | Ga0105237_11224797 | 3300009545 | Bacteria | 757 |
| 469 | Ga0105237_11985958 | 3300009545 | Bacteria | 590 |
| 470 | Ga0105238_10044356 | 3300009551 | Bacteria | 4496 |
| 471 | Ga0105238_10378578 | 3300009551 | Bacteria | 1406 |
| 472 | Ga0105238_10997556 | 3300009551 | Bacteria | 858 |
| 473 | Ga0105238_11087337 | 3300009551 | Bacteria | 822 |
| 474 | Ga0105238_12227639 | 3300009551 | Bacteria | 583 |
| 475 | Ga0105238_12423355 | 3300009551 | Bacteria | 560 |
| 476 | Ga0105238_12909923 | 3300009551 | Bacteria | 515 |
| 477 | Ga0105249_10040745 | 3300009553 | Bacteria | 4219 |
| 478 | Ga0105249_10329162 | 3300009553 | Bacteria | 1541 |
| 479 | Ga0105249_10330115 | 3300009553 | Bacteria | 1539 |
| 480 | Ga0105249_10453128 | 3300009553 | Bacteria | 1322 |
| 481 | Ga0105249_11166391 | 3300009553 | Bacteria | 841 |
| 482 | Ga0105249_11469127 | 3300009553 | Bacteria | 754 |
| 483 | Ga0105249_11973888 | 3300009553 | Bacteria | 656 |
| 484 | Ga0105249_12291228 | 3300009553 | Bacteria | 613 |
| 485 | Ga0105249_12308920 | 3300009553 | Bacteria | 611 |
| 486 | Ga0105249_12353397 | 3300009553 | Bacteria | 605 |
| 487 | Ga0105249_12421697 | 3300009553 | Bacteria | 597 |
| 488 | Ga0105249_12560354 | 3300009553 | Bacteria | 582 |
| 489 | Ga0099796_10023887 | 3300010159 | Bacteria | 1913 |
| 490 | Ga0099796_10275871 | 3300010159 | Bacteria | 706 |
| 491 | Ga0105239_10131095 | 3300010375 | Bacteria | 2789 |
| 492 | Ga0105239_10244856 | 3300010375 | Bacteria | 2013 |
| 493 | Ga0105239_10424269 | 3300010375 | Bacteria | 1507 |
| 494 | Ga0105239_10738877 | 3300010375 | Bacteria | 1126 |
| 495 | Ga0105239_10824069 | 3300010375 | Bacteria | 1063 |
| 496 | Ga0105239_11055172 | 3300010375 | Bacteria | 935 |
| 497 | Ga0105239_11296739 | 3300010375 | Bacteria | 840 |
| 498 | Ga0105239_11681072 | 3300010375 | Bacteria | 735 |
| 499 | Ga0105239_11843541 | 3300010375 | Bacteria | 701 |
| 500 | Ga0105239_12626434 | 3300010375 | Bacteria | 587 |
| 501 | Ga0105246_10000677 | 3300011119 | Bacteria | 19120 |
| 502 | Ga0105246_10043815 | 3300011119 | Bacteria | 3038 |
| 503 | Ga0105246_10246314 | 3300011119 | Bacteria | 1416 |
| 504 | Ga0105246_10264562 | 3300011119 | Bacteria | 1372 |
| 505 | Ga0105246_10271422 | 3300011119 | Bacteria | 1356 |
| 506 | Ga0105246_10685213 | 3300011119 | Bacteria | 896 |
| 507 | Ga0105246_10696760 | 3300011119 | Bacteria | 890 |
| 508 | Ga0105246_10865976 | 3300011119 | Bacteria | 807 |
| 509 | Ga0157340_1029428 | 3300012473 | Bacteria | 506 |
| 510 | Ga0157336_1017202 | 3300012477 | Bacteria | 621 |
| 511 | Ga0157346_1000486 | 3300012480 | Bacteria | 1672 |
| 512 | Ga0157337_1006266 | 3300012483 | Bacteria | 818 |
| 513 | Ga0157325_1018162 | 3300012485 | Bacteria | 602 |
| 514 | Ga0157329_1021702 | 3300012491 | Bacteria | 607 |
| 515 | Ga0157335_1009023 | 3300012492 | Bacteria | 776 |
| 516 | Ga0157341_1041648 | 3300012494 | Bacteria | 534 |
| 517 | Ga0157319_1010846 | 3300012497 | Bacteria | 742 |
| 518 | Ga0157345_1002512 | 3300012498 | Bacteria | 1299 |
| 519 | Ga0157314_1012932 | 3300012500 | Bacteria | 758 |
| 520 | Ga0157347_1005321 | 3300012502 | Bacteria | 1226 |
| 521 | Ga0157313_1014030 | 3300012503 | Bacteria | 735 |
| 522 | Ga0157339_1010108 | 3300012505 | Bacteria | 847 |
| 523 | Ga0157342_1002674 | 3300012507 | Bacteria | 1467 |
| 524 | Ga0157315_1007234 | 3300012508 | Bacteria | 894 |
| 525 | Ga0157327_1068898 | 3300012512 | Bacteria | 545 |
| 526 | Ga0157326_1029780 | 3300012513 | Bacteria | 717 |
| 527 | Ga0157326_1032110 | 3300012513 | Bacteria | 700 |
| 528 | Ga0157338_1005803 | 3300012515 | Bacteria | 1121 |
| 529 | Ga0157373_10080116 | 3300013100 | Bacteria | 2303 |
| 530 | Ga0157373_10094196 | 3300013100 | Bacteria | 2109 |
| 531 | Ga0157373_10128644 | 3300013100 | Bacteria | 1781 |
| 532 | Ga0157373_10481267 | 3300013100 | Bacteria | 895 |
| 533 | Ga0157373_10832202 | 3300013100 | Bacteria | 682 |
| 534 | Ga0157373_11468612 | 3300013100 | Bacteria | 520 |
| 535 | Ga0157371_10018435 | 3300013102 | Bacteria | 5161 |
| 536 | Ga0157371_10042438 | 3300013102 | Bacteria | 3242 |
| 537 | Ga0157371_10055988 | 3300013102 | Bacteria | 2797 |
| 538 | Ga0157371_10165197 | 3300013102 | Bacteria | 1581 |
| 539 | Ga0157371_11540194 | 3300013102 | Bacteria | 519 |
| 540 | Ga0157370_10045055 | 3300013104 | Bacteria | 4234 |
| 541 | Ga0157370_10282438 | 3300013104 | Bacteria | 1534 |
| 542 | Ga0157370_10389342 | 3300013104 | Bacteria | 1283 |
| 543 | Ga0157370_10684486 | 3300013104 | Bacteria | 936 |
| 544 | Ga0157370_10927128 | 3300013104 | Bacteria | 790 |
| 545 | Ga0157370_11139673 | 3300013104 | Bacteria | 704 |
| 546 | Ga0157369_10001226 | 3300013105 | Bacteria | 31968 |
| 547 | Ga0157369_10045005 | 3300013105 | Bacteria | 4802 |
| 548 | Ga0157369_10174634 | 3300013105 | Bacteria | 2262 |
| 549 | Ga0157369_10177656 | 3300013105 | Bacteria | 2241 |
| 550 | Ga0157369_10226639 | 3300013105 | Bacteria | 1955 |
| 551 | Ga0157369_10553907 | 3300013105 | Bacteria | 1188 |
| 552 | Ga0157369_10615632 | 3300013105 | Bacteria | 1120 |
| 553 | Ga0157369_10884227 | 3300013105 | Bacteria | 916 |
| 554 | Ga0157369_11113725 | 3300013105 | Bacteria | 807 |
| 555 | Ga0157369_11332328 | 3300013105 | Bacteria | 731 |
| 556 | Ga0157369_11579337 | 3300013105 | Bacteria | 667 |
| 557 | Ga0157374_10007839 | 3300013296 | Bacteria | 9116 |
| 558 | Ga0157374_10551488 | 3300013296 | Bacteria | 1160 |
| 559 | Ga0157374_10660329 | 3300013296 | Bacteria | 1058 |
| 560 | Ga0157374_11068011 | 3300013296 | Bacteria | 827 |
| 561 | Ga0157374_11379621 | 3300013296 | Bacteria | 727 |
| 562 | Ga0157374_12592194 | 3300013296 | Bacteria | 535 |
| 563 | Ga0157374_12615690 | 3300013296 | Bacteria | 532 |
| 564 | Ga0157374_12967956 | 3300013296 | Bacteria | 501 |
| 565 | Ga0157378_10143210 | 3300013297 | Bacteria | 2221 |
| 566 | Ga0157378_10188750 | 3300013297 | Bacteria | 1943 |
| 567 | Ga0157378_10340383 | 3300013297 | Bacteria | 1463 |
| 568 | Ga0157378_10874525 | 3300013297 | Bacteria | 928 |
| 569 | Ga0157378_10926671 | 3300013297 | Bacteria | 903 |
| 570 | Ga0157378_12965929 | 3300013297 | Bacteria | 526 |
| 571 | Ga0163162_10224162 | 3300013306 | Bacteria | 2009 |
| 572 | Ga0163162_10544828 | 3300013306 | Bacteria | 1289 |
| 573 | Ga0163162_10595887 | 3300013306 | Bacteria | 1232 |
| 574 | Ga0163162_10666633 | 3300013306 | Bacteria | 1163 |
| 575 | Ga0163162_11226593 | 3300013306 | Bacteria | 851 |
| 576 | Ga0163162_11237422 | 3300013306 | Bacteria | 848 |
| 577 | Ga0163162_11347230 | 3300013306 | Bacteria | 811 |
| 578 | Ga0163162_11666999 | 3300013306 | Bacteria | 728 |
| 579 | Ga0163162_12154867 | 3300013306 | Bacteria | 640 |
| 580 | Ga0163162_12432619 | 3300013306 | Bacteria | 602 |
| 581 | Ga0163162_13038927 | 3300013306 | Bacteria | 539 |
| 582 | Ga0157372_10023978 | 3300013307 | Bacteria | 6620 |
| 583 | Ga0157372_10089347 | 3300013307 | Bacteria | 3500 |
| 584 | Ga0157372_10340463 | 3300013307 | Bacteria | 1747 |
| 585 | Ga0157372_10372037 | 3300013307 | Bacteria | 1665 |
| 586 | Ga0157372_10472225 | 3300013307 | Bacteria | 1462 |
| 587 | Ga0157372_10639515 | 3300013307 | Bacteria | 1239 |
| 588 | Ga0157372_11103280 | 3300013307 | Bacteria | 918 |
| 589 | Ga0157372_11261359 | 3300013307 | Bacteria | 853 |
| 590 | Ga0157372_11286038 | 3300013307 | Bacteria | 844 |
| 591 | Ga0157372_11845359 | 3300013307 | Bacteria | 695 |
| 592 | Ga0157372_11846959 | 3300013307 | Bacteria | 695 |
| 593 | Ga0157372_11938749 | 3300013307 | Bacteria | 677 |
| 594 | Ga0157372_12355373 | 3300013307 | Bacteria | 611 |
| 595 | Ga0157372_13386755 | 3300013307 | Bacteria | 507 |
| 596 | Ga0157375_10298048 | 3300013308 | Bacteria | 1776 |
| 597 | Ga0157375_10313841 | 3300013308 | Bacteria | 1732 |
| 598 | Ga0157375_10445668 | 3300013308 | Bacteria | 1460 |
| 599 | Ga0157375_10513284 | 3300013308 | Bacteria | 1362 |
| 600 | Ga0157375_10691200 | 3300013308 | Bacteria | 1174 |
| 601 | Ga0157375_11036968 | 3300013308 | Bacteria | 958 |
| 602 | Ga0157375_11240915 | 3300013308 | Bacteria | 875 |
| 603 | Ga0157375_11395859 | 3300013308 | Bacteria | 825 |
| 604 | Ga0157375_11580698 | 3300013308 | Bacteria | 775 |
| 605 | Ga0163163_10086319 | 3300014325 | Bacteria | 3147 |
| 606 | Ga0163163_10134524 | 3300014325 | Bacteria | 2513 |
| 607 | Ga0163163_10294750 | 3300014325 | Bacteria | 1674 |
| 608 | Ga0163163_10513046 | 3300014325 | Bacteria | 1261 |
| 609 | Ga0163163_11440644 | 3300014325 | Bacteria | 750 |
| 610 | Ga0157380_10419005 | 3300014326 | Bacteria | 1276 |
| 611 | Ga0157380_10572085 | 3300014326 | Bacteria | 1112 |
| 612 | Ga0157380_11041806 | 3300014326 | Bacteria | 854 |
| 613 | Ga0157380_11204456 | 3300014326 | Bacteria | 801 |
| 614 | Ga0182008_10001280 | 3300014497 | Bacteria | 17261 |
| 615 | Ga0182008_10063733 | 3300014497 | Bacteria | 1815 |
| 616 | Ga0182008_10154693 | 3300014497 | Bacteria | 1151 |
| 617 | Ga0182008_10771580 | 3300014497 | Bacteria | 555 |
| 618 | Ga0157377_10099503 | 3300014745 | Bacteria | 1730 |
| 619 | Ga0157377_10297683 | 3300014745 | Bacteria | 1063 |
| 620 | Ga0157377_11014908 | 3300014745 | Bacteria | 629 |
| 621 | Ga0157377_11740804 | 3300014745 | Bacteria | 504 |
| 622 | Ga0157379_10017316 | 3300014968 | Bacteria | 6349 |
| 623 | Ga0157379_10245301 | 3300014968 | Bacteria | 1625 |
| 624 | Ga0157379_10580398 | 3300014968 | Bacteria | 1045 |
| 625 | Ga0157379_11580780 | 3300014968 | Bacteria | 640 |
| 626 | Ga0157376_10149208 | 3300014969 | Bacteria | 2107 |
| 627 | Ga0157376_10176007 | 3300014969 | Bacteria | 1952 |
| 628 | Ga0157376_10289769 | 3300014969 | Bacteria | 1545 |
| 629 | Ga0157376_10743029 | 3300014969 | Bacteria | 990 |
| 630 | Ga0157376_11141997 | 3300014969 | Bacteria | 806 |
| 631 | Ga0157376_11854885 | 3300014969 | Bacteria | 639 |
| 632 | Ga0182006_1239719 | 3300015261 | Bacteria | 596 |
| 633 | Ga0182007_10000582 | 3300015262 | Bacteria | 21489 |
| 634 | Ga0182007_10271434 | 3300015262 | Bacteria | 614 |
| 635 | Ga0182005_1100806 | 3300015265 | Bacteria | 809 |
| 636 | Ga0183367_1005 | 3300015688 | Bacteria | 652063 |
| 637 | Ga0163161_10159234 | 3300017792 | Bacteria | 1721 |
| 638 | Ga0163161_10283976 | 3300017792 | Bacteria | 1299 |
| 639 | Ga0163161_10463463 | 3300017792 | Bacteria | 1026 |
| 640 | Ga0163161_11057483 | 3300017792 | Bacteria | 696 |
| 641 | Ga0163161_11283187 | 3300017792 | Bacteria | 636 |
| 642 | Ga0184601_106011 | 3300019183 | Bacteria | 558 |
| 643 | Ga0197907_10000430 | 3300020069 | Bacteria | 518 |
| 644 | Ga0197907_10288082 | 3300020069 | Bacteria | 792 |
| 645 | Ga0197907_10328527 | 3300020069 | Bacteria | 734 |
| 646 | Ga0197907_10376985 | 3300020069 | Bacteria | 656 |
| 647 | Ga0197907_11094604 | 3300020069 | Bacteria | 763 |
| 648 | Ga0197907_11205039 | 3300020069 | Bacteria | 1306 |
| 649 | Ga0197907_11225079 | 3300020069 | Bacteria | 531 |
| 650 | Ga0206356_10944536 | 3300020070 | Bacteria | 1193 |
| 651 | Ga0206356_11038323 | 3300020070 | Bacteria | 553 |
| 652 | Ga0206356_11717365 | 3300020070 | Bacteria | 1159 |
| 653 | Ga0206349_1677274 | 3300020075 | Bacteria | 606 |
| 654 | Ga0206355_1500362 | 3300020076 | Bacteria | 1339 |
| 655 | Ga0206355_1718134 | 3300020076 | Bacteria | 503 |
| 656 | Ga0206351_10722143 | 3300020077 | Bacteria | 1581 |
| 657 | Ga0206351_10773125 | 3300020077 | Bacteria | 599 |
| 658 | Ga0206352_10254953 | 3300020078 | Bacteria | 561 |
| 659 | Ga0206352_10791224 | 3300020078 | Bacteria | 570 |
| 660 | Ga0206352_11198618 | 3300020078 | Bacteria | 791 |
| 661 | Ga0206352_11221252 | 3300020078 | Bacteria | 829 |
| 662 | Ga0206350_10374030 | 3300020080 | Bacteria | 613 |
| 663 | Ga0206350_11294616 | 3300020080 | Bacteria | 1328 |
| 664 | Ga0206350_11421611 | 3300020080 | Bacteria | 521 |
| 665 | Ga0206354_10431806 | 3300020081 | Bacteria | 2764 |
| 666 | Ga0206354_10445256 | 3300020081 | Bacteria | 654 |
| 667 | Ga0206354_10750047 | 3300020081 | Bacteria | 2724 |
| 668 | Ga0206354_11141536 | 3300020081 | Bacteria | 1702 |
| 669 | Ga0206354_11265793 | 3300020081 | Bacteria | 763 |
| 670 | Ga0206354_11381198 | 3300020081 | Bacteria | 920 |
| 671 | Ga0206354_11660386 | 3300020081 | Bacteria | 608 |
| 672 | Ga0206353_10158060 | 3300020082 | Bacteria | 601 |
| 673 | Ga0206353_10211368 | 3300020082 | Bacteria | 684 |
| 674 | Ga0206353_10224648 | 3300020082 | Bacteria | 2949 |
| 675 | Ga0206353_11402443 | 3300020082 | Bacteria | 1159 |
| 676 | Ga0206353_11571215 | 3300020082 | Bacteria | 659 |
| 677 | Ga0206353_11776395 | 3300020082 | Bacteria | 632 |
| 678 | Ga0154015_1173053 | 3300020610 | Bacteria | 596 |
| 679 | Ga0154015_1285698 | 3300020610 | Bacteria | 1042 |
| 680 | Ga0213873_10048000 | 3300021358 | Bacteria | 1122 |
| 681 | Ga0213872_10363985 | 3300021361 | Bacteria | 591 |
| 682 | Ga0213874_10109716 | 3300021377 | Bacteria | 926 |
| 683 | Ga0213875_10001074 | 3300021388 | Bacteria | 19149 |
| 684 | Ga0213875_10134582 | 3300021388 | Bacteria | 1156 |
| 685 | Ga0213875_10180928 | 3300021388 | Bacteria | 990 |
| 686 | Ga0224712_10018811 | 3300022467 | Bacteria | 2317 |
| 687 | Ga0224712_10033439 | 3300022467 | Bacteria | 1882 |
| 688 | Ga0224712_10038218 | 3300022467 | Bacteria | 1791 |
| 689 | Ga0224712_10038848 | 3300022467 | Bacteria | 1781 |
| 690 | Ga0224712_10154823 | 3300022467 | Bacteria | 1018 |
| 691 | Ga0224712_10169541 | 3300022467 | Bacteria | 978 |
| 692 | Ga0224712_10539998 | 3300022467 | Bacteria | 566 |
| 693 | Ga0224712_10580348 | 3300022467 | Bacteria | 546 |
| 694 | Ga0247551_104776 | 3300023552 | Bacteria | 550 |
| 695 | Ga0247528_111965 | 3300023680 | Bacteria | 586 |
| 696 | Ga0224572_1016890 | 3300024225 | Bacteria | 1400 |
| 697 | Ga0224572_1039710 | 3300024225 | Bacteria | 889 |
| 698 | Ga0228598_1006679 | 3300024227 | Bacteria | 2379 |
| 699 | Ga0207425_1040092 | 3300025245 | Bacteria | 895 |
| 700 | Ga0209759_1041554 | 3300025256 | Bacteria | 786 |
| 701 | Ga0209129_1000109 | 3300025258 | Bacteria | 153068 |
| 702 | Ga0209673_1075826 | 3300025273 | Bacteria | 785 |
| 703 | Ga0209025_1001288 | 3300025294 | Bacteria | 34293 |
| 704 | Ga0209758_1004710 | 3300025297 | Bacteria | 11130 |
| 705 | Ga0207426_1010098 | 3300025302 | Bacteria | 3689 |
| 706 | Ga0207426_1021647 | 3300025302 | Bacteria | 2220 |
| 707 | Ga0207426_1035840 | 3300025302 | Bacteria | 1581 |
| 708 | Ga0209051_1022745 | 3300025303 | Bacteria | 2629 |
| 709 | Ga0207656_10002744 | 3300025321 | Bacteria | 5973 |
| 710 | Ga0207656_10317020 | 3300025321 | Bacteria | 774 |
| 711 | Ga0207696_1089907 | 3300025711 | Bacteria | 842 |
| 712 | Ga0207713_1015813 | 3300025735 | Bacteria | 3856 |
| 713 | Ga0207713_1069261 | 3300025735 | Bacteria | 1308 |
| 714 | Ga0207713_1187793 | 3300025735 | Bacteria | 641 |
| 715 | Ga0207713_1208068 | 3300025735 | Bacteria | 596 |
| 716 | Ga0207653_10010290 | 3300025885 | Bacteria | 2917 |
| 717 | Ga0207682_10434243 | 3300025893 | Bacteria | 621 |
| 718 | Ga0207692_10003532 | 3300025898 | Bacteria | 6114 |
| 719 | Ga0207692_10061982 | 3300025898 | Bacteria | 1940 |
| 720 | Ga0207692_10283443 | 3300025898 | Bacteria | 1003 |
| 721 | Ga0207692_10435207 | 3300025898 | Bacteria | 823 |
| 722 | Ga0207692_11113518 | 3300025898 | Bacteria | 523 |
| 723 | Ga0207710_10048418 | 3300025900 | Bacteria | 1902 |
| 724 | Ga0207710_10148245 | 3300025900 | Bacteria | 1137 |
| 725 | Ga0207710_10285787 | 3300025900 | Bacteria | 831 |
| 726 | Ga0207688_10005845 | 3300025901 | Bacteria | 6696 |
| 727 | Ga0207688_10202007 | 3300025901 | Bacteria | 1192 |
| 728 | Ga0207680_10092482 | 3300025903 | Bacteria | 1927 |
| 729 | Ga0207680_10990028 | 3300025903 | Bacteria | 602 |
| 730 | Ga0207647_10129790 | 3300025904 | Bacteria | 1482 |
| 731 | Ga0207647_10180858 | 3300025904 | Bacteria | 1225 |
| 732 | Ga0207647_10337524 | 3300025904 | Bacteria | 854 |
| 733 | Ga0207685_10029674 | 3300025905 | Bacteria | 1938 |
| 734 | Ga0207685_10106860 | 3300025905 | Bacteria | 1206 |
| 735 | Ga0207685_10128805 | 3300025905 | Bacteria | 1121 |
| 736 | Ga0207699_10005247 | 3300025906 | Bacteria | 6201 |
| 737 | Ga0207699_10008388 | 3300025906 | Bacteria | 5097 |
| 738 | Ga0207699_10019950 | 3300025906 | Bacteria | 3584 |
| 739 | Ga0207699_10052519 | 3300025906 | Bacteria | 2413 |
| 740 | Ga0207699_10057858 | 3300025906 | Bacteria | 2317 |
| 741 | Ga0207699_10127567 | 3300025906 | Bacteria | 1654 |
| 742 | Ga0207699_11421641 | 3300025906 | Bacteria | 513 |
| 743 | Ga0207645_10125468 | 3300025907 | Bacteria | 1668 |
| 744 | Ga0207645_10140421 | 3300025907 | Bacteria | 1574 |
| 745 | Ga0207643_10000785 | 3300025908 | Bacteria | 19366 |
| 746 | Ga0207643_10097704 | 3300025908 | Bacteria | 1719 |
| 747 | Ga0207705_10008895 | 3300025909 | Bacteria | 7318 |
| 748 | Ga0207705_10330599 | 3300025909 | Bacteria | 1172 |
| 749 | Ga0207705_10462458 | 3300025909 | Bacteria | 984 |
| 750 | Ga0207705_10665820 | 3300025909 | Bacteria | 809 |
| 751 | Ga0207684_10001971 | 3300025910 | Bacteria | 21203 |
| 752 | Ga0207684_10033328 | 3300025910 | Bacteria | 4380 |
| 753 | Ga0207684_10053609 | 3300025910 | Bacteria | 3423 |
| 754 | Ga0207684_10152406 | 3300025910 | Bacteria | 1989 |
| 755 | Ga0207684_10169825 | 3300025910 | Bacteria | 1880 |
| 756 | Ga0207684_10190164 | 3300025910 | Bacteria | 1771 |
| 757 | Ga0207684_10339361 | 3300025910 | Bacteria | 1294 |
| 758 | Ga0207684_11239355 | 3300025910 | Bacteria | 616 |
| 759 | Ga0207684_11326226 | 3300025910 | Bacteria | 592 |
| 760 | Ga0207654_10011556 | 3300025911 | Bacteria | 4505 |
| 761 | Ga0207654_11072503 | 3300025911 | Bacteria | 587 |
| 762 | Ga0207707_10000257 | 3300025912 | Bacteria | 57640 |
| 763 | Ga0207707_10070531 | 3300025912 | Bacteria | 3045 |
| 764 | Ga0207707_10083004 | 3300025912 | Bacteria | 2798 |
| 765 | Ga0207707_10085902 | 3300025912 | Bacteria | 2749 |
| 766 | Ga0207707_10239879 | 3300025912 | Bacteria | 1576 |
| 767 | Ga0207707_10761002 | 3300025912 | Bacteria | 809 |
| 768 | Ga0207707_10961448 | 3300025912 | Bacteria | 703 |
| 769 | Ga0207707_11543701 | 3300025912 | Bacteria | 525 |
| 770 | Ga0207695_10204898 | 3300025913 | Bacteria | 1885 |
| 771 | Ga0207695_10522574 | 3300025913 | Bacteria | 1069 |
| 772 | Ga0207671_10032194 | 3300025914 | Bacteria | 3903 |
| 773 | Ga0207671_10706685 | 3300025914 | Bacteria | 802 |
| 774 | Ga0207693_10049363 | 3300025915 | Bacteria | 3305 |
| 775 | Ga0207693_10140509 | 3300025915 | Bacteria | 1899 |
| 776 | Ga0207693_10245271 | 3300025915 | Bacteria | 1406 |
| 777 | Ga0207693_10880097 | 3300025915 | Bacteria | 688 |
| 778 | Ga0207693_10967246 | 3300025915 | Bacteria | 651 |
| 779 | Ga0207663_10004352 | 3300025916 | Bacteria | 7031 |
| 780 | Ga0207663_10065057 | 3300025916 | Bacteria | 2329 |
| 781 | Ga0207663_10219811 | 3300025916 | Bacteria | 1382 |
| 782 | Ga0207663_10321391 | 3300025916 | Bacteria | 1163 |
| 783 | Ga0207663_10899073 | 3300025916 | Bacteria | 708 |
| 784 | Ga0207660_10000443 | 3300025917 | Bacteria | 27313 |
| 785 | Ga0207660_10010834 | 3300025917 | Bacteria | 5925 |
| 786 | Ga0207660_10032108 | 3300025917 | Bacteria | 3622 |
| 787 | Ga0207660_10271016 | 3300025917 | Bacteria | 1345 |
| 788 | Ga0207660_10294724 | 3300025917 | Bacteria | 1290 |
| 789 | Ga0207660_10681717 | 3300025917 | Bacteria | 838 |
| 790 | Ga0207660_11615416 | 3300025917 | Bacteria | 522 |
| 791 | Ga0207662_10026955 | 3300025918 | Bacteria | 3317 |
| 792 | Ga0207662_10088442 | 3300025918 | Bacteria | 1902 |
| 793 | Ga0207657_10009895 | 3300025919 | Bacteria | 9545 |
| 794 | Ga0207657_10029438 | 3300025919 | Bacteria | 4999 |
| 795 | Ga0207657_10090094 | 3300025919 | Bacteria | 2560 |
| 796 | Ga0207657_10104721 | 3300025919 | Bacteria | 2343 |
| 797 | Ga0207657_10149661 | 3300025919 | Bacteria | 1902 |
| 798 | Ga0207657_10641272 | 3300025919 | Bacteria | 827 |
| 799 | Ga0207649_10007710 | 3300025920 | Bacteria | 5853 |
| 800 | Ga0207649_10280483 | 3300025920 | Bacteria | 1211 |
| 801 | Ga0207652_10000070 | 3300025921 | Bacteria | 109705 |
| 802 | Ga0207652_10006407 | 3300025921 | Bacteria | 9495 |
| 803 | Ga0207652_10013800 | 3300025921 | Bacteria | 6535 |
| 804 | Ga0207652_10039314 | 3300025921 | Bacteria | 4014 |
| 805 | Ga0207652_10292989 | 3300025921 | Bacteria | 1468 |
| 806 | Ga0207652_10411397 | 3300025921 | Bacteria | 1220 |
| 807 | Ga0207652_10412404 | 3300025921 | Bacteria | 1218 |
| 808 | Ga0207652_10670105 | 3300025921 | Bacteria | 927 |
| 809 | Ga0207652_11499633 | 3300025921 | Bacteria | 578 |
| 810 | Ga0207652_11760923 | 3300025921 | Bacteria | 524 |
| 811 | Ga0207646_10000180 | 3300025922 | Bacteria | 86389 |
| 812 | Ga0207646_10003225 | 3300025922 | Bacteria | 18622 |
| 813 | Ga0207646_10072175 | 3300025922 | Bacteria | 3083 |
| 814 | Ga0207646_10170346 | 3300025922 | Bacteria | 1966 |
| 815 | Ga0207646_10410649 | 3300025922 | Bacteria | 1223 |
| 816 | Ga0207646_10639852 | 3300025922 | Bacteria | 953 |
| 817 | Ga0207646_11344708 | 3300025922 | Bacteria | 623 |
| 818 | Ga0207694_10263491 | 3300025924 | Bacteria | 1412 |
| 819 | Ga0207694_10815868 | 3300025924 | Bacteria | 788 |
| 820 | Ga0207694_11368813 | 3300025924 | Bacteria | 598 |
| 821 | Ga0207650_10007339 | 3300025925 | Bacteria | 7505 |
| 822 | Ga0207650_10301782 | 3300025925 | Bacteria | 1308 |
| 823 | Ga0207650_10792471 | 3300025925 | Bacteria | 803 |
| 824 | Ga0207659_10076357 | 3300025926 | Bacteria | 2462 |
| 825 | Ga0207659_10538630 | 3300025926 | Bacteria | 991 |
| 826 | Ga0207659_11045978 | 3300025926 | Bacteria | 702 |
| 827 | Ga0207687_10004699 | 3300025927 | Bacteria | 9083 |
| 828 | Ga0207687_10085074 | 3300025927 | Bacteria | 2294 |
| 829 | Ga0207687_10145689 | 3300025927 | Bacteria | 1802 |
| 830 | Ga0207687_10253750 | 3300025927 | Bacteria | 1399 |
| 831 | Ga0207687_10430985 | 3300025927 | Bacteria | 1090 |
| 832 | Ga0207700_10002172 | 3300025928 | Bacteria | 11238 |
| 833 | Ga0207700_10004822 | 3300025928 | Bacteria | 8005 |
| 834 | Ga0207700_10053681 | 3300025928 | Bacteria | 3021 |
| 835 | Ga0207700_10078649 | 3300025928 | Bacteria | 2566 |
| 836 | Ga0207700_10110485 | 3300025928 | Bacteria | 2211 |
| 837 | Ga0207700_10138114 | 3300025928 | Bacteria | 1999 |
| 838 | Ga0207700_10218242 | 3300025928 | Bacteria | 1615 |
| 839 | Ga0207700_10377698 | 3300025928 | Bacteria | 1239 |
| 840 | Ga0207700_10447459 | 3300025928 | Bacteria | 1138 |
| 841 | Ga0207700_10631391 | 3300025928 | Bacteria | 954 |
| 842 | Ga0207664_10000298 | 3300025929 | Bacteria | 37109 |
| 843 | Ga0207664_10001524 | 3300025929 | Bacteria | 15198 |
| 844 | Ga0207664_10001845 | 3300025929 | Bacteria | 13970 |
| 845 | Ga0207664_10003186 | 3300025929 | Bacteria | 10906 |
| 846 | Ga0207664_10009124 | 3300025929 | Bacteria | 6948 |
| 847 | Ga0207664_10145876 | 3300025929 | Bacteria | 2007 |
| 848 | Ga0207664_10178957 | 3300025929 | Bacteria | 1819 |
| 849 | Ga0207664_10184829 | 3300025929 | Bacteria | 1791 |
| 850 | Ga0207664_10185885 | 3300025929 | Bacteria | 1786 |
| 851 | Ga0207664_10391912 | 3300025929 | Bacteria | 1234 |
| 852 | Ga0207664_10432426 | 3300025929 | Bacteria | 1173 |
| 853 | Ga0207664_10482268 | 3300025929 | Bacteria | 1109 |
| 854 | Ga0207664_10555525 | 3300025929 | Bacteria | 1030 |
| 855 | Ga0207664_10624254 | 3300025929 | Bacteria | 968 |
| 856 | Ga0207664_10709886 | 3300025929 | Bacteria | 904 |
| 857 | Ga0207664_10758987 | 3300025929 | Bacteria | 872 |
| 858 | Ga0207644_10330883 | 3300025931 | Bacteria | 1233 |
| 859 | Ga0207644_10472008 | 3300025931 | Bacteria | 1032 |
| 860 | Ga0207644_10670477 | 3300025931 | Bacteria | 864 |
| 861 | Ga0207644_11566601 | 3300025931 | Bacteria | 553 |
| 862 | Ga0207644_11571817 | 3300025931 | Bacteria | 552 |
| 863 | Ga0207690_10000219 | 3300025932 | Bacteria | 43461 |
| 864 | Ga0207690_10016824 | 3300025932 | Bacteria | 4456 |
| 865 | Ga0207690_10184443 | 3300025932 | Bacteria | 1573 |
| 866 | Ga0207690_10916477 | 3300025932 | Bacteria | 727 |
| 867 | Ga0207706_10072026 | 3300025933 | Bacteria | 3040 |
| 868 | Ga0207706_10103797 | 3300025933 | Bacteria | 2501 |
| 869 | Ga0207686_10070926 | 3300025934 | Bacteria | 2240 |
| 870 | Ga0207686_10085700 | 3300025934 | Bacteria | 2067 |
| 871 | Ga0207686_10182120 | 3300025934 | Bacteria | 1490 |
| 872 | Ga0207686_10396874 | 3300025934 | Bacteria | 1050 |
| 873 | Ga0207686_11003919 | 3300025934 | Bacteria | 677 |
| 874 | Ga0207709_10051993 | 3300025935 | Bacteria | 2513 |
| 875 | Ga0207709_10149879 | 3300025935 | Bacteria | 1614 |
| 876 | Ga0207709_10260330 | 3300025935 | Bacteria | 1272 |
| 877 | Ga0207709_10683302 | 3300025935 | Bacteria | 820 |
| 878 | Ga0207670_10280515 | 3300025936 | Bacteria | 1298 |
| 879 | Ga0207670_10404127 | 3300025936 | Bacteria | 1092 |
| 880 | Ga0207669_10138738 | 3300025937 | Bacteria | 1684 |
| 881 | Ga0207669_11108928 | 3300025937 | Bacteria | 668 |
| 882 | Ga0207669_11368232 | 3300025937 | Bacteria | 602 |
| 883 | Ga0207704_10694076 | 3300025938 | Bacteria | 842 |
| 884 | Ga0207704_10800144 | 3300025938 | Bacteria | 787 |
| 885 | Ga0207704_11471486 | 3300025938 | Bacteria | 584 |
| 886 | Ga0207665_10000657 | 3300025939 | Bacteria | 23270 |
| 887 | Ga0207665_10023462 | 3300025939 | Bacteria | 4065 |
| 888 | Ga0207665_10064239 | 3300025939 | Bacteria | 2494 |
| 889 | Ga0207665_10229302 | 3300025939 | Bacteria | 1364 |
| 890 | Ga0207691_10006993 | 3300025940 | Bacteria | 10888 |
| 891 | Ga0207691_10292907 | 3300025940 | Bacteria | 1399 |
| 892 | Ga0207691_10978209 | 3300025940 | Bacteria | 707 |
| 893 | Ga0207711_10247142 | 3300025941 | Bacteria | 1637 |
| 894 | Ga0207711_10355742 | 3300025941 | Bacteria | 1356 |
| 895 | Ga0207711_11487377 | 3300025941 | Bacteria | 620 |
| 896 | Ga0207689_10006217 | 3300025942 | Bacteria | 10576 |
| 897 | Ga0207689_10038661 | 3300025942 | Bacteria | 3951 |
| 898 | Ga0207689_10796465 | 3300025942 | Bacteria | 798 |
| 899 | Ga0207661_10000336 | 3300025944 | Bacteria | 29965 |
| 900 | Ga0207661_10182423 | 3300025944 | Bacteria | 1834 |
| 901 | Ga0207661_10215294 | 3300025944 | Bacteria | 1695 |
| 902 | Ga0207661_10669166 | 3300025944 | Bacteria | 954 |
| 903 | Ga0207661_11065429 | 3300025944 | Bacteria | 744 |
| 904 | Ga0207661_11118335 | 3300025944 | Bacteria | 725 |
| 905 | Ga0207679_10001066 | 3300025945 | Bacteria | 17442 |
| 906 | Ga0207679_10322244 | 3300025945 | Bacteria | 1339 |
| 907 | Ga0207679_10612563 | 3300025945 | Bacteria | 982 |
| 908 | Ga0207679_11558178 | 3300025945 | Bacteria | 606 |
| 909 | Ga0207667_10274291 | 3300025949 | Bacteria | 1724 |
| 910 | Ga0207667_10426342 | 3300025949 | Bacteria | 1349 |
| 911 | Ga0207667_10787716 | 3300025949 | Bacteria | 948 |
| 912 | Ga0207667_11077547 | 3300025949 | Bacteria | 788 |
| 913 | Ga0207667_11743916 | 3300025949 | Bacteria | 588 |
| 914 | Ga0207651_10091623 | 3300025960 | Bacteria | 2226 |
| 915 | Ga0207651_10212793 | 3300025960 | Bacteria | 1557 |
| 916 | Ga0207712_10486292 | 3300025961 | Bacteria | 1053 |
| 917 | Ga0207712_10509532 | 3300025961 | Bacteria | 1030 |
| 918 | Ga0207712_10919774 | 3300025961 | Bacteria | 774 |
| 919 | Ga0207668_11605737 | 3300025972 | Bacteria | 587 |
| 920 | Ga0207640_10031537 | 3300025981 | Bacteria | 3276 |
| 921 | Ga0207640_11383406 | 3300025981 | Bacteria | 630 |
| 922 | Ga0207658_10012955 | 3300025986 | Bacteria | 5696 |
| 923 | Ga0207658_10147132 | 3300025986 | Bacteria | 1915 |
| 924 | Ga0207658_10928694 | 3300025986 | Bacteria | 793 |
| 925 | Ga0207658_11503540 | 3300025986 | Bacteria | 616 |
| 926 | Ga0207658_11610945 | 3300025986 | Bacteria | 593 |
| 927 | Ga0207677_10019593 | 3300026023 | Bacteria | 4090 |
| 928 | Ga0207677_10251985 | 3300026023 | Bacteria | 1434 |
| 929 | Ga0207677_10592148 | 3300026023 | Bacteria | 972 |
| 930 | Ga0207677_10721886 | 3300026023 | Bacteria | 886 |
| 931 | Ga0207677_11523031 | 3300026023 | Bacteria | 618 |
| 932 | Ga0207703_10234602 | 3300026035 | Bacteria | 1646 |
| 933 | Ga0207703_10395638 | 3300026035 | Bacteria | 1281 |
| 934 | Ga0207703_10852492 | 3300026035 | Bacteria | 871 |
| 935 | Ga0207703_10981002 | 3300026035 | Bacteria | 810 |
| 936 | Ga0207703_11790484 | 3300026035 | Bacteria | 590 |
| 937 | Ga0207639_10056849 | 3300026041 | Bacteria | 3000 |
| 938 | Ga0207639_11183784 | 3300026041 | Bacteria | 717 |
| 939 | Ga0207678_10001106 | 3300026067 | Bacteria | 24706 |
| 940 | Ga0207678_10070312 | 3300026067 | Bacteria | 3001 |
| 941 | Ga0207678_10085601 | 3300026067 | Bacteria | 2694 |
| 942 | Ga0207678_10880553 | 3300026067 | Bacteria | 791 |
| 943 | Ga0207678_11050358 | 3300026067 | Bacteria | 721 |
| 944 | Ga0207708_10009638 | 3300026075 | Bacteria | 7162 |
| 945 | Ga0207708_10102554 | 3300026075 | Bacteria | 2215 |
| 946 | Ga0207708_10516949 | 3300026075 | Bacteria | 1003 |
| 947 | Ga0207708_12014051 | 3300026075 | Bacteria | 505 |
| 948 | Ga0207702_10041776 | 3300026078 | Bacteria | 3845 |
| 949 | Ga0207702_10373661 | 3300026078 | Bacteria | 1369 |
| 950 | Ga0207702_10569475 | 3300026078 | Bacteria | 1109 |
| 951 | Ga0207702_10738716 | 3300026078 | Bacteria | 971 |
| 952 | Ga0207702_10940286 | 3300026078 | Bacteria | 857 |
| 953 | Ga0207702_11012825 | 3300026078 | Bacteria | 824 |
| 954 | Ga0207702_11229571 | 3300026078 | Bacteria | 743 |
| 955 | Ga0207641_10138939 | 3300026088 | Bacteria | 2189 |
| 956 | Ga0207641_10464178 | 3300026088 | Bacteria | 1225 |
| 957 | Ga0207641_10666830 | 3300026088 | Bacteria | 1022 |
| 958 | Ga0207641_11228017 | 3300026088 | Bacteria | 749 |
| 959 | Ga0207641_12122744 | 3300026088 | Bacteria | 562 |
| 960 | Ga0207648_10100745 | 3300026089 | Bacteria | 2531 |
| 961 | Ga0207648_10902268 | 3300026089 | Bacteria | 826 |
| 962 | Ga0207648_11117755 | 3300026089 | Bacteria | 739 |
| 963 | Ga0207648_11203373 | 3300026089 | Bacteria | 712 |
| 964 | Ga0207648_11784803 | 3300026089 | Bacteria | 577 |
| 965 | Ga0207676_10000648 | 3300026095 | Bacteria | 27886 |
| 966 | Ga0207676_10998509 | 3300026095 | Bacteria | 824 |
| 967 | Ga0207676_11928961 | 3300026095 | Bacteria | 589 |
| 968 | Ga0207676_11935980 | 3300026095 | Bacteria | 588 |
| 969 | Ga0207674_10011766 | 3300026116 | Bacteria | 9818 |
| 970 | Ga0207674_10132094 | 3300026116 | Bacteria | 2459 |
| 971 | Ga0207674_10627488 | 3300026116 | Bacteria | 1038 |
| 972 | Ga0207674_11452112 | 3300026116 | Bacteria | 655 |
| 973 | Ga0207675_100021849 | 3300026118 | Bacteria | 5957 |
| 974 | Ga0207675_100359039 | 3300026118 | Bacteria | 1429 |
| 975 | Ga0207675_100397646 | 3300026118 | Bacteria | 1357 |
| 976 | Ga0207675_100700662 | 3300026118 | Bacteria | 1022 |
| 977 | Ga0207675_101174281 | 3300026118 | Bacteria | 788 |
| 978 | Ga0207683_10001393 | 3300026121 | Bacteria | 21815 |
| 979 | Ga0207683_10028516 | 3300026121 | Bacteria | 4827 |
| 980 | Ga0207683_10608142 | 3300026121 | Bacteria | 1012 |
| 981 | Ga0207683_11309190 | 3300026121 | Bacteria | 671 |
| 982 | Ga0207698_10607498 | 3300026142 | Bacteria | 1079 |
| 983 | Ga0207698_10714364 | 3300026142 | Bacteria | 998 |
| 984 | Ga0209179_1125150 | 3300027512 | Bacteria | 574 |
| 985 | Ga0207428_10003435 | 3300027907 | Bacteria | 15399 |
| 986 | Ga0207428_10264295 | 3300027907 | Bacteria | 1281 |
| 987 | Ga0268266_10132557 | 3300028379 | Bacteria | 2230 |
| 988 | Ga0268266_10244148 | 3300028379 | Bacteria | 1658 |
| 989 | Ga0268266_11156271 | 3300028379 | Bacteria | 748 |
| 990 | Ga0268265_10109619 | 3300028380 | Bacteria | 2251 |
| 991 | Ga0268265_10769483 | 3300028380 | Bacteria | 936 |
| 992 | Ga0268264_10346751 | 3300028381 | Bacteria | 1412 |
| 993 | Ga0268264_12003302 | 3300028381 | Bacteria | 588 |
| 994 | Ga0265337_1000015 | 3300028556 | Bacteria | 80871 |
| 995 | Ga0265326_10017844 | 3300028558 | Bacteria | 2044 |
| 996 | Ga0265319_1001246 | 3300028563 | Bacteria | 15553 |
| 997 | Ga0265334_10000373 | 3300028573 | Bacteria | 23956 |
| 998 | Ga0265322_10012472 | 3300028654 | Bacteria | 2459 |
| 999 | Ga0265336_10004317 | 3300028666 | Bacteria | 5394 |
| 1000 | Ga0307517_10008703 | 3300028786 | Bacteria | 14521 |
| 1001 | Ga0307517_10576044 | 3300028786 | Bacteria | 558 |
| 1002 | Ga0265338_10003873 | 3300028800 | Bacteria | 20722 |
| 1003 | Ga0265338_10007479 | 3300028800 | Bacteria | 13536 |
| 1004 | Ga0265338_10014640 | 3300028800 | Bacteria | 8701 |
| 1005 | Ga0265338_11166024 | 3300028800 | Bacteria | 517 |
| 1006 | Ga0311003_101840 | 3300029282 | Bacteria | 545 |
| 1007 | Ga0265324_10002740 | 3300029957 | Bacteria | 8757 |
| 1008 | Ga0268256_1018028 | 3300030500 | Bacteria | 1973 |
| 1009 | Ga0307511_10136404 | 3300030521 | Bacteria | 1459 |
| 1010 | Ga0307511_10142565 | 3300030521 | Bacteria | 1402 |
| 1011 | Ga0307511_10276720 | 3300030521 | Bacteria | 780 |
| 1012 | Ga0265762_1085621 | 3300030760 | Bacteria | 681 |
| 1013 | Ga0265762_1087115 | 3300030760 | Bacteria | 676 |
| 1014 | Ga0265766_1022293 | 3300030863 | Bacteria | 528 |
| 1015 | Ga0265770_1039554 | 3300030878 | Bacteria | 820 |
| 1016 | Ga0265764_111591 | 3300030882 | Bacteria | 571 |
| 1017 | Ga0265761_110884 | 3300030889 | Bacteria | 532 |
| 1018 | Ga0265768_109562 | 3300030963 | Bacteria | 614 |
| 1019 | Ga0265771_1002017 | 3300031010 | Bacteria | 1042 |
| 1020 | Ga0265771_1013123 | 3300031010 | Bacteria | 640 |
| 1021 | Ga0265774_103887 | 3300031011 | Bacteria | 605 |
| 1022 | Ga0265760_10006434 | 3300031090 | Bacteria | 3360 |
| 1023 | Ga0265760_10069611 | 3300031090 | Bacteria | 1078 |
| 1024 | Ga0265760_10113006 | 3300031090 | Bacteria | 866 |
| 1025 | Ga0265330_10212907 | 3300031235 | Bacteria | 816 |
| 1026 | Ga0265332_10001675 | 3300031238 | Bacteria | 12103 |
| 1027 | Ga0265332_10058380 | 3300031238 | Bacteria | 1651 |
| 1028 | Ga0265332_10474348 | 3300031238 | Bacteria | 518 |
| 1029 | Ga0265320_10001898 | 3300031240 | Bacteria | 14748 |
| 1030 | Ga0265320_10041316 | 3300031240 | Bacteria | 2293 |
| 1031 | Ga0265325_10015321 | 3300031241 | Bacteria | 4312 |
| 1032 | Ga0265325_10060617 | 3300031241 | Bacteria | 1921 |
| 1033 | Ga0265340_10003540 | 3300031247 | Bacteria | 8788 |
| 1034 | Ga0265340_10004519 | 3300031247 | Bacteria | 7758 |
| 1035 | Ga0265340_10082220 | 3300031247 | Bacteria | 1515 |
| 1036 | Ga0265339_10000762 | 3300031249 | Bacteria | 24924 |
| 1037 | Ga0265339_10014234 | 3300031249 | Bacteria | 4799 |
| 1038 | Ga0265331_10028427 | 3300031250 | Bacteria | 2796 |
| 1039 | Ga0265331_10246008 | 3300031250 | Bacteria | 802 |
| 1040 | Ga0265316_10006862 | 3300031344 | Bacteria | 10811 |
| 1041 | Ga0265316_10154230 | 3300031344 | Bacteria | 1719 |
| 1042 | Ga0307509_10009190 | 3300031507 | Bacteria | 12410 |
| 1043 | Ga0307408_100053565 | 3300031548 | Bacteria | 2914 |
| 1044 | Ga0307408_100437564 | 3300031548 | Bacteria | 1131 |
| 1045 | Ga0307408_101472446 | 3300031548 | Bacteria | 643 |
| 1046 | Ga0310117_121880 | 3300031592 | Bacteria | 636 |
| 1047 | Ga0265313_10090959 | 3300031595 | Bacteria | 1370 |
| 1048 | Ga0310107_133548 | 3300031615 | Bacteria | 562 |
| 1049 | Ga0307508_10042905 | 3300031616 | Bacteria | 4054 |
| 1050 | Ga0307508_10049088 | 3300031616 | Bacteria | 3758 |
| 1051 | Ga0307508_10436673 | 3300031616 | Bacteria | 901 |
| 1052 | Ga0307514_10175696 | 3300031649 | Bacteria | 1390 |
| 1053 | Ga0310111_125385 | 3300031667 | Bacteria | 704 |
| 1054 | Ga0310111_140077 | 3300031667 | Bacteria | 525 |
| 1055 | Ga0265314_10005562 | 3300031711 | Bacteria | 11331 |
| 1056 | Ga0265314_10016664 | 3300031711 | Bacteria | 5794 |
| 1057 | Ga0265314_10048633 | 3300031711 | Bacteria | 2974 |
| 1058 | Ga0265342_10006989 | 3300031712 | Bacteria | 8336 |
| 1059 | Ga0265342_10033693 | 3300031712 | Bacteria | 3146 |
| 1060 | Ga0265342_10036408 | 3300031712 | Bacteria | 3007 |
| 1061 | Ga0307516_10056359 | 3300031730 | Bacteria | 3832 |
| 1062 | Ga0307516_10068332 | 3300031730 | Bacteria | 3422 |
| 1063 | Ga0307405_10583633 | 3300031731 | Bacteria | 909 |
| 1064 | Ga0316044_123521 | 3300031810 | Bacteria | 619 |
| 1065 | Ga0307413_10154461 | 3300031824 | Bacteria | 1603 |
| 1066 | Ga0307413_10239047 | 3300031824 | Bacteria | 1340 |
| 1067 | Ga0307413_10428832 | 3300031824 | Bacteria | 1043 |
| 1068 | Ga0307413_10783646 | 3300031824 | Bacteria | 800 |
| 1069 | Ga0307410_10018684 | 3300031852 | Bacteria | 4194 |
| 1070 | Ga0307410_10041314 | 3300031852 | Bacteria | 3040 |
| 1071 | Ga0307410_10461216 | 3300031852 | Bacteria | 1038 |
| 1072 | Ga0307410_10517336 | 3300031852 | Bacteria | 984 |
| 1073 | Ga0307410_10585933 | 3300031852 | Bacteria | 929 |
| 1074 | Ga0307406_10061971 | 3300031901 | Bacteria | 2418 |
| 1075 | Ga0307406_10091864 | 3300031901 | Bacteria | 2045 |
| 1076 | Ga0307406_10326390 | 3300031901 | Bacteria | 1189 |
| 1077 | Ga0307407_10270552 | 3300031903 | Bacteria | 1172 |
| 1078 | Ga0307407_10272626 | 3300031903 | Bacteria | 1168 |
| 1079 | Ga0307412_11657115 | 3300031911 | Bacteria | 585 |
| 1080 | Ga0307409_100251429 | 3300031995 | Bacteria | 1616 |
| 1081 | Ga0307409_100316575 | 3300031995 | Bacteria | 1458 |
| 1082 | Ga0307409_100568728 | 3300031995 | Bacteria | 1115 |
| 1083 | Ga0307409_100586607 | 3300031995 | Bacteria | 1099 |
| 1084 | Ga0307409_100767361 | 3300031995 | Bacteria | 969 |
| 1085 | Ga0307409_100778866 | 3300031995 | Bacteria | 962 |
| 1086 | Ga0307409_100997431 | 3300031995 | Bacteria | 855 |
| 1087 | Ga0307409_102105659 | 3300031995 | Bacteria | 594 |
| 1088 | Ga0307416_100035506 | 3300032002 | Bacteria | 3808 |
| 1089 | Ga0307416_100229736 | 3300032002 | Bacteria | 1787 |
| 1090 | Ga0307416_100482859 | 3300032002 | Bacteria | 1299 |
| 1091 | Ga0307416_101073035 | 3300032002 | Bacteria | 909 |
| 1092 | Ga0307416_101966629 | 3300032002 | Bacteria | 687 |
| 1093 | Ga0307416_103054440 | 3300032002 | Bacteria | 560 |
| 1094 | Ga0307414_10157413 | 3300032004 | Bacteria | 1800 |
| 1095 | Ga0307411_10046422 | 3300032005 | Bacteria | 2800 |
| 1096 | Ga0307411_11889445 | 3300032005 | Bacteria | 556 |
| 1097 | Ga0307411_12002959 | 3300032005 | Bacteria | 540 |
| 1098 | Ga0307507_10000013 | 3300033179 | Bacteria | 242708 |
| 1099 | Ga0307507_10331584 | 3300033179 | Bacteria | 908 |
| 1100 | Ga0307507_10620089 | 3300033179 | Bacteria | 555 |
| 1101 | Ga0307510_10144369 | 3300033180 | Bacteria | 2016 |
| 1102 | Ga0316214_1000482 | 3300033545 | Bacteria | 4073 |
| 1103 | Ga0316214_1003948 | 3300033545 | Bacteria | 1892 |
| 1104 | Ga0316212_1003331 | 3300033547 | Bacteria | 2316 |
| 1105 | Ga0373930_0109559 | 3300034816 | Bacteria | 663 |
| 1106 | Ga0373948_0041310 | 3300034817 | Bacteria | 966 |
| 1107 | Ga0373950_0090347 | 3300034818 | Bacteria | 650 |
| 1108 | Ga0373958_0006992 | 3300034819 | Bacteria | 1781 |
| 1109 | Ga0373959_0005926 | 3300034820 | Bacteria | 2014 |
| 1110 | Ga0373926_0024276 | 3300035083 | Bacteria | 2110 |
| 1111 | Ga0373926_0038845 | 3300035083 | Bacteria | 1696 |
| 1112 | Ga0373929_0074912 | 3300035085 | Bacteria | 815 |
| 1113 | Ga0373934_0006708 | 3300035086 | Bacteria | 4277 |
| 1114 | Ga0373934_0016099 | 3300035086 | Bacteria | 2840 |
| 1115 | Ga0373934_0020722 | 3300035086 | Bacteria | 2528 |
| 1116 | Ga0373934_0065600 | 3300035086 | Bacteria | 1449 |
| 1117 | Ga0373934_0077028 | 3300035086 | Bacteria | 1337 |
| 1118 | Ga0373934_0326016 | 3300035086 | Bacteria | 638 |
| 1119 | Ga0373940_0162500 | 3300035088 | Bacteria | 717 |
| 1120 | Ga0373944_0054981 | 3300035089 | Bacteria | 1263 |
| 1121 | Ga0373944_0266351 | 3300035089 | Bacteria | 636 |
| 1122 | Ga0373951_0015579 | 3300035091 | Bacteria | 1713 |
| 1123 | Ga0373951_0162768 | 3300035091 | Bacteria | 632 |
| 1124 | Ga0373952_0255440 | 3300035092 | Bacteria | 532 |
| 1125 | Ga0373923_0014721 | 3300035111 | Bacteria | 2943 |
| 1126 | Ga0373923_0188582 | 3300035111 | Bacteria | 949 |
| 1127 | Ga0373923_0222494 | 3300035111 | Bacteria | 877 |
| 1128 | Ga0373923_0423120 | 3300035111 | Bacteria | 643 |
| 1129 | Ga0373932_0349125 | 3300035112 | Bacteria | 562 |
| 1130 | Ga0373936_0001178 | 3300035113 | Bacteria | 9397 |
| 1131 | Ga0373936_0063067 | 3300035113 | Bacteria | 1516 |
| 1132 | Ga0373936_0199673 | 3300035113 | Bacteria | 882 |
| 1133 | Ga0373936_0311106 | 3300035113 | Bacteria | 712 |
| 1134 | Ga0373941_0100267 | 3300035115 | Bacteria | 1007 |
| 1135 | Ga0373941_0324149 | 3300035115 | Bacteria | 620 |
| 1136 | Ga0373945_0157682 | 3300035116 | Bacteria | 923 |
| 1137 | Ga0373945_0167148 | 3300035116 | Bacteria | 899 |
| 1138 | Ga0373945_0296159 | 3300035116 | Bacteria | 692 |
| 1139 | Ga0373945_0423426 | 3300035116 | Bacteria | 586 |
| 1140 | Ga0373945_0465205 | 3300035116 | Bacteria | 560 |
| 1141 | Ga0373953_0001772 | 3300035117 | Bacteria | 6373 |
| 1142 | Ga0373953_0043953 | 3300035117 | Bacteria | 1785 |
| 1143 | Ga0373953_0079348 | 3300035117 | Bacteria | 1362 |
| 1144 | Ga0373953_0421401 | 3300035117 | Bacteria | 588 |
| 1145 | Ga0373954_0027830 | 3300035118 | Bacteria | 2597 |
| 1146 | Ga0373954_0048362 | 3300035118 | Bacteria | 1992 |
| 1147 | Ga0373954_0097558 | 3300035118 | Bacteria | 1416 |
| 1148 | Ga0373954_0194369 | 3300035118 | Bacteria | 996 |
| 1149 | Ga0373956_0000844 | 3300035119 | Bacteria | 12743 |
| 1150 | Ga0373956_0031323 | 3300035119 | Bacteria | 2330 |
| 1151 | Ga0373956_0034924 | 3300035119 | Bacteria | 2215 |
| 1152 | Ga0373956_0050919 | 3300035119 | Bacteria | 1860 |
| 1153 | Ga0373957_0000011 | 3300035120 | Bacteria | 47051 |
| 1154 | Ga0373957_0037568 | 3300035120 | Bacteria | 1809 |
| 1155 | Ga0373957_0101528 | 3300035120 | Bacteria | 1152 |
| 1156 | Ga0373957_0171550 | 3300035120 | Bacteria | 896 |
| 1157 | Ga0373957_0200007 | 3300035120 | Bacteria | 832 |
| 1158 | Ga0373960_0091762 | 3300035121 | Bacteria | 972 |
| 1159 | Ga0373960_0137114 | 3300035121 | Bacteria | 825 |
| 1160 | Ga0373943_0081332 | 3300035170 | Bacteria | 1661 |
| 1161 | Ga0373943_0151010 | 3300035170 | Bacteria | 1258 |
| 1162 | Ga0373943_0221704 | 3300035170 | Bacteria | 1053 |
| 1163 | Ga0373943_0535043 | 3300035170 | Bacteria | 687 |
| 1164 | Ga0373946_0066712 | 3300035171 | Bacteria | 1543 |
| 1165 | Ga0373946_0071884 | 3300035171 | Bacteria | 1496 |
| 1166 | Ga0373946_0289756 | 3300035171 | Bacteria | 807 |
| 1167 | Ga0373946_0410365 | 3300035171 | Bacteria | 685 |
| 1168 | Ga0373955_0000060 | 3300035172 | Bacteria | 42697 |
| 1169 | Ga0373955_0014764 | 3300035172 | Bacteria | 3809 |
| 1170 | Ga0373955_0140143 | 3300035172 | Bacteria | 1417 |
| 1171 | Ga0373955_0325507 | 3300035172 | Bacteria | 929 |
| 1172 | Ga0373955_0486184 | 3300035172 | Bacteria | 753 |
| 1173 | Ga0373942_0047227 | 3300035207 | Bacteria | 1195 |
| 1174 | Ga0373942_0272647 | 3300035207 | Bacteria | 580 |
| 1175 | Ga0373924_0000672 | 3300035410 | Bacteria | 10628 |
| 1176 | Ga0373924_0019378 | 3300035410 | Bacteria | 2636 |
| 1177 | Ga0373924_0021188 | 3300035410 | Bacteria | 2534 |
| 1178 | Ga0373924_0066473 | 3300035410 | Bacteria | 1515 |
| 1179 | Ga0373924_0585618 | 3300035410 | Bacteria | 503 |
| 1180 | Ga0373931_0091826 | 3300035691 | Bacteria | 1693 |
| 1181 | Ga0373931_0098523 | 3300035691 | Bacteria | 1641 |
| 1182 | Ga0373931_0142313 | 3300035691 | Bacteria | 1390 |
| 1183 | Ga0373931_0836462 | 3300035691 | Bacteria | 615 |
| 1184 | Ga0373935_0004616 | 3300035692 | Bacteria | 8095 |
| 1185 | Ga0373935_0016967 | 3300035692 | Bacteria | 4409 |
| 1186 | Ga0373935_0305980 | 3300035692 | Bacteria | 1124 |
| 1187 | Ga0373935_0338594 | 3300035692 | Bacteria | 1071 |
| 1188 | Ga0373927_0024730 | 3300035695 | Bacteria | 3924 |
| 1189 | Ga0373927_0108817 | 3300035695 | Bacteria | 1805 |
| 1190 | Ga0373927_0157259 | 3300035695 | Bacteria | 1489 |
| 1191 | Ga0373927_0579698 | 3300035695 | Bacteria | 741 |
| 1192 | Ga0373933_0014325 | 3300035724 | Bacteria | 4409 |
| 1193 | Ga0373933_0016385 | 3300035724 | Bacteria | 4143 |
| 1194 | Ga0373933_0133630 | 3300035724 | Bacteria | 1561 |
| 1195 | Ga0373933_0248337 | 3300035724 | Bacteria | 1145 |
| 1196 | Ga0373933_0463129 | 3300035724 | Bacteria | 829 |
| 1197 | Ga0373947_0061727 | 3300035725 | Bacteria | 2278 |
| 1198 | Ga0373947_0093287 | 3300035725 | Bacteria | 1881 |
| 1199 | Ga0373947_0336826 | 3300035725 | Bacteria | 1010 |
| 1200 | Ga0373947_0528508 | 3300035725 | Bacteria | 802 |
| 1201 | Ga0310104_20196 | 3300036242 | Bacteria | 502 |
| 1202 | Ga0373937_0000110 | 3300036401 | Bacteria | 77832 |
| 1203 | Ga0373937_0030844 | 3300036401 | Bacteria | 4855 |
| 1204 | Ga0373937_0037069 | 3300036401 | Bacteria | 4444 |
| 1205 | Ga0373937_0269908 | 3300036401 | Bacteria | 1605 |
| 1206 | Ga0373937_0271984 | 3300036401 | Bacteria | 1599 |
| 1207 | Ga0373937_0366169 | 3300036401 | Bacteria | 1366 |
| 1208 | Ga0373937_0808561 | 3300036401 | Bacteria | 885 |
| 1209 | Ga0265778_024529 | 3300036457 | Bacteria | 758 |
| 1210 | Ga0373925_0000540 | 3300037068 | Bacteria | 37332 |
| 1211 | Ga0373925_0005130 | 3300037068 | Bacteria | 9813 |
| 1212 | Ga0373925_0019497 | 3300037068 | Bacteria | 4934 |
| 1213 | Ga0373925_0108373 | 3300037068 | Bacteria | 2143 |
| 1214 | Ga0373925_0188311 | 3300037068 | Bacteria | 1636 |
| 1215 | Ga0373925_0357750 | 3300037068 | Bacteria | 1186 |
| 1216 | Ga0373925_0466959 | 3300037068 | Bacteria | 1034 |
| 1217 | Ga0373925_1196327 | 3300037068 | Bacteria | 624 |
| 1218 | Ga0395900_0186888 | 3300037418 | Bacteria | 2103 |
| 1219 | Ga0395898_0408457 | 3300037466 | Bacteria | 1294 |
| 1220 | Ga0395898_0550320 | 3300037466 | Bacteria | 1096 |
| 1221 | Ga0395898_0955662 | 3300037466 | Bacteria | 794 |
| 1222 | Ga0395905_0441340 | 3300037471 | Bacteria | 1199 |
| 1223 | Ga0436364_0081229 | 3300037853 | Bacteria | 3392 |
| 1224 | Ga0436364_0098049 | 3300037853 | Bacteria | 1373 |
| 1225 | Ga0436364_0243023 | 3300037853 | Bacteria | 1549 |
| 1226 | Ga0436364_0479741 | 3300037853 | Bacteria | 5755 |
| 1227 | Ga0436364_0718628 | 3300037853 | Bacteria | 574 |
| 1228 | Ga0436364_1098280 | 3300037853 | Bacteria | 1651 |
| 1229 | Ga0436364_1174043 | 3300037853 | Bacteria | 9620 |
| 1230 | Ga0436364_1263484 | 3300037853 | Bacteria | 906 |
| 1231 | Ga0436364_1272150 | 3300037853 | Bacteria | 787 |
| 1232 | Ga0436364_1381350 | 3300037853 | Bacteria | 44948 |
| 1233 | Ga0436364_1527719 | 3300037853 | Bacteria | 1958 |
| 1234 | Ga0395901_0368107 | 3300038443 | Bacteria | 1481 |
| 1235 | Ga0395901_1522668 | 3300038443 | Bacteria | 624 |
| 1236 | Ga0436365_0207903 | 3300039437 | Bacteria | 1140 |
| 1237 | Ga0436365_0456440 | 3300039437 | Bacteria | 871 |
| 1238 | Ga0436360_0519033 | 3300039438 | Bacteria | 806 |
| 1239 | Ga0436360_0800473 | 3300039438 | Bacteria | 814 |
| 1240 | Ga0436361_0083233 | 3300039447 | Bacteria | 533 |
| 1241 | Ga0436361_0085148 | 3300039447 | Bacteria | 503 |
| 1242 | Ga0436361_0592735 | 3300039447 | Bacteria | 564 |
| 1243 | Ga0436361_0739507 | 3300039447 | Bacteria | 1466 |
| 1244 | Ga0436361_1089145 | 3300039447 | Bacteria | 639 |
| 1245 | Ga0436363_0129145 | 3300039450 | Bacteria | 1069 |
| 1246 | Ga0436363_0216045 | 3300039450 | Bacteria | 2348 |
| 1247 | Ga0436363_0287803 | 3300039450 | Bacteria | 617 |
| 1248 | Ga0436363_1231403 | 3300039450 | Bacteria | 1275 |
| 1249 | Ga0436363_1481670 | 3300039450 | Bacteria | 589 |
| 1250 | Ga0436363_1578490 | 3300039450 | Bacteria | 1361 |
| 1251 | Ga0436363_1583483 | 3300039450 | Bacteria | 943 |
| 1252 | Ga0436362_0324614 | 3300039453 | Bacteria | 676 |
| 1253 | Ga0436362_0452318 | 3300039453 | Bacteria | 664 |
| 1254 | Ga0436362_1221077 | 3300039453 | Bacteria | 686 |
| 1255 | Ga0436362_1298483 | 3300039453 | Bacteria | 752 |
| 1256 | Ga0436362_1301744 | 3300039453 | Bacteria | 957 |
| 1257 | Ga0439436_0000524 | 3300041404 | Bacteria | 10046 |
| 1258 | Ga0439436_0006412 | 3300041404 | Bacteria | 3612 |
| 1259 | Ga0439436_0017389 | 3300041404 | Bacteria | 2151 |
| 1260 | Ga0439436_0080170 | 3300041404 | Bacteria | 908 |
| 1261 | Ga0439436_0194399 | 3300041404 | Bacteria | 579 |
| 1262 | Ga0439438_041185 | 3300041405 | Bacteria | 1198 |
| 1263 | Ga0439439_0010113 | 3300041406 | Bacteria | 2253 |
| 1264 | Ga0439439_0068353 | 3300041406 | Bacteria | 949 |
| 1265 | Ga0439439_0082194 | 3300041406 | Bacteria | 872 |
| 1266 | Ga0439461_0001303 | 3300041410 | Bacteria | 3832 |
| 1267 | Ga0439466_0006342 | 3300041411 | Bacteria | 4501 |
| 1268 | Ga0439466_0166992 | 3300041411 | Bacteria | 672 |
| 1269 | Ga0451789_0026674 | 3300041443 | Bacteria | 782 |
| 1270 | Ga0451793_1135109 | 3300041452 | Bacteria | 1895 |
| 1271 | Ga0451797_1112463 | 3300041453 | Bacteria | 550 |
| 1272 | Ga0451805_068977 | 3300041461 | Bacteria | 503 |
| 1273 | Ga0451804_0477614 | 3300041463 | Bacteria | 869 |
| 1274 | Ga0451839_0225412 | 3300041496 | Bacteria | 575 |
| 1275 | Ga0451839_0572827 | 3300041496 | Bacteria | 869 |
| 1276 | Ga0451841_0311264 | 3300041498 | Bacteria | 923 |
| 1277 | Ga0451845_0003149 | 3300041501 | Bacteria | 638 |
| 1278 | Ga0451843_1278596 | 3300041509 | Bacteria | 769 |
| 1279 | Ga0451853_3555550 | 3300041512 | Bacteria | 856 |
| 1280 | Ga0451853_3556725 | 3300041512 | Bacteria | 759 |
| 1281 | Ga0439431_0021633 | 3300041997 | Bacteria | 1545 |
| 1282 | Ga0439433_0001892 | 3300041999 | Bacteria | 4378 |
| 1283 | Ga0439442_016934 | 3300042002 | Bacteria | 1503 |
| 1284 | Ga0439442_071616 | 3300042002 | Bacteria | 738 |
| 1285 | Ga0439448_0001950 | 3300042005 | Bacteria | 5504 |
| 1286 | Ga0439448_0076419 | 3300042005 | Bacteria | 1120 |
| 1287 | Ga0439448_0319083 | 3300042005 | Bacteria | 553 |
| 1288 | Ga0439432_091108 | 3300042006 | Bacteria | 917 |
| 1289 | Ga0439449_0011654 | 3300042007 | Bacteria | 3306 |
| 1290 | Ga0439449_0019562 | 3300042007 | Bacteria | 2538 |
| 1291 | Ga0439449_0032403 | 3300042007 | Bacteria | 1948 |
| 1292 | Ga0439449_0055906 | 3300042007 | Bacteria | 1457 |
| 1293 | Ga0439449_0298946 | 3300042007 | Bacteria | 607 |
| 1294 | Ga0439452_002242 | 3300042010 | Bacteria | 7252 |
| 1295 | Ga0439455_0009521 | 3300042012 | Bacteria | 2111 |
| 1296 | Ga0439455_0076718 | 3300042012 | Bacteria | 904 |
| 1297 | Ga0439456_043895 | 3300042013 | Bacteria | 972 |
| 1298 | Ga0439457_001024 | 3300042014 | Bacteria | 8432 |
| 1299 | Ga0439457_001614 | 3300042014 | Bacteria | 6720 |
| 1300 | Ga0439457_004463 | 3300042014 | Bacteria | 3638 |
| 1301 | Ga0439462_0004876 | 3300042015 | Bacteria | 3292 |
| 1302 | Ga0439462_0051833 | 3300042015 | Bacteria | 1103 |
| 1303 | Ga0439462_0111836 | 3300042015 | Bacteria | 756 |
| 1304 | Ga0439462_0113673 | 3300042015 | Bacteria | 750 |
| 1305 | Ga0439463_179444 | 3300042016 | Bacteria | 549 |
| 1306 | Ga0450911_011083 | 3300042115 | Bacteria | 1238 |
| 1307 | Ga0450914_065157 | 3300042118 | Bacteria | 500 |
| 1308 | Ga0450919_000085 | 3300042121 | Bacteria | 9080 |
| 1309 | Ga0450920_039778 | 3300042122 | Bacteria | 936 |
| 1310 | Ga0450890_071893 | 3300042127 | Bacteria | 554 |
| 1311 | Ga0450894_000035 | 3300042131 | Bacteria | 19542 |
| 1312 | Ga0450896_002593 | 3300042133 | Bacteria | 2349 |
| 1313 | Ga0450898_078105 | 3300042134 | Bacteria | 670 |
| 1314 | Ga0450899_000138 | 3300042135 | Bacteria | 6978 |
| 1315 | Ga0450902_032410 | 3300042137 | Bacteria | 881 |
| 1316 | Ga0450903_000067 | 3300042138 | Bacteria | 20805 |
| 1317 | Ga0450906_002005 | 3300042145 | Bacteria | 4446 |
| 1318 | Ga0450907_018490 | 3300042146 | Bacteria | 1166 |
| 1319 | Ga0450907_064767 | 3300042146 | Bacteria | 632 |
| 1320 | Ga0439446_0020862 | 3300042156 | Bacteria | 1849 |
| 1321 | Ga0439458_0005318 | 3300042157 | Bacteria | 2896 |
| 1322 | Ga0439458_0050659 | 3300042157 | Bacteria | 1024 |
| 1323 | Ga0450908_008452 | 3300042184 | Bacteria | 1929 |
| 1324 | Ga0450909_002630 | 3300042185 | Bacteria | 2545 |
| 1325 | Ga0439434_0065435 | 3300042435 | Bacteria | 1140 |
| 1326 | Ga0439459_0004735 | 3300042438 | Bacteria | 2203 |
| 1327 | Ga0439459_0042938 | 3300042438 | Bacteria | 967 |
| 1328 | Ga0439459_0176540 | 3300042438 | Bacteria | 572 |
| 1329 | Ga0439464_0169427 | 3300042439 | Bacteria | 688 |
| 1330 | Ga0450918_016419 | 3300042531 | Bacteria | 1286 |
| 1331 | Ga0450901_006724 | 3300042533 | Bacteria | 1185 |
| 1332 | Ga0466969_0001305 | 3300044656 | Bacteria | 13440 |
| 1333 | Ga0466969_0006155 | 3300044656 | Bacteria | 6389 |
| 1334 | Ga0466972_0031457 | 3300044658 | Bacteria | 2609 |
| 1335 | Ga0466972_0252403 | 3300044658 | Bacteria | 824 |
| 1336 | Ga0466966_0001016 | 3300044684 | Bacteria | 17896 |
| 1337 | Ga0466966_0002663 | 3300044684 | Bacteria | 11700 |
| 1338 | Ga0466966_0009462 | 3300044684 | Bacteria | 6455 |
| 1339 | Ga0466966_0012013 | 3300044684 | Bacteria | 5739 |
| 1340 | Ga0466966_0019210 | 3300044684 | Bacteria | 4497 |
| 1341 | Ga0466966_0213373 | 3300044684 | Bacteria | 1166 |
| 1342 | Ga0466966_0255491 | 3300044684 | Bacteria | 1055 |
| 1343 | Ga0466966_0271706 | 3300044684 | Bacteria | 1020 |
| 1344 | Ga0466961_0003691 | 3300044693 | Bacteria | 9556 |
| 1345 | Ga0466961_0006277 | 3300044693 | Bacteria | 7549 |
| 1346 | Ga0466961_0007449 | 3300044693 | Bacteria | 6967 |
| 1347 | Ga0466961_0018930 | 3300044693 | Bacteria | 4430 |
| 1348 | Ga0466961_0023269 | 3300044693 | Bacteria | 3986 |
| 1349 | Ga0466961_0032959 | 3300044693 | Bacteria | 3329 |
| 1350 | Ga0466961_0094041 | 3300044693 | Bacteria | 1891 |
| 1351 | Ga0466961_0160266 | 3300044693 | Bacteria | 1402 |
| 1352 | Ga0466961_0806876 | 3300044693 | Bacteria | 560 |
| 1353 | Ga0466963_0028158 | 3300044694 | Bacteria | 3605 |
| 1354 | Ga0466963_0035906 | 3300044694 | Bacteria | 3230 |
| 1355 | Ga0466963_0060997 | 3300044694 | Bacteria | 2520 |
| 1356 | Ga0466963_0069338 | 3300044694 | Bacteria | 2370 |
| 1357 | Ga0466963_0406126 | 3300044694 | Bacteria | 961 |
| 1358 | Ga0466963_0553184 | 3300044694 | Bacteria | 813 |
| 1359 | Ga0466963_0890380 | 3300044694 | Bacteria | 627 |
| 1360 | Ga0466963_0942863 | 3300044694 | Bacteria | 608 |
| 1361 | Ga0466963_1101807 | 3300044694 | Bacteria | 558 |
| 1362 | Ga0466964_0112830 | 3300044706 | Bacteria | 1215 |
| 1363 | Ga0466964_0562917 | 3300044706 | Bacteria | 620 |
| 1364 | Ga0466964_0668844 | 3300044706 | Bacteria | 576 |
| 1365 | Ga0466971_0000730 | 3300044719 | Bacteria | 13160 |
| 1366 | Ga0466971_0005155 | 3300044719 | Bacteria | 5656 |
| 1367 | Ga0466971_0005390 | 3300044719 | Bacteria | 5549 |
| 1368 | Ga0466971_0011377 | 3300044719 | Bacteria | 3897 |
| 1369 | Ga0466971_0031674 | 3300044719 | Bacteria | 2368 |
| 1370 | Ga0466968_0315931 | 3300044735 | Bacteria | 754 |
| 1371 | Ga0466968_0375624 | 3300044735 | Bacteria | 694 |
| 1372 | Ga0466968_0496860 | 3300044735 | Bacteria | 607 |
| 1373 | Ga0466970_0002624 | 3300044765 | Bacteria | 8668 |
| 1374 | Ga0466970_0062185 | 3300044765 | Bacteria | 2001 |
| 1375 | Ga0466970_0310853 | 3300044765 | Bacteria | 890 |
| 1376 | Ga0466970_0354333 | 3300044765 | Bacteria | 833 |
| 1377 | Ga0466970_0410163 | 3300044765 | Bacteria | 774 |
| 1378 | Ga0466970_0611728 | 3300044765 | Bacteria | 632 |
| 1379 | Ga0466970_0720331 | 3300044765 | Bacteria | 582 |
| 1380 | Ga0466957_0008107 | 3300044842 | Bacteria | 5960 |
| 1381 | Ga0466957_0228107 | 3300044842 | Bacteria | 1232 |
| 1382 | Ga0466957_0629040 | 3300044842 | Bacteria | 753 |
| 1383 | Ga0466957_0664502 | 3300044842 | Bacteria | 733 |
| 1384 | Ga0466957_0737721 | 3300044842 | Bacteria | 697 |
| 1385 | Ga0466960_0028068 | 3300044901 | Bacteria | 2573 |
| 1386 | Ga0466959_0000507 | 3300045049 | Bacteria | 22618 |
| 1387 | Ga0466959_0007332 | 3300045049 | Bacteria | 7729 |
| 1388 | Ga0466959_0011863 | 3300045049 | Bacteria | 6275 |
| 1389 | Ga0466959_0036329 | 3300045049 | Bacteria | 3640 |
| 1390 | Ga0466959_0048336 | 3300045049 | Bacteria | 3126 |
| 1391 | Ga0466959_0060117 | 3300045049 | Bacteria | 2765 |
| 1392 | Ga0466959_0141200 | 3300045049 | Bacteria | 1702 |
| 1393 | Ga0466959_0355270 | 3300045049 | Bacteria | 999 |
| 1394 | Ga0466959_0524937 | 3300045049 | Bacteria | 799 |
| 1395 | Ga0451576_0227272 | 3300045051 | Bacteria | 1948 |
| 1396 | Ga0466958_0004494 | 3300045836 | Bacteria | 7366 |
| 1397 | Ga0466958_0010466 | 3300045836 | Bacteria | 5196 |
| 1398 | Ga0466958_0028068 | 3300045836 | Bacteria | 3334 |
| 1399 | Ga0466958_0034351 | 3300045836 | Bacteria | 3025 |
| 1400 | Ga0466958_0192525 | 3300045836 | Bacteria | 1296 |
| 1401 | Ga0466967_0007787 | 3300045976 | Bacteria | 7778 |
| 1402 | Ga0466967_0101495 | 3300045976 | Bacteria | 2630 |
| 1403 | Ga0466967_0525765 | 3300045976 | Bacteria | 1163 |
| 1404 | Ga0466967_0628538 | 3300045976 | Bacteria | 1061 |
| 1405 | Ga0466967_0665844 | 3300045976 | Bacteria | 1030 |
| 1406 | Ga0466967_0725842 | 3300045976 | Bacteria | 985 |
| 1407 | Ga0466967_1271460 | 3300045976 | Bacteria | 733 |
| 1408 | Ga0466967_1419345 | 3300045976 | Bacteria | 691 |
| 1409 | Ga0466967_1642962 | 3300045976 | Bacteria | 640 |
| 1410 | Ga0466967_1916326 | 3300045976 | Bacteria | 589 |
| 1411 | Ga0466967_2527919 | 3300045976 | Bacteria | 508 |
| 1412 | Ga0495627_107445 | 3300046453 | Bacteria | 793 |
| 1413 | Ga0495592_0000049 | 3300046454 | Bacteria | 113704 |
| 1414 | Ga0495592_0011895 | 3300046454 | Bacteria | 6596 |
| 1415 | Ga0495592_0041774 | 3300046454 | Bacteria | 3435 |
| 1416 | Ga0495592_0127909 | 3300046454 | Bacteria | 1779 |
| 1417 | Ga0495592_0149061 | 3300046454 | Bacteria | 1619 |
| 1418 | Ga0495592_0183636 | 3300046454 | Bacteria | 1423 |
| 1419 | Ga0495592_0485817 | 3300046454 | Bacteria | 768 |
| 1420 | Ga0495603_0010028 | 3300046455 | Bacteria | 5731 |
| 1421 | Ga0495603_0024116 | 3300046455 | Bacteria | 3679 |
| 1422 | Ga0495603_0026170 | 3300046455 | Bacteria | 3525 |
| 1423 | Ga0495603_0047280 | 3300046455 | Bacteria | 2563 |
| 1424 | Ga0495603_0049435 | 3300046455 | Bacteria | 2503 |
| 1425 | Ga0495603_0072963 | 3300046455 | Bacteria | 2016 |
| 1426 | Ga0495629_0009686 | 3300046459 | Bacteria | 7038 |
| 1427 | Ga0495629_0010230 | 3300046459 | Bacteria | 6833 |
| 1428 | Ga0495629_0102424 | 3300046459 | Bacteria | 1997 |
| 1429 | Ga0495629_0102605 | 3300046459 | Bacteria | 1995 |
| 1430 | Ga0495629_0105404 | 3300046459 | Bacteria | 1966 |
| 1431 | Ga0495629_0261125 | 3300046459 | Bacteria | 1190 |
| 1432 | Ga0495629_0695599 | 3300046459 | Bacteria | 675 |
| 1433 | Ga0495638_0049888 | 3300046460 | Bacteria | 2615 |
| 1434 | Ga0495638_0118662 | 3300046460 | Bacteria | 1565 |
| 1435 | Ga0495638_0251119 | 3300046460 | Bacteria | 975 |
| 1436 | Ga0495641_0008332 | 3300046461 | Bacteria | 6337 |
| 1437 | Ga0495641_0013098 | 3300046461 | Bacteria | 4583 |
| 1438 | Ga0495641_0027940 | 3300046461 | Bacteria | 2735 |
| 1439 | Ga0495651_0000007 | 3300046462 | Bacteria | 158577 |
| 1440 | Ga0495651_0000079 | 3300046462 | Bacteria | 71581 |
| 1441 | Ga0495651_0034997 | 3300046462 | Bacteria | 3913 |
| 1442 | Ga0495651_0044140 | 3300046462 | Bacteria | 3455 |
| 1443 | Ga0495651_0047991 | 3300046462 | Bacteria | 3298 |
| 1444 | Ga0495651_0105233 | 3300046462 | Bacteria | 2093 |
| 1445 | Ga0495651_0235360 | 3300046462 | Bacteria | 1259 |
| 1446 | Ga0495651_0408707 | 3300046462 | Bacteria | 884 |
| 1447 | Ga0495651_0446451 | 3300046462 | Bacteria | 836 |
| 1448 | Ga0495651_0452362 | 3300046462 | Bacteria | 829 |
| 1449 | Ga0495651_0552354 | 3300046462 | Bacteria | 731 |
| 1450 | Ga0495653_0046082 | 3300046463 | Bacteria | 3376 |
| 1451 | Ga0495653_0046578 | 3300046463 | Bacteria | 3357 |
| 1452 | Ga0495653_0066610 | 3300046463 | Bacteria | 2708 |
| 1453 | Ga0495653_0090526 | 3300046463 | Bacteria | 2238 |
| 1454 | Ga0495653_0239989 | 3300046463 | Bacteria | 1208 |
| 1455 | Ga0495653_0247654 | 3300046463 | Bacteria | 1184 |
| 1456 | Ga0495653_0352192 | 3300046463 | Bacteria | 946 |
| 1457 | Ga0495653_0769772 | 3300046463 | Bacteria | 580 |
| 1458 | Ga0495580_0015098 | 3300046472 | Bacteria | 5844 |
| 1459 | Ga0495580_0154805 | 3300046472 | Bacteria | 1587 |
| 1460 | Ga0495580_0169758 | 3300046472 | Bacteria | 1508 |
| 1461 | Ga0495580_0303167 | 3300046472 | Bacteria | 1087 |
| 1462 | Ga0495582_0002158 | 3300046473 | Bacteria | 11007 |
| 1463 | Ga0495582_0005432 | 3300046473 | Bacteria | 7111 |
| 1464 | Ga0495582_0085008 | 3300046473 | Bacteria | 1759 |
| 1465 | Ga0495582_0319741 | 3300046473 | Bacteria | 893 |
| 1466 | Ga0495639_0010968 | 3300046475 | Bacteria | 3902 |
| 1467 | Ga0495639_0081464 | 3300046475 | Bacteria | 1508 |
| 1468 | Ga0495639_0143354 | 3300046475 | Bacteria | 1149 |
| 1469 | Ga0495662_0002989 | 3300046476 | Bacteria | 8533 |
| 1470 | Ga0495662_0008805 | 3300046476 | Bacteria | 4962 |
| 1471 | Ga0495662_0020179 | 3300046476 | Bacteria | 3223 |
| 1472 | Ga0495662_0020438 | 3300046476 | Bacteria | 3202 |
| 1473 | Ga0495662_0035526 | 3300046476 | Bacteria | 2404 |
| 1474 | Ga0495662_0179222 | 3300046476 | Bacteria | 1044 |
| 1475 | Ga0495664_0003530 | 3300046477 | Bacteria | 8528 |
| 1476 | Ga0495664_0020885 | 3300046477 | Bacteria | 3780 |
| 1477 | Ga0495664_0091512 | 3300046477 | Bacteria | 1828 |
| 1478 | Ga0495664_0117975 | 3300046477 | Bacteria | 1604 |
| 1479 | Ga0495664_0134953 | 3300046477 | Bacteria | 1495 |
| 1480 | Ga0495664_0194739 | 3300046477 | Bacteria | 1228 |
| 1481 | Ga0495664_0422355 | 3300046477 | Bacteria | 800 |
| 1482 | Ga0495585_0013695 | 3300046492 | Bacteria | 4740 |
| 1483 | Ga0495585_0042588 | 3300046492 | Bacteria | 2542 |
| 1484 | Ga0495585_0059459 | 3300046492 | Bacteria | 2106 |
| 1485 | Ga0495585_0202801 | 3300046492 | Bacteria | 1009 |
| 1486 | Ga0495594_0012305 | 3300046499 | Bacteria | 4458 |
| 1487 | Ga0495594_0013501 | 3300046499 | Bacteria | 4267 |
| 1488 | Ga0495594_0019227 | 3300046499 | Bacteria | 3628 |
| 1489 | Ga0495594_0055542 | 3300046499 | Bacteria | 2183 |
| 1490 | Ga0495594_0140826 | 3300046499 | Bacteria | 1368 |
| 1491 | Ga0495594_0471433 | 3300046499 | Bacteria | 714 |
| 1492 | Ga0495594_0783896 | 3300046499 | Bacteria | 537 |
| 1493 | Ga0495607_0042933 | 3300046501 | Bacteria | 2677 |
| 1494 | Ga0495608_0000076 | 3300046511 | Bacteria | 74854 |
| 1495 | Ga0495608_0009966 | 3300046511 | Bacteria | 6634 |
| 1496 | Ga0495608_0040008 | 3300046511 | Bacteria | 3141 |
| 1497 | Ga0495608_0067448 | 3300046511 | Bacteria | 2340 |
| 1498 | Ga0495608_0157894 | 3300046511 | Bacteria | 1443 |
| 1499 | Ga0495608_0208708 | 3300046511 | Bacteria | 1228 |
| 1500 | Ga0495608_0447957 | 3300046511 | Bacteria | 786 |
| 1501 | Ga0495608_0627494 | 3300046511 | Bacteria | 643 |
| 1502 | Ga0495618_0007856 | 3300046514 | Bacteria | 6457 |
| 1503 | Ga0495618_0022729 | 3300046514 | Bacteria | 3873 |
| 1504 | Ga0495618_0106122 | 3300046514 | Bacteria | 1798 |
| 1505 | Ga0495618_0255728 | 3300046514 | Bacteria | 1098 |
| 1506 | Ga0495618_0387054 | 3300046514 | Bacteria | 857 |
| 1507 | Ga0495618_0569619 | 3300046514 | Bacteria | 676 |
| 1508 | Ga0495620_0110578 | 3300046515 | Bacteria | 1089 |
| 1509 | Ga0495628_0001215 | 3300046516 | Bacteria | 23569 |
| 1510 | Ga0495628_0005605 | 3300046516 | Bacteria | 10993 |
| 1511 | Ga0495628_0010042 | 3300046516 | Bacteria | 8055 |
| 1512 | Ga0495628_0021216 | 3300046516 | Bacteria | 5347 |
| 1513 | Ga0495628_0103086 | 3300046516 | Bacteria | 2200 |
| 1514 | Ga0495628_0137701 | 3300046516 | Bacteria | 1864 |
| 1515 | Ga0495628_0156972 | 3300046516 | Bacteria | 1730 |
| 1516 | Ga0495628_0584191 | 3300046516 | Bacteria | 799 |
| 1517 | Ga0495630_0008315 | 3300046517 | Bacteria | 7449 |
| 1518 | Ga0495630_0025191 | 3300046517 | Bacteria | 4397 |
| 1519 | Ga0495630_0032183 | 3300046517 | Bacteria | 3906 |
| 1520 | Ga0495630_0217395 | 3300046517 | Bacteria | 1459 |
| 1521 | Ga0495630_0307930 | 3300046517 | Bacteria | 1210 |
| 1522 | Ga0495630_0844286 | 3300046517 | Bacteria | 698 |
| 1523 | Ga0495630_1402619 | 3300046517 | Bacteria | 525 |
| 1524 | Ga0495631_0139636 | 3300046518 | Bacteria | 1040 |
| 1525 | Ga0495631_0219806 | 3300046518 | Bacteria | 811 |
| 1526 | Ga0495631_0260618 | 3300046518 | Bacteria | 739 |
| 1527 | Ga0495637_0105712 | 3300046520 | Bacteria | 1096 |
| 1528 | Ga0495643_0211792 | 3300046522 | Bacteria | 924 |
| 1529 | Ga0495666_0003384 | 3300046526 | Bacteria | 8041 |
| 1530 | Ga0495666_0058823 | 3300046526 | Bacteria | 1838 |
| 1531 | Ga0495666_0129992 | 3300046526 | Bacteria | 1177 |
| 1532 | Ga0495666_0149655 | 3300046526 | Bacteria | 1085 |
| 1533 | Ga0495666_0313549 | 3300046526 | Bacteria | 708 |
| 1534 | Ga0495666_0374085 | 3300046526 | Bacteria | 641 |
| 1535 | Ga0495652_0000168 | 3300046529 | Bacteria | 74913 |
| 1536 | Ga0495652_0003588 | 3300046529 | Bacteria | 15221 |
| 1537 | Ga0495652_0040527 | 3300046529 | Bacteria | 4025 |
| 1538 | Ga0495652_0059422 | 3300046529 | Bacteria | 3234 |
| 1539 | Ga0495652_0083184 | 3300046529 | Bacteria | 2635 |
| 1540 | Ga0495652_0146356 | 3300046529 | Bacteria | 1851 |
| 1541 | Ga0495652_0273460 | 3300046529 | Bacteria | 1240 |
| 1542 | Ga0495652_0352690 | 3300046529 | Bacteria | 1053 |
| 1543 | Ga0495652_0399634 | 3300046529 | Bacteria | 973 |
| 1544 | Ga0495652_0559306 | 3300046529 | Bacteria | 785 |
| 1545 | Ga0495652_0597782 | 3300046529 | Bacteria | 753 |
| 1546 | Ga0495665_0002190 | 3300046531 | Bacteria | 10572 |
| 1547 | Ga0495665_0004007 | 3300046531 | Bacteria | 7943 |
| 1548 | Ga0495665_0055065 | 3300046531 | Bacteria | 2101 |
| 1549 | Ga0495665_0173646 | 3300046531 | Bacteria | 1121 |
| 1550 | Ga0495665_0634612 | 3300046531 | Bacteria | 532 |
| 1551 | Ga0495640_0017135 | 3300046533 | Bacteria | 5406 |
| 1552 | Ga0495640_0029098 | 3300046533 | Bacteria | 3970 |
| 1553 | Ga0495640_0054496 | 3300046533 | Bacteria | 2738 |
| 1554 | Ga0495640_0054695 | 3300046533 | Bacteria | 2732 |
| 1555 | Ga0495640_0206494 | 3300046533 | Bacteria | 1243 |
| 1556 | Ga0495586_0005311 | 3300046535 | Bacteria | 6889 |
| 1557 | Ga0495586_0008958 | 3300046535 | Bacteria | 5327 |
| 1558 | Ga0495586_0030648 | 3300046535 | Bacteria | 2879 |
| 1559 | Ga0495586_0053081 | 3300046535 | Bacteria | 2195 |
| 1560 | Ga0495586_0082387 | 3300046535 | Bacteria | 1769 |
| 1561 | Ga0495586_0257410 | 3300046535 | Bacteria | 996 |
| 1562 | Ga0495586_0355569 | 3300046535 | Bacteria | 841 |
| 1563 | Ga0495586_0472462 | 3300046535 | Bacteria | 723 |
| 1564 | Ga0495586_0881121 | 3300046535 | Bacteria | 516 |
| 1565 | Ga0495587_0006741 | 3300046536 | Bacteria | 7476 |
| 1566 | Ga0495587_0025931 | 3300046536 | Bacteria | 3577 |
| 1567 | Ga0495587_0077239 | 3300046536 | Bacteria | 1933 |
| 1568 | Ga0495587_0109041 | 3300046536 | Bacteria | 1591 |
| 1569 | Ga0495587_0210367 | 3300046536 | Bacteria | 1098 |
| 1570 | Ga0495587_0742135 | 3300046536 | Bacteria | 537 |
| 1571 | Ga0495645_0013097 | 3300046543 | Bacteria | 5860 |
| 1572 | Ga0495645_0022878 | 3300046543 | Bacteria | 4523 |
| 1573 | Ga0495645_0059107 | 3300046543 | Bacteria | 2780 |
| 1574 | Ga0495645_0368563 | 3300046543 | Bacteria | 921 |
| 1575 | Ga0495645_0384113 | 3300046543 | Bacteria | 898 |
| 1576 | Ga0495645_0395575 | 3300046543 | Bacteria | 881 |
| 1577 | Ga0495622_0022827 | 3300046557 | Bacteria | 2916 |
| 1578 | Ga0495622_0170550 | 3300046557 | Bacteria | 978 |
| 1579 | Ga0495622_0443017 | 3300046557 | Bacteria | 557 |
| 1580 | Ga0495667_0000072 | 3300046559 | Bacteria | 75080 |
| 1581 | Ga0495667_0015012 | 3300046559 | Bacteria | 5230 |
| 1582 | Ga0495667_0018766 | 3300046559 | Bacteria | 4668 |
| 1583 | Ga0495667_0029452 | 3300046559 | Bacteria | 3696 |
| 1584 | Ga0495667_0041818 | 3300046559 | Bacteria | 3038 |
| 1585 | Ga0495667_0068317 | 3300046559 | Bacteria | 2320 |
| 1586 | Ga0495667_0121316 | 3300046559 | Bacteria | 1687 |
| 1587 | Ga0495656_0193205 | 3300046615 | Bacteria | 1006 |
| 1588 | Ga0495656_0509219 | 3300046615 | Bacteria | 639 |
| 1589 | Ga0495634_0020030 | 3300046642 | Bacteria | 4746 |
| 1590 | Ga0495634_0026954 | 3300046642 | Bacteria | 4004 |
| 1591 | Ga0495634_0027278 | 3300046642 | Bacteria | 3974 |
| 1592 | Ga0495634_0033758 | 3300046642 | Bacteria | 3514 |
| 1593 | Ga0495634_0179627 | 3300046642 | Bacteria | 1325 |
| 1594 | Ga0495634_0189762 | 3300046642 | Bacteria | 1282 |
| 1595 | Ga0495611_0033087 | 3300046648 | Bacteria | 2281 |
| 1596 | Ga0495625_0222544 | 3300046660 | Bacteria | 1236 |
| 1597 | Ga0495635_0002665 | 3300046663 | Bacteria | 12199 |
| 1598 | Ga0495635_0020890 | 3300046663 | Bacteria | 4561 |
| 1599 | Ga0495635_0112703 | 3300046663 | Bacteria | 1857 |
| 1600 | Ga0495635_0124402 | 3300046663 | Bacteria | 1758 |
| 1601 | Ga0495635_0180933 | 3300046663 | Bacteria | 1433 |
| 1602 | Ga0495635_0204784 | 3300046663 | Bacteria | 1337 |
| 1603 | Ga0495635_0962288 | 3300046663 | Bacteria | 544 |
| 1604 | Ga0495661_0170131 | 3300046665 | Bacteria | 1163 |
| 1605 | Ga0495588_0067287 | 3300046674 | Bacteria | 1859 |
| 1606 | Ga0495588_0078571 | 3300046674 | Bacteria | 1721 |
| 1607 | Ga0495588_0451689 | 3300046674 | Bacteria | 674 |
| 1608 | Ga0495588_0645247 | 3300046674 | Bacteria | 554 |
| 1609 | Ga0495588_0684305 | 3300046674 | Bacteria | 536 |
| 1610 | Ga0495657_0000424 | 3300046675 | Bacteria | 39370 |
| 1611 | Ga0495657_0002584 | 3300046675 | Bacteria | 15156 |
| 1612 | Ga0495657_0020458 | 3300046675 | Bacteria | 4755 |
| 1613 | Ga0495657_0028016 | 3300046675 | Bacteria | 3966 |
| 1614 | Ga0495657_0042001 | 3300046675 | Bacteria | 3125 |
| 1615 | Ga0495657_0046215 | 3300046675 | Bacteria | 2949 |
| 1616 | Ga0495657_0115442 | 3300046675 | Bacteria | 1696 |
| 1617 | Ga0495657_0314532 | 3300046675 | Bacteria | 931 |
| 1618 | Ga0495657_0320965 | 3300046675 | Bacteria | 920 |
| 1619 | Ga0495599_0000062 | 3300046678 | Bacteria | 74940 |
| 1620 | Ga0495599_0021197 | 3300046678 | Bacteria | 4053 |
| 1621 | Ga0495599_0022810 | 3300046678 | Bacteria | 3909 |
| 1622 | Ga0495599_0026841 | 3300046678 | Bacteria | 3610 |
| 1623 | Ga0495599_0035257 | 3300046678 | Bacteria | 3140 |
| 1624 | Ga0495599_0074779 | 3300046678 | Bacteria | 2115 |
| 1625 | Ga0495599_0276693 | 3300046678 | Bacteria | 1017 |
| 1626 | Ga0495599_0869618 | 3300046678 | Bacteria | 512 |
| 1627 | Ga0495623_0000777 | 3300046679 | Bacteria | 21383 |
| 1628 | Ga0495623_0003796 | 3300046679 | Bacteria | 9951 |
| 1629 | Ga0495623_0048459 | 3300046679 | Bacteria | 2694 |
| 1630 | Ga0495623_0059079 | 3300046679 | Bacteria | 2409 |
| 1631 | Ga0495623_0061932 | 3300046679 | Bacteria | 2345 |
| 1632 | Ga0495623_0083855 | 3300046679 | Bacteria | 1967 |
| 1633 | Ga0495623_0104972 | 3300046679 | Bacteria | 1718 |
| 1634 | Ga0495623_0290995 | 3300046679 | Bacteria | 905 |
| 1635 | Ga0495623_0379528 | 3300046679 | Bacteria | 764 |
| 1636 | Ga0495623_0435910 | 3300046679 | Bacteria | 700 |
| 1637 | Ga0495646_0007097 | 3300046680 | Bacteria | 7118 |
| 1638 | Ga0495646_0059352 | 3300046680 | Bacteria | 2284 |
| 1639 | Ga0495646_0078693 | 3300046680 | Bacteria | 1926 |
| 1640 | Ga0495646_0158769 | 3300046680 | Bacteria | 1253 |
| 1641 | Ga0495646_0188431 | 3300046680 | Bacteria | 1129 |
| 1642 | Ga0495646_0193027 | 3300046680 | Bacteria | 1112 |
| 1643 | Ga0495646_0196394 | 3300046680 | Bacteria | 1100 |
| 1644 | Ga0495646_0357357 | 3300046680 | Bacteria | 764 |
| 1645 | Ga0495647_0356750 | 3300046681 | Bacteria | 666 |
| 1646 | Ga0495647_0569406 | 3300046681 | Bacteria | 530 |
| 1647 | Ga0495658_0069348 | 3300046683 | Bacteria | 2043 |
| 1648 | Ga0495658_0157765 | 3300046683 | Bacteria | 1397 |
| 1649 | Ga0495658_0415133 | 3300046683 | Bacteria | 858 |
| 1650 | Ga0495613_0009407 | 3300046689 | Bacteria | 7249 |
| 1651 | Ga0495613_0011441 | 3300046689 | Bacteria | 6596 |
| 1652 | Ga0495613_0034690 | 3300046689 | Bacteria | 3746 |
| 1653 | Ga0495613_0084477 | 3300046689 | Bacteria | 2304 |
| 1654 | Ga0495613_0129270 | 3300046689 | Bacteria | 1809 |
| 1655 | Ga0495613_0138981 | 3300046689 | Bacteria | 1736 |
| 1656 | Ga0495613_0237480 | 3300046689 | Bacteria | 1275 |
| 1657 | Ga0495613_0645089 | 3300046689 | Bacteria | 701 |
| 1658 | Ga0495624_0006967 | 3300046690 | Bacteria | 7972 |
| 1659 | Ga0495624_0006974 | 3300046690 | Bacteria | 7970 |
| 1660 | Ga0495624_0017325 | 3300046690 | Bacteria | 4838 |
| 1661 | Ga0495624_0027762 | 3300046690 | Bacteria | 3703 |
| 1662 | Ga0495624_0146888 | 3300046690 | Bacteria | 1443 |
| 1663 | Ga0495624_0563981 | 3300046690 | Bacteria | 680 |
| 1664 | Ga0495670_0013056 | 3300046691 | Bacteria | 4084 |
| 1665 | Ga0495670_0020026 | 3300046691 | Bacteria | 3297 |
| 1666 | Ga0495671_0161446 | 3300046692 | Bacteria | 1090 |
| 1667 | Ga0495649_0402218 | 3300046694 | Bacteria | 687 |
| 1668 | Ga0495589_0221108 | 3300046794 | Bacteria | 889 |
| 1669 | Ga0495589_0335128 | 3300046794 | Bacteria | 698 |
| 1670 | Ga0495589_0521254 | 3300046794 | Bacteria | 542 |
| 1671 | Ga0495600_0008443 | 3300046809 | Bacteria | 6327 |
| 1672 | Ga0495600_0010085 | 3300046809 | Bacteria | 5856 |
| 1673 | Ga0495600_0024163 | 3300046809 | Bacteria | 3910 |
| 1674 | Ga0495600_0043077 | 3300046809 | Bacteria | 2943 |
| 1675 | Ga0495600_0045437 | 3300046809 | Bacteria | 2865 |
| 1676 | Ga0495600_0236626 | 3300046809 | Bacteria | 1164 |
| 1677 | Ga0495600_0244884 | 3300046809 | Bacteria | 1141 |
| 1678 | Ga0495600_0280645 | 3300046809 | Bacteria | 1054 |
| 1679 | Ga0495660_0322596 | 3300046810 | Bacteria | 693 |
| 1680 | Ga0495581_0010953 | 3300047315 | Bacteria | 5240 |
| 1681 | Ga0495581_0027064 | 3300047315 | Bacteria | 3325 |
| 1682 | Ga0495581_0121582 | 3300047315 | Bacteria | 1519 |
| 1683 | Ga0495581_0428420 | 3300047315 | Bacteria | 771 |
| 1684 | Ga0495604_0000062 | 3300047317 | Bacteria | 93264 |
| 1685 | Ga0495604_0011814 | 3300047317 | Bacteria | 6946 |
| 1686 | Ga0495604_0022655 | 3300047317 | Bacteria | 5015 |
| 1687 | Ga0495604_0062529 | 3300047317 | Bacteria | 2843 |
| 1688 | Ga0495604_0175014 | 3300047317 | Bacteria | 1505 |
| 1689 | Ga0495604_0216151 | 3300047317 | Bacteria | 1322 |
| 1690 | Ga0495604_0242504 | 3300047317 | Bacteria | 1231 |
| 1691 | Ga0495604_0544271 | 3300047317 | Bacteria | 749 |
| 1692 | Ga0495636_0085601 | 3300047318 | Bacteria | 1362 |
| 1693 | Ga0495636_0256394 | 3300047318 | Bacteria | 810 |
| 1694 | Ga0495674_0007071 | 3300047319 | Bacteria | 10735 |
| 1695 | Ga0495674_0028482 | 3300047319 | Bacteria | 5091 |
| 1696 | Ga0495674_0113536 | 3300047319 | Bacteria | 2294 |
| 1697 | Ga0495674_0134153 | 3300047319 | Bacteria | 2084 |
| 1698 | Ga0495674_0174539 | 3300047319 | Bacteria | 1792 |
| 1699 | Ga0495674_0302329 | 3300047319 | Bacteria | 1306 |
| 1700 | Ga0495674_0379116 | 3300047319 | Bacteria | 1144 |
| 1701 | Ga0495676_0029254 | 3300047321 | Bacteria | 4692 |
| 1702 | Ga0495676_0038718 | 3300047321 | Bacteria | 3957 |
| 1703 | Ga0495676_0090636 | 3300047321 | Bacteria | 2287 |
| 1704 | Ga0495676_0509018 | 3300047321 | Bacteria | 789 |
| 1705 | Ga0495676_0811775 | 3300047321 | Bacteria | 602 |
| 1706 | Ga0495676_0838847 | 3300047321 | Bacteria | 590 |
| 1707 | Ga0495676_0959964 | 3300047321 | Bacteria | 546 |
| 1708 | Ga0495680_0000101 | 3300047322 | Bacteria | 78550 |
| 1709 | Ga0495680_0012972 | 3300047322 | Bacteria | 7296 |
| 1710 | Ga0495680_0030458 | 3300047322 | Bacteria | 4405 |
| 1711 | Ga0495680_0066746 | 3300047322 | Bacteria | 2752 |
| 1712 | Ga0495680_0158901 | 3300047322 | Bacteria | 1642 |
| 1713 | Ga0495680_0357554 | 3300047322 | Bacteria | 1015 |
| 1714 | Ga0495680_0453200 | 3300047322 | Bacteria | 877 |
| 1715 | Ga0495683_0127665 | 3300047323 | Bacteria | 1202 |
| 1716 | Ga0495683_0226451 | 3300047323 | Bacteria | 831 |
| 1717 | Ga0495687_014847 | 3300047443 | Bacteria | 3982 |
| 1718 | Ga0495687_044422 | 3300047443 | Bacteria | 1931 |
| 1719 | Ga0495675_0001304 | 3300047444 | Bacteria | 15104 |
| 1720 | Ga0495675_0009960 | 3300047444 | Bacteria | 5927 |
| 1721 | Ga0495675_0021462 | 3300047444 | Bacteria | 4112 |
| 1722 | Ga0495675_0022793 | 3300047444 | Bacteria | 3992 |
| 1723 | Ga0495675_0028408 | 3300047444 | Bacteria | 3565 |
| 1724 | Ga0495675_0033104 | 3300047444 | Bacteria | 3298 |
| 1725 | Ga0495675_0064305 | 3300047444 | Bacteria | 2320 |
| 1726 | Ga0495675_0423473 | 3300047444 | Bacteria | 773 |
| 1727 | Ga0495685_005390 | 3300047447 | Bacteria | 4174 |
| 1728 | Ga0495685_022256 | 3300047447 | Bacteria | 2181 |
| 1729 | Ga0495685_138526 | 3300047447 | Bacteria | 793 |
| 1730 | Ga0495685_211284 | 3300047447 | Bacteria | 620 |
| 1731 | Ga0495681_0211603 | 3300047470 | Bacteria | 781 |
| 1732 | Ga0495684_0010492 | 3300047471 | Bacteria | 7165 |
| 1733 | Ga0495684_0022686 | 3300047471 | Bacteria | 4828 |
| 1734 | Ga0495684_0100367 | 3300047471 | Bacteria | 2188 |
| 1735 | Ga0495684_0168641 | 3300047471 | Bacteria | 1629 |
| 1736 | Ga0495684_0391701 | 3300047471 | Bacteria | 977 |
| 1737 | Ga0495684_0412100 | 3300047471 | Bacteria | 946 |
| 1738 | Ga0495686_0024806 | 3300047472 | Bacteria | 3935 |
| 1739 | Ga0495593_0005748 | 3300047673 | Bacteria | 7320 |
| 1740 | Ga0495593_0008680 | 3300047673 | Bacteria | 5907 |
| 1741 | Ga0495593_0019207 | 3300047673 | Bacteria | 3833 |
| 1742 | Ga0495593_0112896 | 3300047673 | Bacteria | 1386 |
| 1743 | Ga0495602_0000115 | 3300048088 | Bacteria | 75982 |
| 1744 | Ga0495602_0013494 | 3300048088 | Bacteria | 8348 |
| 1745 | Ga0495602_0078195 | 3300048088 | Bacteria | 2794 |
| 1746 | Ga0495602_0085778 | 3300048088 | Bacteria | 2630 |
| 1747 | Ga0495602_0169551 | 3300048088 | Bacteria | 1695 |
| 1748 | Ga0495602_0636795 | 3300048088 | Bacteria | 729 |
| 1749 | Ga0495602_0648191 | 3300048088 | Bacteria | 721 |
| 1750 | Ga0495602_0779261 | 3300048088 | Bacteria | 643 |
| 1751 | Ga0495614_0016031 | 3300048089 | Bacteria | 3263 |
| 1752 | Ga0495614_0075784 | 3300048089 | Bacteria | 1454 |
| 1753 | Ga0495614_0106237 | 3300048089 | Bacteria | 1230 |
| 1754 | Ga0495614_0165911 | 3300048089 | Bacteria | 989 |
| 1755 | Ga0495614_0395590 | 3300048089 | Bacteria | 649 |
| 1756 | Ga0495626_0395030 | 3300048091 | Bacteria | 535 |
| 1757 | Ga0496100_0225359 | 3300048903 | Bacteria | 1377 |
| 1758 | Ga0496100_0267539 | 3300048903 | Bacteria | 1270 |
| 1759 | Ga0496100_0418829 | 3300048903 | Bacteria | 1022 |
| 1760 | Ga0496100_0498592 | 3300048903 | Bacteria | 938 |
| 1761 | Ga0496101_0133559 | 3300048904 | Bacteria | 1886 |
| 1762 | Ga0496101_0253562 | 3300048904 | Bacteria | 1371 |
| 1763 | Ga0496101_0552835 | 3300048904 | Bacteria | 910 |
| 1764 | Ga0496101_0977712 | 3300048904 | Bacteria | 666 |
| 1765 | Ga0496102_0008136 | 3300048905 | Bacteria | 8974 |
| 1766 | Ga0496102_0144707 | 3300048905 | Bacteria | 2230 |
| 1767 | Ga0496102_0190191 | 3300048905 | Bacteria | 1934 |
| 1768 | Ga0496102_0666327 | 3300048905 | Bacteria | 963 |
| 1769 | Ga0496102_0755743 | 3300048905 | Bacteria | 895 |
| 1770 | Ga0496102_0947438 | 3300048905 | Bacteria | 782 |
| 1771 | Ga0496102_1210177 | 3300048905 | Bacteria | 675 |
| 1772 | Ga0496103_0058025 | 3300048906 | Bacteria | 2404 |
| 1773 | Ga0496103_0171518 | 3300048906 | Bacteria | 1393 |
| 1774 | Ga0496103_0545441 | 3300048906 | Bacteria | 740 |
| 1775 | Ga0496103_0954846 | 3300048906 | Bacteria | 535 |
| 1776 | Ga0496104_0193546 | 3300048907 | Bacteria | 1945 |
| 1777 | Ga0496104_0256480 | 3300048907 | Bacteria | 1661 |
| 1778 | Ga0496104_0268139 | 3300048907 | Bacteria | 1620 |
| 1779 | Ga0496104_0307286 | 3300048907 | Bacteria | 1498 |
| 1780 | Ga0496104_1876195 | 3300048907 | Bacteria | 501 |
| 1781 | Ga0496105_0001951 | 3300048908 | Bacteria | 14812 |
| 1782 | Ga0496105_0067234 | 3300048908 | Bacteria | 2959 |
| 1783 | Ga0496105_0685997 | 3300048908 | Bacteria | 787 |
| 1784 | Ga0496105_1059263 | 3300048908 | Bacteria | 604 |
| 1785 | Ga0496106_0044619 | 3300048909 | Bacteria | 3328 |
| 1786 | Ga0496106_0058655 | 3300048909 | Bacteria | 2914 |
| 1787 | Ga0496106_0059467 | 3300048909 | Bacteria | 2895 |
| 1788 | Ga0496106_0131596 | 3300048909 | Bacteria | 1962 |
| 1789 | Ga0496106_0718939 | 3300048909 | Bacteria | 795 |
| 1790 | Ga0496106_0842165 | 3300048909 | Bacteria | 726 |
| 1791 | Ga0496107_0153111 | 3300048910 | Bacteria | 1706 |
| 1792 | Ga0496107_0176672 | 3300048910 | Bacteria | 1585 |
| 1793 | Ga0496107_0294675 | 3300048910 | Bacteria | 1207 |
| 1794 | Ga0496108_0016852 | 3300048911 | Bacteria | 5971 |
| 1795 | Ga0496108_0046337 | 3300048911 | Bacteria | 3632 |
| 1796 | Ga0496108_0071716 | 3300048911 | Bacteria | 2923 |
| 1797 | Ga0496108_1121815 | 3300048911 | Bacteria | 667 |
| 1798 | Ga0496108_1381098 | 3300048911 | Bacteria | 590 |
| 1799 | Ga0496109_0014763 | 3300048912 | Bacteria | 6796 |
| 1800 | Ga0496109_0078823 | 3300048912 | Bacteria | 3033 |
| 1801 | Ga0496109_0106641 | 3300048912 | Bacteria | 2602 |
| 1802 | Ga0496109_0418089 | 3300048912 | Bacteria | 1266 |
| 1803 | Ga0496109_0923171 | 3300048912 | Bacteria | 811 |
| 1804 | Ga0496109_1261090 | 3300048912 | Bacteria | 675 |
| 1805 | Ga0496109_1489189 | 3300048912 | Bacteria | 612 |
| 1806 | Ga0496110_0130544 | 3300048913 | Bacteria | 2268 |
| 1807 | Ga0496110_0256284 | 3300048913 | Bacteria | 1592 |
| 1808 | Ga0496110_0452662 | 3300048913 | Bacteria | 1170 |
| 1809 | Ga0496110_0915618 | 3300048913 | Bacteria | 783 |
| 1810 | Ga0496111_0000966 | 3300048914 | Bacteria | 15698 |
| 1811 | Ga0496111_0047485 | 3300048914 | Bacteria | 3092 |
| 1812 | Ga0496111_0638406 | 3300048914 | Bacteria | 777 |
| 1813 | Ga0496111_1110594 | 3300048914 | Bacteria | 563 |
| 1814 | Ga0496112_0029297 | 3300048915 | Bacteria | 5323 |
| 1815 | Ga0496112_0201674 | 3300048915 | Bacteria | 1948 |
| 1816 | Ga0496112_0668870 | 3300048915 | Bacteria | 967 |
| 1817 | Ga0496112_1346837 | 3300048915 | Bacteria | 629 |
| 1818 | Ga0496112_1394456 | 3300048915 | Bacteria | 615 |
| 1819 | Ga0496112_1901542 | 3300048915 | Bacteria | 506 |
| 1820 | Ga0496113_0103401 | 3300048916 | Bacteria | 2209 |
| 1821 | Ga0496113_0246203 | 3300048916 | Bacteria | 1427 |
| 1822 | Ga0496113_0412533 | 3300048916 | Bacteria | 1084 |
| 1823 | Ga0496113_0470773 | 3300048916 | Bacteria | 1009 |
| 1824 | Ga0496113_1002278 | 3300048916 | Bacteria | 658 |
| 1825 | Ga0496114_0237928 | 3300048917 | Bacteria | 1600 |
| 1826 | Ga0496114_0337413 | 3300048917 | Bacteria | 1332 |
| 1827 | Ga0496114_0685415 | 3300048917 | Bacteria | 899 |
| 1828 | Ga0496114_0866278 | 3300048917 | Bacteria | 784 |
| 1829 | Ga0496114_1531513 | 3300048917 | Bacteria | 555 |
| 1830 | Ga0496115_0030212 | 3300048918 | Bacteria | 4261 |
| 1831 | Ga0496115_0143568 | 3300048918 | Bacteria | 1969 |
| 1832 | Ga0496115_0441847 | 3300048918 | Bacteria | 1052 |
| 1833 | Ga0496115_0589125 | 3300048918 | Bacteria | 885 |
| 1834 | Ga0496126_0021509 | 3300048929 | Bacteria | 6299 |
| 1835 | Ga0496126_0044968 | 3300048929 | Bacteria | 4061 |
| 1836 | Ga0496126_0810372 | 3300048929 | Bacteria | 717 |
| 1837 | Ga0496126_0976717 | 3300048929 | Bacteria | 637 |
| 1838 | Ga0501306_082899 | 3300049127 | Bacteria | 555 |
| 1839 | Ga0501291_064155 | 3300049514 | Bacteria | 698 |
| 1840 | Ga0501311_084530 | 3300049527 | Bacteria | 544 |
| 1841 | Ga0501312_040992 | 3300049528 | Bacteria | 757 |
| 1842 | Ga0501315_082529 | 3300049531 | Bacteria | 548 |
| 1843 | Ga0501317_035088 | 3300049533 | Bacteria | 745 |
| 1844 | Ga0501318_044439 | 3300049534 | Bacteria | 644 |
| 1845 | Ga0501031_0002572 | 3300049568 | Bacteria | 11555 |
| 1846 | Ga0501031_0085553 | 3300049568 | Bacteria | 2056 |
| 1847 | Ga0501031_0196816 | 3300049568 | Bacteria | 1315 |
| 1848 | Ga0501031_0342624 | 3300049568 | Bacteria | 967 |
| 1849 | Ga0501031_0721815 | 3300049568 | Bacteria | 639 |
| 1850 | Ga0501032_0001212 | 3300049569 | Bacteria | 20635 |
| 1851 | Ga0501032_0004014 | 3300049569 | Bacteria | 11159 |
| 1852 | Ga0501032_0061569 | 3300049569 | Bacteria | 2515 |
| 1853 | Ga0501032_0083428 | 3300049569 | Bacteria | 2125 |
| 1854 | Ga0501032_0216319 | 3300049569 | Bacteria | 1248 |
| 1855 | Ga0501032_0292527 | 3300049569 | Bacteria | 1054 |
| 1856 | Ga0501032_0731608 | 3300049569 | Bacteria | 626 |
| 1857 | Ga0501033_0008061 | 3300049570 | Bacteria | 8158 |
| 1858 | Ga0501033_0038694 | 3300049570 | Bacteria | 3563 |
| 1859 | Ga0501033_0043629 | 3300049570 | Bacteria | 3339 |
| 1860 | Ga0501033_0102595 | 3300049570 | Bacteria | 2086 |
| 1861 | Ga0501033_0121268 | 3300049570 | Bacteria | 1897 |
| 1862 | Ga0501033_0487639 | 3300049570 | Bacteria | 853 |
| 1863 | Ga0501033_0608994 | 3300049570 | Bacteria | 748 |
| 1864 | Ga0501033_1028924 | 3300049570 | Bacteria | 550 |
| 1865 | Ga0501034_0006278 | 3300049571 | Bacteria | 12789 |
| 1866 | Ga0501034_0035629 | 3300049571 | Bacteria | 5044 |
| 1867 | Ga0501034_0092435 | 3300049571 | Bacteria | 3022 |
| 1868 | Ga0501034_0135532 | 3300049571 | Bacteria | 2443 |
| 1869 | Ga0501034_0204269 | 3300049571 | Bacteria | 1932 |
| 1870 | Ga0501034_0770472 | 3300049571 | Bacteria | 856 |
| 1871 | Ga0501036_0008586 | 3300049572 | Bacteria | 8379 |
| 1872 | Ga0501036_0026259 | 3300049572 | Bacteria | 4914 |
| 1873 | Ga0501036_0070822 | 3300049572 | Bacteria | 2948 |
| 1874 | Ga0501036_0136997 | 3300049572 | Bacteria | 2066 |
| 1875 | Ga0501036_0287623 | 3300049572 | Bacteria | 1375 |
| 1876 | Ga0501036_0404226 | 3300049572 | Bacteria | 1139 |
| 1877 | Ga0501036_0636340 | 3300049572 | Bacteria | 883 |
| 1878 | Ga0501036_0771568 | 3300049572 | Bacteria | 792 |
| 1879 | Ga0501036_1290684 | 3300049572 | Bacteria | 593 |
| 1880 | Ga0501037_0000836 | 3300049573 | Bacteria | 23004 |
| 1881 | Ga0501037_0028438 | 3300049573 | Bacteria | 4129 |
| 1882 | Ga0501037_0038085 | 3300049573 | Bacteria | 3544 |
| 1883 | Ga0501037_0047762 | 3300049573 | Bacteria | 3136 |
| 1884 | Ga0501038_0012780 | 3300049574 | Bacteria | 7668 |
| 1885 | Ga0501038_0038303 | 3300049574 | Bacteria | 4199 |
| 1886 | Ga0501038_0098123 | 3300049574 | Bacteria | 2443 |
| 1887 | Ga0501038_0202701 | 3300049574 | Bacteria | 1591 |
| 1888 | Ga0501038_0381674 | 3300049574 | Bacteria | 1093 |
| 1889 | Ga0501038_0432279 | 3300049574 | Bacteria | 1014 |
| 1890 | Ga0501039_0007687 | 3300049575 | Bacteria | 8228 |
| 1891 | Ga0501039_0186535 | 3300049575 | Bacteria | 1631 |
| 1892 | Ga0501039_0356373 | 3300049575 | Bacteria | 1149 |
| 1893 | Ga0501039_0373550 | 3300049575 | Bacteria | 1120 |
| 1894 | Ga0501039_0409181 | 3300049575 | Bacteria | 1065 |
| 1895 | Ga0501039_0720933 | 3300049575 | Bacteria | 779 |
| 1896 | Ga0501039_0774360 | 3300049575 | Bacteria | 749 |
| 1897 | Ga0501040_0007931 | 3300049576 | Bacteria | 6886 |
| 1898 | Ga0501040_0029885 | 3300049576 | Bacteria | 3678 |
| 1899 | Ga0501040_0057922 | 3300049576 | Bacteria | 2661 |
| 1900 | Ga0501041_0001518 | 3300049577 | Bacteria | 12874 |
| 1901 | Ga0501041_0254296 | 3300049577 | Bacteria | 1104 |
| 1902 | Ga0501042_0015097 | 3300049578 | Bacteria | 5281 |
| 1903 | Ga0501042_0121418 | 3300049578 | Bacteria | 1881 |
| 1904 | Ga0501042_0140483 | 3300049578 | Bacteria | 1741 |
| 1905 | Ga0501042_0312857 | 3300049578 | Bacteria | 1134 |
| 1906 | Ga0501043_0005580 | 3300049579 | Bacteria | 10135 |
| 1907 | Ga0501043_0032328 | 3300049579 | Bacteria | 4113 |
| 1908 | Ga0501043_0062990 | 3300049579 | Bacteria | 2912 |
| 1909 | Ga0501043_0176885 | 3300049579 | Bacteria | 1663 |
| 1910 | Ga0501043_0252718 | 3300049579 | Bacteria | 1357 |
| 1911 | Ga0501043_0314179 | 3300049579 | Bacteria | 1195 |
| 1912 | Ga0501043_0412595 | 3300049579 | Bacteria | 1019 |
| 1913 | Ga0501046_0037516 | 3300049580 | Bacteria | 3893 |
| 1914 | Ga0501046_0119453 | 3300049580 | Bacteria | 2007 |
| 1915 | Ga0501046_0143575 | 3300049580 | Bacteria | 1804 |
| 1916 | Ga0501046_0494625 | 3300049580 | Bacteria | 876 |
| 1917 | Ga0501047_0000072 | 3300049581 | Bacteria | 126542 |
| 1918 | Ga0501047_0001607 | 3300049581 | Bacteria | 22028 |
| 1919 | Ga0501047_0070941 | 3300049581 | Bacteria | 3353 |
| 1920 | Ga0501047_0152655 | 3300049581 | Bacteria | 2184 |
| 1921 | Ga0501047_0169702 | 3300049581 | Bacteria | 2051 |
| 1922 | Ga0501047_0384844 | 3300049581 | Bacteria | 1237 |
| 1923 | Ga0501048_0011519 | 3300049582 | Bacteria | 6593 |
| 1924 | Ga0501048_0015295 | 3300049582 | Bacteria | 5666 |
| 1925 | Ga0501048_0037211 | 3300049582 | Bacteria | 3494 |
| 1926 | Ga0501048_0704370 | 3300049582 | Bacteria | 725 |
| 1927 | Ga0501067_0013763 | 3300049583 | Bacteria | 4479 |
| 1928 | Ga0501068_0003236 | 3300049584 | Bacteria | 8730 |
| 1929 | Ga0501068_0333682 | 3300049584 | Bacteria | 973 |
| 1930 | Ga0501068_0493369 | 3300049584 | Bacteria | 794 |
| 1931 | Ga0501069_0017860 | 3300049585 | Bacteria | 3825 |
| 1932 | Ga0501069_0031481 | 3300049585 | Bacteria | 2917 |
| 1933 | Ga0501069_0305289 | 3300049585 | Bacteria | 934 |
| 1934 | Ga0501070_0005040 | 3300049586 | Bacteria | 11267 |
| 1935 | Ga0501070_0008482 | 3300049586 | Bacteria | 8684 |
| 1936 | Ga0501070_0009153 | 3300049586 | Bacteria | 8375 |
| 1937 | Ga0501070_0012340 | 3300049586 | Bacteria | 7208 |
| 1938 | Ga0501070_0012975 | 3300049586 | Bacteria | 7023 |
| 1939 | Ga0501070_0031412 | 3300049586 | Bacteria | 4450 |
| 1940 | Ga0501070_0845307 | 3300049586 | Bacteria | 716 |
| 1941 | Ga0501070_1474102 | 3300049586 | Bacteria | 515 |
| 1942 | Ga0501071_0006687 | 3300049587 | Bacteria | 7492 |
| 1943 | Ga0501071_0205182 | 3300049587 | Bacteria | 1481 |
| 1944 | Ga0501071_0244047 | 3300049587 | Bacteria | 1355 |
| 1945 | Ga0501071_0689739 | 3300049587 | Bacteria | 786 |
| 1946 | Ga0501072_0001898 | 3300049588 | Bacteria | 15570 |
| 1947 | Ga0501072_0267605 | 3300049588 | Bacteria | 1360 |
| 1948 | Ga0501072_0333566 | 3300049588 | Bacteria | 1205 |
| 1949 | Ga0501073_0009415 | 3300049589 | Bacteria | 7213 |
| 1950 | Ga0501073_0015567 | 3300049589 | Bacteria | 5517 |
| 1951 | Ga0501073_0771727 | 3300049589 | Bacteria | 663 |
| 1952 | Ga0501074_0000607 | 3300049590 | Bacteria | 22272 |
| 1953 | Ga0501074_0006705 | 3300049590 | Bacteria | 8310 |
| 1954 | Ga0501074_0016000 | 3300049590 | Bacteria | 5452 |
| 1955 | Ga0501074_0076631 | 3300049590 | Bacteria | 2400 |
| 1956 | Ga0501074_0080253 | 3300049590 | Bacteria | 2341 |
| 1957 | Ga0501075_0011003 | 3300049591 | Bacteria | 6384 |
| 1958 | Ga0501075_0020072 | 3300049591 | Bacteria | 4854 |
| 1959 | Ga0501076_0003333 | 3300049592 | Bacteria | 11268 |
| 1960 | Ga0501076_0035235 | 3300049592 | Bacteria | 3916 |
| 1961 | Ga0501076_0424529 | 3300049592 | Bacteria | 1094 |
| 1962 | Ga0501076_0549399 | 3300049592 | Bacteria | 952 |
| 1963 | Ga0501076_0644736 | 3300049592 | Bacteria | 874 |
| 1964 | Ga0501077_0019671 | 3300049593 | Bacteria | 4271 |
| 1965 | Ga0501077_0023052 | 3300049593 | Bacteria | 3948 |
| 1966 | Ga0501235_008627 | 3300049669 | Bacteria | 2225 |
| 1967 | Ga0501251_022715 | 3300049681 | Bacteria | 845 |
| 1968 | Ga0501261_034512 | 3300049690 | Bacteria | 777 |
| 1969 | Ga0501079_0000029 | 3300049741 | Bacteria | 60538 |
| 1970 | Ga0501079_0007167 | 3300049741 | Bacteria | 8417 |
| 1971 | Ga0501079_0328774 | 3300049741 | Bacteria | 1197 |
| 1972 | Ga0501080_0006601 | 3300049742 | Bacteria | 10427 |
| 1973 | Ga0501080_0013816 | 3300049742 | Bacteria | 7434 |
| 1974 | Ga0501080_0121371 | 3300049742 | Bacteria | 2421 |
| 1975 | Ga0501080_0193663 | 3300049742 | Bacteria | 1867 |
| 1976 | Ga0501080_0639037 | 3300049742 | Bacteria | 942 |
| 1977 | Ga0501080_1383399 | 3300049742 | Bacteria | 601 |
| 1978 | Ga0501080_1407600 | 3300049742 | Bacteria | 595 |
| 1979 | Ga0501081_0076315 | 3300049743 | Bacteria | 2340 |
| 1980 | Ga0501083_0383782 | 3300049744 | Bacteria | 914 |
| 1981 | Ga0501282_001694 | 3300049778 | Bacteria | 2435 |
| 1982 | Ga0501035_0005086 | 3300049822 | Bacteria | 12462 |
| 1983 | Ga0501035_0012487 | 3300049822 | Bacteria | 7847 |
| 1984 | Ga0501035_0024124 | 3300049822 | Bacteria | 5579 |
| 1985 | Ga0501035_0111057 | 3300049822 | Bacteria | 2403 |
| 1986 | Ga0501035_0132132 | 3300049822 | Bacteria | 2175 |
| 1987 | Ga0501035_0298983 | 3300049822 | Bacteria | 1356 |
| 1988 | Ga0501035_0479587 | 3300049822 | Bacteria | 1026 |
| 1989 | Ga0501044_0005927 | 3300049823 | Bacteria | 13541 |
| 1990 | Ga0501044_0007860 | 3300049823 | Bacteria | 11729 |
| 1991 | Ga0501044_0050036 | 3300049823 | Bacteria | 4313 |
| 1992 | Ga0501044_0059401 | 3300049823 | Bacteria | 3918 |
| 1993 | Ga0501044_0065905 | 3300049823 | Bacteria | 3693 |
| 1994 | Ga0501044_0091036 | 3300049823 | Bacteria | 3076 |
| 1995 | Ga0501044_0092812 | 3300049823 | Bacteria | 3044 |
| 1996 | Ga0501044_0203538 | 3300049823 | Bacteria | 1937 |
| 1997 | Ga0501044_0210357 | 3300049823 | Bacteria | 1899 |
| 1998 | Ga0501044_0237979 | 3300049823 | Bacteria | 1765 |
| 1999 | Ga0501044_0777924 | 3300049823 | Bacteria | 838 |
| 2000 | Ga0501045_0014996 | 3300049824 | Bacteria | 5499 |
| 2001 | Ga0501045_0037572 | 3300049824 | Bacteria | 3520 |
| 2002 | Ga0501045_0348642 | 3300049824 | Bacteria | 1102 |
| 2003 | Ga0501045_0553357 | 3300049824 | Bacteria | 853 |
| 2004 | Ga0501045_0801738 | 3300049824 | Bacteria | 693 |
| 2005 | nmdc:mga03683_331178_c1 | 3300050489 | Bacteria | 718 |
| 2006 | nmdc:mga03n38_71279_c1 | 3300050490 | Bacteria | 1609 |
| 2007 | nmdc:mga0yw44_371395_c1 | 3300050492 | Bacteria | 965 |
| 2008 | nmdc:mga05p37_1302285_c1 | 3300050507 | Bacteria | 741 |
| 2009 | nmdc:mga05p37_1677414_c1 | 3300050507 | Bacteria | 621 |
| 2010 | nmdc:mga05p37_2012723_c1 | 3300050507 | Bacteria | 546 |
| 2011 | nmdc:mga05p37_425422_c1 | 3300050507 | Unclassified | 1544 |
| 2012 | nmdc:mga05p37_4279_c1 | 3300050507 | Bacteria | 16672 |
| 2013 | nmdc:mga05p37_728152_c1 | 3300050507 | Bacteria | 1097 |
| 2014 | nmdc:mga09592_21197_c1 | 3300050508 | Bacteria | 5354 |
| 2015 | nmdc:mga09592_326452_c1 | 3300050508 | Bacteria | 1329 |
| 2016 | nmdc:mga08y16_142507_c1 | 3300050511 | Bacteria | 2491 |
| 2017 | nmdc:mga08y16_52073_c1 | 3300050511 | Bacteria | 4284 |
| 2018 | nmdc:mga08y16_735505_c1 | 3300050511 | Bacteria | 984 |
| 2019 | nmdc:mga0n895_1080559_c1 | 3300050512 | Bacteria | 780 |
| 2020 | nmdc:mga0n895_1231098_c1 | 3300050512 | Bacteria | 722 |
| 2021 | nmdc:mga0n895_149115_c1 | 3300050512 | Bacteria | 2368 |
| 2022 | nmdc:mga0n895_347695_c1 | 3300050512 | Bacteria | 1502 |
| 2023 | nmdc:mga0n895_63544_c1 | 3300050512 | Bacteria | 3651 |
| 2024 | nmdc:mga0n895_7764_c1 | 3300050512 | Bacteria | 9243 |
| 2025 | nmdc:mga0rr50_103846_c1 | 3300050513 | Bacteria | 2238 |
| 2026 | nmdc:mga0rr50_1174000_c1 | 3300050513 | Bacteria | 652 |
| 2027 | nmdc:mga0rr50_1483984_c1 | 3300050513 | Bacteria | 573 |
| 2028 | nmdc:mga0rr50_1831282_c1 | 3300050513 | Bacteria | 511 |
| 2029 | nmdc:mga0rr50_4305_c1 | 3300050513 | Bacteria | 8339 |
| 2030 | nmdc:mga0rr50_9965_c1 | 3300050513 | Bacteria | 6007 |
| 2031 | nmdc:mga08x19_107348_c1 | 3300050514 | Bacteria | 1859 |
| 2032 | nmdc:mga08x19_15062_c1 | 3300050514 | Bacteria | 4697 |
| 2033 | nmdc:mga08x19_16720_c1 | 3300050514 | Bacteria | 4479 |
| 2034 | nmdc:mga08x19_308513_c1 | 3300050514 | Bacteria | 1100 |
| 2035 | nmdc:mga08x19_382382_c1 | 3300050514 | Bacteria | 986 |
| 2036 | nmdc:mga0a205_306282_c1 | 3300050515 | Bacteria | 1461 |
| 2037 | nmdc:mga0a205_312603_c1 | 3300050515 | Bacteria | 1443 |
| 2038 | nmdc:mga0a205_362154_c1 | 3300050515 | Bacteria | 1317 |
| 2039 | nmdc:mga0a205_618_c1 | 3300050515 | Bacteria | 28265 |
| 2040 | nmdc:mga0a205_81627_c1 | 3300050515 | Bacteria | 3123 |
| 2041 | Ga0495601_0039256 | 3300053077 | Bacteria | 2964 |
| 2042 | Ga0495601_0053846 | 3300053077 | Bacteria | 2544 |
| 2043 | Ga0495601_0151747 | 3300053077 | Bacteria | 1512 |
| 2044 | Ga0495601_0264047 | 3300053077 | Bacteria | 1123 |
| 2045 | Ga0495601_0734996 | 3300053077 | Bacteria | 628 |
| 2046 | Ga0495601_0802431 | 3300053077 | Bacteria | 597 |
| 2047 | Ga0495612_0001654 | 3300053078 | Bacteria | 9176 |
| 2048 | Ga0495612_0003302 | 3300053078 | Bacteria | 6687 |
| 2049 | Ga0495612_0028326 | 3300053078 | Bacteria | 2255 |
| 2050 | Ga0495612_0095192 | 3300053078 | Bacteria | 1264 |
| 2051 | Ga0495612_0228164 | 3300053078 | Bacteria | 825 |
| 2052 | Ga0495655_0020718 | 3300053083 | Bacteria | 1479 |
| 2053 | Ga0495655_0176416 | 3300053083 | Bacteria | 687 |
| 2054 | Ga0495595_0003935 | 3300053084 | Bacteria | 5933 |
| 2055 | Ga0495595_0087318 | 3300053084 | Bacteria | 1493 |
| 2056 | Ga0495619_0007135 | 3300053085 | Bacteria | 7074 |
| 2057 | Ga0495619_0014045 | 3300053085 | Bacteria | 5052 |
| 2058 | Ga0495619_0067820 | 3300053085 | Bacteria | 2382 |
| 2059 | Ga0495619_0092261 | 3300053085 | Bacteria | 2051 |
| 2060 | Ga0495619_0245604 | 3300053085 | Bacteria | 1240 |
| 2061 | Ga0495619_0699125 | 3300053085 | Bacteria | 689 |
| 2062 | Ga0500583_0271553 | 3300053092 | Bacteria | 834 |
| 2063 | Ga0500651_0403077 | 3300053093 | Bacteria | 768 |
| 2064 | Ga0500566_0137313 | 3300053094 | Bacteria | 1301 |
| 2065 | Ga0500641_0084013 | 3300053096 | Bacteria | 1354 |
| 2066 | Ga0500641_0381705 | 3300053096 | Bacteria | 559 |
| 2067 | Ga0500654_064920 | 3300053099 | Bacteria | 1833 |
| 2068 | Ga0500553_118913 | 3300053101 | Bacteria | 1093 |
| 2069 | Ga0500556_0401583 | 3300053104 | Bacteria | 526 |
| 2070 | Ga0500558_067368 | 3300053106 | Bacteria | 1484 |
| 2071 | Ga0500560_127497 | 3300053107 | Bacteria | 852 |
| 2072 | Ga0500569_004143 | 3300053109 | Bacteria | 3026 |
| 2073 | Ga0500594_0022448 | 3300053118 | Bacteria | 1592 |
| 2074 | Ga0500614_017862 | 3300053123 | Bacteria | 1608 |
| 2075 | Ga0500628_012677 | 3300053129 | Bacteria | 1557 |
| 2076 | Ga0500652_008937 | 3300053131 | Bacteria | 3365 |
| 2077 | Ga0500655_147778 | 3300053133 | Bacteria | 507 |
| 2078 | Ga0500658_0003343 | 3300053134 | Bacteria | 6078 |
| 2079 | Ga0500573_0065287 | 3300053140 | Bacteria | 2081 |
| 2080 | Ga0500573_0137513 | 3300053140 | Bacteria | 1348 |
| 2081 | Ga0500573_0320426 | 3300053140 | Bacteria | 766 |
| 2082 | Ga0500579_018317 | 3300053143 | Bacteria | 4535 |
| 2083 | Ga0500589_207773 | 3300053147 | Bacteria | 747 |
| 2084 | Ga0500600_0032935 | 3300053149 | Bacteria | 3033 |
| 2085 | Ga0500600_0295193 | 3300053149 | Bacteria | 697 |
| 2086 | Ga0500603_105497 | 3300053150 | Bacteria | 842 |
| 2087 | Ga0500616_0256946 | 3300053153 | Bacteria | 743 |
| 2088 | Ga0500633_0000825 | 3300053160 | Bacteria | 5333 |
| 2089 | Ga0500634_0050937 | 3300053161 | Bacteria | 2228 |
| 2090 | Ga0500656_001561 | 3300053732 | Bacteria | 1992 |
| 2091 | Ga0500587_002484 | 3300053739 | Bacteria | 2620 |
| 2092 | Ga0501084_0004130 | 3300054114 | Bacteria | 11829 |
| 2093 | Ga0501084_0048010 | 3300054114 | Bacteria | 3575 |
| 2094 | Ga0501084_0110758 | 3300054114 | Bacteria | 2307 |
| 2095 | Ga0501084_0284950 | 3300054114 | Bacteria | 1395 |
| 2096 | Ga0501084_0891695 | 3300054114 | Bacteria | 748 |
| 2097 | Ga0590075_003626 | 3300059424 | Bacteria | 3662 |
| 2098 | Ga0587066_125493 | 3300059490 | Bacteria | 611 |
| 2099 | Ga0587072_046729 | 3300059643 | Bacteria | 857 |
| 2100 | Ga0587078_075059 | 3300059646 | Bacteria | 534 |
| 2101 | Ga0587114_108277 | 3300059655 | Bacteria | 549 |
| 2102 | Ga0587071_085205 | 3300060344 | Bacteria | 710 |
| 2103 | Ga0587111_0019558 | 3300060346 | Bacteria | 1286 |
| 2104 | Ga0501082_0008254 | 3300060353 | Bacteria | 8980 |
| 2105 | Ga0501082_0188578 | 3300060353 | Bacteria | 1794 |
| 2106 | Ga0501082_0689082 | 3300060353 | Bacteria | 894 |
| 2107 | Ga0466962_0001597 | 3300061719 | Bacteria | 10609 |
| 2108 | Ga0466962_0003215 | 3300061719 | Bacteria | 7762 |
| 2109 | Ga0466962_0019804 | 3300061719 | Bacteria | 3233 |
| 2110 | Ga0466962_0024928 | 3300061719 | Bacteria | 2871 |
| 2111 | Ga0466962_0035029 | 3300061719 | Bacteria | 2403 |
| 2112 | Ga0466962_0209981 | 3300061719 | Bacteria | 952 |
| 2113 | Ga0466962_0567793 | 3300061719 | Bacteria | 577 |
| 2114 | Ga0530510_0056005 | 3300061734 | Bacteria | 2848 |
| 2115 | Ga0530510_0241313 | 3300061734 | Bacteria | 1345 |
| 2116 | Ga0530510_1109580 | 3300061734 | Bacteria | 606 |
| 2117 | Ga0530510_1135254 | 3300061734 | Bacteria | 599 |
| 2118 | 2528202875 | 2527291627 | Bacteria | 5309833 |
| 2119 | 2528213253 | 2527291629 | Bacteria | 5267418 |
| 2120 | 2537898779 | 2537561592 | Bacteria | 4348607 |
| 2121 | 2546947610 | 2546825537 | Bacteria | 5389291 |
| 2122 | 2547408185 | 2547132111 | Bacteria | 8013147 |
| 2123 | 2554257760 | 2554235005 | Bacteria | 6457341 |
| 2124 | 2579748402 | 2576861822 | Bacteria | 5004595 |
| 2125 | 2579857875 | 2579778521 | Bacteria | 7624758 |
| 2126 | 2585299224 | 2582581312 | Bacteria | 7308206 |
| 2127 | 2585308877 | 2582581313 | Bacteria | 10042643 |
| 2128 | 2600198837 | 2599185353 | Bacteria | 2219443 |
| 2129 | 2616904550 | 2616644941 | Bacteria | 8510691 |
| 2130 | 2619858529 | 2619618881 | Bacteria | 7521104 |
| 2131 | 2620353764 | 2619619003 | Bacteria | 7619552 |
| 2132 | 2626634477 | 2626541554 | Bacteria | 7741902 |
| 2133 | 2643765030 | 2643221548 | Bacteria | 8053412 |
| 2134 | 2643900764 | 2643221578 | Bacteria | 9213798 |
| 2135 | 2643942346 | 2643221587 | Bacteria | 7586415 |
| 2136 | 2644017133 | 2643221601 | Bacteria | 7493239 |
| 2137 | 2644173906 | 2643221631 | Bacteria | 8168043 |
| 2138 | 2644262368 | 2643221647 | Bacteria | 10741251 |
| 2139 | 2644389982 | 2643221670 | Bacteria | 6497041 |
| 2140 | 2644405015 | 2643221673 | Bacteria | 9196637 |
| 2141 | 2644429426 | 2643221677 | Bacteria | 7584031 |
| 2142 | 2644461131 | 2643221682 | Bacteria | 6743283 |
| 2143 | 2676497096 | 2675903060 | Bacteria | 10051191 |
| 2144 | 2686534371 | 2684623035 | Bacteria | 8032739 |
| 2145 | 2686543749 | 2684623036 | Bacteria | 5199090 |
| 2146 | 2710604303 | 2710264753 | Bacteria | 5455564 |
| 2147 | 2768643512 | 2767802112 | Bacteria | 6465194 |
| 2148 | 2774864285 | 2773857924 | Bacteria | 5256821 |
| 2149 | 2784588645 | 2784132148 | Bacteria | 8627943 |
| 2150 | 2785343206 | 2784746763 | Bacteria | 9783172 |
| 2151 | 2785369589 | 2784746768 | Bacteria | 10036182 |
| 2152 | 2786670679 | 2786546132 | Bacteria | 10419719 |
| 2153 | 2791213414 | 2788500588 | Bacteria | 4584915 |
| 2154 | 2793984432 | 2791355406 | Bacteria | 11364898 |
| 2155 | 2804846910 | 2802429296 | Bacteria | 7227771 |
| 2156 | 2809232255 | 2808606448 | Bacteria | 8656184 |
| 2157 | 2811849127 | 2808606982 | Bacteria | 7791042 |
| 2158 | 2812358008 | 2811994879 | Bacteria | 9313447 |
| 2159 | 2812480452 | 2811994917 | Bacteria | 7761064 |
| 2160 | 2819627478 | 2818991451 | Bacteria | 4697364 |
| 2161 | 2819695484 | 2818991463 | Bacteria | 7948711 |
| 2162 | 2819741196 | 2818991472 | Bacteria | 10089953 |
| 2163 | 2844851709 | 2844849076 | Bacteria | 4091819 |
| 2164 | 2847088829 | 2847085930 | Bacteria | 5070450 |
| 2165 | 2852636577 | 2852635781 | Bacteria | 8251373 |
| 2166 | 2856744598 | 2856741275 | Bacteria | 8096094 |
| 2167 | 2862179398 | 2862178590 | Bacteria | 8583590 |
| 2168 | 2862285734 | 2862281513 | Bacteria | 9621493 |
| 2169 | 2862294834 | 2862290372 | Bacteria | 7471434 |
| 2170 | 2862391572 | 2862382967 | Bacteria | 10317375 |
| 2171 | 2862511733 | 2862507626 | Bacteria | 9425308 |
| 2172 | 2862579180 | 2862574272 | Bacteria | 10567477 |
| 2173 | 2862709359 | 2862705112 | Bacteria | 6563286 |
| 2174 | 2863404518 | 2863404153 | Bacteria | 9672205 |
| 2175 | 2867348898 | 2867346516 | Bacteria | 7608576 |
| 2176 | 2867371955 | 2867369537 | Bacteria | 6501581 |
| 2177 | 2867434852 | 2867428634 | Bacteria | 9590268 |
| 2178 | 2867479902 | 2867475112 | Bacteria | 6909112 |
| 2179 | 2873155656 | 2873151551 | Bacteria | 8625867 |
| 2180 | 2873316372 | 2873314349 | Bacteria | 8512634 |
| 2181 | 2875395639 | 2875391855 | Bacteria | 7600475 |
| 2182 | 2877681039 | 2877676314 | Bacteria | 9512378 |
| 2183 | 2884703590 | 2884693830 | Bacteria | 11273186 |
| 2184 | 2891398903 | 2891395885 | Bacteria | 9251614 |
| 2185 | 2891559113 | 2891554331 | Bacteria | 8812224 |
| 2186 | 2891569556 | 2891562705 | Bacteria | 8039471 |
| 2187 | 2895438539 | 2895427314 | Bacteria | 13147766 |
| 2188 | 2895443382 | 2895442618 | Bacteria | 11027144 |
| 2189 | 2895883767 | 2895880812 | Bacteria | 11255272 |
| 2190 | 2904501520 | 2904497146 | Bacteria | 4731781 |
| 2191 | 2904608559 | 2904606771 | Bacteria | 4684500 |
| 2192 | 2912724285 | 2912723979 | Bacteria | 8557534 |
| 2193 | 2912760859 | 2912757875 | Bacteria | 7940295 |
| 2194 | 2918505511 | 2918501144 | Bacteria | 8668083 |
| 2195 | 2919035526 | 2919034639 | Bacteria | 4763403 |
| 2196 | 2935393340 | 2935390628 | Bacteria | 7043367 |
| 2197 | 2946049000 | 2946045630 | Bacteria | 8527308 |
| 2198 | 2946067835 | 2946064051 | Bacteria | 8957905 |
| 2199 | 2946075977 | 2946072368 | Bacteria | 8999607 |
| 2200 | 2947229160 | 2947224130 | Bacteria | 9938529 |
| 2201 | 2954386148 | 2954380949 | Bacteria | 10050426 |
| 2202 | 2954677002 | 2954673503 | Bacteria | 9685905 |
| 2203 | 2954687155 | 2954682443 | Bacteria | 9862841 |
| 2204 | 2954696786 | 2954691527 | Bacteria | 10720516 |
| 2205 | 2954705352 | 2954701450 | Bacteria | 10834262 |
| 2206 | 2954716165 | 2954711539 | Bacteria | 10867210 |
| 2207 | 2954726108 | 2954721474 | Bacteria | 10456478 |
| 2208 | 2954735702 | 2954731030 | Bacteria | 10243860 |
| 2209 | 2954745034 | 2954740390 | Bacteria | 10229294 |
| 2210 | 2954754558 | 2954749733 | Bacteria | 10366972 |
| 2211 | 2954764006 | 2954759201 | Bacteria | 9358192 |
| 2212 | 2966601722 | 2966598605 | Bacteria | 7676064 |
| 2213 | 2990048080 | 2990044586 | Bacteria | 6603797 |
| 2214 | 2990063166 | 2990059506 | Bacteria | 9321252 |
| 2215 | 2995465892 | 2995463766 | Bacteria | 8577691 |
| 2216 | 2995466746 | 2995463766 | Bacteria | 8577691 |
| 2217 | 2997457774 | 2997451912 | Bacteria | 8492419 |
| 2218 | 2997600354 | 2997600082 | Bacteria | 9896405 |
| 2219 | 3003004870 | 3002998708 | Bacteria | 11715108 |
| 2220 | 3006324990 | 3006321560 | Bacteria | 8247479 |
| 2221 | 3006399692 | 3006393351 | Bacteria | 6615579 |
| 2222 | 3006428769 | 3006425503 | Bacteria | 6491253 |
| 2223 | 3006487457 | 3006486233 | Bacteria | 8157040 |
| 2224 | 3006500827 | 3006493962 | Bacteria | 8825450 |
| 2225 | 637877588 | 637000116 | Bacteria | 5433628 |
| 2226 | 8007377605 | 8007375930 | Bacteria | 4080554 |
| 2227 | 8008488623 | 8008485437 | Bacteria | 7198341 |
| 2228 | 8008567201 | 8008558824 | Bacteria | 10610750 |
| 2229 | 8008578821 | 8008574985 | Bacteria | 7815457 |
| 2230 | 8023629810 | 8023623736 | Bacteria | 8593882 |
| 2231 | 8025417821 | 8025413630 | Bacteria | 7014048 |
| 2232 | 8025481844 | 8025478263 | Bacteria | 8209203 |
| 2233 | 8025527399 | 8025524527 | Bacteria | 7197316 |
| 2234 | 8025537943 | 8025530807 | Bacteria | 8495698 |
| 2235 | 8033686962 | 8033684223 | Bacteria | 6906479 |
| 2236 | 8047898044 | 8047893842 | Bacteria | 11723082 |
| 2237 | 8048128019 | 8048127548 | Bacteria | 11053136 |
| 2238 | 8048360849 | 8048356638 | Bacteria | 11044339 |
| 2239 | 8048375007 | 8048369669 | Bacteria | 11666822 |
| 2240 | 8048383199 | 8048379754 | Bacteria | 11877923 |
| 2241 | 8048412667 | 8048406513 | Bacteria | 8936924 |
| 2242 | 8054167024 | 8054160619 | Bacteria | 7783213 |
| 2243 | 8055074387 | 8055066027 | Bacteria | 9479577 |
| 2244 | 8055173924 | 8055172936 | Bacteria | 9305943 |
| 2245 | 8056449183 | 8056447290 | Bacteria | 7680491 |
| 2246 | 8056671188 | 8056667051 | Bacteria | 6953971 |
| 2247 | Ga0466961_0728462 | |||
| 2248 | JGI24741J21665_1068614 | |||
| 2249 | JGI24752J21851_1053559 | |||
| 2250 | JGI24747J21853_1048214 | |||
| 2251 | JGI24740J21852_10144583 | |||
| 2252 | JGI24743J22301_10063866 | |||
| 2253 | JGI24745J21846_1054131 | |||
| 2254 | JGI24033J26618_1075896 | |||
| 2255 | JGI24751J29686_10011389 | |||
| 2256 | JGI25152J39213_1000431 | |||
| 2257 | Ga0006759J45824_1010939 | |||
| 2258 | JGI25151J46595_10048603 | |||
| 2259 | rootH1_10054865 | |||
| 2260 | rootL2_10002354 | |||
| 2261 | rootH1_10077154 | |||
| 2262 | Ga0007417J51691_1031744 | |||
| 2263 | Ga0007416J51690_1039243 | |||
| 2264 | Ga0006562J51391_1013573 | |||
| 2265 | Ga0007429J51699_1029739 | |||
| 2266 | JGI25404J52841_10004078 | |||
| 2267 | Ga0058859_11593662 | |||
| 2268 | Ga0070658_10080675 | |||
| 2269 | Ga0070658_10109176 | |||
| 2270 | Ga0070658_10126206 | |||
| 2271 | Ga0070658_10384459 | |||
| 2272 | Ga0070658_10467407 | |||
| 2273 | Ga0070658_10489431 | |||
| 2274 | Ga0070658_10573142 | |||
| 2275 | Ga0070658_11618769 | |||
| 2276 | Ga0070676_10132525 | |||
| 2277 | Ga0070676_10199801 | |||
| 2278 | Ga0070683_100086548 | |||
| 2279 | Ga0070683_100236714 | |||
| 2280 | Ga0070683_100242651 | |||
| 2281 | Ga0070683_100319737 | |||
| 2282 | Ga0070683_100649829 | |||
| 2283 | Ga0070683_100769179 | |||
| 2284 | Ga0070683_100933785 | |||
| 2285 | Ga0070683_100993534 | |||
| 2286 | Ga0070690_100074092 | |||
| 2287 | Ga0070690_100728694 | |||
| 2288 | Ga0070670_100116948 | |||
| 2289 | Ga0070670_100304737 | |||
| 2290 | Ga0070670_100714487 | |||
| 2291 | Ga0068869_100102951 | |||
| 2292 | Ga0068869_100415167 | |||
| 2293 | Ga0070666_10354187 | |||
| 2294 | Ga0070666_10956143 | |||
| 2295 | Ga0070680_100046686 | |||
| 2296 | Ga0070680_100538264 | |||
| 2297 | Ga0070680_100606669 | |||
| 2298 | Ga0070680_100610347 | |||
| 2299 | Ga0070680_100698235 | |||
| 2300 | Ga0070680_101025375 | |||
| 2301 | Ga0070682_100156042 | |||
| 2302 | Ga0070682_100393943 | |||
| 2303 | Ga0070682_100538345 | |||
| 2304 | Ga0068868_100047482 | |||
| 2305 | Ga0068868_100124661 | |||
| 2306 | Ga0068868_100147618 | |||
| 2307 | Ga0068868_100284076 | |||
| 2308 | Ga0068868_100542797 | |||
| 2309 | Ga0068868_100858346 | |||
| 2310 | Ga0068868_102239428 | |||
| 2311 | Ga0070660_100056154 | |||
| 2312 | Ga0070660_100205642 | |||
| 2313 | Ga0070660_100263905 | |||
| 2314 | Ga0070660_100354618 | |||
| 2315 | Ga0070660_100510441 | |||
| 2316 | Ga0070660_101554158 | |||
| 2317 | Ga0070689_100023700 | |||
| 2318 | Ga0070689_100077283 | |||
| 2319 | Ga0070691_10011376 | |||
| 2320 | Ga0070691_10102607 | |||
| 2321 | Ga0070687_100030344 | |||
| 2322 | Ga0070687_100063632 | |||
| 2323 | Ga0070661_100021766 | |||
| 2324 | Ga0070661_100124775 | |||
| 2325 | Ga0070661_100334839 | |||
| 2326 | Ga0070661_101843976 | |||
| 2327 | Ga0070692_10041379 | |||
| 2328 | Ga0070692_10055692 | |||
| 2329 | Ga0070692_10254029 | |||
| 2330 | Ga0070692_11110272 | |||
| 2331 | Ga0070692_11233403 | |||
| 2332 | Ga0070668_100125509 | |||
| 2333 | Ga0070668_101289281 | |||
| 2334 | Ga0070669_100198950 | |||
| 2335 | Ga0070669_100614344 | |||
| 2336 | Ga0070675_100014849 | |||
| 2337 | Ga0070675_100412316 | |||
| 2338 | Ga0070671_100079033 | |||
| 2339 | Ga0070671_100093054 | |||
| 2340 | Ga0070671_100984026 | |||
| 2341 | Ga0070671_101505015 | |||
| 2342 | Ga0070674_100106617 | |||
| 2343 | Ga0070674_100420697 | |||
| 2344 | Ga0070674_100474125 | |||
| 2345 | Ga0070674_100928262 | |||
| 2346 | Ga0070673_100104251 | |||
| 2347 | Ga0070673_100154142 | |||
| 2348 | Ga0070673_100870359 | |||
| 2349 | Ga0070673_102250448 | |||
| 2350 | Ga0070688_100871259 | |||
| 2351 | Ga0070659_100122200 | |||
| 2352 | Ga0070659_100498801 | |||
| 2353 | Ga0070659_102159688 | |||
| 2354 | Ga0070667_100120475 | |||
| 2355 | Ga0070667_100600987 | |||
| 2356 | Ga0070667_101238485 | |||
| 2357 | Ga0070667_101365278 | |||
| 2358 | Ga0070667_101456044 | |||
| 2359 | Ga0070703_10180095 | |||
| 2360 | Ga0070709_10001280 | |||
| 2361 | Ga0070709_10006908 | |||
| 2362 | Ga0070709_10063516 | |||
| 2363 | Ga0070709_10087255 | |||
| 2364 | Ga0070709_10174334 | |||
| 2365 | Ga0070709_10202510 | |||
| 2366 | Ga0070709_10778168 | |||
| 2367 | Ga0070714_100001940 | |||
| 2368 | Ga0070714_100034995 | |||
| 2369 | Ga0070714_100037342 | |||
| 2370 | Ga0070714_100095332 | |||
| 2371 | Ga0070714_100377177 | |||
| 2372 | Ga0070714_100988991 | |||
| 2373 | Ga0070714_101171864 | |||
| 2374 | Ga0070714_101177506 | |||
| 2375 | Ga0070714_101715283 | |||
| 2376 | Ga0070713_100004434 | |||
| 2377 | Ga0070713_100012635 | |||
| 2378 | Ga0070713_100013221 | |||
| 2379 | Ga0070713_100049348 | |||
| 2380 | Ga0070713_100088315 | |||
| 2381 | Ga0070713_100147071 | |||
| 2382 | Ga0070713_100649696 | |||
| 2383 | Ga0070713_100841886 | |||
| 2384 | Ga0070713_100898909 | |||
| 2385 | Ga0070713_101061230 | |||
| 2386 | Ga0070713_101255139 | |||
| 2387 | Ga0070713_101653296 | |||
| 2388 | Ga0070713_101710907 | |||
| 2389 | Ga0070713_102016839 | |||
| 2390 | Ga0070710_10001003 | |||
| 2391 | Ga0070710_10023246 | |||
| 2392 | Ga0070710_10040445 | |||
| 2393 | Ga0070710_10092801 | |||
| 2394 | Ga0070710_10788568 | |||
| 2395 | Ga0070701_10002382 | |||
| 2396 | Ga0070701_10017082 | |||
| 2397 | Ga0070701_10383669 | |||
| 2398 | Ga0070711_100002980 | |||
| 2399 | Ga0070711_100012494 | |||
| 2400 | Ga0070711_100032246 | |||
| 2401 | Ga0070711_100047988 | |||
| 2402 | Ga0070711_100305332 | |||
| 2403 | Ga0070711_100360005 | |||
| 2404 | Ga0070711_100463276 | |||
| 2405 | Ga0070711_100914197 | |||
| 2406 | Ga0070711_100989946 | |||
| 2407 | Ga0070705_100117944 | |||
| 2408 | Ga0070705_100253250 | |||
| 2409 | Ga0070705_100676564 | |||
| 2410 | Ga0070700_100084167 | |||
| 2411 | Ga0070700_100126695 | |||
| 2412 | Ga0070694_100159574 | |||
| 2413 | Ga0070694_101185010 | |||
| 2414 | Ga0070708_100025343 | |||
| 2415 | Ga0070708_100224558 | |||
| 2416 | Ga0070708_100530524 | |||
| 2417 | Ga0070708_101258753 | |||
| 2418 | Ga0070663_100054987 | |||
| 2419 | Ga0070663_100188437 | |||
| 2420 | Ga0070663_100257789 | |||
| 2421 | Ga0070663_100496541 | |||
| 2422 | Ga0070663_100524603 | |||
| 2423 | Ga0070663_101374622 | |||
| 2424 | Ga0070678_100001635 | |||
| 2425 | Ga0070678_100096431 | |||
| 2426 | Ga0070678_100977622 | |||
| 2427 | Ga0070678_101473509 | |||
| 2428 | Ga0070662_100222732 | |||
| 2429 | Ga0070662_101195085 | |||
| 2430 | Ga0070662_101293285 | |||
| 2431 | Ga0070681_10010877 | |||
| 2432 | Ga0070681_10108042 | |||
| 2433 | Ga0070681_10137321 | |||
| 2434 | Ga0070681_10196105 | |||
| 2435 | Ga0070681_10337063 | |||
| 2436 | Ga0070681_10553769 | |||
| 2437 | Ga0070681_11172480 | |||
| 2438 | Ga0070681_11596470 | |||
| 2439 | Ga0068867_100319689 | |||
| 2440 | Ga0068867_100732792 | |||
| 2441 | Ga0068867_101855960 | |||
| 2442 | Ga0070685_10035130 | |||
| 2443 | Ga0070706_100003283 | |||
| 2444 | Ga0070706_100057923 | |||
| 2445 | Ga0070706_100068689 | |||
| 2446 | Ga0070706_100122297 | |||
| 2447 | Ga0070706_100149776 | |||
| 2448 | Ga0070706_100176547 | |||
| 2449 | Ga0070706_100535921 | |||
| 2450 | Ga0070707_100000759 | |||
| 2451 | Ga0070707_100038811 | |||
| 2452 | Ga0070707_100365192 | |||
| 2453 | Ga0070707_100508407 | |||
| 2454 | Ga0070707_100591905 | |||
| 2455 | Ga0070698_100001019 | |||
| 2456 | Ga0070698_100002343 | |||
| 2457 | Ga0070698_100015778 | |||
| 2458 | Ga0070698_100061092 | |||
| 2459 | Ga0070698_100080895 | |||
| 2460 | Ga0070698_100120956 | |||
| 2461 | Ga0070698_100322503 | |||
| 2462 | Ga0070698_101133924 | |||
| 2463 | Ga0070699_100145669 | |||
| 2464 | Ga0070679_100010387 | |||
| 2465 | Ga0070679_100025712 | |||
| 2466 | Ga0070679_100106370 | |||
| 2467 | Ga0070679_100271602 | |||
| 2468 | Ga0070679_100298098 | |||
| 2469 | Ga0070679_100345874 | |||
| 2470 | Ga0070679_101406517 | |||
| 2471 | Ga0070684_100206692 | |||
| 2472 | Ga0070684_100212168 | |||
| 2473 | Ga0070684_100312069 | |||
| 2474 | Ga0070684_100443196 | |||
| 2475 | Ga0070684_100584887 | |||
| 2476 | Ga0070684_100729378 | |||
| 2477 | Ga0070684_100984099 | |||
| 2478 | Ga0070697_100004357 | |||
| 2479 | Ga0070697_100010938 | |||
| 2480 | Ga0070697_100190470 | |||
| 2481 | Ga0070697_100608698 | |||
| 2482 | Ga0070697_101160348 | |||
| 2483 | Ga0068853_100325991 | |||
| 2484 | Ga0068853_100600049 | |||
| 2485 | Ga0070672_100025168 | |||
| 2486 | Ga0070672_100264280 | |||
| 2487 | Ga0070672_100491634 | |||
| 2488 | Ga0070672_100668898 | |||
| 2489 | Ga0070686_100908941 | |||
| 2490 | Ga0070695_100050897 | |||
| 2491 | Ga0070695_100342472 | |||
| 2492 | Ga0070695_101709408 | |||
| 2493 | Ga0070696_100060268 | |||
| 2494 | Ga0070696_100177283 | |||
| 2495 | Ga0070696_101169569 | |||
| 2496 | Ga0070696_101407026 | |||
| 2497 | Ga0070696_101819046 | |||
| 2498 | Ga0070693_100005092 | |||
| 2499 | Ga0070693_100598680 | |||
| 2500 | Ga0070693_101049708 | |||
| 2501 | Ga0070665_100030159 | |||
| 2502 | Ga0070665_100260984 | |||
| 2503 | Ga0070665_100396212 | |||
| 2504 | Ga0070665_100447186 | |||
| 2505 | Ga0070704_100265991 | |||
| 2506 | Ga0070704_100874040 | |||
| 2507 | Ga0070704_101940956 | |||
| 2508 | Ga0068855_100121025 | |||
| 2509 | Ga0068855_100158059 | |||
| 2510 | Ga0068855_100678137 | |||
| 2511 | Ga0068855_100919154 | |||
| 2512 | Ga0068855_101817696 | |||
| 2513 | Ga0068855_102212485 | |||
| 2514 | Ga0070664_100074926 | |||
| 2515 | Ga0070664_101325913 | |||
| 2516 | Ga0070664_101414514 | |||
| 2517 | Ga0070664_101589521 | |||
| 2518 | Ga0068857_100272546 | |||
| 2519 | Ga0068857_100609823 | |||
| 2520 | Ga0068857_100728433 | |||
| 2521 | Ga0068857_101054175 | |||
| 2522 | Ga0068857_101174897 | |||
| 2523 | Ga0068857_101876973 | |||
| 2524 | Ga0068854_100056428 | |||
| 2525 | Ga0068854_100393090 | |||
| 2526 | Ga0068854_101826830 | |||
| 2527 | Ga0068856_100105265 | |||
| 2528 | Ga0068856_101059653 | |||
| 2529 | Ga0068856_101851418 | |||
| 2530 | Ga0070702_100068800 | |||
| 2531 | Ga0070702_100213681 | |||
| 2532 | Ga0068852_100000497 | |||
| 2533 | Ga0068852_100075312 | |||
| 2534 | Ga0068852_100096999 | |||
| 2535 | Ga0068852_100340080 | |||
| 2536 | Ga0068852_100602885 | |||
| 2537 | Ga0068852_102172148 | |||
| 2538 | Ga0068859_100246961 | |||
| 2539 | Ga0068859_100273218 | |||
| 2540 | Ga0068859_100889388 | |||
| 2541 | Ga0068859_101870180 | |||
| 2542 | Ga0068864_100003244 | |||
| 2543 | Ga0068864_100127348 | |||
| 2544 | Ga0068864_101623856 | |||
| 2545 | Ga0068864_101662577 | |||
| 2546 | Ga0068864_101764136 | |||
| 2547 | Ga0068866_10032583 | |||
| 2548 | Ga0068866_10386663 | |||
| 2549 | Ga0068861_100358099 | |||
| 2550 | Ga0068851_10081316 | |||
| 2551 | Ga0068851_10356563 | |||
| 2552 | Ga0068870_10021137 | |||
| 2553 | Ga0068870_10563046 | |||
| 2554 | Ga0068870_10732648 | |||
| 2555 | Ga0068870_10906967 | |||
| 2556 | Ga0068863_100003332 | |||
| 2557 | Ga0068863_100519231 | |||
| 2558 | Ga0068863_100565331 | |||
| 2559 | Ga0068863_100819907 | |||
| 2560 | Ga0068858_100214839 | |||
| 2561 | Ga0068858_100246158 | |||
| 2562 | Ga0068858_100398373 | |||
| 2563 | Ga0068858_100422857 | |||
| 2564 | Ga0068858_100748928 | |||
| 2565 | Ga0068860_100371807 | |||
| 2566 | Ga0068860_101451373 | |||
| 2567 | Ga0068860_102725001 | |||
| 2568 | Ga0068862_100020590 | |||
| 2569 | Ga0081455_10181061 | |||
| 2570 | Ga0081538_10035881 | |||
| 2571 | Ga0081540_1000193 | |||
| 2572 | Ga0081540_1000355 | |||
| 2573 | Ga0081540_1078394 | |||
| 2574 | Ga0081539_10389280 | |||
| 2575 | Ga0070717_10017503 | |||
| 2576 | Ga0070717_10107833 | |||
| 2577 | Ga0070717_10156341 | |||
| 2578 | Ga0070717_10303179 | |||
| 2579 | Ga0070717_10314830 | |||
| 2580 | Ga0070717_10403326 | |||
| 2581 | Ga0070717_10608322 | |||
| 2582 | Ga0070717_10761132 | |||
| 2583 | Ga0070717_10812605 | |||
| 2584 | Ga0070717_11141430 | |||
| 2585 | Ga0070717_11528065 | |||
| 2586 | Ga0070717_11741542 | |||
| 2587 | Ga0075363_100138181 | |||
| 2588 | Ga0075363_100647093 | |||
| 2589 | Ga0075432_10260394 | |||
| 2590 | Ga0070715_10018614 | |||
| 2591 | Ga0070715_10083546 | |||
| 2592 | Ga0070715_10131122 | |||
| 2593 | Ga0070716_100003676 | |||
| 2594 | Ga0070716_100013747 | |||
| 2595 | Ga0070716_100018980 | |||
| 2596 | Ga0070716_100149237 | |||
| 2597 | Ga0070716_100575500 | |||
| 2598 | Ga0070712_100001764 | |||
| 2599 | Ga0070712_100220805 | |||
| 2600 | Ga0070712_100330101 | |||
| 2601 | Ga0070712_100396209 | |||
| 2602 | Ga0070712_100808737 | |||
| 2603 | Ga0070712_101487354 | |||
| 2604 | Ga0070712_101693509 | |||
| 2605 | Ga0097621_100028657 | |||
| 2606 | Ga0097621_100138272 | |||
| 2607 | Ga0097621_100467346 | |||
| 2608 | Ga0068871_100116304 | |||
| 2609 | Ga0068871_100192461 | |||
| 2610 | Ga0068871_100934828 | |||
| 2611 | Ga0075428_100116954 | |||
| 2612 | Ga0075428_100248314 | |||
| 2613 | Ga0075428_100875814 | |||
| 2614 | Ga0075433_10004667 | |||
| 2615 | Ga0075433_10058534 | |||
| 2616 | Ga0075433_10212584 | |||
| 2617 | Ga0075433_10302864 | |||
| 2618 | Ga0075433_10487249 | |||
| 2619 | Ga0075434_100004126 | |||
| 2620 | Ga0075434_100121257 | |||
| 2621 | Ga0075434_100295990 | |||
| 2622 | Ga0075434_100381904 | |||
| 2623 | Ga0075434_100509932 | |||
| 2624 | Ga0075429_100032855 | |||
| 2625 | Ga0075429_100995142 | |||
| 2626 | Ga0068865_100197174 | |||
| 2627 | Ga0068865_100223398 | |||
| 2628 | Ga0068865_100226394 | |||
| 2629 | Ga0075436_100005351 | |||
| 2630 | Ga0075436_100130030 | |||
| 2631 | Ga0075436_100214031 | |||
| 2632 | Ga0075436_100370472 | |||
| 2633 | Ga0097620_100246968 | |||
| 2634 | Ga0097620_100273204 | |||
| 2635 | Ga0097620_100889376 | |||
| 2636 | Ga0097620_101869838 | |||
| 2637 | Ga0099826_10129515 | |||
| 2638 | Ga0075435_100008998 | |||
| 2639 | Ga0075435_100137120 | |||
| 2640 | Ga0075435_100184646 | |||
| 2641 | Ga0075435_100853002 | |||
| 2642 | Ga0075435_101056291 | |||
| 2643 | Ga0099794_10376727 | |||
| 2644 | Ga0099794_10501751 | |||
| 2645 | Ga0099795_10015129 | |||
| 2646 | Ga0099795_10346424 | |||
| 2647 | Ga0105251_10009748 | |||
| 2648 | Ga0105251_10038963 | |||
| 2649 | Ga0105244_10227262 | |||
| 2650 | Ga0105244_10254694 | |||
| 2651 | Ga0105244_10362605 | |||
| 2652 | Ga0105250_10114222 | |||
| 2653 | Ga0105250_10351630 | |||
| 2654 | Ga0105250_10417671 | |||
| 2655 | Ga0105240_10535477 | |||
| 2656 | Ga0105240_10639032 | |||
| 2657 | Ga0105240_10733600 | |||
| 2658 | Ga0105240_11127334 | |||
| 2659 | Ga0111539_10088965 | |||
| 2660 | Ga0111539_10189764 | |||
| 2661 | Ga0111539_13273931 | |||
| 2662 | Ga0105245_10001105 | |||
| 2663 | Ga0105245_10103611 | |||
| 2664 | Ga0105245_10251416 | |||
| 2665 | Ga0105245_10423434 | |||
| 2666 | Ga0105245_10443110 | |||
| 2667 | Ga0105245_10541536 | |||
| 2668 | Ga0105245_10784209 | |||
| 2669 | Ga0105245_11488914 | |||
| 2670 | Ga0105245_11818852 | |||
| 2671 | Ga0105245_12683201 | |||
| 2672 | Ga0105247_10000156 | |||
| 2673 | Ga0105247_10004622 | |||
| 2674 | Ga0105247_10212950 | |||
| 2675 | Ga0105247_10448552 | |||
| 2676 | Ga0105247_10674909 | |||
| 2677 | Ga0105247_10716612 | |||
| 2678 | Ga0114129_10003727 | |||
| 2679 | Ga0114129_10176253 | |||
| 2680 | Ga0114129_10672238 | |||
| 2681 | Ga0114129_10818495 | |||
| 2682 | Ga0114129_10905906 | |||
| 2683 | Ga0114129_11140280 | |||
| 2684 | Ga0114129_11520112 | |||
| 2685 | Ga0114129_13415871 | |||
| 2686 | Ga0105243_10011592 | |||
| 2687 | Ga0105243_10081732 | |||
| 2688 | Ga0105243_10132867 | |||
| 2689 | Ga0105243_10329695 | |||
| 2690 | Ga0105243_10641639 | |||
| 2691 | Ga0105243_11886270 | |||
| 2692 | Ga0105241_10131584 | |||
| 2693 | Ga0105241_10185322 | |||
| 2694 | Ga0105241_10687614 | |||
| 2695 | Ga0105241_10793881 | |||
| 2696 | Ga0105241_10989007 | |||
| 2697 | Ga0105242_10103963 | |||
| 2698 | Ga0105242_10222383 | |||
| 2699 | Ga0105242_10410322 | |||
| 2700 | Ga0105242_11683134 | |||
| 2701 | Ga0105242_12045705 | |||
| 2702 | Ga0105242_12307653 | |||
| 2703 | Ga0105248_10001256 | |||
| 2704 | Ga0105248_10039623 | |||
| 2705 | Ga0105248_10184254 | |||
| 2706 | Ga0105248_10288636 | |||
| 2707 | Ga0105248_11215465 | |||
| 2708 | Ga0105248_12343562 | |||
| 2709 | Ga0105237_10365688 | |||
| 2710 | Ga0105237_10426969 | |||
| 2711 | Ga0105237_10591198 | |||
| 2712 | Ga0105237_10797391 | |||
| 2713 | Ga0105237_11081608 | |||
| 2714 | Ga0105237_11224797 | |||
| 2715 | Ga0105237_11985958 | |||
| 2716 | Ga0105238_10044356 | |||
| 2717 | Ga0105238_10378578 | |||
| 2718 | Ga0105238_10997556 | |||
| 2719 | Ga0105238_11087337 | |||
| 2720 | Ga0105238_12227639 | |||
| 2721 | Ga0105238_12423355 | |||
| 2722 | Ga0105238_12909923 | |||
| 2723 | Ga0105249_10040745 | |||
| 2724 | Ga0105249_10329162 | |||
| 2725 | Ga0105249_10330115 | |||
| 2726 | Ga0105249_10453128 | |||
| 2727 | Ga0105249_11166391 | |||
| 2728 | Ga0105249_11469127 | |||
| 2729 | Ga0105249_11973888 | |||
| 2730 | Ga0105249_12291228 | |||
| 2731 | Ga0105249_12308920 | |||
| 2732 | Ga0105249_12353397 | |||
| 2733 | Ga0105249_12421697 | |||
| 2734 | Ga0105249_12560354 | |||
| 2735 | Ga0099796_10023887 | |||
| 2736 | Ga0099796_10275871 | |||
| 2737 | Ga0105239_10131095 | |||
| 2738 | Ga0105239_10244856 | |||
| 2739 | Ga0105239_10424269 | |||
| 2740 | Ga0105239_10738877 | |||
| 2741 | Ga0105239_10824069 | |||
| 2742 | Ga0105239_11055172 | |||
| 2743 | Ga0105239_11296739 | |||
| 2744 | Ga0105239_11681072 | |||
| 2745 | Ga0105239_11843541 | |||
| 2746 | Ga0105239_12626434 | |||
| 2747 | Ga0105246_10000677 | |||
| 2748 | Ga0105246_10043815 | |||
| 2749 | Ga0105246_10246314 | |||
| 2750 | Ga0105246_10264562 | |||
| 2751 | Ga0105246_10271422 | |||
| 2752 | Ga0105246_10685213 | |||
| 2753 | Ga0105246_10696760 | |||
| 2754 | Ga0105246_10865976 | |||
| 2755 | Ga0157340_1029428 | |||
| 2756 | Ga0157336_1017202 | |||
| 2757 | Ga0157346_1000486 | |||
| 2758 | Ga0157337_1006266 | |||
| 2759 | Ga0157325_1018162 | |||
| 2760 | Ga0157329_1021702 | |||
| 2761 | Ga0157335_1009023 | |||
| 2762 | Ga0157341_1041648 | |||
| 2763 | Ga0157319_1010846 | |||
| 2764 | Ga0157345_1002512 | |||
| 2765 | Ga0157314_1012932 | |||
| 2766 | Ga0157347_1005321 | |||
| 2767 | Ga0157313_1014030 | |||
| 2768 | Ga0157339_1010108 | |||
| 2769 | Ga0157342_1002674 | |||
| 2770 | Ga0157315_1007234 | |||
| 2771 | Ga0157327_1068898 | |||
| 2772 | Ga0157326_1029780 | |||
| 2773 | Ga0157326_1032110 | |||
| 2774 | Ga0157338_1005803 | |||
| 2775 | Ga0157373_10080116 | |||
| 2776 | Ga0157373_10094196 | |||
| 2777 | Ga0157373_10128644 | |||
| 2778 | Ga0157373_10481267 | |||
| 2779 | Ga0157373_10832202 | |||
| 2780 | Ga0157373_11468612 | |||
| 2781 | Ga0157371_10018435 | |||
| 2782 | Ga0157371_10042438 | |||
| 2783 | Ga0157371_10055988 | |||
| 2784 | Ga0157371_10165197 | |||
| 2785 | Ga0157371_11540194 | |||
| 2786 | Ga0157370_10045055 | |||
| 2787 | Ga0157370_10282438 | |||
| 2788 | Ga0157370_10389342 | |||
| 2789 | Ga0157370_10684486 | |||
| 2790 | Ga0157370_10927128 | |||
| 2791 | Ga0157370_11139673 | |||
| 2792 | Ga0157369_10001226 | |||
| 2793 | Ga0157369_10045005 | |||
| 2794 | Ga0157369_10174634 | |||
| 2795 | Ga0157369_10177656 | |||
| 2796 | Ga0157369_10226639 | |||
| 2797 | Ga0157369_10553907 | |||
| 2798 | Ga0157369_10615632 | |||
| 2799 | Ga0157369_10884227 | |||
| 2800 | Ga0157369_11113725 | |||
| 2801 | Ga0157369_11332328 | |||
| 2802 | Ga0157369_11579337 | |||
| 2803 | Ga0157374_10007839 | |||
| 2804 | Ga0157374_10551488 | |||
| 2805 | Ga0157374_10660329 | |||
| 2806 | Ga0157374_11068011 | |||
| 2807 | Ga0157374_11379621 | |||
| 2808 | Ga0157374_12592194 | |||
| 2809 | Ga0157374_12615690 | |||
| 2810 | Ga0157374_12967956 | |||
| 2811 | Ga0157378_10143210 | |||
| 2812 | Ga0157378_10188750 | |||
| 2813 | Ga0157378_10340383 | |||
| 2814 | Ga0157378_10874525 | |||
| 2815 | Ga0157378_10926671 | |||
| 2816 | Ga0157378_12965929 | |||
| 2817 | Ga0163162_10224162 | |||
| 2818 | Ga0163162_10544828 | |||
| 2819 | Ga0163162_10595887 | |||
| 2820 | Ga0163162_10666633 | |||
| 2821 | Ga0163162_11226593 | |||
| 2822 | Ga0163162_11237422 | |||
| 2823 | Ga0163162_11347230 | |||
| 2824 | Ga0163162_11666999 | |||
| 2825 | Ga0163162_12154867 | |||
| 2826 | Ga0163162_12432619 | |||
| 2827 | Ga0163162_13038927 | |||
| 2828 | Ga0157372_10023978 | |||
| 2829 | Ga0157372_10089347 | |||
| 2830 | Ga0157372_10340463 | |||
| 2831 | Ga0157372_10372037 | |||
| 2832 | Ga0157372_10472225 | |||
| 2833 | Ga0157372_10639515 | |||
| 2834 | Ga0157372_11103280 | |||
| 2835 | Ga0157372_11261359 | |||
| 2836 | Ga0157372_11286038 | |||
| 2837 | Ga0157372_11845359 | |||
| 2838 | Ga0157372_11846959 | |||
| 2839 | Ga0157372_11938749 | |||
| 2840 | Ga0157372_12355373 | |||
| 2841 | Ga0157372_13386755 | |||
| 2842 | Ga0157375_10298048 | |||
| 2843 | Ga0157375_10313841 | |||
| 2844 | Ga0157375_10445668 | |||
| 2845 | Ga0157375_10513284 | |||
| 2846 | Ga0157375_10691200 | |||
| 2847 | Ga0157375_11036968 | |||
| 2848 | Ga0157375_11240915 | |||
| 2849 | Ga0157375_11395859 | |||
| 2850 | Ga0157375_11580698 | |||
| 2851 | Ga0163163_10086319 | |||
| 2852 | Ga0163163_10134524 | |||
| 2853 | Ga0163163_10294750 | |||
| 2854 | Ga0163163_10513046 | |||
| 2855 | Ga0163163_11440644 | |||
| 2856 | Ga0157380_10419005 | |||
| 2857 | Ga0157380_10572085 | |||
| 2858 | Ga0157380_11041806 | |||
| 2859 | Ga0157380_11204456 | |||
| 2860 | Ga0182008_10001280 | |||
| 2861 | Ga0182008_10063733 | |||
| 2862 | Ga0182008_10154693 | |||
| 2863 | Ga0182008_10771580 | |||
| 2864 | Ga0157377_10099503 | |||
| 2865 | Ga0157377_10297683 | |||
| 2866 | Ga0157377_11014908 | |||
| 2867 | Ga0157377_11740804 | |||
| 2868 | Ga0157379_10017316 | |||
| 2869 | Ga0157379_10245301 | |||
| 2870 | Ga0157379_10580398 | |||
| 2871 | Ga0157379_11580780 | |||
| 2872 | Ga0157376_10149208 | |||
| 2873 | Ga0157376_10176007 | |||
| 2874 | Ga0157376_10289769 | |||
| 2875 | Ga0157376_10743029 | |||
| 2876 | Ga0157376_11141997 | |||
| 2877 | Ga0157376_11854885 | |||
| 2878 | Ga0182006_1239719 | |||
| 2879 | Ga0182007_10000582 | |||
| 2880 | Ga0182007_10271434 | |||
| 2881 | Ga0182005_1100806 | |||
| 2882 | Ga0183367_1005 | |||
| 2883 | Ga0163161_10159234 | |||
| 2884 | Ga0163161_10283976 | |||
| 2885 | Ga0163161_10463463 | |||
| 2886 | Ga0163161_11057483 | |||
| 2887 | Ga0163161_11283187 | |||
| 2888 | Ga0184601_106011 | |||
| 2889 | Ga0197907_10000430 | |||
| 2890 | Ga0197907_10288082 | |||
| 2891 | Ga0197907_10328527 | |||
| 2892 | Ga0197907_10376985 | |||
| 2893 | Ga0197907_11094604 | |||
| 2894 | Ga0197907_11205039 | |||
| 2895 | Ga0197907_11225079 | |||
| 2896 | Ga0206356_10944536 | |||
| 2897 | Ga0206356_11038323 | |||
| 2898 | Ga0206356_11717365 | |||
| 2899 | Ga0206349_1677274 | |||
| 2900 | Ga0206355_1500362 | |||
| 2901 | Ga0206355_1718134 | |||
| 2902 | Ga0206351_10722143 | |||
| 2903 | Ga0206351_10773125 | |||
| 2904 | Ga0206352_10254953 | |||
| 2905 | Ga0206352_10791224 | |||
| 2906 | Ga0206352_11198618 | |||
| 2907 | Ga0206352_11221252 | |||
| 2908 | Ga0206350_10374030 | |||
| 2909 | Ga0206350_11294616 | |||
| 2910 | Ga0206350_11421611 | |||
| 2911 | Ga0206354_10431806 | |||
| 2912 | Ga0206354_10445256 | |||
| 2913 | Ga0206354_10750047 | |||
| 2914 | Ga0206354_11141536 | |||
| 2915 | Ga0206354_11265793 | |||
| 2916 | Ga0206354_11381198 | |||
| 2917 | Ga0206354_11660386 | |||
| 2918 | Ga0206353_10158060 | |||
| 2919 | Ga0206353_10211368 | |||
| 2920 | Ga0206353_10224648 | |||
| 2921 | Ga0206353_11402443 | |||
| 2922 | Ga0206353_11571215 | |||
| 2923 | Ga0206353_11776395 | |||
| 2924 | Ga0154015_1173053 | |||
| 2925 | Ga0154015_1285698 | |||
| 2926 | Ga0213873_10048000 | |||
| 2927 | Ga0213872_10363985 | |||
| 2928 | Ga0213874_10109716 | |||
| 2929 | Ga0213875_10001074 | |||
| 2930 | Ga0213875_10134582 | |||
| 2931 | Ga0213875_10180928 | |||
| 2932 | Ga0224712_10018811 | |||
| 2933 | Ga0224712_10033439 | |||
| 2934 | Ga0224712_10038218 | |||
| 2935 | Ga0224712_10038848 | |||
| 2936 | Ga0224712_10154823 | |||
| 2937 | Ga0224712_10169541 | |||
| 2938 | Ga0224712_10539998 | |||
| 2939 | Ga0224712_10580348 | |||
| 2940 | Ga0247551_104776 | |||
| 2941 | Ga0247528_111965 | |||
| 2942 | Ga0224572_1016890 | |||
| 2943 | Ga0224572_1039710 | |||
| 2944 | Ga0228598_1006679 | |||
| 2945 | Ga0207425_1040092 | |||
| 2946 | Ga0209759_1041554 | |||
| 2947 | Ga0209129_1000109 | |||
| 2948 | Ga0209673_1075826 | |||
| 2949 | Ga0209025_1001288 | |||
| 2950 | Ga0209758_1004710 | |||
| 2951 | Ga0207426_1010098 | |||
| 2952 | Ga0207426_1021647 | |||
| 2953 | Ga0207426_1035840 | |||
| 2954 | Ga0209051_1022745 | |||
| 2955 | Ga0207656_10002744 | |||
| 2956 | Ga0207656_10317020 | |||
| 2957 | Ga0207696_1089907 | |||
| 2958 | Ga0207713_1015813 | |||
| 2959 | Ga0207713_1069261 | |||
| 2960 | Ga0207713_1187793 | |||
| 2961 | Ga0207713_1208068 | |||
| 2962 | Ga0207653_10010290 | |||
| 2963 | Ga0207682_10434243 | |||
| 2964 | Ga0207692_10003532 | |||
| 2965 | Ga0207692_10061982 | |||
| 2966 | Ga0207692_10283443 | |||
| 2967 | Ga0207692_10435207 | |||
| 2968 | Ga0207692_11113518 | |||
| 2969 | Ga0207710_10048418 | |||
| 2970 | Ga0207710_10148245 | |||
| 2971 | Ga0207710_10285787 | |||
| 2972 | Ga0207688_10005845 | |||
| 2973 | Ga0207688_10202007 | |||
| 2974 | Ga0207680_10092482 | |||
| 2975 | Ga0207680_10990028 | |||
| 2976 | Ga0207647_10129790 | |||
| 2977 | Ga0207647_10180858 | |||
| 2978 | Ga0207647_10337524 | |||
| 2979 | Ga0207685_10029674 | |||
| 2980 | Ga0207685_10106860 | |||
| 2981 | Ga0207685_10128805 | |||
| 2982 | Ga0207699_10005247 | |||
| 2983 | Ga0207699_10008388 | |||
| 2984 | Ga0207699_10019950 | |||
| 2985 | Ga0207699_10052519 | |||
| 2986 | Ga0207699_10057858 | |||
| 2987 | Ga0207699_10127567 | |||
| 2988 | Ga0207699_11421641 | |||
| 2989 | Ga0207645_10125468 | |||
| 2990 | Ga0207645_10140421 | |||
| 2991 | Ga0207643_10000785 | |||
| 2992 | Ga0207643_10097704 | |||
| 2993 | Ga0207705_10008895 | |||
| 2994 | Ga0207705_10330599 | |||
| 2995 | Ga0207705_10462458 | |||
| 2996 | Ga0207705_10665820 | |||
| 2997 | Ga0207684_10001971 | |||
| 2998 | Ga0207684_10033328 | |||
| 2999 | Ga0207684_10053609 | |||
| 3000 | Ga0207684_10152406 | |||
| 3001 | Ga0207684_10169825 | |||
| 3002 | Ga0207684_10190164 | |||
| 3003 | Ga0207684_10339361 | |||
| 3004 | Ga0207684_11239355 | |||
| 3005 | Ga0207684_11326226 | |||
| 3006 | Ga0207654_10011556 | |||
| 3007 | Ga0207654_11072503 | |||
| 3008 | Ga0207707_10000257 | |||
| 3009 | Ga0207707_10070531 | |||
| 3010 | Ga0207707_10083004 | |||
| 3011 | Ga0207707_10085902 | |||
| 3012 | Ga0207707_10239879 | |||
| 3013 | Ga0207707_10761002 | |||
| 3014 | Ga0207707_10961448 | |||
| 3015 | Ga0207707_11543701 | |||
| 3016 | Ga0207695_10204898 | |||
| 3017 | Ga0207695_10522574 | |||
| 3018 | Ga0207671_10032194 | |||
| 3019 | Ga0207671_10706685 | |||
| 3020 | Ga0207693_10049363 | |||
| 3021 | Ga0207693_10140509 | |||
| 3022 | Ga0207693_10245271 | |||
| 3023 | Ga0207693_10880097 | |||
| 3024 | Ga0207693_10967246 | |||
| 3025 | Ga0207663_10004352 | |||
| 3026 | Ga0207663_10065057 | |||
| 3027 | Ga0207663_10219811 | |||
| 3028 | Ga0207663_10321391 | |||
| 3029 | Ga0207663_10899073 | |||
| 3030 | Ga0207660_10000443 | |||
| 3031 | Ga0207660_10010834 | |||
| 3032 | Ga0207660_10032108 | |||
| 3033 | Ga0207660_10271016 | |||
| 3034 | Ga0207660_10294724 | |||
| 3035 | Ga0207660_10681717 | |||
| 3036 | Ga0207660_11615416 | |||
| 3037 | Ga0207662_10026955 | |||
| 3038 | Ga0207662_10088442 | |||
| 3039 | Ga0207657_10009895 | |||
| 3040 | Ga0207657_10029438 | |||
| 3041 | Ga0207657_10090094 | |||
| 3042 | Ga0207657_10104721 | |||
| 3043 | Ga0207657_10149661 | |||
| 3044 | Ga0207657_10641272 | |||
| 3045 | Ga0207649_10007710 | |||
| 3046 | Ga0207649_10280483 | |||
| 3047 | Ga0207652_10000070 | |||
| 3048 | Ga0207652_10006407 | |||
| 3049 | Ga0207652_10013800 | |||
| 3050 | Ga0207652_10039314 | |||
| 3051 | Ga0207652_10292989 | |||
| 3052 | Ga0207652_10411397 | |||
| 3053 | Ga0207652_10412404 | |||
| 3054 | Ga0207652_10670105 | |||
| 3055 | Ga0207652_11499633 | |||
| 3056 | Ga0207652_11760923 | |||
| 3057 | Ga0207646_10000180 | |||
| 3058 | Ga0207646_10003225 | |||
| 3059 | Ga0207646_10072175 | |||
| 3060 | Ga0207646_10170346 | |||
| 3061 | Ga0207646_10410649 | |||
| 3062 | Ga0207646_10639852 | |||
| 3063 | Ga0207646_11344708 | |||
| 3064 | Ga0207694_10263491 | |||
| 3065 | Ga0207694_10815868 | |||
| 3066 | Ga0207694_11368813 | |||
| 3067 | Ga0207650_10007339 | |||
| 3068 | Ga0207650_10301782 | |||
| 3069 | Ga0207650_10792471 | |||
| 3070 | Ga0207659_10076357 | |||
| 3071 | Ga0207659_10538630 | |||
| 3072 | Ga0207659_11045978 | |||
| 3073 | Ga0207687_10004699 | |||
| 3074 | Ga0207687_10085074 | |||
| 3075 | Ga0207687_10145689 | |||
| 3076 | Ga0207687_10253750 | |||
| 3077 | Ga0207687_10430985 | |||
| 3078 | Ga0207700_10002172 | |||
| 3079 | Ga0207700_10004822 | |||
| 3080 | Ga0207700_10053681 | |||
| 3081 | Ga0207700_10078649 | |||
| 3082 | Ga0207700_10110485 | |||
| 3083 | Ga0207700_10138114 | |||
| 3084 | Ga0207700_10218242 | |||
| 3085 | Ga0207700_10377698 | |||
| 3086 | Ga0207700_10447459 | |||
| 3087 | Ga0207700_10631391 | |||
| 3088 | Ga0207664_10000298 | |||
| 3089 | Ga0207664_10001524 | |||
| 3090 | Ga0207664_10001845 | |||
| 3091 | Ga0207664_10003186 | |||
| 3092 | Ga0207664_10009124 | |||
| 3093 | Ga0207664_10145876 | |||
| 3094 | Ga0207664_10178957 | |||
| 3095 | Ga0207664_10184829 | |||
| 3096 | Ga0207664_10185885 | |||
| 3097 | Ga0207664_10391912 | |||
| 3098 | Ga0207664_10432426 | |||
| 3099 | Ga0207664_10482268 | |||
| 3100 | Ga0207664_10555525 | |||
| 3101 | Ga0207664_10624254 | |||
| 3102 | Ga0207664_10709886 | |||
| 3103 | Ga0207664_10758987 | |||
| 3104 | Ga0207644_10330883 | |||
| 3105 | Ga0207644_10472008 | |||
| 3106 | Ga0207644_10670477 | |||
| 3107 | Ga0207644_11566601 | |||
| 3108 | Ga0207644_11571817 | |||
| 3109 | Ga0207690_10000219 | |||
| 3110 | Ga0207690_10016824 | |||
| 3111 | Ga0207690_10184443 | |||
| 3112 | Ga0207690_10916477 | |||
| 3113 | Ga0207706_10072026 | |||
| 3114 | Ga0207706_10103797 | |||
| 3115 | Ga0207686_10070926 | |||
| 3116 | Ga0207686_10085700 | |||
| 3117 | Ga0207686_10182120 | |||
| 3118 | Ga0207686_10396874 | |||
| 3119 | Ga0207686_11003919 | |||
| 3120 | Ga0207709_10051993 | |||
| 3121 | Ga0207709_10149879 | |||
| 3122 | Ga0207709_10260330 | |||
| 3123 | Ga0207709_10683302 | |||
| 3124 | Ga0207670_10280515 | |||
| 3125 | Ga0207670_10404127 | |||
| 3126 | Ga0207669_10138738 | |||
| 3127 | Ga0207669_11108928 | |||
| 3128 | Ga0207669_11368232 | |||
| 3129 | Ga0207704_10694076 | |||
| 3130 | Ga0207704_10800144 | |||
| 3131 | Ga0207704_11471486 | |||
| 3132 | Ga0207665_10000657 | |||
| 3133 | Ga0207665_10023462 | |||
| 3134 | Ga0207665_10064239 | |||
| 3135 | Ga0207665_10229302 | |||
| 3136 | Ga0207691_10006993 | |||
| 3137 | Ga0207691_10292907 | |||
| 3138 | Ga0207691_10978209 | |||
| 3139 | Ga0207711_10247142 | |||
| 3140 | Ga0207711_10355742 | |||
| 3141 | Ga0207711_11487377 | |||
| 3142 | Ga0207689_10006217 | |||
| 3143 | Ga0207689_10038661 | |||
| 3144 | Ga0207689_10796465 | |||
| 3145 | Ga0207661_10000336 | |||
| 3146 | Ga0207661_10182423 | |||
| 3147 | Ga0207661_10215294 | |||
| 3148 | Ga0207661_10669166 | |||
| 3149 | Ga0207661_11065429 | |||
| 3150 | Ga0207661_11118335 | |||
| 3151 | Ga0207679_10001066 | |||
| 3152 | Ga0207679_10322244 | |||
| 3153 | Ga0207679_10612563 | |||
| 3154 | Ga0207679_11558178 | |||
| 3155 | Ga0207667_10274291 | |||
| 3156 | Ga0207667_10426342 | |||
| 3157 | Ga0207667_10787716 | |||
| 3158 | Ga0207667_11077547 | |||
| 3159 | Ga0207667_11743916 | |||
| 3160 | Ga0207651_10091623 | |||
| 3161 | Ga0207651_10212793 | |||
| 3162 | Ga0207712_10486292 | |||
| 3163 | Ga0207712_10509532 | |||
| 3164 | Ga0207712_10919774 | |||
| 3165 | Ga0207668_11605737 | |||
| 3166 | Ga0207640_10031537 | |||
| 3167 | Ga0207640_11383406 | |||
| 3168 | Ga0207658_10012955 | |||
| 3169 | Ga0207658_10147132 | |||
| 3170 | Ga0207658_10928694 | |||
| 3171 | Ga0207658_11503540 | |||
| 3172 | Ga0207658_11610945 | |||
| 3173 | Ga0207677_10019593 | |||
| 3174 | Ga0207677_10251985 | |||
| 3175 | Ga0207677_10592148 | |||
| 3176 | Ga0207677_10721886 | |||
| 3177 | Ga0207677_11523031 | |||
| 3178 | Ga0207703_10234602 | |||
| 3179 | Ga0207703_10395638 | |||
| 3180 | Ga0207703_10852492 | |||
| 3181 | Ga0207703_10981002 | |||
| 3182 | Ga0207703_11790484 | |||
| 3183 | Ga0207639_10056849 | |||
| 3184 | Ga0207639_11183784 | |||
| 3185 | Ga0207678_10001106 | |||
| 3186 | Ga0207678_10070312 | |||
| 3187 | Ga0207678_10085601 | |||
| 3188 | Ga0207678_10880553 | |||
| 3189 | Ga0207678_11050358 | |||
| 3190 | Ga0207708_10009638 | |||
| 3191 | Ga0207708_10102554 | |||
| 3192 | Ga0207708_10516949 | |||
| 3193 | Ga0207708_12014051 | |||
| 3194 | Ga0207702_10041776 | |||
| 3195 | Ga0207702_10373661 | |||
| 3196 | Ga0207702_10569475 | |||
| 3197 | Ga0207702_10738716 | |||
| 3198 | Ga0207702_10940286 | |||
| 3199 | Ga0207702_11012825 | |||
| 3200 | Ga0207702_11229571 | |||
| 3201 | Ga0207641_10138939 | |||
| 3202 | Ga0207641_10464178 | |||
| 3203 | Ga0207641_10666830 | |||
| 3204 | Ga0207641_11228017 | |||
| 3205 | Ga0207641_12122744 | |||
| 3206 | Ga0207648_10100745 | |||
| 3207 | Ga0207648_10902268 | |||
| 3208 | Ga0207648_11117755 | |||
| 3209 | Ga0207648_11203373 | |||
| 3210 | Ga0207648_11784803 | |||
| 3211 | Ga0207676_10000648 | |||
| 3212 | Ga0207676_10998509 | |||
| 3213 | Ga0207676_11928961 | |||
| 3214 | Ga0207676_11935980 | |||
| 3215 | Ga0207674_10011766 | |||
| 3216 | Ga0207674_10132094 | |||
| 3217 | Ga0207674_10627488 | |||
| 3218 | Ga0207674_11452112 | |||
| 3219 | Ga0207675_100021849 | |||
| 3220 | Ga0207675_100359039 | |||
| 3221 | Ga0207675_100397646 | |||
| 3222 | Ga0207675_100700662 | |||
| 3223 | Ga0207675_101174281 | |||
| 3224 | Ga0207683_10001393 | |||
| 3225 | Ga0207683_10028516 | |||
| 3226 | Ga0207683_10608142 | |||
| 3227 | Ga0207683_11309190 | |||
| 3228 | Ga0207698_10607498 | |||
| 3229 | Ga0207698_10714364 | |||
| 3230 | Ga0209179_1125150 | |||
| 3231 | Ga0207428_10003435 | |||
| 3232 | Ga0207428_10264295 | |||
| 3233 | Ga0268266_10132557 | |||
| 3234 | Ga0268266_10244148 | |||
| 3235 | Ga0268266_11156271 | |||
| 3236 | Ga0268265_10109619 | |||
| 3237 | Ga0268265_10769483 | |||
| 3238 | Ga0268264_10346751 | |||
| 3239 | Ga0268264_12003302 | |||
| 3240 | Ga0265337_1000015 | |||
| 3241 | Ga0265326_10017844 | |||
| 3242 | Ga0265319_1001246 | |||
| 3243 | Ga0265334_10000373 | |||
| 3244 | Ga0265322_10012472 | |||
| 3245 | Ga0265336_10004317 | |||
| 3246 | Ga0307517_10008703 | |||
| 3247 | Ga0307517_10576044 | |||
| 3248 | Ga0265338_10003873 | |||
| 3249 | Ga0265338_10007479 | |||
| 3250 | Ga0265338_10014640 | |||
| 3251 | Ga0265338_11166024 | |||
| 3252 | Ga0311003_101840 | |||
| 3253 | Ga0265324_10002740 | |||
| 3254 | Ga0268256_1018028 | |||
| 3255 | Ga0307511_10136404 | |||
| 3256 | Ga0307511_10142565 | |||
| 3257 | Ga0307511_10276720 | |||
| 3258 | Ga0265762_1085621 | |||
| 3259 | Ga0265762_1087115 | |||
| 3260 | Ga0265766_1022293 | |||
| 3261 | Ga0265770_1039554 | |||
| 3262 | Ga0265764_111591 | |||
| 3263 | Ga0265761_110884 | |||
| 3264 | Ga0265768_109562 | |||
| 3265 | Ga0265771_1002017 | |||
| 3266 | Ga0265771_1013123 | |||
| 3267 | Ga0265774_103887 | |||
| 3268 | Ga0265760_10006434 | |||
| 3269 | Ga0265760_10069611 | |||
| 3270 | Ga0265760_10113006 | |||
| 3271 | Ga0265330_10212907 | |||
| 3272 | Ga0265332_10001675 | |||
| 3273 | Ga0265332_10058380 | |||
| 3274 | Ga0265332_10474348 | |||
| 3275 | Ga0265320_10001898 | |||
| 3276 | Ga0265320_10041316 | |||
| 3277 | Ga0265325_10015321 | |||
| 3278 | Ga0265325_10060617 | |||
| 3279 | Ga0265340_10003540 | |||
| 3280 | Ga0265340_10004519 | |||
| 3281 | Ga0265340_10082220 | |||
| 3282 | Ga0265339_10000762 | |||
| 3283 | Ga0265339_10014234 | |||
| 3284 | Ga0265331_10028427 | |||
| 3285 | Ga0265331_10246008 | |||
| 3286 | Ga0265316_10006862 | |||
| 3287 | Ga0265316_10154230 | |||
| 3288 | Ga0307509_10009190 | |||
| 3289 | Ga0307408_100053565 | |||
| 3290 | Ga0307408_100437564 | |||
| 3291 | Ga0307408_101472446 | |||
| 3292 | Ga0310117_121880 | |||
| 3293 | Ga0265313_10090959 | |||
| 3294 | Ga0310107_133548 | |||
| 3295 | Ga0307508_10042905 | |||
| 3296 | Ga0307508_10049088 | |||
| 3297 | Ga0307508_10436673 | |||
| 3298 | Ga0307514_10175696 | |||
| 3299 | Ga0310111_125385 | |||
| 3300 | Ga0310111_140077 | |||
| 3301 | Ga0265314_10005562 | |||
| 3302 | Ga0265314_10016664 | |||
| 3303 | Ga0265314_10048633 | |||
| 3304 | Ga0265342_10006989 | |||
| 3305 | Ga0265342_10033693 | |||
| 3306 | Ga0265342_10036408 | |||
| 3307 | Ga0307516_10056359 | |||
| 3308 | Ga0307516_10068332 | |||
| 3309 | Ga0307405_10583633 | |||
| 3310 | Ga0316044_123521 | |||
| 3311 | Ga0307413_10154461 | |||
| 3312 | Ga0307413_10239047 | |||
| 3313 | Ga0307413_10428832 | |||
| 3314 | Ga0307413_10783646 | |||
| 3315 | Ga0307410_10018684 | |||
| 3316 | Ga0307410_10041314 | |||
| 3317 | Ga0307410_10461216 | |||
| 3318 | Ga0307410_10517336 | |||
| 3319 | Ga0307410_10585933 | |||
| 3320 | Ga0307406_10061971 | |||
| 3321 | Ga0307406_10091864 | |||
| 3322 | Ga0307406_10326390 | |||
| 3323 | Ga0307407_10270552 | |||
| 3324 | Ga0307407_10272626 | |||
| 3325 | Ga0307412_11657115 | |||
| 3326 | Ga0307409_100251429 | |||
| 3327 | Ga0307409_100316575 | |||
| 3328 | Ga0307409_100568728 | |||
| 3329 | Ga0307409_100586607 | |||
| 3330 | Ga0307409_100767361 | |||
| 3331 | Ga0307409_100778866 | |||
| 3332 | Ga0307409_100997431 | |||
| 3333 | Ga0307409_102105659 | |||
| 3334 | Ga0307416_100035506 | |||
| 3335 | Ga0307416_100229736 | |||
| 3336 | Ga0307416_100482859 | |||
| 3337 | Ga0307416_101073035 | |||
| 3338 | Ga0307416_101966629 | |||
| 3339 | Ga0307416_103054440 | |||
| 3340 | Ga0307414_10157413 | |||
| 3341 | Ga0307411_10046422 | |||
| 3342 | Ga0307411_11889445 | |||
| 3343 | Ga0307411_12002959 | |||
| 3344 | Ga0307507_10000013 | |||
| 3345 | Ga0307507_10331584 | |||
| 3346 | Ga0307507_10620089 | |||
| 3347 | Ga0307510_10144369 | |||
| 3348 | Ga0316214_1000482 | |||
| 3349 | Ga0316214_1003948 | |||
| 3350 | Ga0316212_1003331 | |||
| 3351 | Ga0373930_0109559 | |||
| 3352 | Ga0373948_0041310 | |||
| 3353 | Ga0373950_0090347 | |||
| 3354 | Ga0373958_0006992 | |||
| 3355 | Ga0373959_0005926 | |||
| 3356 | Ga0373926_0024276 | |||
| 3357 | Ga0373926_0038845 | |||
| 3358 | Ga0373929_0074912 | |||
| 3359 | Ga0373934_0006708 | |||
| 3360 | Ga0373934_0016099 | |||
| 3361 | Ga0373934_0020722 | |||
| 3362 | Ga0373934_0065600 | |||
| 3363 | Ga0373934_0077028 | |||
| 3364 | Ga0373934_0326016 | |||
| 3365 | Ga0373940_0162500 | |||
| 3366 | Ga0373944_0054981 | |||
| 3367 | Ga0373944_0266351 | |||
| 3368 | Ga0373951_0015579 | |||
| 3369 | Ga0373951_0162768 | |||
| 3370 | Ga0373952_0255440 | |||
| 3371 | Ga0373923_0014721 | |||
| 3372 | Ga0373923_0188582 | |||
| 3373 | Ga0373923_0222494 | |||
| 3374 | Ga0373923_0423120 | |||
| 3375 | Ga0373932_0349125 | |||
| 3376 | Ga0373936_0001178 | |||
| 3377 | Ga0373936_0063067 | |||
| 3378 | Ga0373936_0199673 | |||
| 3379 | Ga0373936_0311106 | |||
| 3380 | Ga0373941_0100267 | |||
| 3381 | Ga0373941_0324149 | |||
| 3382 | Ga0373945_0157682 | |||
| 3383 | Ga0373945_0167148 | |||
| 3384 | Ga0373945_0296159 | |||
| 3385 | Ga0373945_0423426 | |||
| 3386 | Ga0373945_0465205 | |||
| 3387 | Ga0373953_0001772 | |||
| 3388 | Ga0373953_0043953 | |||
| 3389 | Ga0373953_0079348 | |||
| 3390 | Ga0373953_0421401 | |||
| 3391 | Ga0373954_0027830 | |||
| 3392 | Ga0373954_0048362 | |||
| 3393 | Ga0373954_0097558 | |||
| 3394 | Ga0373954_0194369 | |||
| 3395 | Ga0373956_0000844 | |||
| 3396 | Ga0373956_0031323 | |||
| 3397 | Ga0373956_0034924 | |||
| 3398 | Ga0373956_0050919 | |||
| 3399 | Ga0373957_0000011 | |||
| 3400 | Ga0373957_0037568 | |||
| 3401 | Ga0373957_0101528 | |||
| 3402 | Ga0373957_0171550 | |||
| 3403 | Ga0373957_0200007 | |||
| 3404 | Ga0373960_0091762 | |||
| 3405 | Ga0373960_0137114 | |||
| 3406 | Ga0373943_0081332 | |||
| 3407 | Ga0373943_0151010 | |||
| 3408 | Ga0373943_0221704 | |||
| 3409 | Ga0373943_0535043 | |||
| 3410 | Ga0373946_0066712 | |||
| 3411 | Ga0373946_0071884 | |||
| 3412 | Ga0373946_0289756 | |||
| 3413 | Ga0373946_0410365 | |||
| 3414 | Ga0373955_0000060 | |||
| 3415 | Ga0373955_0014764 | |||
| 3416 | Ga0373955_0140143 | |||
| 3417 | Ga0373955_0325507 | |||
| 3418 | Ga0373955_0486184 | |||
| 3419 | Ga0373942_0047227 | |||
| 3420 | Ga0373942_0272647 | |||
| 3421 | Ga0373924_0000672 | |||
| 3422 | Ga0373924_0019378 | |||
| 3423 | Ga0373924_0021188 | |||
| 3424 | Ga0373924_0066473 | |||
| 3425 | Ga0373924_0585618 | |||
| 3426 | Ga0373931_0091826 | |||
| 3427 | Ga0373931_0098523 | |||
| 3428 | Ga0373931_0142313 | |||
| 3429 | Ga0373931_0836462 | |||
| 3430 | Ga0373935_0004616 | |||
| 3431 | Ga0373935_0016967 | |||
| 3432 | Ga0373935_0305980 | |||
| 3433 | Ga0373935_0338594 | |||
| 3434 | Ga0373927_0024730 | |||
| 3435 | Ga0373927_0108817 | |||
| 3436 | Ga0373927_0157259 | |||
| 3437 | Ga0373927_0579698 | |||
| 3438 | Ga0373933_0014325 | |||
| 3439 | Ga0373933_0016385 | |||
| 3440 | Ga0373933_0133630 | |||
| 3441 | Ga0373933_0248337 | |||
| 3442 | Ga0373933_0463129 | |||
| 3443 | Ga0373947_0061727 | |||
| 3444 | Ga0373947_0093287 | |||
| 3445 | Ga0373947_0336826 | |||
| 3446 | Ga0373947_0528508 | |||
| 3447 | Ga0310104_20196 | |||
| 3448 | Ga0373937_0000110 | |||
| 3449 | Ga0373937_0030844 | |||
| 3450 | Ga0373937_0037069 | |||
| 3451 | Ga0373937_0269908 | |||
| 3452 | Ga0373937_0271984 | |||
| 3453 | Ga0373937_0366169 | |||
| 3454 | Ga0373937_0808561 | |||
| 3455 | Ga0265778_024529 | |||
| 3456 | Ga0373925_0000540 | |||
| 3457 | Ga0373925_0005130 | |||
| 3458 | Ga0373925_0019497 | |||
| 3459 | Ga0373925_0108373 | |||
| 3460 | Ga0373925_0188311 | |||
| 3461 | Ga0373925_0357750 | |||
| 3462 | Ga0373925_0466959 | |||
| 3463 | Ga0373925_1196327 | |||
| 3464 | Ga0395900_0186888 | |||
| 3465 | Ga0395898_0408457 | |||
| 3466 | Ga0395898_0550320 | |||
| 3467 | Ga0395898_0955662 | |||
| 3468 | Ga0395905_0441340 | |||
| 3469 | Ga0436364_0081229 | |||
| 3470 | Ga0436364_0098049 | |||
| 3471 | Ga0436364_0243023 | |||
| 3472 | Ga0436364_0479741 | |||
| 3473 | Ga0436364_0718628 | |||
| 3474 | Ga0436364_1098280 | |||
| 3475 | Ga0436364_1174043 | |||
| 3476 | Ga0436364_1263484 | |||
| 3477 | Ga0436364_1272150 | |||
| 3478 | Ga0436364_1381350 | |||
| 3479 | Ga0436364_1527719 | |||
| 3480 | Ga0395901_0368107 | |||
| 3481 | Ga0395901_1522668 | |||
| 3482 | Ga0436365_0207903 | |||
| 3483 | Ga0436365_0456440 | |||
| 3484 | Ga0436360_0519033 | |||
| 3485 | Ga0436360_0800473 | |||
| 3486 | Ga0436361_0083233 | |||
| 3487 | Ga0436361_0085148 | |||
| 3488 | Ga0436361_0592735 | |||
| 3489 | Ga0436361_0739507 | |||
| 3490 | Ga0436361_1089145 | |||
| 3491 | Ga0436363_0129145 | |||
| 3492 | Ga0436363_0216045 | |||
| 3493 | Ga0436363_0287803 | |||
| 3494 | Ga0436363_1231403 | |||
| 3495 | Ga0436363_1481670 | |||
| 3496 | Ga0436363_1578490 | |||
| 3497 | Ga0436363_1583483 | |||
| 3498 | Ga0436362_0324614 | |||
| 3499 | Ga0436362_0452318 | |||
| 3500 | Ga0436362_1221077 | |||
| 3501 | Ga0436362_1298483 | |||
| 3502 | Ga0436362_1301744 | |||
| 3503 | Ga0439436_0000524 | |||
| 3504 | Ga0439436_0006412 | |||
| 3505 | Ga0439436_0017389 | |||
| 3506 | Ga0439436_0080170 | |||
| 3507 | Ga0439436_0194399 | |||
| 3508 | Ga0439438_041185 | |||
| 3509 | Ga0439439_0010113 | |||
| 3510 | Ga0439439_0068353 | |||
| 3511 | Ga0439439_0082194 | |||
| 3512 | Ga0439461_0001303 | |||
| 3513 | Ga0439466_0006342 | |||
| 3514 | Ga0439466_0166992 | |||
| 3515 | Ga0451789_0026674 | |||
| 3516 | Ga0451793_1135109 | |||
| 3517 | Ga0451797_1112463 | |||
| 3518 | Ga0451805_068977 | |||
| 3519 | Ga0451804_0477614 | |||
| 3520 | Ga0451839_0225412 | |||
| 3521 | Ga0451839_0572827 | |||
| 3522 | Ga0451841_0311264 | |||
| 3523 | Ga0451845_0003149 | |||
| 3524 | Ga0451843_1278596 | |||
| 3525 | Ga0451853_3555550 | |||
| 3526 | Ga0451853_3556725 | |||
| 3527 | Ga0439431_0021633 | |||
| 3528 | Ga0439433_0001892 | |||
| 3529 | Ga0439442_016934 | |||
| 3530 | Ga0439442_071616 | |||
| 3531 | Ga0439448_0001950 | |||
| 3532 | Ga0439448_0076419 | |||
| 3533 | Ga0439448_0319083 | |||
| 3534 | Ga0439432_091108 | |||
| 3535 | Ga0439449_0011654 | |||
| 3536 | Ga0439449_0019562 | |||
| 3537 | Ga0439449_0032403 | |||
| 3538 | Ga0439449_0055906 | |||
| 3539 | Ga0439449_0298946 | |||
| 3540 | Ga0439452_002242 | |||
| 3541 | Ga0439455_0009521 | |||
| 3542 | Ga0439455_0076718 | |||
| 3543 | Ga0439456_043895 | |||
| 3544 | Ga0439457_001024 | |||
| 3545 | Ga0439457_001614 | |||
| 3546 | Ga0439457_004463 | |||
| 3547 | Ga0439462_0004876 | |||
| 3548 | Ga0439462_0051833 | |||
| 3549 | Ga0439462_0111836 | |||
| 3550 | Ga0439462_0113673 | |||
| 3551 | Ga0439463_179444 | |||
| 3552 | Ga0450911_011083 | |||
| 3553 | Ga0450914_065157 | |||
| 3554 | Ga0450919_000085 | |||
| 3555 | Ga0450920_039778 | |||
| 3556 | Ga0450890_071893 | |||
| 3557 | Ga0450894_000035 | |||
| 3558 | Ga0450896_002593 | |||
| 3559 | Ga0450898_078105 | |||
| 3560 | Ga0450899_000138 | |||
| 3561 | Ga0450902_032410 | |||
| 3562 | Ga0450903_000067 | |||
| 3563 | Ga0450906_002005 | |||
| 3564 | Ga0450907_018490 | |||
| 3565 | Ga0450907_064767 | |||
| 3566 | Ga0439446_0020862 | |||
| 3567 | Ga0439458_0005318 | |||
| 3568 | Ga0439458_0050659 | |||
| 3569 | Ga0450908_008452 | |||
| 3570 | Ga0450909_002630 | |||
| 3571 | Ga0439434_0065435 | |||
| 3572 | Ga0439459_0004735 | |||
| 3573 | Ga0439459_0042938 | |||
| 3574 | Ga0439459_0176540 | |||
| 3575 | Ga0439464_0169427 | |||
| 3576 | Ga0450918_016419 | |||
| 3577 | Ga0450901_006724 | |||
| 3578 | Ga0466969_0001305 | |||
| 3579 | Ga0466969_0006155 | |||
| 3580 | Ga0466972_0031457 | |||
| 3581 | Ga0466972_0252403 | |||
| 3582 | Ga0466966_0001016 | |||
| 3583 | Ga0466966_0002663 | |||
| 3584 | Ga0466966_0009462 | |||
| 3585 | Ga0466966_0012013 | |||
| 3586 | Ga0466966_0019210 | |||
| 3587 | Ga0466966_0213373 | |||
| 3588 | Ga0466966_0255491 | |||
| 3589 | Ga0466966_0271706 | |||
| 3590 | Ga0466961_0003691 | |||
| 3591 | Ga0466961_0006277 | |||
| 3592 | Ga0466961_0007449 | |||
| 3593 | Ga0466961_0018930 | |||
| 3594 | Ga0466961_0023269 | |||
| 3595 | Ga0466961_0032959 | |||
| 3596 | Ga0466961_0094041 | |||
| 3597 | Ga0466961_0160266 | |||
| 3598 | Ga0466961_0806876 | |||
| 3599 | Ga0466963_0028158 | |||
| 3600 | Ga0466963_0035906 | |||
| 3601 | Ga0466963_0060997 | |||
| 3602 | Ga0466963_0069338 | |||
| 3603 | Ga0466963_0406126 | |||
| 3604 | Ga0466963_0553184 | |||
| 3605 | Ga0466963_0890380 | |||
| 3606 | Ga0466963_0942863 | |||
| 3607 | Ga0466963_1101807 | |||
| 3608 | Ga0466964_0112830 | |||
| 3609 | Ga0466964_0562917 | |||
| 3610 | Ga0466964_0668844 | |||
| 3611 | Ga0466971_0000730 | |||
| 3612 | Ga0466971_0005155 | |||
| 3613 | Ga0466971_0005390 | |||
| 3614 | Ga0466971_0011377 | |||
| 3615 | Ga0466971_0031674 | |||
| 3616 | Ga0466968_0315931 | |||
| 3617 | Ga0466968_0375624 | |||
| 3618 | Ga0466968_0496860 | |||
| 3619 | Ga0466970_0002624 | |||
| 3620 | Ga0466970_0062185 | |||
| 3621 | Ga0466970_0310853 | |||
| 3622 | Ga0466970_0354333 | |||
| 3623 | Ga0466970_0410163 | |||
| 3624 | Ga0466970_0611728 | |||
| 3625 | Ga0466970_0720331 | |||
| 3626 | Ga0466957_0008107 | |||
| 3627 | Ga0466957_0228107 | |||
| 3628 | Ga0466957_0629040 | |||
| 3629 | Ga0466957_0664502 | |||
| 3630 | Ga0466957_0737721 | |||
| 3631 | Ga0466960_0028068 | |||
| 3632 | Ga0466959_0000507 | |||
| 3633 | Ga0466959_0007332 | |||
| 3634 | Ga0466959_0011863 | |||
| 3635 | Ga0466959_0036329 | |||
| 3636 | Ga0466959_0048336 | |||
| 3637 | Ga0466959_0060117 | |||
| 3638 | Ga0466959_0141200 | |||
| 3639 | Ga0466959_0355270 | |||
| 3640 | Ga0466959_0524937 | |||
| 3641 | Ga0451576_0227272 | |||
| 3642 | Ga0466958_0004494 | |||
| 3643 | Ga0466958_0010466 | |||
| 3644 | Ga0466958_0028068 | |||
| 3645 | Ga0466958_0034351 | |||
| 3646 | Ga0466958_0192525 | |||
| 3647 | Ga0466967_0007787 | |||
| 3648 | Ga0466967_0101495 | |||
| 3649 | Ga0466967_0525765 | |||
| 3650 | Ga0466967_0628538 | |||
| 3651 | Ga0466967_0665844 | |||
| 3652 | Ga0466967_0725842 | |||
| 3653 | Ga0466967_1271460 | |||
| 3654 | Ga0466967_1419345 | |||
| 3655 | Ga0466967_1642962 | |||
| 3656 | Ga0466967_1916326 | |||
| 3657 | Ga0466967_2527919 | |||
| 3658 | Ga0495627_107445 | |||
| 3659 | Ga0495592_0000049 | |||
| 3660 | Ga0495592_0011895 | |||
| 3661 | Ga0495592_0041774 | |||
| 3662 | Ga0495592_0127909 | |||
| 3663 | Ga0495592_0149061 | |||
| 3664 | Ga0495592_0183636 | |||
| 3665 | Ga0495592_0485817 | |||
| 3666 | Ga0495603_0010028 | |||
| 3667 | Ga0495603_0024116 | |||
| 3668 | Ga0495603_0026170 | |||
| 3669 | Ga0495603_0047280 | |||
| 3670 | Ga0495603_0049435 | |||
| 3671 | Ga0495603_0072963 | |||
| 3672 | Ga0495629_0009686 | |||
| 3673 | Ga0495629_0010230 | |||
| 3674 | Ga0495629_0102424 | |||
| 3675 | Ga0495629_0102605 | |||
| 3676 | Ga0495629_0105404 | |||
| 3677 | Ga0495629_0261125 | |||
| 3678 | Ga0495629_0695599 | |||
| 3679 | Ga0495638_0049888 | |||
| 3680 | Ga0495638_0118662 | |||
| 3681 | Ga0495638_0251119 | |||
| 3682 | Ga0495641_0008332 | |||
| 3683 | Ga0495641_0013098 | |||
| 3684 | Ga0495641_0027940 | |||
| 3685 | Ga0495651_0000007 | |||
| 3686 | Ga0495651_0000079 | |||
| 3687 | Ga0495651_0034997 | |||
| 3688 | Ga0495651_0044140 | |||
| 3689 | Ga0495651_0047991 | |||
| 3690 | Ga0495651_0105233 | |||
| 3691 | Ga0495651_0235360 | |||
| 3692 | Ga0495651_0408707 | |||
| 3693 | Ga0495651_0446451 | |||
| 3694 | Ga0495651_0452362 | |||
| 3695 | Ga0495651_0552354 | |||
| 3696 | Ga0495653_0046082 | |||
| 3697 | Ga0495653_0046578 | |||
| 3698 | Ga0495653_0066610 | |||
| 3699 | Ga0495653_0090526 | |||
| 3700 | Ga0495653_0239989 | |||
| 3701 | Ga0495653_0247654 | |||
| 3702 | Ga0495653_0352192 | |||
| 3703 | Ga0495653_0769772 | |||
| 3704 | Ga0495580_0015098 | |||
| 3705 | Ga0495580_0154805 | |||
| 3706 | Ga0495580_0169758 | |||
| 3707 | Ga0495580_0303167 | |||
| 3708 | Ga0495582_0002158 | |||
| 3709 | Ga0495582_0005432 | |||
| 3710 | Ga0495582_0085008 | |||
| 3711 | Ga0495582_0319741 | |||
| 3712 | Ga0495639_0010968 | |||
| 3713 | Ga0495639_0081464 | |||
| 3714 | Ga0495639_0143354 | |||
| 3715 | Ga0495662_0002989 | |||
| 3716 | Ga0495662_0008805 | |||
| 3717 | Ga0495662_0020179 | |||
| 3718 | Ga0495662_0020438 | |||
| 3719 | Ga0495662_0035526 | |||
| 3720 | Ga0495662_0179222 | |||
| 3721 | Ga0495664_0003530 | |||
| 3722 | Ga0495664_0020885 | |||
| 3723 | Ga0495664_0091512 | |||
| 3724 | Ga0495664_0117975 | |||
| 3725 | Ga0495664_0134953 | |||
| 3726 | Ga0495664_0194739 | |||
| 3727 | Ga0495664_0422355 | |||
| 3728 | Ga0495585_0013695 | |||
| 3729 | Ga0495585_0042588 | |||
| 3730 | Ga0495585_0059459 | |||
| 3731 | Ga0495585_0202801 | |||
| 3732 | Ga0495594_0012305 | |||
| 3733 | Ga0495594_0013501 | |||
| 3734 | Ga0495594_0019227 | |||
| 3735 | Ga0495594_0055542 | |||
| 3736 | Ga0495594_0140826 | |||
| 3737 | Ga0495594_0471433 | |||
| 3738 | Ga0495594_0783896 | |||
| 3739 | Ga0495607_0042933 | |||
| 3740 | Ga0495608_0000076 | |||
| 3741 | Ga0495608_0009966 | |||
| 3742 | Ga0495608_0040008 | |||
| 3743 | Ga0495608_0067448 | |||
| 3744 | Ga0495608_0157894 | |||
| 3745 | Ga0495608_0208708 | |||
| 3746 | Ga0495608_0447957 | |||
| 3747 | Ga0495608_0627494 | |||
| 3748 | Ga0495618_0007856 | |||
| 3749 | Ga0495618_0022729 | |||
| 3750 | Ga0495618_0106122 | |||
| 3751 | Ga0495618_0255728 | |||
| 3752 | Ga0495618_0387054 | |||
| 3753 | Ga0495618_0569619 | |||
| 3754 | Ga0495620_0110578 | |||
| 3755 | Ga0495628_0001215 | |||
| 3756 | Ga0495628_0005605 | |||
| 3757 | Ga0495628_0010042 | |||
| 3758 | Ga0495628_0021216 | |||
| 3759 | Ga0495628_0103086 | |||
| 3760 | Ga0495628_0137701 | |||
| 3761 | Ga0495628_0156972 | |||
| 3762 | Ga0495628_0584191 | |||
| 3763 | Ga0495630_0008315 | |||
| 3764 | Ga0495630_0025191 | |||
| 3765 | Ga0495630_0032183 | |||
| 3766 | Ga0495630_0217395 | |||
| 3767 | Ga0495630_0307930 | |||
| 3768 | Ga0495630_0844286 | |||
| 3769 | Ga0495630_1402619 | |||
| 3770 | Ga0495631_0139636 | |||
| 3771 | Ga0495631_0219806 | |||
| 3772 | Ga0495631_0260618 | |||
| 3773 | Ga0495637_0105712 | |||
| 3774 | Ga0495643_0211792 | |||
| 3775 | Ga0495666_0003384 | |||
| 3776 | Ga0495666_0058823 | |||
| 3777 | Ga0495666_0129992 | |||
| 3778 | Ga0495666_0149655 | |||
| 3779 | Ga0495666_0313549 | |||
| 3780 | Ga0495666_0374085 | |||
| 3781 | Ga0495652_0000168 | |||
| 3782 | Ga0495652_0003588 | |||
| 3783 | Ga0495652_0040527 | |||
| 3784 | Ga0495652_0059422 | |||
| 3785 | Ga0495652_0083184 | |||
| 3786 | Ga0495652_0146356 | |||
| 3787 | Ga0495652_0273460 | |||
| 3788 | Ga0495652_0352690 | |||
| 3789 | Ga0495652_0399634 | |||
| 3790 | Ga0495652_0559306 | |||
| 3791 | Ga0495652_0597782 | |||
| 3792 | Ga0495665_0002190 | |||
| 3793 | Ga0495665_0004007 | |||
| 3794 | Ga0495665_0055065 | |||
| 3795 | Ga0495665_0173646 | |||
| 3796 | Ga0495665_0634612 | |||
| 3797 | Ga0495640_0017135 | |||
| 3798 | Ga0495640_0029098 | |||
| 3799 | Ga0495640_0054496 | |||
| 3800 | Ga0495640_0054695 | |||
| 3801 | Ga0495640_0206494 | |||
| 3802 | Ga0495586_0005311 | |||
| 3803 | Ga0495586_0008958 | |||
| 3804 | Ga0495586_0030648 | |||
| 3805 | Ga0495586_0053081 | |||
| 3806 | Ga0495586_0082387 | |||
| 3807 | Ga0495586_0257410 | |||
| 3808 | Ga0495586_0355569 | |||
| 3809 | Ga0495586_0472462 | |||
| 3810 | Ga0495586_0881121 | |||
| 3811 | Ga0495587_0006741 | |||
| 3812 | Ga0495587_0025931 | |||
| 3813 | Ga0495587_0077239 | |||
| 3814 | Ga0495587_0109041 | |||
| 3815 | Ga0495587_0210367 | |||
| 3816 | Ga0495587_0742135 | |||
| 3817 | Ga0495645_0013097 | |||
| 3818 | Ga0495645_0022878 | |||
| 3819 | Ga0495645_0059107 | |||
| 3820 | Ga0495645_0368563 | |||
| 3821 | Ga0495645_0384113 | |||
| 3822 | Ga0495645_0395575 | |||
| 3823 | Ga0495622_0022827 | |||
| 3824 | Ga0495622_0170550 | |||
| 3825 | Ga0495622_0443017 | |||
| 3826 | Ga0495667_0000072 | |||
| 3827 | Ga0495667_0015012 | |||
| 3828 | Ga0495667_0018766 | |||
| 3829 | Ga0495667_0029452 | |||
| 3830 | Ga0495667_0041818 | |||
| 3831 | Ga0495667_0068317 | |||
| 3832 | Ga0495667_0121316 | |||
| 3833 | Ga0495656_0193205 | |||
| 3834 | Ga0495656_0509219 | |||
| 3835 | Ga0495634_0020030 | |||
| 3836 | Ga0495634_0026954 | |||
| 3837 | Ga0495634_0027278 | |||
| 3838 | Ga0495634_0033758 | |||
| 3839 | Ga0495634_0179627 | |||
| 3840 | Ga0495634_0189762 | |||
| 3841 | Ga0495611_0033087 | |||
| 3842 | Ga0495625_0222544 | |||
| 3843 | Ga0495635_0002665 | |||
| 3844 | Ga0495635_0020890 | |||
| 3845 | Ga0495635_0112703 | |||
| 3846 | Ga0495635_0124402 | |||
| 3847 | Ga0495635_0180933 | |||
| 3848 | Ga0495635_0204784 | |||
| 3849 | Ga0495635_0962288 | |||
| 3850 | Ga0495661_0170131 | |||
| 3851 | Ga0495588_0067287 | |||
| 3852 | Ga0495588_0078571 | |||
| 3853 | Ga0495588_0451689 | |||
| 3854 | Ga0495588_0645247 | |||
| 3855 | Ga0495588_0684305 | |||
| 3856 | Ga0495657_0000424 | |||
| 3857 | Ga0495657_0002584 | |||
| 3858 | Ga0495657_0020458 | |||
| 3859 | Ga0495657_0028016 | |||
| 3860 | Ga0495657_0042001 | |||
| 3861 | Ga0495657_0046215 | |||
| 3862 | Ga0495657_0115442 | |||
| 3863 | Ga0495657_0314532 | |||
| 3864 | Ga0495657_0320965 | |||
| 3865 | Ga0495599_0000062 | |||
| 3866 | Ga0495599_0021197 | |||
| 3867 | Ga0495599_0022810 | |||
| 3868 | Ga0495599_0026841 | |||
| 3869 | Ga0495599_0035257 | |||
| 3870 | Ga0495599_0074779 | |||
| 3871 | Ga0495599_0276693 | |||
| 3872 | Ga0495599_0869618 | |||
| 3873 | Ga0495623_0000777 | |||
| 3874 | Ga0495623_0003796 | |||
| 3875 | Ga0495623_0048459 | |||
| 3876 | Ga0495623_0059079 | |||
| 3877 | Ga0495623_0061932 | |||
| 3878 | Ga0495623_0083855 | |||
| 3879 | Ga0495623_0104972 | |||
| 3880 | Ga0495623_0290995 | |||
| 3881 | Ga0495623_0379528 | |||
| 3882 | Ga0495623_0435910 | |||
| 3883 | Ga0495646_0007097 | |||
| 3884 | Ga0495646_0059352 | |||
| 3885 | Ga0495646_0078693 | |||
| 3886 | Ga0495646_0158769 | |||
| 3887 | Ga0495646_0188431 | |||
| 3888 | Ga0495646_0193027 | |||
| 3889 | Ga0495646_0196394 | |||
| 3890 | Ga0495646_0357357 | |||
| 3891 | Ga0495647_0356750 | |||
| 3892 | Ga0495647_0569406 | |||
| 3893 | Ga0495658_0069348 | |||
| 3894 | Ga0495658_0157765 | |||
| 3895 | Ga0495658_0415133 | |||
| 3896 | Ga0495613_0009407 | |||
| 3897 | Ga0495613_0011441 | |||
| 3898 | Ga0495613_0034690 | |||
| 3899 | Ga0495613_0084477 | |||
| 3900 | Ga0495613_0129270 | |||
| 3901 | Ga0495613_0138981 | |||
| 3902 | Ga0495613_0237480 | |||
| 3903 | Ga0495613_0645089 | |||
| 3904 | Ga0495624_0006967 | |||
| 3905 | Ga0495624_0006974 | |||
| 3906 | Ga0495624_0017325 | |||
| 3907 | Ga0495624_0027762 | |||
| 3908 | Ga0495624_0146888 | |||
| 3909 | Ga0495624_0563981 | |||
| 3910 | Ga0495670_0013056 | |||
| 3911 | Ga0495670_0020026 | |||
| 3912 | Ga0495671_0161446 | |||
| 3913 | Ga0495649_0402218 | |||
| 3914 | Ga0495589_0221108 | |||
| 3915 | Ga0495589_0335128 | |||
| 3916 | Ga0495589_0521254 | |||
| 3917 | Ga0495600_0008443 | |||
| 3918 | Ga0495600_0010085 | |||
| 3919 | Ga0495600_0024163 | |||
| 3920 | Ga0495600_0043077 | |||
| 3921 | Ga0495600_0045437 | |||
| 3922 | Ga0495600_0236626 | |||
| 3923 | Ga0495600_0244884 | |||
| 3924 | Ga0495600_0280645 | |||
| 3925 | Ga0495660_0322596 | |||
| 3926 | Ga0495581_0010953 | |||
| 3927 | Ga0495581_0027064 | |||
| 3928 | Ga0495581_0121582 | |||
| 3929 | Ga0495581_0428420 | |||
| 3930 | Ga0495604_0000062 | |||
| 3931 | Ga0495604_0011814 | |||
| 3932 | Ga0495604_0022655 | |||
| 3933 | Ga0495604_0062529 | |||
| 3934 | Ga0495604_0175014 | |||
| 3935 | Ga0495604_0216151 | |||
| 3936 | Ga0495604_0242504 | |||
| 3937 | Ga0495604_0544271 | |||
| 3938 | Ga0495636_0085601 | |||
| 3939 | Ga0495636_0256394 | |||
| 3940 | Ga0495674_0007071 | |||
| 3941 | Ga0495674_0028482 | |||
| 3942 | Ga0495674_0113536 | |||
| 3943 | Ga0495674_0134153 | |||
| 3944 | Ga0495674_0174539 | |||
| 3945 | Ga0495674_0302329 | |||
| 3946 | Ga0495674_0379116 | |||
| 3947 | Ga0495676_0029254 | |||
| 3948 | Ga0495676_0038718 | |||
| 3949 | Ga0495676_0090636 | |||
| 3950 | Ga0495676_0509018 | |||
| 3951 | Ga0495676_0811775 | |||
| 3952 | Ga0495676_0838847 | |||
| 3953 | Ga0495676_0959964 | |||
| 3954 | Ga0495680_0000101 | |||
| 3955 | Ga0495680_0012972 | |||
| 3956 | Ga0495680_0030458 | |||
| 3957 | Ga0495680_0066746 | |||
| 3958 | Ga0495680_0158901 | |||
| 3959 | Ga0495680_0357554 | |||
| 3960 | Ga0495680_0453200 | |||
| 3961 | Ga0495683_0127665 | |||
| 3962 | Ga0495683_0226451 | |||
| 3963 | Ga0495687_014847 | |||
| 3964 | Ga0495687_044422 | |||
| 3965 | Ga0495675_0001304 | |||
| 3966 | Ga0495675_0009960 | |||
| 3967 | Ga0495675_0021462 | |||
| 3968 | Ga0495675_0022793 | |||
| 3969 | Ga0495675_0028408 | |||
| 3970 | Ga0495675_0033104 | |||
| 3971 | Ga0495675_0064305 | |||
| 3972 | Ga0495675_0423473 | |||
| 3973 | Ga0495685_005390 | |||
| 3974 | Ga0495685_022256 | |||
| 3975 | Ga0495685_138526 | |||
| 3976 | Ga0495685_211284 | |||
| 3977 | Ga0495681_0211603 | |||
| 3978 | Ga0495684_0010492 | |||
| 3979 | Ga0495684_0022686 | |||
| 3980 | Ga0495684_0100367 | |||
| 3981 | Ga0495684_0168641 | |||
| 3982 | Ga0495684_0391701 | |||
| 3983 | Ga0495684_0412100 | |||
| 3984 | Ga0495686_0024806 | |||
| 3985 | Ga0495593_0005748 | |||
| 3986 | Ga0495593_0008680 | |||
| 3987 | Ga0495593_0019207 | |||
| 3988 | Ga0495593_0112896 | |||
| 3989 | Ga0495602_0000115 | |||
| 3990 | Ga0495602_0013494 | |||
| 3991 | Ga0495602_0078195 | |||
| 3992 | Ga0495602_0085778 | |||
| 3993 | Ga0495602_0169551 | |||
| 3994 | Ga0495602_0636795 | |||
| 3995 | Ga0495602_0648191 | |||
| 3996 | Ga0495602_0779261 | |||
| 3997 | Ga0495614_0016031 | |||
| 3998 | Ga0495614_0075784 | |||
| 3999 | Ga0495614_0106237 | |||
| 4000 | Ga0495614_0165911 | |||
| 4001 | Ga0495614_0395590 | |||
| 4002 | Ga0495626_0395030 | |||
| 4003 | Ga0496100_0225359 | |||
| 4004 | Ga0496100_0267539 | |||
| 4005 | Ga0496100_0418829 | |||
| 4006 | Ga0496100_0498592 | |||
| 4007 | Ga0496101_0133559 | |||
| 4008 | Ga0496101_0253562 | |||
| 4009 | Ga0496101_0552835 | |||
| 4010 | Ga0496101_0977712 | |||
| 4011 | Ga0496102_0008136 | |||
| 4012 | Ga0496102_0144707 | |||
| 4013 | Ga0496102_0190191 | |||
| 4014 | Ga0496102_0666327 | |||
| 4015 | Ga0496102_0755743 | |||
| 4016 | Ga0496102_0947438 | |||
| 4017 | Ga0496102_1210177 | |||
| 4018 | Ga0496103_0058025 | |||
| 4019 | Ga0496103_0171518 | |||
| 4020 | Ga0496103_0545441 | |||
| 4021 | Ga0496103_0954846 | |||
| 4022 | Ga0496104_0193546 | |||
| 4023 | Ga0496104_0256480 | |||
| 4024 | Ga0496104_0268139 | |||
| 4025 | Ga0496104_0307286 | |||
| 4026 | Ga0496104_1876195 | |||
| 4027 | Ga0496105_0001951 | |||
| 4028 | Ga0496105_0067234 | |||
| 4029 | Ga0496105_0685997 | |||
| 4030 | Ga0496105_1059263 | |||
| 4031 | Ga0496106_0044619 | |||
| 4032 | Ga0496106_0058655 | |||
| 4033 | Ga0496106_0059467 | |||
| 4034 | Ga0496106_0131596 | |||
| 4035 | Ga0496106_0718939 | |||
| 4036 | Ga0496106_0842165 | |||
| 4037 | Ga0496107_0153111 | |||
| 4038 | Ga0496107_0176672 | |||
| 4039 | Ga0496107_0294675 | |||
| 4040 | Ga0496108_0016852 | |||
| 4041 | Ga0496108_0046337 | |||
| 4042 | Ga0496108_0071716 | |||
| 4043 | Ga0496108_1121815 | |||
| 4044 | Ga0496108_1381098 | |||
| 4045 | Ga0496109_0014763 | |||
| 4046 | Ga0496109_0078823 | |||
| 4047 | Ga0496109_0106641 | |||
| 4048 | Ga0496109_0418089 | |||
| 4049 | Ga0496109_0923171 | |||
| 4050 | Ga0496109_1261090 | |||
| 4051 | Ga0496109_1489189 | |||
| 4052 | Ga0496110_0130544 | |||
| 4053 | Ga0496110_0256284 | |||
| 4054 | Ga0496110_0452662 | |||
| 4055 | Ga0496110_0915618 | |||
| 4056 | Ga0496111_0000966 | |||
| 4057 | Ga0496111_0047485 | |||
| 4058 | Ga0496111_0638406 | |||
| 4059 | Ga0496111_1110594 | |||
| 4060 | Ga0496112_0029297 | |||
| 4061 | Ga0496112_0201674 | |||
| 4062 | Ga0496112_0668870 | |||
| 4063 | Ga0496112_1346837 | |||
| 4064 | Ga0496112_1394456 | |||
| 4065 | Ga0496112_1901542 | |||
| 4066 | Ga0496113_0103401 | |||
| 4067 | Ga0496113_0246203 | |||
| 4068 | Ga0496113_0412533 | |||
| 4069 | Ga0496113_0470773 | |||
| 4070 | Ga0496113_1002278 | |||
| 4071 | Ga0496114_0237928 | |||
| 4072 | Ga0496114_0337413 | |||
| 4073 | Ga0496114_0685415 | |||
| 4074 | Ga0496114_0866278 | |||
| 4075 | Ga0496114_1531513 | |||
| 4076 | Ga0496115_0030212 | |||
| 4077 | Ga0496115_0143568 | |||
| 4078 | Ga0496115_0441847 | |||
| 4079 | Ga0496115_0589125 | |||
| 4080 | Ga0496126_0021509 | |||
| 4081 | Ga0496126_0044968 | |||
| 4082 | Ga0496126_0810372 | |||
| 4083 | Ga0496126_0976717 | |||
| 4084 | Ga0501306_082899 | |||
| 4085 | Ga0501291_064155 | |||
| 4086 | Ga0501311_084530 | |||
| 4087 | Ga0501312_040992 | |||
| 4088 | Ga0501315_082529 | |||
| 4089 | Ga0501317_035088 | |||
| 4090 | Ga0501318_044439 | |||
| 4091 | Ga0501031_0002572 | |||
| 4092 | Ga0501031_0085553 | |||
| 4093 | Ga0501031_0196816 | |||
| 4094 | Ga0501031_0342624 | |||
| 4095 | Ga0501031_0721815 | |||
| 4096 | Ga0501032_0001212 | |||
| 4097 | Ga0501032_0004014 | |||
| 4098 | Ga0501032_0061569 | |||
| 4099 | Ga0501032_0083428 | |||
| 4100 | Ga0501032_0216319 | |||
| 4101 | Ga0501032_0292527 | |||
| 4102 | Ga0501032_0731608 | |||
| 4103 | Ga0501033_0008061 | |||
| 4104 | Ga0501033_0038694 | |||
| 4105 | Ga0501033_0043629 | |||
| 4106 | Ga0501033_0102595 | |||
| 4107 | Ga0501033_0121268 | |||
| 4108 | Ga0501033_0487639 | |||
| 4109 | Ga0501033_0608994 | |||
| 4110 | Ga0501033_1028924 | |||
| 4111 | Ga0501034_0006278 | |||
| 4112 | Ga0501034_0035629 | |||
| 4113 | Ga0501034_0092435 | |||
| 4114 | Ga0501034_0135532 | |||
| 4115 | Ga0501034_0204269 | |||
| 4116 | Ga0501034_0770472 | |||
| 4117 | Ga0501036_0008586 | |||
| 4118 | Ga0501036_0026259 | |||
| 4119 | Ga0501036_0070822 | |||
| 4120 | Ga0501036_0136997 | |||
| 4121 | Ga0501036_0287623 | |||
| 4122 | Ga0501036_0404226 | |||
| 4123 | Ga0501036_0636340 | |||
| 4124 | Ga0501036_0771568 | |||
| 4125 | Ga0501036_1290684 | |||
| 4126 | Ga0501037_0000836 | |||
| 4127 | Ga0501037_0028438 | |||
| 4128 | Ga0501037_0038085 | |||
| 4129 | Ga0501037_0047762 | |||
| 4130 | Ga0501038_0012780 | |||
| 4131 | Ga0501038_0038303 | |||
| 4132 | Ga0501038_0098123 | |||
| 4133 | Ga0501038_0202701 | |||
| 4134 | Ga0501038_0381674 | |||
| 4135 | Ga0501038_0432279 | |||
| 4136 | Ga0501039_0007687 | |||
| 4137 | Ga0501039_0186535 | |||
| 4138 | Ga0501039_0356373 | |||
| 4139 | Ga0501039_0373550 | |||
| 4140 | Ga0501039_0409181 | |||
| 4141 | Ga0501039_0720933 | |||
| 4142 | Ga0501039_0774360 | |||
| 4143 | Ga0501040_0007931 | |||
| 4144 | Ga0501040_0029885 | |||
| 4145 | Ga0501040_0057922 | |||
| 4146 | Ga0501041_0001518 | |||
| 4147 | Ga0501041_0254296 | |||
| 4148 | Ga0501042_0015097 | |||
| 4149 | Ga0501042_0121418 | |||
| 4150 | Ga0501042_0140483 | |||
| 4151 | Ga0501042_0312857 | |||
| 4152 | Ga0501043_0005580 | |||
| 4153 | Ga0501043_0032328 | |||
| 4154 | Ga0501043_0062990 | |||
| 4155 | Ga0501043_0176885 | |||
| 4156 | Ga0501043_0252718 | |||
| 4157 | Ga0501043_0314179 | |||
| 4158 | Ga0501043_0412595 | |||
| 4159 | Ga0501046_0037516 | |||
| 4160 | Ga0501046_0119453 | |||
| 4161 | Ga0501046_0143575 | |||
| 4162 | Ga0501046_0494625 | |||
| 4163 | Ga0501047_0000072 | |||
| 4164 | Ga0501047_0001607 | |||
| 4165 | Ga0501047_0070941 | |||
| 4166 | Ga0501047_0152655 | |||
| 4167 | Ga0501047_0169702 | |||
| 4168 | Ga0501047_0384844 | |||
| 4169 | Ga0501048_0011519 | |||
| 4170 | Ga0501048_0015295 | |||
| 4171 | Ga0501048_0037211 | |||
| 4172 | Ga0501048_0704370 | |||
| 4173 | Ga0501067_0013763 | |||
| 4174 | Ga0501068_0003236 | |||
| 4175 | Ga0501068_0333682 | |||
| 4176 | Ga0501068_0493369 | |||
| 4177 | Ga0501069_0017860 | |||
| 4178 | Ga0501069_0031481 | |||
| 4179 | Ga0501069_0305289 | |||
| 4180 | Ga0501070_0005040 | |||
| 4181 | Ga0501070_0008482 | |||
| 4182 | Ga0501070_0009153 | |||
| 4183 | Ga0501070_0012340 | |||
| 4184 | Ga0501070_0012975 | |||
| 4185 | Ga0501070_0031412 | |||
| 4186 | Ga0501070_0845307 | |||
| 4187 | Ga0501070_1474102 | |||
| 4188 | Ga0501071_0006687 | |||
| 4189 | Ga0501071_0205182 | |||
| 4190 | Ga0501071_0244047 | |||
| 4191 | Ga0501071_0689739 | |||
| 4192 | Ga0501072_0001898 | |||
| 4193 | Ga0501072_0267605 | |||
| 4194 | Ga0501072_0333566 | |||
| 4195 | Ga0501073_0009415 | |||
| 4196 | Ga0501073_0015567 | |||
| 4197 | Ga0501073_0771727 | |||
| 4198 | Ga0501074_0000607 | |||
| 4199 | Ga0501074_0006705 | |||
| 4200 | Ga0501074_0016000 | |||
| 4201 | Ga0501074_0076631 | |||
| 4202 | Ga0501074_0080253 | |||
| 4203 | Ga0501075_0011003 | |||
| 4204 | Ga0501075_0020072 | |||
| 4205 | Ga0501076_0003333 | |||
| 4206 | Ga0501076_0035235 | |||
| 4207 | Ga0501076_0424529 | |||
| 4208 | Ga0501076_0549399 | |||
| 4209 | Ga0501076_0644736 | |||
| 4210 | Ga0501077_0019671 | |||
| 4211 | Ga0501077_0023052 | |||
| 4212 | Ga0501235_008627 | |||
| 4213 | Ga0501251_022715 | |||
| 4214 | Ga0501261_034512 | |||
| 4215 | Ga0501079_0000029 | |||
| 4216 | Ga0501079_0007167 | |||
| 4217 | Ga0501079_0328774 | |||
| 4218 | Ga0501080_0006601 | |||
| 4219 | Ga0501080_0013816 | |||
| 4220 | Ga0501080_0121371 | |||
| 4221 | Ga0501080_0193663 | |||
| 4222 | Ga0501080_0639037 | |||
| 4223 | Ga0501080_1383399 | |||
| 4224 | Ga0501080_1407600 | |||
| 4225 | Ga0501081_0076315 | |||
| 4226 | Ga0501083_0383782 | |||
| 4227 | Ga0501282_001694 | |||
| 4228 | Ga0501035_0005086 | |||
| 4229 | Ga0501035_0012487 | |||
| 4230 | Ga0501035_0024124 | |||
| 4231 | Ga0501035_0111057 | |||
| 4232 | Ga0501035_0132132 | |||
| 4233 | Ga0501035_0298983 | |||
| 4234 | Ga0501035_0479587 | |||
| 4235 | Ga0501044_0005927 | |||
| 4236 | Ga0501044_0007860 | |||
| 4237 | Ga0501044_0050036 | |||
| 4238 | Ga0501044_0059401 | |||
| 4239 | Ga0501044_0065905 | |||
| 4240 | Ga0501044_0091036 | |||
| 4241 | Ga0501044_0092812 | |||
| 4242 | Ga0501044_0203538 | |||
| 4243 | Ga0501044_0210357 | |||
| 4244 | Ga0501044_0237979 | |||
| 4245 | Ga0501044_0777924 | |||
| 4246 | Ga0501045_0014996 | |||
| 4247 | Ga0501045_0037572 | |||
| 4248 | Ga0501045_0348642 | |||
| 4249 | Ga0501045_0553357 | |||
| 4250 | Ga0501045_0801738 | |||
| 4251 | nmdc:mga03683_331178_c1 | |||
| 4252 | nmdc:mga03n38_71279_c1 | |||
| 4253 | nmdc:mga0yw44_371395_c1 | |||
| 4254 | nmdc:mga05p37_1302285_c1 | |||
| 4255 | nmdc:mga05p37_1677414_c1 | |||
| 4256 | nmdc:mga05p37_2012723_c1 | |||
| 4257 | nmdc:mga05p37_425422_c1 | |||
| 4258 | nmdc:mga05p37_4279_c1 | |||
| 4259 | nmdc:mga05p37_728152_c1 | |||
| 4260 | nmdc:mga09592_21197_c1 | |||
| 4261 | nmdc:mga09592_326452_c1 | |||
| 4262 | nmdc:mga08y16_142507_c1 | |||
| 4263 | nmdc:mga08y16_52073_c1 | |||
| 4264 | nmdc:mga08y16_735505_c1 | |||
| 4265 | nmdc:mga0n895_1080559_c1 | |||
| 4266 | nmdc:mga0n895_1231098_c1 | |||
| 4267 | nmdc:mga0n895_149115_c1 | |||
| 4268 | nmdc:mga0n895_347695_c1 | |||
| 4269 | nmdc:mga0n895_63544_c1 | |||
| 4270 | nmdc:mga0n895_7764_c1 | |||
| 4271 | nmdc:mga0rr50_103846_c1 | |||
| 4272 | nmdc:mga0rr50_1174000_c1 | |||
| 4273 | nmdc:mga0rr50_1483984_c1 | |||
| 4274 | nmdc:mga0rr50_1831282_c1 | |||
| 4275 | nmdc:mga0rr50_4305_c1 | |||
| 4276 | nmdc:mga0rr50_9965_c1 | |||
| 4277 | nmdc:mga08x19_107348_c1 | |||
| 4278 | nmdc:mga08x19_15062_c1 | |||
| 4279 | nmdc:mga08x19_16720_c1 | |||
| 4280 | nmdc:mga08x19_308513_c1 | |||
| 4281 | nmdc:mga08x19_382382_c1 | |||
| 4282 | nmdc:mga0a205_306282_c1 | |||
| 4283 | nmdc:mga0a205_312603_c1 | |||
| 4284 | nmdc:mga0a205_362154_c1 | |||
| 4285 | nmdc:mga0a205_618_c1 | |||
| 4286 | nmdc:mga0a205_81627_c1 | |||
| 4287 | Ga0495601_0039256 | |||
| 4288 | Ga0495601_0053846 | |||
| 4289 | Ga0495601_0151747 | |||
| 4290 | Ga0495601_0264047 | |||
| 4291 | Ga0495601_0734996 | |||
| 4292 | Ga0495601_0802431 | |||
| 4293 | Ga0495612_0001654 | |||
| 4294 | Ga0495612_0003302 | |||
| 4295 | Ga0495612_0028326 | |||
| 4296 | Ga0495612_0095192 | |||
| 4297 | Ga0495612_0228164 | |||
| 4298 | Ga0495655_0020718 | |||
| 4299 | Ga0495655_0176416 | |||
| 4300 | Ga0495595_0003935 | |||
| 4301 | Ga0495595_0087318 | |||
| 4302 | Ga0495619_0007135 | |||
| 4303 | Ga0495619_0014045 | |||
| 4304 | Ga0495619_0067820 | |||
| 4305 | Ga0495619_0092261 | |||
| 4306 | Ga0495619_0245604 | |||
| 4307 | Ga0495619_0699125 | |||
| 4308 | Ga0500583_0271553 | |||
| 4309 | Ga0500651_0403077 | |||
| 4310 | Ga0500566_0137313 | |||
| 4311 | Ga0500641_0084013 | |||
| 4312 | Ga0500641_0381705 | |||
| 4313 | Ga0500654_064920 | |||
| 4314 | Ga0500553_118913 | |||
| 4315 | Ga0500556_0401583 | |||
| 4316 | Ga0500558_067368 | |||
| 4317 | Ga0500560_127497 | |||
| 4318 | Ga0500569_004143 | |||
| 4319 | Ga0500594_0022448 | |||
| 4320 | Ga0500614_017862 | |||
| 4321 | Ga0500628_012677 | |||
| 4322 | Ga0500652_008937 | |||
| 4323 | Ga0500655_147778 | |||
| 4324 | Ga0500658_0003343 | |||
| 4325 | Ga0500573_0065287 | |||
| 4326 | Ga0500573_0137513 | |||
| 4327 | Ga0500573_0320426 | |||
| 4328 | Ga0500579_018317 | |||
| 4329 | Ga0500589_207773 | |||
| 4330 | Ga0500600_0032935 | |||
| 4331 | Ga0500600_0295193 | |||
| 4332 | Ga0500603_105497 | |||
| 4333 | Ga0500616_0256946 | |||
| 4334 | Ga0500633_0000825 | |||
| 4335 | Ga0500634_0050937 | |||
| 4336 | Ga0500656_001561 | |||
| 4337 | Ga0500587_002484 | |||
| 4338 | Ga0501084_0004130 | |||
| 4339 | Ga0501084_0048010 | |||
| 4340 | Ga0501084_0110758 | |||
| 4341 | Ga0501084_0284950 | |||
| 4342 | Ga0501084_0891695 | |||
| 4343 | Ga0590075_003626 | |||
| 4344 | Ga0587066_125493 | |||
| 4345 | Ga0587072_046729 | |||
| 4346 | Ga0587078_075059 | |||
| 4347 | Ga0587114_108277 | |||
| 4348 | Ga0587071_085205 | |||
| 4349 | Ga0587111_0019558 | |||
| 4350 | Ga0501082_0008254 | |||
| 4351 | Ga0501082_0188578 | |||
| 4352 | Ga0501082_0689082 | |||
| 4353 | Ga0466962_0001597 | |||
| 4354 | Ga0466962_0003215 | |||
| 4355 | Ga0466962_0019804 | |||
| 4356 | Ga0466962_0024928 | |||
| 4357 | Ga0466962_0035029 | |||
| 4358 | Ga0466962_0209981 | |||
| 4359 | Ga0466962_0567793 | |||
| 4360 | Ga0530510_0056005 | |||
| 4361 | Ga0530510_0241313 | |||
| 4362 | Ga0530510_1109580 | |||
| 4363 | Ga0530510_1135254 | |||
| 4364 | 2528202875 | |||
| 4365 | 2528213253 | |||
| 4366 | 2537898779 | |||
| 4367 | 2546947610 | |||
| 4368 | 2547408185 | |||
| 4369 | 2554257760 | |||
| 4370 | 2579748402 | |||
| 4371 | 2579857875 | |||
| 4372 | 2585299224 | |||
| 4373 | 2585308877 | |||
| 4374 | 2600198837 | |||
| 4375 | 2616904550 | |||
| 4376 | 2619858529 | |||
| 4377 | 2620353764 | |||
| 4378 | 2626634477 | |||
| 4379 | 2643765030 | |||
| 4380 | 2643900764 | |||
| 4381 | 2643942346 | |||
| 4382 | 2644017133 | |||
| 4383 | 2644173906 | |||
| 4384 | 2644262368 | |||
| 4385 | 2644389982 | |||
| 4386 | 2644405015 | |||
| 4387 | 2644429426 | |||
| 4388 | 2644461131 | |||
| 4389 | 2676497096 | |||
| 4390 | 2686534371 | |||
| 4391 | 2686543749 | |||
| 4392 | 2710604303 | |||
| 4393 | 2768643512 | |||
| 4394 | 2774864285 | |||
| 4395 | 2784588645 | |||
| 4396 | 2785343206 | |||
| 4397 | 2785369589 | |||
| 4398 | 2786670679 | |||
| 4399 | 2791213414 | |||
| 4400 | 2793984432 | |||
| 4401 | 2804846910 | |||
| 4402 | 2809232255 | |||
| 4403 | 2811849127 | |||
| 4404 | 2812358008 | |||
| 4405 | 2812480452 | |||
| 4406 | 2819627478 | |||
| 4407 | 2819695484 | |||
| 4408 | 2819741196 | |||
| 4409 | 2844851709 | |||
| 4410 | 2847088829 | |||
| 4411 | 2852636577 | |||
| 4412 | 2856744598 | |||
| 4413 | 2862179398 | |||
| 4414 | 2862285734 | |||
| 4415 | 2862294834 | |||
| 4416 | 2862391572 | |||
| 4417 | 2862511733 | |||
| 4418 | 2862579180 | |||
| 4419 | 2862709359 | |||
| 4420 | 2863404518 | |||
| 4421 | 2867348898 | |||
| 4422 | 2867371955 | |||
| 4423 | 2867434852 | |||
| 4424 | 2867479902 | |||
| 4425 | 2873155656 | |||
| 4426 | 2873316372 | |||
| 4427 | 2875395639 | |||
| 4428 | 2877681039 | |||
| 4429 | 2884703590 | |||
| 4430 | 2891398903 | |||
| 4431 | 2891559113 | |||
| 4432 | 2891569556 | |||
| 4433 | 2895438539 | |||
| 4434 | 2895443382 | |||
| 4435 | 2895883767 | |||
| 4436 | 2904501520 | |||
| 4437 | 2904608559 | |||
| 4438 | 2912724285 | |||
| 4439 | 2912760859 | |||
| 4440 | 2918505511 | |||
| 4441 | 2919035526 | |||
| 4442 | 2935393340 | |||
| 4443 | 2946049000 | |||
| 4444 | 2946067835 | |||
| 4445 | 2946075977 | |||
| 4446 | 2947229160 | |||
| 4447 | 2954386148 | |||
| 4448 | 2954677002 | |||
| 4449 | 2954687155 | |||
| 4450 | 2954696786 | |||
| 4451 | 2954705352 | |||
| 4452 | 2954716165 | |||
| 4453 | 2954726108 | |||
| 4454 | 2954735702 | |||
| 4455 | 2954745034 | |||
| 4456 | 2954754558 | |||
| 4457 | 2954764006 | |||
| 4458 | 2966601722 | |||
| 4459 | 2990048080 | |||
| 4460 | 2990063166 | |||
| 4461 | 2995465892 | |||
| 4462 | 2995466746 | |||
| 4463 | 2997457774 | |||
| 4464 | 2997600354 | |||
| 4465 | 3003004870 | |||
| 4466 | 3006324990 | |||
| 4467 | 3006399692 | |||
| 4468 | 3006428769 | |||
| 4469 | 3006487457 | |||
| 4470 | 3006500827 | |||
| 4471 | 637877588 | |||
| 4472 | 8007377605 | |||
| 4473 | 8008488623 | |||
| 4474 | 8008567201 | |||
| 4475 | 8008578821 | |||
| 4476 | 8023629810 | |||
| 4477 | 8025417821 | |||
| 4478 | 8025481844 | |||
| 4479 | 8025527399 | |||
| 4480 | 8025537943 | |||
| 4481 | 8033686962 | |||
| 4482 | 8047898044 | |||
| 4483 | 8048128019 | |||
| 4484 | 8048360849 | |||
| 4485 | 8048375007 | |||
| 4486 | 8048383199 | |||
| 4487 | 8048412667 | |||
| 4488 | 8054167024 | |||
| 4489 | 8055074387 | |||
| 4490 | 8055173924 | |||
| 4491 | 8056449183 | |||
| 4492 | 8056671188 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3i2z-assembly2.cif.gz_B | structure of cold shock protein e from salmonella typhimurium | 0.9752 | 1 | 66 |
| 1mjc-assembly1.cif.gz_A | crystal structure of cspa, the major cold shock protein of escherichia coli | 0.9699 | 2 | 66 |
| 1hza-assembly1.cif.gz_B | bacillus caldolyticus cold-shock protein mutants to study determinants of protein stability | 0.9673 | 1 | 67 |
| 1c9o-assembly1.cif.gz_B | crystal structure analysis of the bacillus caldolyticus cold shock protein bc-csp | 0.9601 | 1 | 66 |
| 1hz9-assembly1.cif.gz_B | bacillus caldolyticus cold-shock protein mutants to study determinants of protein stability | 0.959 | 1 | 66 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P92186_48_133_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9689 | 2 | 65 | 2.40.50.140 |
| af_Q94C69_1_75_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9596 | 2 | 64 | 2.40.50.140 |
| af_Q9VRN5_36_116_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9471 | 2 | 66 | 2.40.50.140 |
| af_I1LPN7_1_82_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9441 | 2 | 65 | 2.40.50.140 |
| 5o6fA00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9433 | 1 | 66 | 2.40.50.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-L8PCS3-F1-model_v4 | Putative Cold shock protein | 1.01 | 1 | 67 |
GO:0003677
GO:0005737 |
| AF-A0A7Y6CAR0-F1-model_v4 | Cold-shock protein | 1.009 | 1 | 67 |
GO:0003677
GO:0005737 |
| AF-A0A0M2GS90-F1-model_v4 | Cold-shock protein | 1.009 | 1 | 67 |
GO:0003677
GO:0005737 |
| AF-A0A7K2YX20-F1-model_v4 | Cold shock domain-containing protein | 1.009 | 1 | 67 |
GO:0003677
GO:0005737 |
| AF-A0A7W7BXJ9-F1-model_v4 | deleted | 1.008 | 1 | 67 |
|