F496598

General Info

Members Datasets Scaffolds Average Seq Length
2247 751 4492 66

Family's Representative Sequence

Representative Sequence 3300044693|Ga0466961_0728462|Ga0466961_0728462_244_471
Length 75
Sequence VRIEKPGVVVAQGTVKWFNAEKGYGFIAVDGGSDVFVHYSAIQMDGYKSLEEGQRVEFEVTQGQKGPQADAVRAV

Samples

Sample ID Description Type Environment
1 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
8 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
9 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
10 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
11 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
13 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
16 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
17 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
18 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
19 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
20 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
21 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
29 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
30 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
34 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
35 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
36 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
37 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
38 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
39 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
40 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
41 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
42 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
43 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
44 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
45 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
46 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
47 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
48 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
49 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
50 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
51 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
52 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
53 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
54 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
55 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
56 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
57 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
58 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
59 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
60 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
61 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
62 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
63 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
64 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
65 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
66 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
67 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
68 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
69 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
70 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
71 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
72 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
73 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
74 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
75 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
76 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
77 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
78 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
79 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
80 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
81 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
82 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
83 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
84 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
85 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
86 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
87 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
88 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
89 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
90 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
91 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
92 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
93 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
94 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
95 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
96 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
97 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
98 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
99 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
100 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
101 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
102 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
103 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
104 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
105 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
106 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
107 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
108 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
109 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
110 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
111 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
112 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
113 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
114 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
115 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
116 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
117 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
118 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
119 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
120 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
121 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
122 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
123 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
124 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
125 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
126 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
127 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
128 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
129 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
130 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
131 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
132 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
133 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
134 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
135 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
136 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
137 3300012473 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 Metagenome Rhizosphere
138 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
139 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
140 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
141 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
142 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
143 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
144 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
145 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
146 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
147 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
148 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
149 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
150 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
151 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
152 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
153 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
154 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
155 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
156 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
157 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
158 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
159 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
160 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
161 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
162 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
163 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
164 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
165 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
166 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
167 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
168 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
169 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
170 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
171 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
172 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
173 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
174 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
175 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
176 3300019183 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
178 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
179 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
180 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
181 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
182 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
183 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
184 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
185 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
186 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
188 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
189 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
190 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
191 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
192 3300023552 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300023680 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
194 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
195 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
196 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
197 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
198 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
199 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
200 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
201 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
202 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
203 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
204 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
271 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
273 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
275 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
276 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
277 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
278 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
279 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
280 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
281 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
282 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
283 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
284 3300029282 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.stcc.R1 Metatranscriptome Rhizosphere
285 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
286 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
287 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
288 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
289 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
290 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
291 3300030882 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
292 3300030889 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
293 3300030963 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
294 3300031010 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
295 3300031011 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
296 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
297 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
298 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
299 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
300 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
301 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
302 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
303 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
304 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
305 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
306 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
307 3300031592 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
308 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
309 3300031615 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
310 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
311 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
312 3300031667 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
313 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
314 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
315 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
316 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
317 3300031810 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Unclassified
318 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
319 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
320 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
321 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
322 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
323 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
324 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
325 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
326 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
327 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
328 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
329 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
330 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
331 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
332 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
333 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
334 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
335 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
336 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
337 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
338 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
339 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
340 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
341 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
342 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
343 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
344 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
345 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
346 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
347 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
348 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
349 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
350 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
351 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
352 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
353 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
354 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
355 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
356 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
357 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
358 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
359 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
360 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
361 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
362 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
363 3300036242 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
364 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
365 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
366 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
367 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
368 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
369 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
370 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
371 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
372 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
373 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
374 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
375 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
376 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
377 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
378 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
379 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
380 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
381 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
382 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
383 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
384 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
385 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
386 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
387 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
388 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
389 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
390 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
391 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
392 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
393 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
394 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
395 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
396 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
397 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
398 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
399 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
400 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
401 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
402 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
403 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
404 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
405 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
406 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
407 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
408 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
409 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
410 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
411 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
412 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
413 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
414 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
415 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
416 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
417 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
418 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
419 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
420 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
421 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
422 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
423 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
424 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
425 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
426 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
427 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
428 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
429 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
430 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
431 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
432 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
433 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
434 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
435 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
436 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
437 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
438 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
439 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
440 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
441 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
442 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
443 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
444 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
445 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
446 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
447 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
448 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
449 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
450 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
451 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
452 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
453 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
454 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
455 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
456 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
457 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
458 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
459 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
460 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
461 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
462 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
463 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
464 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
465 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
466 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
467 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
468 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
469 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
470 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
471 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
472 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
473 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
474 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
475 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
476 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
477 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
478 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
479 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
480 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
481 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
482 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
483 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
484 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
485 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
486 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
487 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
488 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
489 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
490 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
491 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
492 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
493 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
494 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
495 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
496 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
497 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
498 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
499 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
500 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
501 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
502 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
503 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
504 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
505 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
506 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
507 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
508 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
509 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
510 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
511 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
512 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
513 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
514 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
515 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
516 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
517 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
518 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
519 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
520 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
521 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
522 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
523 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
524 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
525 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
526 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
527 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
528 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
529 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
530 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
531 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
532 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
533 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
534 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
535 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
536 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
537 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
538 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
539 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
540 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
541 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
542 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
543 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
544 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
545 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
546 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
547 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
548 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
549 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
550 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
551 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
552 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
553 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
554 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
555 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
556 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
557 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
558 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
559 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
560 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
561 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
562 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
563 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
564 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
565 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
566 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
567 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
568 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
569 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
570 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
571 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
572 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
573 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
574 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
575 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
576 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
577 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
578 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
579 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
580 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
581 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
582 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
583 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
584 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
585 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
586 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
587 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
588 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
589 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
590 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
591 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
592 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
593 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
594 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
595 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
596 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
597 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
598 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
599 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
600 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
601 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
602 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
603 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
604 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
605 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
606 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
607 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
608 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
609 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
610 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
611 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
612 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
613 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
614 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
615 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
616 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
617 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
618 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
619 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
620 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
621 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
622 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
623 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
624 2527291627 Frankia casuarinae Thr Isolate Nodule
625 2527291629 Frankia sp. BMG5.23 Isolate Nodule
626 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
627 2546825537 Frankia sp. CcI6 Isolate Rhizoplane
628 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
629 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
630 2576861822 Frankia sp. CeD Isolate Nodule
631 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
632 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
633 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
634 2599185353 Staphylococcus sp. NFPP34 Isolate Rhizoplane
635 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
636 2619618881 Frankia sp. ACN1ag Isolate Unclassified
637 2619619003 Frankia sp. CpI1-P Isolate Nodule
638 2626541554 Frankia sp. AvcI.1 Isolate Nodule
639 2643221548 Streptomyces sp. Root55 Isolate Unclassified
640 2643221578 Streptomyces sp. Root63 Isolate Unclassified
641 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
642 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
643 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
644 2643221647 Streptomyces sp. Root369 Isolate Unclassified
645 2643221670 Streptomyces sp. Root431 Isolate Unclassified
646 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
647 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
648 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
649 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
650 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
651 2684623036 Frankia sp. CgIM4 Isolate Nodule
652 2710264753 Frankia sp. KB5 Isolate Nodule
653 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
654 2773857924 Frankia sp. CgIS1 Isolate Nodule
655 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
656 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
657 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
658 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
659 2788500588 Lysinibacillus sp. YS11 Isolate Unclassified
660 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
661 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
662 2808606448 Streptomyces sp. 193411 Isolate Unclassified
663 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
664 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
665 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
666 2818991451 Lysinibacillus fusiformis 3193 Isolate Unclassified
667 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
668 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
669 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
670 2847085930 Erwinia persicina B64 Isolate Bulb
671 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
672 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
673 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
674 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
675 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
676 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
677 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
678 2862574272 Streptomyces sp. AcE210 Isolate Nodule
679 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
680 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
681 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
682 2867369537 Streptomyces sp. Z26 Isolate Unclassified
683 2867428634 Streptomyces sp. RP5T Isolate Unclassified
684 2867475112 Streptomyces sp. TM32 Isolate Unclassified
685 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
686 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
687 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
688 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
689 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
690 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
691 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
692 2891562705 Microbispora tritici MT50 Isolate Unclassified
693 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
694 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
695 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
696 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
697 2904606771 Lysinibacillus macroides 1284 Isolate Rhizosphere
698 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
699 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
700 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
701 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
702 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
703 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
704 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
705 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
706 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
707 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
708 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
709 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
710 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
711 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
712 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
713 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
714 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
715 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
716 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
717 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
718 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
719 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
720 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
721 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
722 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
723 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
724 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
725 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
726 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
727 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
728 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
729 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
730 637000116 Frankia casuarinae CcI3 Isolate Nodule
731 8007375930 Clostridium sp. YIM B02565 Isolate Unclassified
732 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
733 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
734 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
735 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
736 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
737 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
738 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
739 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
740 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
741 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
742 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
743 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
744 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
745 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
746 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
747 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
748 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
749 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
750 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
751 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.3
Metatranscriptomes 3.96
Isolates 5.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0.04
Endosphere 2.05
Nodule 0.58
Rhizoplane 3.78
Rhizosphere 88.07
Stem 0
Stem Tuber 0
Unclassified 0.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466961_0728462 3300044693 Bacteria 593
2 JGI24741J21665_1068614 3300001915 Bacteria 525
3 JGI24752J21851_1053559 3300001976 Bacteria 550
4 JGI24747J21853_1048214 3300001978 Bacteria 515
5 JGI24740J21852_10144583 3300001979 Bacteria 591
6 JGI24743J22301_10063866 3300001991 Bacteria 761
7 JGI24745J21846_1054131 3300002073 Bacteria 512
8 JGI24033J26618_1075896 3300002155 Bacteria 510
9 JGI24751J29686_10011389 3300002459 Bacteria 1834
10 JGI25152J39213_1000431 3300002773 Bacteria 25240
11 Ga0006759J45824_1010939 3300003163 Bacteria 545
12 JGI25151J46595_10048603 3300003187 Bacteria 1464
13 rootH1_10054865 3300003316 Bacteria 1982
14 rootL2_10002354 3300003322 Bacteria 3195
15 rootH1_10077154 3300003323 Bacteria 1378
16 Ga0007417J51691_1031744 3300003544 Bacteria 541
17 Ga0007416J51690_1039243 3300003577 Bacteria 538
18 Ga0006562J51391_1013573 3300003578 Bacteria 2369
19 Ga0007429J51699_1029739 3300003579 Bacteria 514
20 JGI25404J52841_10004078 3300003659 Bacteria 2936
21 Ga0058859_11593662 3300004798 Bacteria 695
22 Ga0070658_10080675 3300005327 Bacteria 2672
23 Ga0070658_10109176 3300005327 Bacteria 2291
24 Ga0070658_10126206 3300005327 Bacteria 2130
25 Ga0070658_10384459 3300005327 Bacteria 1204
26 Ga0070658_10467407 3300005327 Bacteria 1088
27 Ga0070658_10489431 3300005327 Bacteria 1062
28 Ga0070658_10573142 3300005327 Bacteria 977
29 Ga0070658_11618769 3300005327 Bacteria 561
30 Ga0070676_10132525 3300005328 Bacteria 1578
31 Ga0070676_10199801 3300005328 Bacteria 1310
32 Ga0070683_100086548 3300005329 Bacteria 2938
33 Ga0070683_100236714 3300005329 Bacteria 1736
34 Ga0070683_100242651 3300005329 Bacteria 1714
35 Ga0070683_100319737 3300005329 Bacteria 1477
36 Ga0070683_100649829 3300005329 Bacteria 1010
37 Ga0070683_100769179 3300005329 Bacteria 923
38 Ga0070683_100933785 3300005329 Bacteria 832
39 Ga0070683_100993534 3300005329 Bacteria 806
40 Ga0070690_100074092 3300005330 Bacteria 2216
41 Ga0070690_100728694 3300005330 Bacteria 764
42 Ga0070670_100116948 3300005331 Bacteria 2299
43 Ga0070670_100304737 3300005331 Bacteria 1394
44 Ga0070670_100714487 3300005331 Bacteria 902
45 Ga0068869_100102951 3300005334 Bacteria 2162
46 Ga0068869_100415167 3300005334 Bacteria 1109
47 Ga0070666_10354187 3300005335 Bacteria 1051
48 Ga0070666_10956143 3300005335 Bacteria 634
49 Ga0070680_100046686 3300005336 Bacteria 3524
50 Ga0070680_100538264 3300005336 Bacteria 1000
51 Ga0070680_100606669 3300005336 Bacteria 939
52 Ga0070680_100610347 3300005336 Bacteria 936
53 Ga0070680_100698235 3300005336 Bacteria 873
54 Ga0070680_101025375 3300005336 Bacteria 713
55 Ga0070682_100156042 3300005337 Bacteria 1571
56 Ga0070682_100393943 3300005337 Bacteria 1045
57 Ga0070682_100538345 3300005337 Bacteria 912
58 Ga0068868_100047482 3300005338 Bacteria 3365
59 Ga0068868_100124661 3300005338 Bacteria 2103
60 Ga0068868_100147618 3300005338 Bacteria 1935
61 Ga0068868_100284076 3300005338 Bacteria 1401
62 Ga0068868_100542797 3300005338 Bacteria 1024
63 Ga0068868_100858346 3300005338 Bacteria 823
64 Ga0068868_102239428 3300005338 Bacteria 521
65 Ga0070660_100056154 3300005339 Bacteria 3045
66 Ga0070660_100205642 3300005339 Bacteria 1598
67 Ga0070660_100263905 3300005339 Bacteria 1406
68 Ga0070660_100354618 3300005339 Bacteria 1208
69 Ga0070660_100510441 3300005339 Bacteria 1000
70 Ga0070660_101554158 3300005339 Bacteria 563
71 Ga0070689_100023700 3300005340 Bacteria 4598
72 Ga0070689_100077283 3300005340 Bacteria 2608
73 Ga0070691_10011376 3300005341 Bacteria 4063
74 Ga0070691_10102607 3300005341 Bacteria 1422
75 Ga0070687_100030344 3300005343 Bacteria 2642
76 Ga0070687_100063632 3300005343 Bacteria 1957
77 Ga0070661_100021766 3300005344 Bacteria 4585
78 Ga0070661_100124775 3300005344 Bacteria 1931
79 Ga0070661_100334839 3300005344 Bacteria 1184
80 Ga0070661_101843976 3300005344 Bacteria 514
81 Ga0070692_10041379 3300005345 Bacteria 2360
82 Ga0070692_10055692 3300005345 Bacteria 2068
83 Ga0070692_10254029 3300005345 Bacteria 1053
84 Ga0070692_11110272 3300005345 Bacteria 559
85 Ga0070692_11233403 3300005345 Bacteria 534
86 Ga0070668_100125509 3300005347 Bacteria 2055
87 Ga0070668_101289281 3300005347 Bacteria 664
88 Ga0070669_100198950 3300005353 Bacteria 1576
89 Ga0070669_100614344 3300005353 Bacteria 912
90 Ga0070675_100014849 3300005354 Bacteria 6147
91 Ga0070675_100412316 3300005354 Bacteria 1207
92 Ga0070671_100079033 3300005355 Bacteria 2749
93 Ga0070671_100093054 3300005355 Bacteria 2526
94 Ga0070671_100984026 3300005355 Bacteria 739
95 Ga0070671_101505015 3300005355 Bacteria 596
96 Ga0070674_100106617 3300005356 Bacteria 2051
97 Ga0070674_100420697 3300005356 Bacteria 1096
98 Ga0070674_100474125 3300005356 Bacteria 1037
99 Ga0070674_100928262 3300005356 Bacteria 760
100 Ga0070673_100104251 3300005364 Bacteria 2341
101 Ga0070673_100154142 3300005364 Bacteria 1948
102 Ga0070673_100870359 3300005364 Bacteria 834
103 Ga0070673_102250448 3300005364 Bacteria 518
104 Ga0070688_100871259 3300005365 Bacteria 709
105 Ga0070659_100122200 3300005366 Bacteria 2110
106 Ga0070659_100498801 3300005366 Bacteria 1037
107 Ga0070659_102159688 3300005366 Bacteria 501
108 Ga0070667_100120475 3300005367 Bacteria 2282
109 Ga0070667_100600987 3300005367 Bacteria 1014
110 Ga0070667_101238485 3300005367 Bacteria 699
111 Ga0070667_101365278 3300005367 Bacteria 664
112 Ga0070667_101456044 3300005367 Bacteria 643
113 Ga0070703_10180095 3300005406 Bacteria 815
114 Ga0070709_10001280 3300005434 Bacteria 13735
115 Ga0070709_10006908 3300005434 Bacteria 6195
116 Ga0070709_10063516 3300005434 Bacteria 2359
117 Ga0070709_10087255 3300005434 Bacteria 2050
118 Ga0070709_10174334 3300005434 Bacteria 1505
119 Ga0070709_10202510 3300005434 Bacteria 1406
120 Ga0070709_10778168 3300005434 Bacteria 749
121 Ga0070714_100001940 3300005435 Bacteria 15105
122 Ga0070714_100034995 3300005435 Bacteria 4207
123 Ga0070714_100037342 3300005435 Bacteria 4081
124 Ga0070714_100095332 3300005435 Bacteria 2613
125 Ga0070714_100377177 3300005435 Bacteria 1336
126 Ga0070714_100988991 3300005435 Bacteria 818
127 Ga0070714_101171864 3300005435 Bacteria 749
128 Ga0070714_101177506 3300005435 Bacteria 747
129 Ga0070714_101715283 3300005435 Bacteria 613
130 Ga0070713_100004434 3300005436 Bacteria 9431
131 Ga0070713_100012635 3300005436 Bacteria 6204
132 Ga0070713_100013221 3300005436 Bacteria 6085
133 Ga0070713_100049348 3300005436 Bacteria 3472
134 Ga0070713_100088315 3300005436 Bacteria 2660
135 Ga0070713_100147071 3300005436 Bacteria 2092
136 Ga0070713_100649696 3300005436 Bacteria 1004
137 Ga0070713_100841886 3300005436 Bacteria 880
138 Ga0070713_100898909 3300005436 Bacteria 852
139 Ga0070713_101061230 3300005436 Bacteria 782
140 Ga0070713_101255139 3300005436 Bacteria 718
141 Ga0070713_101653296 3300005436 Bacteria 622
142 Ga0070713_101710907 3300005436 Bacteria 610
143 Ga0070713_102016839 3300005436 Bacteria 560
144 Ga0070710_10001003 3300005437 Bacteria 13427
145 Ga0070710_10023246 3300005437 Bacteria 3255
146 Ga0070710_10040445 3300005437 Bacteria 2570
147 Ga0070710_10092801 3300005437 Bacteria 1784
148 Ga0070710_10788568 3300005437 Bacteria 678
149 Ga0070701_10002382 3300005438 Bacteria 7225
150 Ga0070701_10017082 3300005438 Bacteria 3387
151 Ga0070701_10383669 3300005438 Bacteria 886
152 Ga0070711_100002980 3300005439 Bacteria 9778
153 Ga0070711_100012494 3300005439 Bacteria 5308
154 Ga0070711_100032246 3300005439 Bacteria 3482
155 Ga0070711_100047988 3300005439 Bacteria 2917
156 Ga0070711_100305332 3300005439 Bacteria 1267
157 Ga0070711_100360005 3300005439 Bacteria 1172
158 Ga0070711_100463276 3300005439 Bacteria 1039
159 Ga0070711_100914197 3300005439 Bacteria 749
160 Ga0070711_100989946 3300005439 Bacteria 721
161 Ga0070705_100117944 3300005440 Bacteria 1708
162 Ga0070705_100253250 3300005440 Bacteria 1237
163 Ga0070705_100676564 3300005440 Bacteria 808
164 Ga0070700_100084167 3300005441 Bacteria 2061
165 Ga0070700_100126695 3300005441 Bacteria 1718
166 Ga0070694_100159574 3300005444 Bacteria 1653
167 Ga0070694_101185010 3300005444 Bacteria 640
168 Ga0070708_100025343 3300005445 Bacteria 5069
169 Ga0070708_100224558 3300005445 Bacteria 1762
170 Ga0070708_100530524 3300005445 Bacteria 1110
171 Ga0070708_101258753 3300005445 Bacteria 691
172 Ga0070663_100054987 3300005455 Bacteria 2847
173 Ga0070663_100188437 3300005455 Bacteria 1604
174 Ga0070663_100257789 3300005455 Bacteria 1382
175 Ga0070663_100496541 3300005455 Bacteria 1013
176 Ga0070663_100524603 3300005455 Bacteria 986
177 Ga0070663_101374622 3300005455 Bacteria 625
178 Ga0070678_100001635 3300005456 Bacteria 11996
179 Ga0070678_100096431 3300005456 Bacteria 2281
180 Ga0070678_100977622 3300005456 Bacteria 777
181 Ga0070678_101473509 3300005456 Bacteria 637
182 Ga0070662_100222732 3300005457 Bacteria 1506
183 Ga0070662_101195085 3300005457 Bacteria 654
184 Ga0070662_101293285 3300005457 Bacteria 628
185 Ga0070681_10010877 3300005458 Bacteria 8995
186 Ga0070681_10108042 3300005458 Bacteria 2723
187 Ga0070681_10137321 3300005458 Bacteria 2375
188 Ga0070681_10196105 3300005458 Bacteria 1938
189 Ga0070681_10337063 3300005458 Bacteria 1417
190 Ga0070681_10553769 3300005458 Bacteria 1064
191 Ga0070681_11172480 3300005458 Bacteria 690
192 Ga0070681_11596470 3300005458 Bacteria 578
193 Ga0068867_100319689 3300005459 Bacteria 1285
194 Ga0068867_100732792 3300005459 Bacteria 875
195 Ga0068867_101855960 3300005459 Bacteria 568
196 Ga0070685_10035130 3300005466 Bacteria 2827
197 Ga0070706_100003283 3300005467 Bacteria 15999
198 Ga0070706_100057923 3300005467 Bacteria 3575
199 Ga0070706_100068689 3300005467 Bacteria 3277
200 Ga0070706_100122297 3300005467 Bacteria 2426
201 Ga0070706_100149776 3300005467 Bacteria 2178
202 Ga0070706_100176547 3300005467 Bacteria 1994
203 Ga0070706_100535921 3300005467 Bacteria 1089
204 Ga0070707_100000759 3300005468 Bacteria 31807
205 Ga0070707_100038811 3300005468 Bacteria 4549
206 Ga0070707_100365192 3300005468 Bacteria 1402
207 Ga0070707_100508407 3300005468 Bacteria 1166
208 Ga0070707_100591905 3300005468 Bacteria 1071
209 Ga0070698_100001019 3300005471 Bacteria 30816
210 Ga0070698_100002343 3300005471 Bacteria 20941
211 Ga0070698_100015778 3300005471 Bacteria 7979
212 Ga0070698_100061092 3300005471 Bacteria 3801
213 Ga0070698_100080895 3300005471 Bacteria 3243
214 Ga0070698_100120956 3300005471 Bacteria 2578
215 Ga0070698_100322503 3300005471 Bacteria 1475
216 Ga0070698_101133924 3300005471 Bacteria 731
217 Ga0070699_100145669 3300005518 Bacteria 2092
218 Ga0070679_100010387 3300005530 Bacteria 8830
219 Ga0070679_100025712 3300005530 Bacteria 5777
220 Ga0070679_100106370 3300005530 Bacteria 2791
221 Ga0070679_100271602 3300005530 Bacteria 1649
222 Ga0070679_100298098 3300005530 Bacteria 1563
223 Ga0070679_100345874 3300005530 Bacteria 1435
224 Ga0070679_101406517 3300005530 Bacteria 644
225 Ga0070684_100206692 3300005535 Bacteria 1789
226 Ga0070684_100212168 3300005535 Bacteria 1764
227 Ga0070684_100312069 3300005535 Bacteria 1444
228 Ga0070684_100443196 3300005535 Bacteria 1200
229 Ga0070684_100584887 3300005535 Bacteria 1037
230 Ga0070684_100729378 3300005535 Bacteria 924
231 Ga0070684_100984099 3300005535 Bacteria 791
232 Ga0070697_100004357 3300005536 Bacteria 10859
233 Ga0070697_100010938 3300005536 Bacteria 7089
234 Ga0070697_100190470 3300005536 Bacteria 1741
235 Ga0070697_100608698 3300005536 Bacteria 961
236 Ga0070697_101160348 3300005536 Bacteria 688
237 Ga0068853_100325991 3300005539 Bacteria 1424
238 Ga0068853_100600049 3300005539 Bacteria 1045
239 Ga0070672_100025168 3300005543 Bacteria 4411
240 Ga0070672_100264280 3300005543 Bacteria 1452
241 Ga0070672_100491634 3300005543 Bacteria 1060
242 Ga0070672_100668898 3300005543 Bacteria 908
243 Ga0070686_100908941 3300005544 Bacteria 717
244 Ga0070695_100050897 3300005545 Bacteria 2656
245 Ga0070695_100342472 3300005545 Bacteria 1118
246 Ga0070695_101709408 3300005545 Bacteria 527
247 Ga0070696_100060268 3300005546 Bacteria 2654
248 Ga0070696_100177283 3300005546 Bacteria 1579
249 Ga0070696_101169569 3300005546 Bacteria 649
250 Ga0070696_101407026 3300005546 Bacteria 595
251 Ga0070696_101819046 3300005546 Bacteria 527
252 Ga0070693_100005092 3300005547 Bacteria 6280
253 Ga0070693_100598680 3300005547 Bacteria 795
254 Ga0070693_101049708 3300005547 Bacteria 619
255 Ga0070665_100030159 3300005548 Bacteria 5457
256 Ga0070665_100260984 3300005548 Bacteria 1734
257 Ga0070665_100396212 3300005548 Bacteria 1388
258 Ga0070665_100447186 3300005548 Bacteria 1302
259 Ga0070704_100265991 3300005549 Bacteria 1414
260 Ga0070704_100874040 3300005549 Bacteria 807
261 Ga0070704_101940956 3300005549 Bacteria 546
262 Ga0068855_100121025 3300005563 Bacteria 2996
263 Ga0068855_100158059 3300005563 Bacteria 2574
264 Ga0068855_100678137 3300005563 Bacteria 1105
265 Ga0068855_100919154 3300005563 Bacteria 923
266 Ga0068855_101817696 3300005563 Bacteria 619
267 Ga0068855_102212485 3300005563 Bacteria 552
268 Ga0070664_100074926 3300005564 Bacteria 2905
269 Ga0070664_101325913 3300005564 Bacteria 680
270 Ga0070664_101414514 3300005564 Bacteria 658
271 Ga0070664_101589521 3300005564 Bacteria 619
272 Ga0068857_100272546 3300005577 Bacteria 1555
273 Ga0068857_100609823 3300005577 Bacteria 1032
274 Ga0068857_100728433 3300005577 Bacteria 943
275 Ga0068857_101054175 3300005577 Bacteria 784
276 Ga0068857_101174897 3300005577 Bacteria 742
277 Ga0068857_101876973 3300005577 Bacteria 587
278 Ga0068854_100056428 3300005578 Bacteria 2830
279 Ga0068854_100393090 3300005578 Bacteria 1145
280 Ga0068854_101826830 3300005578 Bacteria 557
281 Ga0068856_100105265 3300005614 Bacteria 2815
282 Ga0068856_101059653 3300005614 Bacteria 828
283 Ga0068856_101851418 3300005614 Bacteria 615
284 Ga0070702_100068800 3300005615 Bacteria 2084
285 Ga0070702_100213681 3300005615 Bacteria 1285
286 Ga0068852_100000497 3300005616 Bacteria 25765
287 Ga0068852_100075312 3300005616 Bacteria 2977
288 Ga0068852_100096999 3300005616 Bacteria 2651
289 Ga0068852_100340080 3300005616 Bacteria 1462
290 Ga0068852_100602885 3300005616 Bacteria 1103
291 Ga0068852_102172148 3300005616 Bacteria 577
292 Ga0068859_100246961 3300005617 Bacteria 1874
293 Ga0068859_100273218 3300005617 Bacteria 1782
294 Ga0068859_100889388 3300005617 Bacteria 976
295 Ga0068859_101870180 3300005617 Bacteria 663
296 Ga0068864_100003244 3300005618 Bacteria 13439
297 Ga0068864_100127348 3300005618 Bacteria 2283
298 Ga0068864_101623856 3300005618 Bacteria 651
299 Ga0068864_101662577 3300005618 Bacteria 643
300 Ga0068864_101764136 3300005618 Bacteria 624
301 Ga0068866_10032583 3300005718 Bacteria 2521
302 Ga0068866_10386663 3300005718 Bacteria 899
303 Ga0068861_100358099 3300005719 Bacteria 1282
304 Ga0068851_10081316 3300005834 Bacteria 1692
305 Ga0068851_10356563 3300005834 Bacteria 852
306 Ga0068870_10021137 3300005840 Bacteria 3179
307 Ga0068870_10563046 3300005840 Bacteria 769
308 Ga0068870_10732648 3300005840 Bacteria 685
309 Ga0068870_10906967 3300005840 Bacteria 623
310 Ga0068863_100003332 3300005841 Bacteria 15867
311 Ga0068863_100519231 3300005841 Bacteria 1174
312 Ga0068863_100565331 3300005841 Bacteria 1124
313 Ga0068863_100819907 3300005841 Bacteria 928
314 Ga0068858_100214839 3300005842 Bacteria 1820
315 Ga0068858_100246158 3300005842 Bacteria 1697
316 Ga0068858_100398373 3300005842 Bacteria 1322
317 Ga0068858_100422857 3300005842 Bacteria 1281
318 Ga0068858_100748928 3300005842 Bacteria 952
319 Ga0068860_100371807 3300005843 Bacteria 1410
320 Ga0068860_101451373 3300005843 Bacteria 707
321 Ga0068860_102725001 3300005843 Bacteria 513
322 Ga0068862_100020590 3300005844 Bacteria 5509
323 Ga0081455_10181061 3300005937 Bacteria 1595
324 Ga0081538_10035881 3300005981 Bacteria 3248
325 Ga0081540_1000193 3300005983 Bacteria 63248
326 Ga0081540_1000355 3300005983 Bacteria 46352
327 Ga0081540_1078394 3300005983 Bacteria 1498
328 Ga0081539_10389280 3300005985 Bacteria 581
329 Ga0070717_10017503 3300006028 Bacteria 5578
330 Ga0070717_10107833 3300006028 Bacteria 2372
331 Ga0070717_10156341 3300006028 Bacteria 1976
332 Ga0070717_10303179 3300006028 Bacteria 1420
333 Ga0070717_10314830 3300006028 Bacteria 1393
334 Ga0070717_10403326 3300006028 Bacteria 1228
335 Ga0070717_10608322 3300006028 Bacteria 991
336 Ga0070717_10761132 3300006028 Bacteria 880
337 Ga0070717_10812605 3300006028 Bacteria 851
338 Ga0070717_11141430 3300006028 Bacteria 709
339 Ga0070717_11528065 3300006028 Bacteria 605
340 Ga0070717_11741542 3300006028 Bacteria 563
341 Ga0075363_100138181 3300006048 Bacteria 1370
342 Ga0075363_100647093 3300006048 Bacteria 636
343 Ga0075432_10260394 3300006058 Bacteria 707
344 Ga0070715_10018614 3300006163 Bacteria 2650
345 Ga0070715_10083546 3300006163 Bacteria 1454
346 Ga0070715_10131122 3300006163 Bacteria 1206
347 Ga0070716_100003676 3300006173 Bacteria 7258
348 Ga0070716_100013747 3300006173 Bacteria 4133
349 Ga0070716_100018980 3300006173 Bacteria 3589
350 Ga0070716_100149237 3300006173 Bacteria 1501
351 Ga0070716_100575500 3300006173 Bacteria 843
352 Ga0070712_100001764 3300006175 Bacteria 13234
353 Ga0070712_100220805 3300006175 Bacteria 1500
354 Ga0070712_100330101 3300006175 Bacteria 1242
355 Ga0070712_100396209 3300006175 Bacteria 1139
356 Ga0070712_100808737 3300006175 Bacteria 804
357 Ga0070712_101487354 3300006175 Bacteria 592
358 Ga0070712_101693509 3300006175 Bacteria 553
359 Ga0097621_100028657 3300006237 Bacteria 4390
360 Ga0097621_100138272 3300006237 Bacteria 2079
361 Ga0097621_100467346 3300006237 Bacteria 1138
362 Ga0068871_100116304 3300006358 Bacteria 2254
363 Ga0068871_100192461 3300006358 Bacteria 1758
364 Ga0068871_100934828 3300006358 Bacteria 805
365 Ga0075428_100116954 3300006844 Bacteria 2904
366 Ga0075428_100248314 3300006844 Bacteria 1918
367 Ga0075428_100875814 3300006844 Bacteria 953
368 Ga0075433_10004667 3300006852 Bacteria 10683
369 Ga0075433_10058534 3300006852 Bacteria 3370
370 Ga0075433_10212584 3300006852 Bacteria 1718
371 Ga0075433_10302864 3300006852 Bacteria 1415
372 Ga0075433_10487249 3300006852 Bacteria 1086
373 Ga0075434_100004126 3300006871 Bacteria 13026
374 Ga0075434_100121257 3300006871 Bacteria 2630
375 Ga0075434_100295990 3300006871 Bacteria 1638
376 Ga0075434_100381904 3300006871 Bacteria 1429
377 Ga0075434_100509932 3300006871 Bacteria 1223
378 Ga0075429_100032855 3300006880 Bacteria 4509
379 Ga0075429_100995142 3300006880 Bacteria 733
380 Ga0068865_100197174 3300006881 Bacteria 1561
381 Ga0068865_100223398 3300006881 Bacteria 1473
382 Ga0068865_100226394 3300006881 Bacteria 1465
383 Ga0075436_100005351 3300006914 Bacteria 8832
384 Ga0075436_100130030 3300006914 Bacteria 1765
385 Ga0075436_100214031 3300006914 Bacteria 1366
386 Ga0075436_100370472 3300006914 Bacteria 1034
387 Ga0097620_100246968 3300006931 Bacteria 1874
388 Ga0097620_100273204 3300006931 Bacteria 1782
389 Ga0097620_100889376 3300006931 Bacteria 976
390 Ga0097620_101869838 3300006931 Bacteria 663
391 Ga0099826_10129515 3300006948 Bacteria 1473
392 Ga0075435_100008998 3300007076 Bacteria 7203
393 Ga0075435_100137120 3300007076 Bacteria 2050
394 Ga0075435_100184646 3300007076 Bacteria 1763
395 Ga0075435_100853002 3300007076 Bacteria 794
396 Ga0075435_101056291 3300007076 Bacteria 710
397 Ga0099794_10376727 3300007265 Bacteria 740
398 Ga0099794_10501751 3300007265 Bacteria 639
399 Ga0099795_10015129 3300007788 Bacteria 2409
400 Ga0099795_10346424 3300007788 Bacteria 664
401 Ga0105251_10009748 3300009011 Bacteria 5639
402 Ga0105251_10038963 3300009011 Bacteria 2324
403 Ga0105244_10227262 3300009036 Bacteria 874
404 Ga0105244_10254694 3300009036 Bacteria 818
405 Ga0105244_10362605 3300009036 Bacteria 668
406 Ga0105250_10114222 3300009092 Bacteria 1107
407 Ga0105250_10351630 3300009092 Bacteria 645
408 Ga0105250_10417671 3300009092 Bacteria 597
409 Ga0105240_10535477 3300009093 Bacteria 1298
410 Ga0105240_10639032 3300009093 Bacteria 1168
411 Ga0105240_10733600 3300009093 Bacteria 1075
412 Ga0105240_11127334 3300009093 Bacteria 834
413 Ga0111539_10088965 3300009094 Bacteria 3628
414 Ga0111539_10189764 3300009094 Bacteria 2398
415 Ga0111539_13273931 3300009094 Bacteria 522
416 Ga0105245_10001105 3300009098 Bacteria 24416
417 Ga0105245_10103611 3300009098 Bacteria 2637
418 Ga0105245_10251416 3300009098 Bacteria 1717
419 Ga0105245_10423434 3300009098 Bacteria 1335
420 Ga0105245_10443110 3300009098 Bacteria 1306
421 Ga0105245_10541536 3300009098 Bacteria 1185
422 Ga0105245_10784209 3300009098 Bacteria 990
423 Ga0105245_11488914 3300009098 Bacteria 728
424 Ga0105245_11818852 3300009098 Bacteria 662
425 Ga0105245_12683201 3300009098 Bacteria 551
426 Ga0105247_10000156 3300009101 Bacteria 67016
427 Ga0105247_10004622 3300009101 Bacteria 8774
428 Ga0105247_10212950 3300009101 Bacteria 1304
429 Ga0105247_10448552 3300009101 Bacteria 930
430 Ga0105247_10674909 3300009101 Bacteria 775
431 Ga0105247_10716612 3300009101 Bacteria 755
432 Ga0114129_10003727 3300009147 Bacteria 21488
433 Ga0114129_10176253 3300009147 Unclassified 2912
434 Ga0114129_10672238 3300009147 Bacteria 1334
435 Ga0114129_10818495 3300009147 Unclassified 1187
436 Ga0114129_10905906 3300009147 Bacteria 1117
437 Ga0114129_11140280 3300009147 Bacteria 974
438 Ga0114129_11520112 3300009147 Bacteria 822
439 Ga0114129_13415871 3300009147 Bacteria 510
440 Ga0105243_10011592 3300009148 Bacteria 6669
441 Ga0105243_10081732 3300009148 Bacteria 2639
442 Ga0105243_10132867 3300009148 Bacteria 2114
443 Ga0105243_10329695 3300009148 Bacteria 1394
444 Ga0105243_10641639 3300009148 Bacteria 1028
445 Ga0105243_11886270 3300009148 Bacteria 630
446 Ga0105241_10131584 3300009174 Bacteria 2026
447 Ga0105241_10185322 3300009174 Bacteria 1729
448 Ga0105241_10687614 3300009174 Bacteria 933
449 Ga0105241_10793881 3300009174 Bacteria 872
450 Ga0105241_10989007 3300009174 Bacteria 786
451 Ga0105242_10103963 3300009176 Bacteria 2410
452 Ga0105242_10222383 3300009176 Bacteria 1688
453 Ga0105242_10410322 3300009176 Bacteria 1266
454 Ga0105242_11683134 3300009176 Bacteria 670
455 Ga0105242_12045705 3300009176 Bacteria 616
456 Ga0105242_12307653 3300009176 Bacteria 584
457 Ga0105248_10001256 3300009177 Bacteria 28350
458 Ga0105248_10039623 3300009177 Bacteria 5279
459 Ga0105248_10184254 3300009177 Bacteria 2353
460 Ga0105248_10288636 3300009177 Bacteria 1847
461 Ga0105248_11215465 3300009177 Bacteria 852
462 Ga0105248_12343562 3300009177 Bacteria 608
463 Ga0105237_10365688 3300009545 Bacteria 1447
464 Ga0105237_10426969 3300009545 Bacteria 1331
465 Ga0105237_10591198 3300009545 Bacteria 1117
466 Ga0105237_10797391 3300009545 Bacteria 951
467 Ga0105237_11081608 3300009545 Bacteria 809
468 Ga0105237_11224797 3300009545 Bacteria 757
469 Ga0105237_11985958 3300009545 Bacteria 590
470 Ga0105238_10044356 3300009551 Bacteria 4496
471 Ga0105238_10378578 3300009551 Bacteria 1406
472 Ga0105238_10997556 3300009551 Bacteria 858
473 Ga0105238_11087337 3300009551 Bacteria 822
474 Ga0105238_12227639 3300009551 Bacteria 583
475 Ga0105238_12423355 3300009551 Bacteria 560
476 Ga0105238_12909923 3300009551 Bacteria 515
477 Ga0105249_10040745 3300009553 Bacteria 4219
478 Ga0105249_10329162 3300009553 Bacteria 1541
479 Ga0105249_10330115 3300009553 Bacteria 1539
480 Ga0105249_10453128 3300009553 Bacteria 1322
481 Ga0105249_11166391 3300009553 Bacteria 841
482 Ga0105249_11469127 3300009553 Bacteria 754
483 Ga0105249_11973888 3300009553 Bacteria 656
484 Ga0105249_12291228 3300009553 Bacteria 613
485 Ga0105249_12308920 3300009553 Bacteria 611
486 Ga0105249_12353397 3300009553 Bacteria 605
487 Ga0105249_12421697 3300009553 Bacteria 597
488 Ga0105249_12560354 3300009553 Bacteria 582
489 Ga0099796_10023887 3300010159 Bacteria 1913
490 Ga0099796_10275871 3300010159 Bacteria 706
491 Ga0105239_10131095 3300010375 Bacteria 2789
492 Ga0105239_10244856 3300010375 Bacteria 2013
493 Ga0105239_10424269 3300010375 Bacteria 1507
494 Ga0105239_10738877 3300010375 Bacteria 1126
495 Ga0105239_10824069 3300010375 Bacteria 1063
496 Ga0105239_11055172 3300010375 Bacteria 935
497 Ga0105239_11296739 3300010375 Bacteria 840
498 Ga0105239_11681072 3300010375 Bacteria 735
499 Ga0105239_11843541 3300010375 Bacteria 701
500 Ga0105239_12626434 3300010375 Bacteria 587
501 Ga0105246_10000677 3300011119 Bacteria 19120
502 Ga0105246_10043815 3300011119 Bacteria 3038
503 Ga0105246_10246314 3300011119 Bacteria 1416
504 Ga0105246_10264562 3300011119 Bacteria 1372
505 Ga0105246_10271422 3300011119 Bacteria 1356
506 Ga0105246_10685213 3300011119 Bacteria 896
507 Ga0105246_10696760 3300011119 Bacteria 890
508 Ga0105246_10865976 3300011119 Bacteria 807
509 Ga0157340_1029428 3300012473 Bacteria 506
510 Ga0157336_1017202 3300012477 Bacteria 621
511 Ga0157346_1000486 3300012480 Bacteria 1672
512 Ga0157337_1006266 3300012483 Bacteria 818
513 Ga0157325_1018162 3300012485 Bacteria 602
514 Ga0157329_1021702 3300012491 Bacteria 607
515 Ga0157335_1009023 3300012492 Bacteria 776
516 Ga0157341_1041648 3300012494 Bacteria 534
517 Ga0157319_1010846 3300012497 Bacteria 742
518 Ga0157345_1002512 3300012498 Bacteria 1299
519 Ga0157314_1012932 3300012500 Bacteria 758
520 Ga0157347_1005321 3300012502 Bacteria 1226
521 Ga0157313_1014030 3300012503 Bacteria 735
522 Ga0157339_1010108 3300012505 Bacteria 847
523 Ga0157342_1002674 3300012507 Bacteria 1467
524 Ga0157315_1007234 3300012508 Bacteria 894
525 Ga0157327_1068898 3300012512 Bacteria 545
526 Ga0157326_1029780 3300012513 Bacteria 717
527 Ga0157326_1032110 3300012513 Bacteria 700
528 Ga0157338_1005803 3300012515 Bacteria 1121
529 Ga0157373_10080116 3300013100 Bacteria 2303
530 Ga0157373_10094196 3300013100 Bacteria 2109
531 Ga0157373_10128644 3300013100 Bacteria 1781
532 Ga0157373_10481267 3300013100 Bacteria 895
533 Ga0157373_10832202 3300013100 Bacteria 682
534 Ga0157373_11468612 3300013100 Bacteria 520
535 Ga0157371_10018435 3300013102 Bacteria 5161
536 Ga0157371_10042438 3300013102 Bacteria 3242
537 Ga0157371_10055988 3300013102 Bacteria 2797
538 Ga0157371_10165197 3300013102 Bacteria 1581
539 Ga0157371_11540194 3300013102 Bacteria 519
540 Ga0157370_10045055 3300013104 Bacteria 4234
541 Ga0157370_10282438 3300013104 Bacteria 1534
542 Ga0157370_10389342 3300013104 Bacteria 1283
543 Ga0157370_10684486 3300013104 Bacteria 936
544 Ga0157370_10927128 3300013104 Bacteria 790
545 Ga0157370_11139673 3300013104 Bacteria 704
546 Ga0157369_10001226 3300013105 Bacteria 31968
547 Ga0157369_10045005 3300013105 Bacteria 4802
548 Ga0157369_10174634 3300013105 Bacteria 2262
549 Ga0157369_10177656 3300013105 Bacteria 2241
550 Ga0157369_10226639 3300013105 Bacteria 1955
551 Ga0157369_10553907 3300013105 Bacteria 1188
552 Ga0157369_10615632 3300013105 Bacteria 1120
553 Ga0157369_10884227 3300013105 Bacteria 916
554 Ga0157369_11113725 3300013105 Bacteria 807
555 Ga0157369_11332328 3300013105 Bacteria 731
556 Ga0157369_11579337 3300013105 Bacteria 667
557 Ga0157374_10007839 3300013296 Bacteria 9116
558 Ga0157374_10551488 3300013296 Bacteria 1160
559 Ga0157374_10660329 3300013296 Bacteria 1058
560 Ga0157374_11068011 3300013296 Bacteria 827
561 Ga0157374_11379621 3300013296 Bacteria 727
562 Ga0157374_12592194 3300013296 Bacteria 535
563 Ga0157374_12615690 3300013296 Bacteria 532
564 Ga0157374_12967956 3300013296 Bacteria 501
565 Ga0157378_10143210 3300013297 Bacteria 2221
566 Ga0157378_10188750 3300013297 Bacteria 1943
567 Ga0157378_10340383 3300013297 Bacteria 1463
568 Ga0157378_10874525 3300013297 Bacteria 928
569 Ga0157378_10926671 3300013297 Bacteria 903
570 Ga0157378_12965929 3300013297 Bacteria 526
571 Ga0163162_10224162 3300013306 Bacteria 2009
572 Ga0163162_10544828 3300013306 Bacteria 1289
573 Ga0163162_10595887 3300013306 Bacteria 1232
574 Ga0163162_10666633 3300013306 Bacteria 1163
575 Ga0163162_11226593 3300013306 Bacteria 851
576 Ga0163162_11237422 3300013306 Bacteria 848
577 Ga0163162_11347230 3300013306 Bacteria 811
578 Ga0163162_11666999 3300013306 Bacteria 728
579 Ga0163162_12154867 3300013306 Bacteria 640
580 Ga0163162_12432619 3300013306 Bacteria 602
581 Ga0163162_13038927 3300013306 Bacteria 539
582 Ga0157372_10023978 3300013307 Bacteria 6620
583 Ga0157372_10089347 3300013307 Bacteria 3500
584 Ga0157372_10340463 3300013307 Bacteria 1747
585 Ga0157372_10372037 3300013307 Bacteria 1665
586 Ga0157372_10472225 3300013307 Bacteria 1462
587 Ga0157372_10639515 3300013307 Bacteria 1239
588 Ga0157372_11103280 3300013307 Bacteria 918
589 Ga0157372_11261359 3300013307 Bacteria 853
590 Ga0157372_11286038 3300013307 Bacteria 844
591 Ga0157372_11845359 3300013307 Bacteria 695
592 Ga0157372_11846959 3300013307 Bacteria 695
593 Ga0157372_11938749 3300013307 Bacteria 677
594 Ga0157372_12355373 3300013307 Bacteria 611
595 Ga0157372_13386755 3300013307 Bacteria 507
596 Ga0157375_10298048 3300013308 Bacteria 1776
597 Ga0157375_10313841 3300013308 Bacteria 1732
598 Ga0157375_10445668 3300013308 Bacteria 1460
599 Ga0157375_10513284 3300013308 Bacteria 1362
600 Ga0157375_10691200 3300013308 Bacteria 1174
601 Ga0157375_11036968 3300013308 Bacteria 958
602 Ga0157375_11240915 3300013308 Bacteria 875
603 Ga0157375_11395859 3300013308 Bacteria 825
604 Ga0157375_11580698 3300013308 Bacteria 775
605 Ga0163163_10086319 3300014325 Bacteria 3147
606 Ga0163163_10134524 3300014325 Bacteria 2513
607 Ga0163163_10294750 3300014325 Bacteria 1674
608 Ga0163163_10513046 3300014325 Bacteria 1261
609 Ga0163163_11440644 3300014325 Bacteria 750
610 Ga0157380_10419005 3300014326 Bacteria 1276
611 Ga0157380_10572085 3300014326 Bacteria 1112
612 Ga0157380_11041806 3300014326 Bacteria 854
613 Ga0157380_11204456 3300014326 Bacteria 801
614 Ga0182008_10001280 3300014497 Bacteria 17261
615 Ga0182008_10063733 3300014497 Bacteria 1815
616 Ga0182008_10154693 3300014497 Bacteria 1151
617 Ga0182008_10771580 3300014497 Bacteria 555
618 Ga0157377_10099503 3300014745 Bacteria 1730
619 Ga0157377_10297683 3300014745 Bacteria 1063
620 Ga0157377_11014908 3300014745 Bacteria 629
621 Ga0157377_11740804 3300014745 Bacteria 504
622 Ga0157379_10017316 3300014968 Bacteria 6349
623 Ga0157379_10245301 3300014968 Bacteria 1625
624 Ga0157379_10580398 3300014968 Bacteria 1045
625 Ga0157379_11580780 3300014968 Bacteria 640
626 Ga0157376_10149208 3300014969 Bacteria 2107
627 Ga0157376_10176007 3300014969 Bacteria 1952
628 Ga0157376_10289769 3300014969 Bacteria 1545
629 Ga0157376_10743029 3300014969 Bacteria 990
630 Ga0157376_11141997 3300014969 Bacteria 806
631 Ga0157376_11854885 3300014969 Bacteria 639
632 Ga0182006_1239719 3300015261 Bacteria 596
633 Ga0182007_10000582 3300015262 Bacteria 21489
634 Ga0182007_10271434 3300015262 Bacteria 614
635 Ga0182005_1100806 3300015265 Bacteria 809
636 Ga0183367_1005 3300015688 Bacteria 652063
637 Ga0163161_10159234 3300017792 Bacteria 1721
638 Ga0163161_10283976 3300017792 Bacteria 1299
639 Ga0163161_10463463 3300017792 Bacteria 1026
640 Ga0163161_11057483 3300017792 Bacteria 696
641 Ga0163161_11283187 3300017792 Bacteria 636
642 Ga0184601_106011 3300019183 Bacteria 558
643 Ga0197907_10000430 3300020069 Bacteria 518
644 Ga0197907_10288082 3300020069 Bacteria 792
645 Ga0197907_10328527 3300020069 Bacteria 734
646 Ga0197907_10376985 3300020069 Bacteria 656
647 Ga0197907_11094604 3300020069 Bacteria 763
648 Ga0197907_11205039 3300020069 Bacteria 1306
649 Ga0197907_11225079 3300020069 Bacteria 531
650 Ga0206356_10944536 3300020070 Bacteria 1193
651 Ga0206356_11038323 3300020070 Bacteria 553
652 Ga0206356_11717365 3300020070 Bacteria 1159
653 Ga0206349_1677274 3300020075 Bacteria 606
654 Ga0206355_1500362 3300020076 Bacteria 1339
655 Ga0206355_1718134 3300020076 Bacteria 503
656 Ga0206351_10722143 3300020077 Bacteria 1581
657 Ga0206351_10773125 3300020077 Bacteria 599
658 Ga0206352_10254953 3300020078 Bacteria 561
659 Ga0206352_10791224 3300020078 Bacteria 570
660 Ga0206352_11198618 3300020078 Bacteria 791
661 Ga0206352_11221252 3300020078 Bacteria 829
662 Ga0206350_10374030 3300020080 Bacteria 613
663 Ga0206350_11294616 3300020080 Bacteria 1328
664 Ga0206350_11421611 3300020080 Bacteria 521
665 Ga0206354_10431806 3300020081 Bacteria 2764
666 Ga0206354_10445256 3300020081 Bacteria 654
667 Ga0206354_10750047 3300020081 Bacteria 2724
668 Ga0206354_11141536 3300020081 Bacteria 1702
669 Ga0206354_11265793 3300020081 Bacteria 763
670 Ga0206354_11381198 3300020081 Bacteria 920
671 Ga0206354_11660386 3300020081 Bacteria 608
672 Ga0206353_10158060 3300020082 Bacteria 601
673 Ga0206353_10211368 3300020082 Bacteria 684
674 Ga0206353_10224648 3300020082 Bacteria 2949
675 Ga0206353_11402443 3300020082 Bacteria 1159
676 Ga0206353_11571215 3300020082 Bacteria 659
677 Ga0206353_11776395 3300020082 Bacteria 632
678 Ga0154015_1173053 3300020610 Bacteria 596
679 Ga0154015_1285698 3300020610 Bacteria 1042
680 Ga0213873_10048000 3300021358 Bacteria 1122
681 Ga0213872_10363985 3300021361 Bacteria 591
682 Ga0213874_10109716 3300021377 Bacteria 926
683 Ga0213875_10001074 3300021388 Bacteria 19149
684 Ga0213875_10134582 3300021388 Bacteria 1156
685 Ga0213875_10180928 3300021388 Bacteria 990
686 Ga0224712_10018811 3300022467 Bacteria 2317
687 Ga0224712_10033439 3300022467 Bacteria 1882
688 Ga0224712_10038218 3300022467 Bacteria 1791
689 Ga0224712_10038848 3300022467 Bacteria 1781
690 Ga0224712_10154823 3300022467 Bacteria 1018
691 Ga0224712_10169541 3300022467 Bacteria 978
692 Ga0224712_10539998 3300022467 Bacteria 566
693 Ga0224712_10580348 3300022467 Bacteria 546
694 Ga0247551_104776 3300023552 Bacteria 550
695 Ga0247528_111965 3300023680 Bacteria 586
696 Ga0224572_1016890 3300024225 Bacteria 1400
697 Ga0224572_1039710 3300024225 Bacteria 889
698 Ga0228598_1006679 3300024227 Bacteria 2379
699 Ga0207425_1040092 3300025245 Bacteria 895
700 Ga0209759_1041554 3300025256 Bacteria 786
701 Ga0209129_1000109 3300025258 Bacteria 153068
702 Ga0209673_1075826 3300025273 Bacteria 785
703 Ga0209025_1001288 3300025294 Bacteria 34293
704 Ga0209758_1004710 3300025297 Bacteria 11130
705 Ga0207426_1010098 3300025302 Bacteria 3689
706 Ga0207426_1021647 3300025302 Bacteria 2220
707 Ga0207426_1035840 3300025302 Bacteria 1581
708 Ga0209051_1022745 3300025303 Bacteria 2629
709 Ga0207656_10002744 3300025321 Bacteria 5973
710 Ga0207656_10317020 3300025321 Bacteria 774
711 Ga0207696_1089907 3300025711 Bacteria 842
712 Ga0207713_1015813 3300025735 Bacteria 3856
713 Ga0207713_1069261 3300025735 Bacteria 1308
714 Ga0207713_1187793 3300025735 Bacteria 641
715 Ga0207713_1208068 3300025735 Bacteria 596
716 Ga0207653_10010290 3300025885 Bacteria 2917
717 Ga0207682_10434243 3300025893 Bacteria 621
718 Ga0207692_10003532 3300025898 Bacteria 6114
719 Ga0207692_10061982 3300025898 Bacteria 1940
720 Ga0207692_10283443 3300025898 Bacteria 1003
721 Ga0207692_10435207 3300025898 Bacteria 823
722 Ga0207692_11113518 3300025898 Bacteria 523
723 Ga0207710_10048418 3300025900 Bacteria 1902
724 Ga0207710_10148245 3300025900 Bacteria 1137
725 Ga0207710_10285787 3300025900 Bacteria 831
726 Ga0207688_10005845 3300025901 Bacteria 6696
727 Ga0207688_10202007 3300025901 Bacteria 1192
728 Ga0207680_10092482 3300025903 Bacteria 1927
729 Ga0207680_10990028 3300025903 Bacteria 602
730 Ga0207647_10129790 3300025904 Bacteria 1482
731 Ga0207647_10180858 3300025904 Bacteria 1225
732 Ga0207647_10337524 3300025904 Bacteria 854
733 Ga0207685_10029674 3300025905 Bacteria 1938
734 Ga0207685_10106860 3300025905 Bacteria 1206
735 Ga0207685_10128805 3300025905 Bacteria 1121
736 Ga0207699_10005247 3300025906 Bacteria 6201
737 Ga0207699_10008388 3300025906 Bacteria 5097
738 Ga0207699_10019950 3300025906 Bacteria 3584
739 Ga0207699_10052519 3300025906 Bacteria 2413
740 Ga0207699_10057858 3300025906 Bacteria 2317
741 Ga0207699_10127567 3300025906 Bacteria 1654
742 Ga0207699_11421641 3300025906 Bacteria 513
743 Ga0207645_10125468 3300025907 Bacteria 1668
744 Ga0207645_10140421 3300025907 Bacteria 1574
745 Ga0207643_10000785 3300025908 Bacteria 19366
746 Ga0207643_10097704 3300025908 Bacteria 1719
747 Ga0207705_10008895 3300025909 Bacteria 7318
748 Ga0207705_10330599 3300025909 Bacteria 1172
749 Ga0207705_10462458 3300025909 Bacteria 984
750 Ga0207705_10665820 3300025909 Bacteria 809
751 Ga0207684_10001971 3300025910 Bacteria 21203
752 Ga0207684_10033328 3300025910 Bacteria 4380
753 Ga0207684_10053609 3300025910 Bacteria 3423
754 Ga0207684_10152406 3300025910 Bacteria 1989
755 Ga0207684_10169825 3300025910 Bacteria 1880
756 Ga0207684_10190164 3300025910 Bacteria 1771
757 Ga0207684_10339361 3300025910 Bacteria 1294
758 Ga0207684_11239355 3300025910 Bacteria 616
759 Ga0207684_11326226 3300025910 Bacteria 592
760 Ga0207654_10011556 3300025911 Bacteria 4505
761 Ga0207654_11072503 3300025911 Bacteria 587
762 Ga0207707_10000257 3300025912 Bacteria 57640
763 Ga0207707_10070531 3300025912 Bacteria 3045
764 Ga0207707_10083004 3300025912 Bacteria 2798
765 Ga0207707_10085902 3300025912 Bacteria 2749
766 Ga0207707_10239879 3300025912 Bacteria 1576
767 Ga0207707_10761002 3300025912 Bacteria 809
768 Ga0207707_10961448 3300025912 Bacteria 703
769 Ga0207707_11543701 3300025912 Bacteria 525
770 Ga0207695_10204898 3300025913 Bacteria 1885
771 Ga0207695_10522574 3300025913 Bacteria 1069
772 Ga0207671_10032194 3300025914 Bacteria 3903
773 Ga0207671_10706685 3300025914 Bacteria 802
774 Ga0207693_10049363 3300025915 Bacteria 3305
775 Ga0207693_10140509 3300025915 Bacteria 1899
776 Ga0207693_10245271 3300025915 Bacteria 1406
777 Ga0207693_10880097 3300025915 Bacteria 688
778 Ga0207693_10967246 3300025915 Bacteria 651
779 Ga0207663_10004352 3300025916 Bacteria 7031
780 Ga0207663_10065057 3300025916 Bacteria 2329
781 Ga0207663_10219811 3300025916 Bacteria 1382
782 Ga0207663_10321391 3300025916 Bacteria 1163
783 Ga0207663_10899073 3300025916 Bacteria 708
784 Ga0207660_10000443 3300025917 Bacteria 27313
785 Ga0207660_10010834 3300025917 Bacteria 5925
786 Ga0207660_10032108 3300025917 Bacteria 3622
787 Ga0207660_10271016 3300025917 Bacteria 1345
788 Ga0207660_10294724 3300025917 Bacteria 1290
789 Ga0207660_10681717 3300025917 Bacteria 838
790 Ga0207660_11615416 3300025917 Bacteria 522
791 Ga0207662_10026955 3300025918 Bacteria 3317
792 Ga0207662_10088442 3300025918 Bacteria 1902
793 Ga0207657_10009895 3300025919 Bacteria 9545
794 Ga0207657_10029438 3300025919 Bacteria 4999
795 Ga0207657_10090094 3300025919 Bacteria 2560
796 Ga0207657_10104721 3300025919 Bacteria 2343
797 Ga0207657_10149661 3300025919 Bacteria 1902
798 Ga0207657_10641272 3300025919 Bacteria 827
799 Ga0207649_10007710 3300025920 Bacteria 5853
800 Ga0207649_10280483 3300025920 Bacteria 1211
801 Ga0207652_10000070 3300025921 Bacteria 109705
802 Ga0207652_10006407 3300025921 Bacteria 9495
803 Ga0207652_10013800 3300025921 Bacteria 6535
804 Ga0207652_10039314 3300025921 Bacteria 4014
805 Ga0207652_10292989 3300025921 Bacteria 1468
806 Ga0207652_10411397 3300025921 Bacteria 1220
807 Ga0207652_10412404 3300025921 Bacteria 1218
808 Ga0207652_10670105 3300025921 Bacteria 927
809 Ga0207652_11499633 3300025921 Bacteria 578
810 Ga0207652_11760923 3300025921 Bacteria 524
811 Ga0207646_10000180 3300025922 Bacteria 86389
812 Ga0207646_10003225 3300025922 Bacteria 18622
813 Ga0207646_10072175 3300025922 Bacteria 3083
814 Ga0207646_10170346 3300025922 Bacteria 1966
815 Ga0207646_10410649 3300025922 Bacteria 1223
816 Ga0207646_10639852 3300025922 Bacteria 953
817 Ga0207646_11344708 3300025922 Bacteria 623
818 Ga0207694_10263491 3300025924 Bacteria 1412
819 Ga0207694_10815868 3300025924 Bacteria 788
820 Ga0207694_11368813 3300025924 Bacteria 598
821 Ga0207650_10007339 3300025925 Bacteria 7505
822 Ga0207650_10301782 3300025925 Bacteria 1308
823 Ga0207650_10792471 3300025925 Bacteria 803
824 Ga0207659_10076357 3300025926 Bacteria 2462
825 Ga0207659_10538630 3300025926 Bacteria 991
826 Ga0207659_11045978 3300025926 Bacteria 702
827 Ga0207687_10004699 3300025927 Bacteria 9083
828 Ga0207687_10085074 3300025927 Bacteria 2294
829 Ga0207687_10145689 3300025927 Bacteria 1802
830 Ga0207687_10253750 3300025927 Bacteria 1399
831 Ga0207687_10430985 3300025927 Bacteria 1090
832 Ga0207700_10002172 3300025928 Bacteria 11238
833 Ga0207700_10004822 3300025928 Bacteria 8005
834 Ga0207700_10053681 3300025928 Bacteria 3021
835 Ga0207700_10078649 3300025928 Bacteria 2566
836 Ga0207700_10110485 3300025928 Bacteria 2211
837 Ga0207700_10138114 3300025928 Bacteria 1999
838 Ga0207700_10218242 3300025928 Bacteria 1615
839 Ga0207700_10377698 3300025928 Bacteria 1239
840 Ga0207700_10447459 3300025928 Bacteria 1138
841 Ga0207700_10631391 3300025928 Bacteria 954
842 Ga0207664_10000298 3300025929 Bacteria 37109
843 Ga0207664_10001524 3300025929 Bacteria 15198
844 Ga0207664_10001845 3300025929 Bacteria 13970
845 Ga0207664_10003186 3300025929 Bacteria 10906
846 Ga0207664_10009124 3300025929 Bacteria 6948
847 Ga0207664_10145876 3300025929 Bacteria 2007
848 Ga0207664_10178957 3300025929 Bacteria 1819
849 Ga0207664_10184829 3300025929 Bacteria 1791
850 Ga0207664_10185885 3300025929 Bacteria 1786
851 Ga0207664_10391912 3300025929 Bacteria 1234
852 Ga0207664_10432426 3300025929 Bacteria 1173
853 Ga0207664_10482268 3300025929 Bacteria 1109
854 Ga0207664_10555525 3300025929 Bacteria 1030
855 Ga0207664_10624254 3300025929 Bacteria 968
856 Ga0207664_10709886 3300025929 Bacteria 904
857 Ga0207664_10758987 3300025929 Bacteria 872
858 Ga0207644_10330883 3300025931 Bacteria 1233
859 Ga0207644_10472008 3300025931 Bacteria 1032
860 Ga0207644_10670477 3300025931 Bacteria 864
861 Ga0207644_11566601 3300025931 Bacteria 553
862 Ga0207644_11571817 3300025931 Bacteria 552
863 Ga0207690_10000219 3300025932 Bacteria 43461
864 Ga0207690_10016824 3300025932 Bacteria 4456
865 Ga0207690_10184443 3300025932 Bacteria 1573
866 Ga0207690_10916477 3300025932 Bacteria 727
867 Ga0207706_10072026 3300025933 Bacteria 3040
868 Ga0207706_10103797 3300025933 Bacteria 2501
869 Ga0207686_10070926 3300025934 Bacteria 2240
870 Ga0207686_10085700 3300025934 Bacteria 2067
871 Ga0207686_10182120 3300025934 Bacteria 1490
872 Ga0207686_10396874 3300025934 Bacteria 1050
873 Ga0207686_11003919 3300025934 Bacteria 677
874 Ga0207709_10051993 3300025935 Bacteria 2513
875 Ga0207709_10149879 3300025935 Bacteria 1614
876 Ga0207709_10260330 3300025935 Bacteria 1272
877 Ga0207709_10683302 3300025935 Bacteria 820
878 Ga0207670_10280515 3300025936 Bacteria 1298
879 Ga0207670_10404127 3300025936 Bacteria 1092
880 Ga0207669_10138738 3300025937 Bacteria 1684
881 Ga0207669_11108928 3300025937 Bacteria 668
882 Ga0207669_11368232 3300025937 Bacteria 602
883 Ga0207704_10694076 3300025938 Bacteria 842
884 Ga0207704_10800144 3300025938 Bacteria 787
885 Ga0207704_11471486 3300025938 Bacteria 584
886 Ga0207665_10000657 3300025939 Bacteria 23270
887 Ga0207665_10023462 3300025939 Bacteria 4065
888 Ga0207665_10064239 3300025939 Bacteria 2494
889 Ga0207665_10229302 3300025939 Bacteria 1364
890 Ga0207691_10006993 3300025940 Bacteria 10888
891 Ga0207691_10292907 3300025940 Bacteria 1399
892 Ga0207691_10978209 3300025940 Bacteria 707
893 Ga0207711_10247142 3300025941 Bacteria 1637
894 Ga0207711_10355742 3300025941 Bacteria 1356
895 Ga0207711_11487377 3300025941 Bacteria 620
896 Ga0207689_10006217 3300025942 Bacteria 10576
897 Ga0207689_10038661 3300025942 Bacteria 3951
898 Ga0207689_10796465 3300025942 Bacteria 798
899 Ga0207661_10000336 3300025944 Bacteria 29965
900 Ga0207661_10182423 3300025944 Bacteria 1834
901 Ga0207661_10215294 3300025944 Bacteria 1695
902 Ga0207661_10669166 3300025944 Bacteria 954
903 Ga0207661_11065429 3300025944 Bacteria 744
904 Ga0207661_11118335 3300025944 Bacteria 725
905 Ga0207679_10001066 3300025945 Bacteria 17442
906 Ga0207679_10322244 3300025945 Bacteria 1339
907 Ga0207679_10612563 3300025945 Bacteria 982
908 Ga0207679_11558178 3300025945 Bacteria 606
909 Ga0207667_10274291 3300025949 Bacteria 1724
910 Ga0207667_10426342 3300025949 Bacteria 1349
911 Ga0207667_10787716 3300025949 Bacteria 948
912 Ga0207667_11077547 3300025949 Bacteria 788
913 Ga0207667_11743916 3300025949 Bacteria 588
914 Ga0207651_10091623 3300025960 Bacteria 2226
915 Ga0207651_10212793 3300025960 Bacteria 1557
916 Ga0207712_10486292 3300025961 Bacteria 1053
917 Ga0207712_10509532 3300025961 Bacteria 1030
918 Ga0207712_10919774 3300025961 Bacteria 774
919 Ga0207668_11605737 3300025972 Bacteria 587
920 Ga0207640_10031537 3300025981 Bacteria 3276
921 Ga0207640_11383406 3300025981 Bacteria 630
922 Ga0207658_10012955 3300025986 Bacteria 5696
923 Ga0207658_10147132 3300025986 Bacteria 1915
924 Ga0207658_10928694 3300025986 Bacteria 793
925 Ga0207658_11503540 3300025986 Bacteria 616
926 Ga0207658_11610945 3300025986 Bacteria 593
927 Ga0207677_10019593 3300026023 Bacteria 4090
928 Ga0207677_10251985 3300026023 Bacteria 1434
929 Ga0207677_10592148 3300026023 Bacteria 972
930 Ga0207677_10721886 3300026023 Bacteria 886
931 Ga0207677_11523031 3300026023 Bacteria 618
932 Ga0207703_10234602 3300026035 Bacteria 1646
933 Ga0207703_10395638 3300026035 Bacteria 1281
934 Ga0207703_10852492 3300026035 Bacteria 871
935 Ga0207703_10981002 3300026035 Bacteria 810
936 Ga0207703_11790484 3300026035 Bacteria 590
937 Ga0207639_10056849 3300026041 Bacteria 3000
938 Ga0207639_11183784 3300026041 Bacteria 717
939 Ga0207678_10001106 3300026067 Bacteria 24706
940 Ga0207678_10070312 3300026067 Bacteria 3001
941 Ga0207678_10085601 3300026067 Bacteria 2694
942 Ga0207678_10880553 3300026067 Bacteria 791
943 Ga0207678_11050358 3300026067 Bacteria 721
944 Ga0207708_10009638 3300026075 Bacteria 7162
945 Ga0207708_10102554 3300026075 Bacteria 2215
946 Ga0207708_10516949 3300026075 Bacteria 1003
947 Ga0207708_12014051 3300026075 Bacteria 505
948 Ga0207702_10041776 3300026078 Bacteria 3845
949 Ga0207702_10373661 3300026078 Bacteria 1369
950 Ga0207702_10569475 3300026078 Bacteria 1109
951 Ga0207702_10738716 3300026078 Bacteria 971
952 Ga0207702_10940286 3300026078 Bacteria 857
953 Ga0207702_11012825 3300026078 Bacteria 824
954 Ga0207702_11229571 3300026078 Bacteria 743
955 Ga0207641_10138939 3300026088 Bacteria 2189
956 Ga0207641_10464178 3300026088 Bacteria 1225
957 Ga0207641_10666830 3300026088 Bacteria 1022
958 Ga0207641_11228017 3300026088 Bacteria 749
959 Ga0207641_12122744 3300026088 Bacteria 562
960 Ga0207648_10100745 3300026089 Bacteria 2531
961 Ga0207648_10902268 3300026089 Bacteria 826
962 Ga0207648_11117755 3300026089 Bacteria 739
963 Ga0207648_11203373 3300026089 Bacteria 712
964 Ga0207648_11784803 3300026089 Bacteria 577
965 Ga0207676_10000648 3300026095 Bacteria 27886
966 Ga0207676_10998509 3300026095 Bacteria 824
967 Ga0207676_11928961 3300026095 Bacteria 589
968 Ga0207676_11935980 3300026095 Bacteria 588
969 Ga0207674_10011766 3300026116 Bacteria 9818
970 Ga0207674_10132094 3300026116 Bacteria 2459
971 Ga0207674_10627488 3300026116 Bacteria 1038
972 Ga0207674_11452112 3300026116 Bacteria 655
973 Ga0207675_100021849 3300026118 Bacteria 5957
974 Ga0207675_100359039 3300026118 Bacteria 1429
975 Ga0207675_100397646 3300026118 Bacteria 1357
976 Ga0207675_100700662 3300026118 Bacteria 1022
977 Ga0207675_101174281 3300026118 Bacteria 788
978 Ga0207683_10001393 3300026121 Bacteria 21815
979 Ga0207683_10028516 3300026121 Bacteria 4827
980 Ga0207683_10608142 3300026121 Bacteria 1012
981 Ga0207683_11309190 3300026121 Bacteria 671
982 Ga0207698_10607498 3300026142 Bacteria 1079
983 Ga0207698_10714364 3300026142 Bacteria 998
984 Ga0209179_1125150 3300027512 Bacteria 574
985 Ga0207428_10003435 3300027907 Bacteria 15399
986 Ga0207428_10264295 3300027907 Bacteria 1281
987 Ga0268266_10132557 3300028379 Bacteria 2230
988 Ga0268266_10244148 3300028379 Bacteria 1658
989 Ga0268266_11156271 3300028379 Bacteria 748
990 Ga0268265_10109619 3300028380 Bacteria 2251
991 Ga0268265_10769483 3300028380 Bacteria 936
992 Ga0268264_10346751 3300028381 Bacteria 1412
993 Ga0268264_12003302 3300028381 Bacteria 588
994 Ga0265337_1000015 3300028556 Bacteria 80871
995 Ga0265326_10017844 3300028558 Bacteria 2044
996 Ga0265319_1001246 3300028563 Bacteria 15553
997 Ga0265334_10000373 3300028573 Bacteria 23956
998 Ga0265322_10012472 3300028654 Bacteria 2459
999 Ga0265336_10004317 3300028666 Bacteria 5394
1000 Ga0307517_10008703 3300028786 Bacteria 14521
1001 Ga0307517_10576044 3300028786 Bacteria 558
1002 Ga0265338_10003873 3300028800 Bacteria 20722
1003 Ga0265338_10007479 3300028800 Bacteria 13536
1004 Ga0265338_10014640 3300028800 Bacteria 8701
1005 Ga0265338_11166024 3300028800 Bacteria 517
1006 Ga0311003_101840 3300029282 Bacteria 545
1007 Ga0265324_10002740 3300029957 Bacteria 8757
1008 Ga0268256_1018028 3300030500 Bacteria 1973
1009 Ga0307511_10136404 3300030521 Bacteria 1459
1010 Ga0307511_10142565 3300030521 Bacteria 1402
1011 Ga0307511_10276720 3300030521 Bacteria 780
1012 Ga0265762_1085621 3300030760 Bacteria 681
1013 Ga0265762_1087115 3300030760 Bacteria 676
1014 Ga0265766_1022293 3300030863 Bacteria 528
1015 Ga0265770_1039554 3300030878 Bacteria 820
1016 Ga0265764_111591 3300030882 Bacteria 571
1017 Ga0265761_110884 3300030889 Bacteria 532
1018 Ga0265768_109562 3300030963 Bacteria 614
1019 Ga0265771_1002017 3300031010 Bacteria 1042
1020 Ga0265771_1013123 3300031010 Bacteria 640
1021 Ga0265774_103887 3300031011 Bacteria 605
1022 Ga0265760_10006434 3300031090 Bacteria 3360
1023 Ga0265760_10069611 3300031090 Bacteria 1078
1024 Ga0265760_10113006 3300031090 Bacteria 866
1025 Ga0265330_10212907 3300031235 Bacteria 816
1026 Ga0265332_10001675 3300031238 Bacteria 12103
1027 Ga0265332_10058380 3300031238 Bacteria 1651
1028 Ga0265332_10474348 3300031238 Bacteria 518
1029 Ga0265320_10001898 3300031240 Bacteria 14748
1030 Ga0265320_10041316 3300031240 Bacteria 2293
1031 Ga0265325_10015321 3300031241 Bacteria 4312
1032 Ga0265325_10060617 3300031241 Bacteria 1921
1033 Ga0265340_10003540 3300031247 Bacteria 8788
1034 Ga0265340_10004519 3300031247 Bacteria 7758
1035 Ga0265340_10082220 3300031247 Bacteria 1515
1036 Ga0265339_10000762 3300031249 Bacteria 24924
1037 Ga0265339_10014234 3300031249 Bacteria 4799
1038 Ga0265331_10028427 3300031250 Bacteria 2796
1039 Ga0265331_10246008 3300031250 Bacteria 802
1040 Ga0265316_10006862 3300031344 Bacteria 10811
1041 Ga0265316_10154230 3300031344 Bacteria 1719
1042 Ga0307509_10009190 3300031507 Bacteria 12410
1043 Ga0307408_100053565 3300031548 Bacteria 2914
1044 Ga0307408_100437564 3300031548 Bacteria 1131
1045 Ga0307408_101472446 3300031548 Bacteria 643
1046 Ga0310117_121880 3300031592 Bacteria 636
1047 Ga0265313_10090959 3300031595 Bacteria 1370
1048 Ga0310107_133548 3300031615 Bacteria 562
1049 Ga0307508_10042905 3300031616 Bacteria 4054
1050 Ga0307508_10049088 3300031616 Bacteria 3758
1051 Ga0307508_10436673 3300031616 Bacteria 901
1052 Ga0307514_10175696 3300031649 Bacteria 1390
1053 Ga0310111_125385 3300031667 Bacteria 704
1054 Ga0310111_140077 3300031667 Bacteria 525
1055 Ga0265314_10005562 3300031711 Bacteria 11331
1056 Ga0265314_10016664 3300031711 Bacteria 5794
1057 Ga0265314_10048633 3300031711 Bacteria 2974
1058 Ga0265342_10006989 3300031712 Bacteria 8336
1059 Ga0265342_10033693 3300031712 Bacteria 3146
1060 Ga0265342_10036408 3300031712 Bacteria 3007
1061 Ga0307516_10056359 3300031730 Bacteria 3832
1062 Ga0307516_10068332 3300031730 Bacteria 3422
1063 Ga0307405_10583633 3300031731 Bacteria 909
1064 Ga0316044_123521 3300031810 Bacteria 619
1065 Ga0307413_10154461 3300031824 Bacteria 1603
1066 Ga0307413_10239047 3300031824 Bacteria 1340
1067 Ga0307413_10428832 3300031824 Bacteria 1043
1068 Ga0307413_10783646 3300031824 Bacteria 800
1069 Ga0307410_10018684 3300031852 Bacteria 4194
1070 Ga0307410_10041314 3300031852 Bacteria 3040
1071 Ga0307410_10461216 3300031852 Bacteria 1038
1072 Ga0307410_10517336 3300031852 Bacteria 984
1073 Ga0307410_10585933 3300031852 Bacteria 929
1074 Ga0307406_10061971 3300031901 Bacteria 2418
1075 Ga0307406_10091864 3300031901 Bacteria 2045
1076 Ga0307406_10326390 3300031901 Bacteria 1189
1077 Ga0307407_10270552 3300031903 Bacteria 1172
1078 Ga0307407_10272626 3300031903 Bacteria 1168
1079 Ga0307412_11657115 3300031911 Bacteria 585
1080 Ga0307409_100251429 3300031995 Bacteria 1616
1081 Ga0307409_100316575 3300031995 Bacteria 1458
1082 Ga0307409_100568728 3300031995 Bacteria 1115
1083 Ga0307409_100586607 3300031995 Bacteria 1099
1084 Ga0307409_100767361 3300031995 Bacteria 969
1085 Ga0307409_100778866 3300031995 Bacteria 962
1086 Ga0307409_100997431 3300031995 Bacteria 855
1087 Ga0307409_102105659 3300031995 Bacteria 594
1088 Ga0307416_100035506 3300032002 Bacteria 3808
1089 Ga0307416_100229736 3300032002 Bacteria 1787
1090 Ga0307416_100482859 3300032002 Bacteria 1299
1091 Ga0307416_101073035 3300032002 Bacteria 909
1092 Ga0307416_101966629 3300032002 Bacteria 687
1093 Ga0307416_103054440 3300032002 Bacteria 560
1094 Ga0307414_10157413 3300032004 Bacteria 1800
1095 Ga0307411_10046422 3300032005 Bacteria 2800
1096 Ga0307411_11889445 3300032005 Bacteria 556
1097 Ga0307411_12002959 3300032005 Bacteria 540
1098 Ga0307507_10000013 3300033179 Bacteria 242708
1099 Ga0307507_10331584 3300033179 Bacteria 908
1100 Ga0307507_10620089 3300033179 Bacteria 555
1101 Ga0307510_10144369 3300033180 Bacteria 2016
1102 Ga0316214_1000482 3300033545 Bacteria 4073
1103 Ga0316214_1003948 3300033545 Bacteria 1892
1104 Ga0316212_1003331 3300033547 Bacteria 2316
1105 Ga0373930_0109559 3300034816 Bacteria 663
1106 Ga0373948_0041310 3300034817 Bacteria 966
1107 Ga0373950_0090347 3300034818 Bacteria 650
1108 Ga0373958_0006992 3300034819 Bacteria 1781
1109 Ga0373959_0005926 3300034820 Bacteria 2014
1110 Ga0373926_0024276 3300035083 Bacteria 2110
1111 Ga0373926_0038845 3300035083 Bacteria 1696
1112 Ga0373929_0074912 3300035085 Bacteria 815
1113 Ga0373934_0006708 3300035086 Bacteria 4277
1114 Ga0373934_0016099 3300035086 Bacteria 2840
1115 Ga0373934_0020722 3300035086 Bacteria 2528
1116 Ga0373934_0065600 3300035086 Bacteria 1449
1117 Ga0373934_0077028 3300035086 Bacteria 1337
1118 Ga0373934_0326016 3300035086 Bacteria 638
1119 Ga0373940_0162500 3300035088 Bacteria 717
1120 Ga0373944_0054981 3300035089 Bacteria 1263
1121 Ga0373944_0266351 3300035089 Bacteria 636
1122 Ga0373951_0015579 3300035091 Bacteria 1713
1123 Ga0373951_0162768 3300035091 Bacteria 632
1124 Ga0373952_0255440 3300035092 Bacteria 532
1125 Ga0373923_0014721 3300035111 Bacteria 2943
1126 Ga0373923_0188582 3300035111 Bacteria 949
1127 Ga0373923_0222494 3300035111 Bacteria 877
1128 Ga0373923_0423120 3300035111 Bacteria 643
1129 Ga0373932_0349125 3300035112 Bacteria 562
1130 Ga0373936_0001178 3300035113 Bacteria 9397
1131 Ga0373936_0063067 3300035113 Bacteria 1516
1132 Ga0373936_0199673 3300035113 Bacteria 882
1133 Ga0373936_0311106 3300035113 Bacteria 712
1134 Ga0373941_0100267 3300035115 Bacteria 1007
1135 Ga0373941_0324149 3300035115 Bacteria 620
1136 Ga0373945_0157682 3300035116 Bacteria 923
1137 Ga0373945_0167148 3300035116 Bacteria 899
1138 Ga0373945_0296159 3300035116 Bacteria 692
1139 Ga0373945_0423426 3300035116 Bacteria 586
1140 Ga0373945_0465205 3300035116 Bacteria 560
1141 Ga0373953_0001772 3300035117 Bacteria 6373
1142 Ga0373953_0043953 3300035117 Bacteria 1785
1143 Ga0373953_0079348 3300035117 Bacteria 1362
1144 Ga0373953_0421401 3300035117 Bacteria 588
1145 Ga0373954_0027830 3300035118 Bacteria 2597
1146 Ga0373954_0048362 3300035118 Bacteria 1992
1147 Ga0373954_0097558 3300035118 Bacteria 1416
1148 Ga0373954_0194369 3300035118 Bacteria 996
1149 Ga0373956_0000844 3300035119 Bacteria 12743
1150 Ga0373956_0031323 3300035119 Bacteria 2330
1151 Ga0373956_0034924 3300035119 Bacteria 2215
1152 Ga0373956_0050919 3300035119 Bacteria 1860
1153 Ga0373957_0000011 3300035120 Bacteria 47051
1154 Ga0373957_0037568 3300035120 Bacteria 1809
1155 Ga0373957_0101528 3300035120 Bacteria 1152
1156 Ga0373957_0171550 3300035120 Bacteria 896
1157 Ga0373957_0200007 3300035120 Bacteria 832
1158 Ga0373960_0091762 3300035121 Bacteria 972
1159 Ga0373960_0137114 3300035121 Bacteria 825
1160 Ga0373943_0081332 3300035170 Bacteria 1661
1161 Ga0373943_0151010 3300035170 Bacteria 1258
1162 Ga0373943_0221704 3300035170 Bacteria 1053
1163 Ga0373943_0535043 3300035170 Bacteria 687
1164 Ga0373946_0066712 3300035171 Bacteria 1543
1165 Ga0373946_0071884 3300035171 Bacteria 1496
1166 Ga0373946_0289756 3300035171 Bacteria 807
1167 Ga0373946_0410365 3300035171 Bacteria 685
1168 Ga0373955_0000060 3300035172 Bacteria 42697
1169 Ga0373955_0014764 3300035172 Bacteria 3809
1170 Ga0373955_0140143 3300035172 Bacteria 1417
1171 Ga0373955_0325507 3300035172 Bacteria 929
1172 Ga0373955_0486184 3300035172 Bacteria 753
1173 Ga0373942_0047227 3300035207 Bacteria 1195
1174 Ga0373942_0272647 3300035207 Bacteria 580
1175 Ga0373924_0000672 3300035410 Bacteria 10628
1176 Ga0373924_0019378 3300035410 Bacteria 2636
1177 Ga0373924_0021188 3300035410 Bacteria 2534
1178 Ga0373924_0066473 3300035410 Bacteria 1515
1179 Ga0373924_0585618 3300035410 Bacteria 503
1180 Ga0373931_0091826 3300035691 Bacteria 1693
1181 Ga0373931_0098523 3300035691 Bacteria 1641
1182 Ga0373931_0142313 3300035691 Bacteria 1390
1183 Ga0373931_0836462 3300035691 Bacteria 615
1184 Ga0373935_0004616 3300035692 Bacteria 8095
1185 Ga0373935_0016967 3300035692 Bacteria 4409
1186 Ga0373935_0305980 3300035692 Bacteria 1124
1187 Ga0373935_0338594 3300035692 Bacteria 1071
1188 Ga0373927_0024730 3300035695 Bacteria 3924
1189 Ga0373927_0108817 3300035695 Bacteria 1805
1190 Ga0373927_0157259 3300035695 Bacteria 1489
1191 Ga0373927_0579698 3300035695 Bacteria 741
1192 Ga0373933_0014325 3300035724 Bacteria 4409
1193 Ga0373933_0016385 3300035724 Bacteria 4143
1194 Ga0373933_0133630 3300035724 Bacteria 1561
1195 Ga0373933_0248337 3300035724 Bacteria 1145
1196 Ga0373933_0463129 3300035724 Bacteria 829
1197 Ga0373947_0061727 3300035725 Bacteria 2278
1198 Ga0373947_0093287 3300035725 Bacteria 1881
1199 Ga0373947_0336826 3300035725 Bacteria 1010
1200 Ga0373947_0528508 3300035725 Bacteria 802
1201 Ga0310104_20196 3300036242 Bacteria 502
1202 Ga0373937_0000110 3300036401 Bacteria 77832
1203 Ga0373937_0030844 3300036401 Bacteria 4855
1204 Ga0373937_0037069 3300036401 Bacteria 4444
1205 Ga0373937_0269908 3300036401 Bacteria 1605
1206 Ga0373937_0271984 3300036401 Bacteria 1599
1207 Ga0373937_0366169 3300036401 Bacteria 1366
1208 Ga0373937_0808561 3300036401 Bacteria 885
1209 Ga0265778_024529 3300036457 Bacteria 758
1210 Ga0373925_0000540 3300037068 Bacteria 37332
1211 Ga0373925_0005130 3300037068 Bacteria 9813
1212 Ga0373925_0019497 3300037068 Bacteria 4934
1213 Ga0373925_0108373 3300037068 Bacteria 2143
1214 Ga0373925_0188311 3300037068 Bacteria 1636
1215 Ga0373925_0357750 3300037068 Bacteria 1186
1216 Ga0373925_0466959 3300037068 Bacteria 1034
1217 Ga0373925_1196327 3300037068 Bacteria 624
1218 Ga0395900_0186888 3300037418 Bacteria 2103
1219 Ga0395898_0408457 3300037466 Bacteria 1294
1220 Ga0395898_0550320 3300037466 Bacteria 1096
1221 Ga0395898_0955662 3300037466 Bacteria 794
1222 Ga0395905_0441340 3300037471 Bacteria 1199
1223 Ga0436364_0081229 3300037853 Bacteria 3392
1224 Ga0436364_0098049 3300037853 Bacteria 1373
1225 Ga0436364_0243023 3300037853 Bacteria 1549
1226 Ga0436364_0479741 3300037853 Bacteria 5755
1227 Ga0436364_0718628 3300037853 Bacteria 574
1228 Ga0436364_1098280 3300037853 Bacteria 1651
1229 Ga0436364_1174043 3300037853 Bacteria 9620
1230 Ga0436364_1263484 3300037853 Bacteria 906
1231 Ga0436364_1272150 3300037853 Bacteria 787
1232 Ga0436364_1381350 3300037853 Bacteria 44948
1233 Ga0436364_1527719 3300037853 Bacteria 1958
1234 Ga0395901_0368107 3300038443 Bacteria 1481
1235 Ga0395901_1522668 3300038443 Bacteria 624
1236 Ga0436365_0207903 3300039437 Bacteria 1140
1237 Ga0436365_0456440 3300039437 Bacteria 871
1238 Ga0436360_0519033 3300039438 Bacteria 806
1239 Ga0436360_0800473 3300039438 Bacteria 814
1240 Ga0436361_0083233 3300039447 Bacteria 533
1241 Ga0436361_0085148 3300039447 Bacteria 503
1242 Ga0436361_0592735 3300039447 Bacteria 564
1243 Ga0436361_0739507 3300039447 Bacteria 1466
1244 Ga0436361_1089145 3300039447 Bacteria 639
1245 Ga0436363_0129145 3300039450 Bacteria 1069
1246 Ga0436363_0216045 3300039450 Bacteria 2348
1247 Ga0436363_0287803 3300039450 Bacteria 617
1248 Ga0436363_1231403 3300039450 Bacteria 1275
1249 Ga0436363_1481670 3300039450 Bacteria 589
1250 Ga0436363_1578490 3300039450 Bacteria 1361
1251 Ga0436363_1583483 3300039450 Bacteria 943
1252 Ga0436362_0324614 3300039453 Bacteria 676
1253 Ga0436362_0452318 3300039453 Bacteria 664
1254 Ga0436362_1221077 3300039453 Bacteria 686
1255 Ga0436362_1298483 3300039453 Bacteria 752
1256 Ga0436362_1301744 3300039453 Bacteria 957
1257 Ga0439436_0000524 3300041404 Bacteria 10046
1258 Ga0439436_0006412 3300041404 Bacteria 3612
1259 Ga0439436_0017389 3300041404 Bacteria 2151
1260 Ga0439436_0080170 3300041404 Bacteria 908
1261 Ga0439436_0194399 3300041404 Bacteria 579
1262 Ga0439438_041185 3300041405 Bacteria 1198
1263 Ga0439439_0010113 3300041406 Bacteria 2253
1264 Ga0439439_0068353 3300041406 Bacteria 949
1265 Ga0439439_0082194 3300041406 Bacteria 872
1266 Ga0439461_0001303 3300041410 Bacteria 3832
1267 Ga0439466_0006342 3300041411 Bacteria 4501
1268 Ga0439466_0166992 3300041411 Bacteria 672
1269 Ga0451789_0026674 3300041443 Bacteria 782
1270 Ga0451793_1135109 3300041452 Bacteria 1895
1271 Ga0451797_1112463 3300041453 Bacteria 550
1272 Ga0451805_068977 3300041461 Bacteria 503
1273 Ga0451804_0477614 3300041463 Bacteria 869
1274 Ga0451839_0225412 3300041496 Bacteria 575
1275 Ga0451839_0572827 3300041496 Bacteria 869
1276 Ga0451841_0311264 3300041498 Bacteria 923
1277 Ga0451845_0003149 3300041501 Bacteria 638
1278 Ga0451843_1278596 3300041509 Bacteria 769
1279 Ga0451853_3555550 3300041512 Bacteria 856
1280 Ga0451853_3556725 3300041512 Bacteria 759
1281 Ga0439431_0021633 3300041997 Bacteria 1545
1282 Ga0439433_0001892 3300041999 Bacteria 4378
1283 Ga0439442_016934 3300042002 Bacteria 1503
1284 Ga0439442_071616 3300042002 Bacteria 738
1285 Ga0439448_0001950 3300042005 Bacteria 5504
1286 Ga0439448_0076419 3300042005 Bacteria 1120
1287 Ga0439448_0319083 3300042005 Bacteria 553
1288 Ga0439432_091108 3300042006 Bacteria 917
1289 Ga0439449_0011654 3300042007 Bacteria 3306
1290 Ga0439449_0019562 3300042007 Bacteria 2538
1291 Ga0439449_0032403 3300042007 Bacteria 1948
1292 Ga0439449_0055906 3300042007 Bacteria 1457
1293 Ga0439449_0298946 3300042007 Bacteria 607
1294 Ga0439452_002242 3300042010 Bacteria 7252
1295 Ga0439455_0009521 3300042012 Bacteria 2111
1296 Ga0439455_0076718 3300042012 Bacteria 904
1297 Ga0439456_043895 3300042013 Bacteria 972
1298 Ga0439457_001024 3300042014 Bacteria 8432
1299 Ga0439457_001614 3300042014 Bacteria 6720
1300 Ga0439457_004463 3300042014 Bacteria 3638
1301 Ga0439462_0004876 3300042015 Bacteria 3292
1302 Ga0439462_0051833 3300042015 Bacteria 1103
1303 Ga0439462_0111836 3300042015 Bacteria 756
1304 Ga0439462_0113673 3300042015 Bacteria 750
1305 Ga0439463_179444 3300042016 Bacteria 549
1306 Ga0450911_011083 3300042115 Bacteria 1238
1307 Ga0450914_065157 3300042118 Bacteria 500
1308 Ga0450919_000085 3300042121 Bacteria 9080
1309 Ga0450920_039778 3300042122 Bacteria 936
1310 Ga0450890_071893 3300042127 Bacteria 554
1311 Ga0450894_000035 3300042131 Bacteria 19542
1312 Ga0450896_002593 3300042133 Bacteria 2349
1313 Ga0450898_078105 3300042134 Bacteria 670
1314 Ga0450899_000138 3300042135 Bacteria 6978
1315 Ga0450902_032410 3300042137 Bacteria 881
1316 Ga0450903_000067 3300042138 Bacteria 20805
1317 Ga0450906_002005 3300042145 Bacteria 4446
1318 Ga0450907_018490 3300042146 Bacteria 1166
1319 Ga0450907_064767 3300042146 Bacteria 632
1320 Ga0439446_0020862 3300042156 Bacteria 1849
1321 Ga0439458_0005318 3300042157 Bacteria 2896
1322 Ga0439458_0050659 3300042157 Bacteria 1024
1323 Ga0450908_008452 3300042184 Bacteria 1929
1324 Ga0450909_002630 3300042185 Bacteria 2545
1325 Ga0439434_0065435 3300042435 Bacteria 1140
1326 Ga0439459_0004735 3300042438 Bacteria 2203
1327 Ga0439459_0042938 3300042438 Bacteria 967
1328 Ga0439459_0176540 3300042438 Bacteria 572
1329 Ga0439464_0169427 3300042439 Bacteria 688
1330 Ga0450918_016419 3300042531 Bacteria 1286
1331 Ga0450901_006724 3300042533 Bacteria 1185
1332 Ga0466969_0001305 3300044656 Bacteria 13440
1333 Ga0466969_0006155 3300044656 Bacteria 6389
1334 Ga0466972_0031457 3300044658 Bacteria 2609
1335 Ga0466972_0252403 3300044658 Bacteria 824
1336 Ga0466966_0001016 3300044684 Bacteria 17896
1337 Ga0466966_0002663 3300044684 Bacteria 11700
1338 Ga0466966_0009462 3300044684 Bacteria 6455
1339 Ga0466966_0012013 3300044684 Bacteria 5739
1340 Ga0466966_0019210 3300044684 Bacteria 4497
1341 Ga0466966_0213373 3300044684 Bacteria 1166
1342 Ga0466966_0255491 3300044684 Bacteria 1055
1343 Ga0466966_0271706 3300044684 Bacteria 1020
1344 Ga0466961_0003691 3300044693 Bacteria 9556
1345 Ga0466961_0006277 3300044693 Bacteria 7549
1346 Ga0466961_0007449 3300044693 Bacteria 6967
1347 Ga0466961_0018930 3300044693 Bacteria 4430
1348 Ga0466961_0023269 3300044693 Bacteria 3986
1349 Ga0466961_0032959 3300044693 Bacteria 3329
1350 Ga0466961_0094041 3300044693 Bacteria 1891
1351 Ga0466961_0160266 3300044693 Bacteria 1402
1352 Ga0466961_0806876 3300044693 Bacteria 560
1353 Ga0466963_0028158 3300044694 Bacteria 3605
1354 Ga0466963_0035906 3300044694 Bacteria 3230
1355 Ga0466963_0060997 3300044694 Bacteria 2520
1356 Ga0466963_0069338 3300044694 Bacteria 2370
1357 Ga0466963_0406126 3300044694 Bacteria 961
1358 Ga0466963_0553184 3300044694 Bacteria 813
1359 Ga0466963_0890380 3300044694 Bacteria 627
1360 Ga0466963_0942863 3300044694 Bacteria 608
1361 Ga0466963_1101807 3300044694 Bacteria 558
1362 Ga0466964_0112830 3300044706 Bacteria 1215
1363 Ga0466964_0562917 3300044706 Bacteria 620
1364 Ga0466964_0668844 3300044706 Bacteria 576
1365 Ga0466971_0000730 3300044719 Bacteria 13160
1366 Ga0466971_0005155 3300044719 Bacteria 5656
1367 Ga0466971_0005390 3300044719 Bacteria 5549
1368 Ga0466971_0011377 3300044719 Bacteria 3897
1369 Ga0466971_0031674 3300044719 Bacteria 2368
1370 Ga0466968_0315931 3300044735 Bacteria 754
1371 Ga0466968_0375624 3300044735 Bacteria 694
1372 Ga0466968_0496860 3300044735 Bacteria 607
1373 Ga0466970_0002624 3300044765 Bacteria 8668
1374 Ga0466970_0062185 3300044765 Bacteria 2001
1375 Ga0466970_0310853 3300044765 Bacteria 890
1376 Ga0466970_0354333 3300044765 Bacteria 833
1377 Ga0466970_0410163 3300044765 Bacteria 774
1378 Ga0466970_0611728 3300044765 Bacteria 632
1379 Ga0466970_0720331 3300044765 Bacteria 582
1380 Ga0466957_0008107 3300044842 Bacteria 5960
1381 Ga0466957_0228107 3300044842 Bacteria 1232
1382 Ga0466957_0629040 3300044842 Bacteria 753
1383 Ga0466957_0664502 3300044842 Bacteria 733
1384 Ga0466957_0737721 3300044842 Bacteria 697
1385 Ga0466960_0028068 3300044901 Bacteria 2573
1386 Ga0466959_0000507 3300045049 Bacteria 22618
1387 Ga0466959_0007332 3300045049 Bacteria 7729
1388 Ga0466959_0011863 3300045049 Bacteria 6275
1389 Ga0466959_0036329 3300045049 Bacteria 3640
1390 Ga0466959_0048336 3300045049 Bacteria 3126
1391 Ga0466959_0060117 3300045049 Bacteria 2765
1392 Ga0466959_0141200 3300045049 Bacteria 1702
1393 Ga0466959_0355270 3300045049 Bacteria 999
1394 Ga0466959_0524937 3300045049 Bacteria 799
1395 Ga0451576_0227272 3300045051 Bacteria 1948
1396 Ga0466958_0004494 3300045836 Bacteria 7366
1397 Ga0466958_0010466 3300045836 Bacteria 5196
1398 Ga0466958_0028068 3300045836 Bacteria 3334
1399 Ga0466958_0034351 3300045836 Bacteria 3025
1400 Ga0466958_0192525 3300045836 Bacteria 1296
1401 Ga0466967_0007787 3300045976 Bacteria 7778
1402 Ga0466967_0101495 3300045976 Bacteria 2630
1403 Ga0466967_0525765 3300045976 Bacteria 1163
1404 Ga0466967_0628538 3300045976 Bacteria 1061
1405 Ga0466967_0665844 3300045976 Bacteria 1030
1406 Ga0466967_0725842 3300045976 Bacteria 985
1407 Ga0466967_1271460 3300045976 Bacteria 733
1408 Ga0466967_1419345 3300045976 Bacteria 691
1409 Ga0466967_1642962 3300045976 Bacteria 640
1410 Ga0466967_1916326 3300045976 Bacteria 589
1411 Ga0466967_2527919 3300045976 Bacteria 508
1412 Ga0495627_107445 3300046453 Bacteria 793
1413 Ga0495592_0000049 3300046454 Bacteria 113704
1414 Ga0495592_0011895 3300046454 Bacteria 6596
1415 Ga0495592_0041774 3300046454 Bacteria 3435
1416 Ga0495592_0127909 3300046454 Bacteria 1779
1417 Ga0495592_0149061 3300046454 Bacteria 1619
1418 Ga0495592_0183636 3300046454 Bacteria 1423
1419 Ga0495592_0485817 3300046454 Bacteria 768
1420 Ga0495603_0010028 3300046455 Bacteria 5731
1421 Ga0495603_0024116 3300046455 Bacteria 3679
1422 Ga0495603_0026170 3300046455 Bacteria 3525
1423 Ga0495603_0047280 3300046455 Bacteria 2563
1424 Ga0495603_0049435 3300046455 Bacteria 2503
1425 Ga0495603_0072963 3300046455 Bacteria 2016
1426 Ga0495629_0009686 3300046459 Bacteria 7038
1427 Ga0495629_0010230 3300046459 Bacteria 6833
1428 Ga0495629_0102424 3300046459 Bacteria 1997
1429 Ga0495629_0102605 3300046459 Bacteria 1995
1430 Ga0495629_0105404 3300046459 Bacteria 1966
1431 Ga0495629_0261125 3300046459 Bacteria 1190
1432 Ga0495629_0695599 3300046459 Bacteria 675
1433 Ga0495638_0049888 3300046460 Bacteria 2615
1434 Ga0495638_0118662 3300046460 Bacteria 1565
1435 Ga0495638_0251119 3300046460 Bacteria 975
1436 Ga0495641_0008332 3300046461 Bacteria 6337
1437 Ga0495641_0013098 3300046461 Bacteria 4583
1438 Ga0495641_0027940 3300046461 Bacteria 2735
1439 Ga0495651_0000007 3300046462 Bacteria 158577
1440 Ga0495651_0000079 3300046462 Bacteria 71581
1441 Ga0495651_0034997 3300046462 Bacteria 3913
1442 Ga0495651_0044140 3300046462 Bacteria 3455
1443 Ga0495651_0047991 3300046462 Bacteria 3298
1444 Ga0495651_0105233 3300046462 Bacteria 2093
1445 Ga0495651_0235360 3300046462 Bacteria 1259
1446 Ga0495651_0408707 3300046462 Bacteria 884
1447 Ga0495651_0446451 3300046462 Bacteria 836
1448 Ga0495651_0452362 3300046462 Bacteria 829
1449 Ga0495651_0552354 3300046462 Bacteria 731
1450 Ga0495653_0046082 3300046463 Bacteria 3376
1451 Ga0495653_0046578 3300046463 Bacteria 3357
1452 Ga0495653_0066610 3300046463 Bacteria 2708
1453 Ga0495653_0090526 3300046463 Bacteria 2238
1454 Ga0495653_0239989 3300046463 Bacteria 1208
1455 Ga0495653_0247654 3300046463 Bacteria 1184
1456 Ga0495653_0352192 3300046463 Bacteria 946
1457 Ga0495653_0769772 3300046463 Bacteria 580
1458 Ga0495580_0015098 3300046472 Bacteria 5844
1459 Ga0495580_0154805 3300046472 Bacteria 1587
1460 Ga0495580_0169758 3300046472 Bacteria 1508
1461 Ga0495580_0303167 3300046472 Bacteria 1087
1462 Ga0495582_0002158 3300046473 Bacteria 11007
1463 Ga0495582_0005432 3300046473 Bacteria 7111
1464 Ga0495582_0085008 3300046473 Bacteria 1759
1465 Ga0495582_0319741 3300046473 Bacteria 893
1466 Ga0495639_0010968 3300046475 Bacteria 3902
1467 Ga0495639_0081464 3300046475 Bacteria 1508
1468 Ga0495639_0143354 3300046475 Bacteria 1149
1469 Ga0495662_0002989 3300046476 Bacteria 8533
1470 Ga0495662_0008805 3300046476 Bacteria 4962
1471 Ga0495662_0020179 3300046476 Bacteria 3223
1472 Ga0495662_0020438 3300046476 Bacteria 3202
1473 Ga0495662_0035526 3300046476 Bacteria 2404
1474 Ga0495662_0179222 3300046476 Bacteria 1044
1475 Ga0495664_0003530 3300046477 Bacteria 8528
1476 Ga0495664_0020885 3300046477 Bacteria 3780
1477 Ga0495664_0091512 3300046477 Bacteria 1828
1478 Ga0495664_0117975 3300046477 Bacteria 1604
1479 Ga0495664_0134953 3300046477 Bacteria 1495
1480 Ga0495664_0194739 3300046477 Bacteria 1228
1481 Ga0495664_0422355 3300046477 Bacteria 800
1482 Ga0495585_0013695 3300046492 Bacteria 4740
1483 Ga0495585_0042588 3300046492 Bacteria 2542
1484 Ga0495585_0059459 3300046492 Bacteria 2106
1485 Ga0495585_0202801 3300046492 Bacteria 1009
1486 Ga0495594_0012305 3300046499 Bacteria 4458
1487 Ga0495594_0013501 3300046499 Bacteria 4267
1488 Ga0495594_0019227 3300046499 Bacteria 3628
1489 Ga0495594_0055542 3300046499 Bacteria 2183
1490 Ga0495594_0140826 3300046499 Bacteria 1368
1491 Ga0495594_0471433 3300046499 Bacteria 714
1492 Ga0495594_0783896 3300046499 Bacteria 537
1493 Ga0495607_0042933 3300046501 Bacteria 2677
1494 Ga0495608_0000076 3300046511 Bacteria 74854
1495 Ga0495608_0009966 3300046511 Bacteria 6634
1496 Ga0495608_0040008 3300046511 Bacteria 3141
1497 Ga0495608_0067448 3300046511 Bacteria 2340
1498 Ga0495608_0157894 3300046511 Bacteria 1443
1499 Ga0495608_0208708 3300046511 Bacteria 1228
1500 Ga0495608_0447957 3300046511 Bacteria 786
1501 Ga0495608_0627494 3300046511 Bacteria 643
1502 Ga0495618_0007856 3300046514 Bacteria 6457
1503 Ga0495618_0022729 3300046514 Bacteria 3873
1504 Ga0495618_0106122 3300046514 Bacteria 1798
1505 Ga0495618_0255728 3300046514 Bacteria 1098
1506 Ga0495618_0387054 3300046514 Bacteria 857
1507 Ga0495618_0569619 3300046514 Bacteria 676
1508 Ga0495620_0110578 3300046515 Bacteria 1089
1509 Ga0495628_0001215 3300046516 Bacteria 23569
1510 Ga0495628_0005605 3300046516 Bacteria 10993
1511 Ga0495628_0010042 3300046516 Bacteria 8055
1512 Ga0495628_0021216 3300046516 Bacteria 5347
1513 Ga0495628_0103086 3300046516 Bacteria 2200
1514 Ga0495628_0137701 3300046516 Bacteria 1864
1515 Ga0495628_0156972 3300046516 Bacteria 1730
1516 Ga0495628_0584191 3300046516 Bacteria 799
1517 Ga0495630_0008315 3300046517 Bacteria 7449
1518 Ga0495630_0025191 3300046517 Bacteria 4397
1519 Ga0495630_0032183 3300046517 Bacteria 3906
1520 Ga0495630_0217395 3300046517 Bacteria 1459
1521 Ga0495630_0307930 3300046517 Bacteria 1210
1522 Ga0495630_0844286 3300046517 Bacteria 698
1523 Ga0495630_1402619 3300046517 Bacteria 525
1524 Ga0495631_0139636 3300046518 Bacteria 1040
1525 Ga0495631_0219806 3300046518 Bacteria 811
1526 Ga0495631_0260618 3300046518 Bacteria 739
1527 Ga0495637_0105712 3300046520 Bacteria 1096
1528 Ga0495643_0211792 3300046522 Bacteria 924
1529 Ga0495666_0003384 3300046526 Bacteria 8041
1530 Ga0495666_0058823 3300046526 Bacteria 1838
1531 Ga0495666_0129992 3300046526 Bacteria 1177
1532 Ga0495666_0149655 3300046526 Bacteria 1085
1533 Ga0495666_0313549 3300046526 Bacteria 708
1534 Ga0495666_0374085 3300046526 Bacteria 641
1535 Ga0495652_0000168 3300046529 Bacteria 74913
1536 Ga0495652_0003588 3300046529 Bacteria 15221
1537 Ga0495652_0040527 3300046529 Bacteria 4025
1538 Ga0495652_0059422 3300046529 Bacteria 3234
1539 Ga0495652_0083184 3300046529 Bacteria 2635
1540 Ga0495652_0146356 3300046529 Bacteria 1851
1541 Ga0495652_0273460 3300046529 Bacteria 1240
1542 Ga0495652_0352690 3300046529 Bacteria 1053
1543 Ga0495652_0399634 3300046529 Bacteria 973
1544 Ga0495652_0559306 3300046529 Bacteria 785
1545 Ga0495652_0597782 3300046529 Bacteria 753
1546 Ga0495665_0002190 3300046531 Bacteria 10572
1547 Ga0495665_0004007 3300046531 Bacteria 7943
1548 Ga0495665_0055065 3300046531 Bacteria 2101
1549 Ga0495665_0173646 3300046531 Bacteria 1121
1550 Ga0495665_0634612 3300046531 Bacteria 532
1551 Ga0495640_0017135 3300046533 Bacteria 5406
1552 Ga0495640_0029098 3300046533 Bacteria 3970
1553 Ga0495640_0054496 3300046533 Bacteria 2738
1554 Ga0495640_0054695 3300046533 Bacteria 2732
1555 Ga0495640_0206494 3300046533 Bacteria 1243
1556 Ga0495586_0005311 3300046535 Bacteria 6889
1557 Ga0495586_0008958 3300046535 Bacteria 5327
1558 Ga0495586_0030648 3300046535 Bacteria 2879
1559 Ga0495586_0053081 3300046535 Bacteria 2195
1560 Ga0495586_0082387 3300046535 Bacteria 1769
1561 Ga0495586_0257410 3300046535 Bacteria 996
1562 Ga0495586_0355569 3300046535 Bacteria 841
1563 Ga0495586_0472462 3300046535 Bacteria 723
1564 Ga0495586_0881121 3300046535 Bacteria 516
1565 Ga0495587_0006741 3300046536 Bacteria 7476
1566 Ga0495587_0025931 3300046536 Bacteria 3577
1567 Ga0495587_0077239 3300046536 Bacteria 1933
1568 Ga0495587_0109041 3300046536 Bacteria 1591
1569 Ga0495587_0210367 3300046536 Bacteria 1098
1570 Ga0495587_0742135 3300046536 Bacteria 537
1571 Ga0495645_0013097 3300046543 Bacteria 5860
1572 Ga0495645_0022878 3300046543 Bacteria 4523
1573 Ga0495645_0059107 3300046543 Bacteria 2780
1574 Ga0495645_0368563 3300046543 Bacteria 921
1575 Ga0495645_0384113 3300046543 Bacteria 898
1576 Ga0495645_0395575 3300046543 Bacteria 881
1577 Ga0495622_0022827 3300046557 Bacteria 2916
1578 Ga0495622_0170550 3300046557 Bacteria 978
1579 Ga0495622_0443017 3300046557 Bacteria 557
1580 Ga0495667_0000072 3300046559 Bacteria 75080
1581 Ga0495667_0015012 3300046559 Bacteria 5230
1582 Ga0495667_0018766 3300046559 Bacteria 4668
1583 Ga0495667_0029452 3300046559 Bacteria 3696
1584 Ga0495667_0041818 3300046559 Bacteria 3038
1585 Ga0495667_0068317 3300046559 Bacteria 2320
1586 Ga0495667_0121316 3300046559 Bacteria 1687
1587 Ga0495656_0193205 3300046615 Bacteria 1006
1588 Ga0495656_0509219 3300046615 Bacteria 639
1589 Ga0495634_0020030 3300046642 Bacteria 4746
1590 Ga0495634_0026954 3300046642 Bacteria 4004
1591 Ga0495634_0027278 3300046642 Bacteria 3974
1592 Ga0495634_0033758 3300046642 Bacteria 3514
1593 Ga0495634_0179627 3300046642 Bacteria 1325
1594 Ga0495634_0189762 3300046642 Bacteria 1282
1595 Ga0495611_0033087 3300046648 Bacteria 2281
1596 Ga0495625_0222544 3300046660 Bacteria 1236
1597 Ga0495635_0002665 3300046663 Bacteria 12199
1598 Ga0495635_0020890 3300046663 Bacteria 4561
1599 Ga0495635_0112703 3300046663 Bacteria 1857
1600 Ga0495635_0124402 3300046663 Bacteria 1758
1601 Ga0495635_0180933 3300046663 Bacteria 1433
1602 Ga0495635_0204784 3300046663 Bacteria 1337
1603 Ga0495635_0962288 3300046663 Bacteria 544
1604 Ga0495661_0170131 3300046665 Bacteria 1163
1605 Ga0495588_0067287 3300046674 Bacteria 1859
1606 Ga0495588_0078571 3300046674 Bacteria 1721
1607 Ga0495588_0451689 3300046674 Bacteria 674
1608 Ga0495588_0645247 3300046674 Bacteria 554
1609 Ga0495588_0684305 3300046674 Bacteria 536
1610 Ga0495657_0000424 3300046675 Bacteria 39370
1611 Ga0495657_0002584 3300046675 Bacteria 15156
1612 Ga0495657_0020458 3300046675 Bacteria 4755
1613 Ga0495657_0028016 3300046675 Bacteria 3966
1614 Ga0495657_0042001 3300046675 Bacteria 3125
1615 Ga0495657_0046215 3300046675 Bacteria 2949
1616 Ga0495657_0115442 3300046675 Bacteria 1696
1617 Ga0495657_0314532 3300046675 Bacteria 931
1618 Ga0495657_0320965 3300046675 Bacteria 920
1619 Ga0495599_0000062 3300046678 Bacteria 74940
1620 Ga0495599_0021197 3300046678 Bacteria 4053
1621 Ga0495599_0022810 3300046678 Bacteria 3909
1622 Ga0495599_0026841 3300046678 Bacteria 3610
1623 Ga0495599_0035257 3300046678 Bacteria 3140
1624 Ga0495599_0074779 3300046678 Bacteria 2115
1625 Ga0495599_0276693 3300046678 Bacteria 1017
1626 Ga0495599_0869618 3300046678 Bacteria 512
1627 Ga0495623_0000777 3300046679 Bacteria 21383
1628 Ga0495623_0003796 3300046679 Bacteria 9951
1629 Ga0495623_0048459 3300046679 Bacteria 2694
1630 Ga0495623_0059079 3300046679 Bacteria 2409
1631 Ga0495623_0061932 3300046679 Bacteria 2345
1632 Ga0495623_0083855 3300046679 Bacteria 1967
1633 Ga0495623_0104972 3300046679 Bacteria 1718
1634 Ga0495623_0290995 3300046679 Bacteria 905
1635 Ga0495623_0379528 3300046679 Bacteria 764
1636 Ga0495623_0435910 3300046679 Bacteria 700
1637 Ga0495646_0007097 3300046680 Bacteria 7118
1638 Ga0495646_0059352 3300046680 Bacteria 2284
1639 Ga0495646_0078693 3300046680 Bacteria 1926
1640 Ga0495646_0158769 3300046680 Bacteria 1253
1641 Ga0495646_0188431 3300046680 Bacteria 1129
1642 Ga0495646_0193027 3300046680 Bacteria 1112
1643 Ga0495646_0196394 3300046680 Bacteria 1100
1644 Ga0495646_0357357 3300046680 Bacteria 764
1645 Ga0495647_0356750 3300046681 Bacteria 666
1646 Ga0495647_0569406 3300046681 Bacteria 530
1647 Ga0495658_0069348 3300046683 Bacteria 2043
1648 Ga0495658_0157765 3300046683 Bacteria 1397
1649 Ga0495658_0415133 3300046683 Bacteria 858
1650 Ga0495613_0009407 3300046689 Bacteria 7249
1651 Ga0495613_0011441 3300046689 Bacteria 6596
1652 Ga0495613_0034690 3300046689 Bacteria 3746
1653 Ga0495613_0084477 3300046689 Bacteria 2304
1654 Ga0495613_0129270 3300046689 Bacteria 1809
1655 Ga0495613_0138981 3300046689 Bacteria 1736
1656 Ga0495613_0237480 3300046689 Bacteria 1275
1657 Ga0495613_0645089 3300046689 Bacteria 701
1658 Ga0495624_0006967 3300046690 Bacteria 7972
1659 Ga0495624_0006974 3300046690 Bacteria 7970
1660 Ga0495624_0017325 3300046690 Bacteria 4838
1661 Ga0495624_0027762 3300046690 Bacteria 3703
1662 Ga0495624_0146888 3300046690 Bacteria 1443
1663 Ga0495624_0563981 3300046690 Bacteria 680
1664 Ga0495670_0013056 3300046691 Bacteria 4084
1665 Ga0495670_0020026 3300046691 Bacteria 3297
1666 Ga0495671_0161446 3300046692 Bacteria 1090
1667 Ga0495649_0402218 3300046694 Bacteria 687
1668 Ga0495589_0221108 3300046794 Bacteria 889
1669 Ga0495589_0335128 3300046794 Bacteria 698
1670 Ga0495589_0521254 3300046794 Bacteria 542
1671 Ga0495600_0008443 3300046809 Bacteria 6327
1672 Ga0495600_0010085 3300046809 Bacteria 5856
1673 Ga0495600_0024163 3300046809 Bacteria 3910
1674 Ga0495600_0043077 3300046809 Bacteria 2943
1675 Ga0495600_0045437 3300046809 Bacteria 2865
1676 Ga0495600_0236626 3300046809 Bacteria 1164
1677 Ga0495600_0244884 3300046809 Bacteria 1141
1678 Ga0495600_0280645 3300046809 Bacteria 1054
1679 Ga0495660_0322596 3300046810 Bacteria 693
1680 Ga0495581_0010953 3300047315 Bacteria 5240
1681 Ga0495581_0027064 3300047315 Bacteria 3325
1682 Ga0495581_0121582 3300047315 Bacteria 1519
1683 Ga0495581_0428420 3300047315 Bacteria 771
1684 Ga0495604_0000062 3300047317 Bacteria 93264
1685 Ga0495604_0011814 3300047317 Bacteria 6946
1686 Ga0495604_0022655 3300047317 Bacteria 5015
1687 Ga0495604_0062529 3300047317 Bacteria 2843
1688 Ga0495604_0175014 3300047317 Bacteria 1505
1689 Ga0495604_0216151 3300047317 Bacteria 1322
1690 Ga0495604_0242504 3300047317 Bacteria 1231
1691 Ga0495604_0544271 3300047317 Bacteria 749
1692 Ga0495636_0085601 3300047318 Bacteria 1362
1693 Ga0495636_0256394 3300047318 Bacteria 810
1694 Ga0495674_0007071 3300047319 Bacteria 10735
1695 Ga0495674_0028482 3300047319 Bacteria 5091
1696 Ga0495674_0113536 3300047319 Bacteria 2294
1697 Ga0495674_0134153 3300047319 Bacteria 2084
1698 Ga0495674_0174539 3300047319 Bacteria 1792
1699 Ga0495674_0302329 3300047319 Bacteria 1306
1700 Ga0495674_0379116 3300047319 Bacteria 1144
1701 Ga0495676_0029254 3300047321 Bacteria 4692
1702 Ga0495676_0038718 3300047321 Bacteria 3957
1703 Ga0495676_0090636 3300047321 Bacteria 2287
1704 Ga0495676_0509018 3300047321 Bacteria 789
1705 Ga0495676_0811775 3300047321 Bacteria 602
1706 Ga0495676_0838847 3300047321 Bacteria 590
1707 Ga0495676_0959964 3300047321 Bacteria 546
1708 Ga0495680_0000101 3300047322 Bacteria 78550
1709 Ga0495680_0012972 3300047322 Bacteria 7296
1710 Ga0495680_0030458 3300047322 Bacteria 4405
1711 Ga0495680_0066746 3300047322 Bacteria 2752
1712 Ga0495680_0158901 3300047322 Bacteria 1642
1713 Ga0495680_0357554 3300047322 Bacteria 1015
1714 Ga0495680_0453200 3300047322 Bacteria 877
1715 Ga0495683_0127665 3300047323 Bacteria 1202
1716 Ga0495683_0226451 3300047323 Bacteria 831
1717 Ga0495687_014847 3300047443 Bacteria 3982
1718 Ga0495687_044422 3300047443 Bacteria 1931
1719 Ga0495675_0001304 3300047444 Bacteria 15104
1720 Ga0495675_0009960 3300047444 Bacteria 5927
1721 Ga0495675_0021462 3300047444 Bacteria 4112
1722 Ga0495675_0022793 3300047444 Bacteria 3992
1723 Ga0495675_0028408 3300047444 Bacteria 3565
1724 Ga0495675_0033104 3300047444 Bacteria 3298
1725 Ga0495675_0064305 3300047444 Bacteria 2320
1726 Ga0495675_0423473 3300047444 Bacteria 773
1727 Ga0495685_005390 3300047447 Bacteria 4174
1728 Ga0495685_022256 3300047447 Bacteria 2181
1729 Ga0495685_138526 3300047447 Bacteria 793
1730 Ga0495685_211284 3300047447 Bacteria 620
1731 Ga0495681_0211603 3300047470 Bacteria 781
1732 Ga0495684_0010492 3300047471 Bacteria 7165
1733 Ga0495684_0022686 3300047471 Bacteria 4828
1734 Ga0495684_0100367 3300047471 Bacteria 2188
1735 Ga0495684_0168641 3300047471 Bacteria 1629
1736 Ga0495684_0391701 3300047471 Bacteria 977
1737 Ga0495684_0412100 3300047471 Bacteria 946
1738 Ga0495686_0024806 3300047472 Bacteria 3935
1739 Ga0495593_0005748 3300047673 Bacteria 7320
1740 Ga0495593_0008680 3300047673 Bacteria 5907
1741 Ga0495593_0019207 3300047673 Bacteria 3833
1742 Ga0495593_0112896 3300047673 Bacteria 1386
1743 Ga0495602_0000115 3300048088 Bacteria 75982
1744 Ga0495602_0013494 3300048088 Bacteria 8348
1745 Ga0495602_0078195 3300048088 Bacteria 2794
1746 Ga0495602_0085778 3300048088 Bacteria 2630
1747 Ga0495602_0169551 3300048088 Bacteria 1695
1748 Ga0495602_0636795 3300048088 Bacteria 729
1749 Ga0495602_0648191 3300048088 Bacteria 721
1750 Ga0495602_0779261 3300048088 Bacteria 643
1751 Ga0495614_0016031 3300048089 Bacteria 3263
1752 Ga0495614_0075784 3300048089 Bacteria 1454
1753 Ga0495614_0106237 3300048089 Bacteria 1230
1754 Ga0495614_0165911 3300048089 Bacteria 989
1755 Ga0495614_0395590 3300048089 Bacteria 649
1756 Ga0495626_0395030 3300048091 Bacteria 535
1757 Ga0496100_0225359 3300048903 Bacteria 1377
1758 Ga0496100_0267539 3300048903 Bacteria 1270
1759 Ga0496100_0418829 3300048903 Bacteria 1022
1760 Ga0496100_0498592 3300048903 Bacteria 938
1761 Ga0496101_0133559 3300048904 Bacteria 1886
1762 Ga0496101_0253562 3300048904 Bacteria 1371
1763 Ga0496101_0552835 3300048904 Bacteria 910
1764 Ga0496101_0977712 3300048904 Bacteria 666
1765 Ga0496102_0008136 3300048905 Bacteria 8974
1766 Ga0496102_0144707 3300048905 Bacteria 2230
1767 Ga0496102_0190191 3300048905 Bacteria 1934
1768 Ga0496102_0666327 3300048905 Bacteria 963
1769 Ga0496102_0755743 3300048905 Bacteria 895
1770 Ga0496102_0947438 3300048905 Bacteria 782
1771 Ga0496102_1210177 3300048905 Bacteria 675
1772 Ga0496103_0058025 3300048906 Bacteria 2404
1773 Ga0496103_0171518 3300048906 Bacteria 1393
1774 Ga0496103_0545441 3300048906 Bacteria 740
1775 Ga0496103_0954846 3300048906 Bacteria 535
1776 Ga0496104_0193546 3300048907 Bacteria 1945
1777 Ga0496104_0256480 3300048907 Bacteria 1661
1778 Ga0496104_0268139 3300048907 Bacteria 1620
1779 Ga0496104_0307286 3300048907 Bacteria 1498
1780 Ga0496104_1876195 3300048907 Bacteria 501
1781 Ga0496105_0001951 3300048908 Bacteria 14812
1782 Ga0496105_0067234 3300048908 Bacteria 2959
1783 Ga0496105_0685997 3300048908 Bacteria 787
1784 Ga0496105_1059263 3300048908 Bacteria 604
1785 Ga0496106_0044619 3300048909 Bacteria 3328
1786 Ga0496106_0058655 3300048909 Bacteria 2914
1787 Ga0496106_0059467 3300048909 Bacteria 2895
1788 Ga0496106_0131596 3300048909 Bacteria 1962
1789 Ga0496106_0718939 3300048909 Bacteria 795
1790 Ga0496106_0842165 3300048909 Bacteria 726
1791 Ga0496107_0153111 3300048910 Bacteria 1706
1792 Ga0496107_0176672 3300048910 Bacteria 1585
1793 Ga0496107_0294675 3300048910 Bacteria 1207
1794 Ga0496108_0016852 3300048911 Bacteria 5971
1795 Ga0496108_0046337 3300048911 Bacteria 3632
1796 Ga0496108_0071716 3300048911 Bacteria 2923
1797 Ga0496108_1121815 3300048911 Bacteria 667
1798 Ga0496108_1381098 3300048911 Bacteria 590
1799 Ga0496109_0014763 3300048912 Bacteria 6796
1800 Ga0496109_0078823 3300048912 Bacteria 3033
1801 Ga0496109_0106641 3300048912 Bacteria 2602
1802 Ga0496109_0418089 3300048912 Bacteria 1266
1803 Ga0496109_0923171 3300048912 Bacteria 811
1804 Ga0496109_1261090 3300048912 Bacteria 675
1805 Ga0496109_1489189 3300048912 Bacteria 612
1806 Ga0496110_0130544 3300048913 Bacteria 2268
1807 Ga0496110_0256284 3300048913 Bacteria 1592
1808 Ga0496110_0452662 3300048913 Bacteria 1170
1809 Ga0496110_0915618 3300048913 Bacteria 783
1810 Ga0496111_0000966 3300048914 Bacteria 15698
1811 Ga0496111_0047485 3300048914 Bacteria 3092
1812 Ga0496111_0638406 3300048914 Bacteria 777
1813 Ga0496111_1110594 3300048914 Bacteria 563
1814 Ga0496112_0029297 3300048915 Bacteria 5323
1815 Ga0496112_0201674 3300048915 Bacteria 1948
1816 Ga0496112_0668870 3300048915 Bacteria 967
1817 Ga0496112_1346837 3300048915 Bacteria 629
1818 Ga0496112_1394456 3300048915 Bacteria 615
1819 Ga0496112_1901542 3300048915 Bacteria 506
1820 Ga0496113_0103401 3300048916 Bacteria 2209
1821 Ga0496113_0246203 3300048916 Bacteria 1427
1822 Ga0496113_0412533 3300048916 Bacteria 1084
1823 Ga0496113_0470773 3300048916 Bacteria 1009
1824 Ga0496113_1002278 3300048916 Bacteria 658
1825 Ga0496114_0237928 3300048917 Bacteria 1600
1826 Ga0496114_0337413 3300048917 Bacteria 1332
1827 Ga0496114_0685415 3300048917 Bacteria 899
1828 Ga0496114_0866278 3300048917 Bacteria 784
1829 Ga0496114_1531513 3300048917 Bacteria 555
1830 Ga0496115_0030212 3300048918 Bacteria 4261
1831 Ga0496115_0143568 3300048918 Bacteria 1969
1832 Ga0496115_0441847 3300048918 Bacteria 1052
1833 Ga0496115_0589125 3300048918 Bacteria 885
1834 Ga0496126_0021509 3300048929 Bacteria 6299
1835 Ga0496126_0044968 3300048929 Bacteria 4061
1836 Ga0496126_0810372 3300048929 Bacteria 717
1837 Ga0496126_0976717 3300048929 Bacteria 637
1838 Ga0501306_082899 3300049127 Bacteria 555
1839 Ga0501291_064155 3300049514 Bacteria 698
1840 Ga0501311_084530 3300049527 Bacteria 544
1841 Ga0501312_040992 3300049528 Bacteria 757
1842 Ga0501315_082529 3300049531 Bacteria 548
1843 Ga0501317_035088 3300049533 Bacteria 745
1844 Ga0501318_044439 3300049534 Bacteria 644
1845 Ga0501031_0002572 3300049568 Bacteria 11555
1846 Ga0501031_0085553 3300049568 Bacteria 2056
1847 Ga0501031_0196816 3300049568 Bacteria 1315
1848 Ga0501031_0342624 3300049568 Bacteria 967
1849 Ga0501031_0721815 3300049568 Bacteria 639
1850 Ga0501032_0001212 3300049569 Bacteria 20635
1851 Ga0501032_0004014 3300049569 Bacteria 11159
1852 Ga0501032_0061569 3300049569 Bacteria 2515
1853 Ga0501032_0083428 3300049569 Bacteria 2125
1854 Ga0501032_0216319 3300049569 Bacteria 1248
1855 Ga0501032_0292527 3300049569 Bacteria 1054
1856 Ga0501032_0731608 3300049569 Bacteria 626
1857 Ga0501033_0008061 3300049570 Bacteria 8158
1858 Ga0501033_0038694 3300049570 Bacteria 3563
1859 Ga0501033_0043629 3300049570 Bacteria 3339
1860 Ga0501033_0102595 3300049570 Bacteria 2086
1861 Ga0501033_0121268 3300049570 Bacteria 1897
1862 Ga0501033_0487639 3300049570 Bacteria 853
1863 Ga0501033_0608994 3300049570 Bacteria 748
1864 Ga0501033_1028924 3300049570 Bacteria 550
1865 Ga0501034_0006278 3300049571 Bacteria 12789
1866 Ga0501034_0035629 3300049571 Bacteria 5044
1867 Ga0501034_0092435 3300049571 Bacteria 3022
1868 Ga0501034_0135532 3300049571 Bacteria 2443
1869 Ga0501034_0204269 3300049571 Bacteria 1932
1870 Ga0501034_0770472 3300049571 Bacteria 856
1871 Ga0501036_0008586 3300049572 Bacteria 8379
1872 Ga0501036_0026259 3300049572 Bacteria 4914
1873 Ga0501036_0070822 3300049572 Bacteria 2948
1874 Ga0501036_0136997 3300049572 Bacteria 2066
1875 Ga0501036_0287623 3300049572 Bacteria 1375
1876 Ga0501036_0404226 3300049572 Bacteria 1139
1877 Ga0501036_0636340 3300049572 Bacteria 883
1878 Ga0501036_0771568 3300049572 Bacteria 792
1879 Ga0501036_1290684 3300049572 Bacteria 593
1880 Ga0501037_0000836 3300049573 Bacteria 23004
1881 Ga0501037_0028438 3300049573 Bacteria 4129
1882 Ga0501037_0038085 3300049573 Bacteria 3544
1883 Ga0501037_0047762 3300049573 Bacteria 3136
1884 Ga0501038_0012780 3300049574 Bacteria 7668
1885 Ga0501038_0038303 3300049574 Bacteria 4199
1886 Ga0501038_0098123 3300049574 Bacteria 2443
1887 Ga0501038_0202701 3300049574 Bacteria 1591
1888 Ga0501038_0381674 3300049574 Bacteria 1093
1889 Ga0501038_0432279 3300049574 Bacteria 1014
1890 Ga0501039_0007687 3300049575 Bacteria 8228
1891 Ga0501039_0186535 3300049575 Bacteria 1631
1892 Ga0501039_0356373 3300049575 Bacteria 1149
1893 Ga0501039_0373550 3300049575 Bacteria 1120
1894 Ga0501039_0409181 3300049575 Bacteria 1065
1895 Ga0501039_0720933 3300049575 Bacteria 779
1896 Ga0501039_0774360 3300049575 Bacteria 749
1897 Ga0501040_0007931 3300049576 Bacteria 6886
1898 Ga0501040_0029885 3300049576 Bacteria 3678
1899 Ga0501040_0057922 3300049576 Bacteria 2661
1900 Ga0501041_0001518 3300049577 Bacteria 12874
1901 Ga0501041_0254296 3300049577 Bacteria 1104
1902 Ga0501042_0015097 3300049578 Bacteria 5281
1903 Ga0501042_0121418 3300049578 Bacteria 1881
1904 Ga0501042_0140483 3300049578 Bacteria 1741
1905 Ga0501042_0312857 3300049578 Bacteria 1134
1906 Ga0501043_0005580 3300049579 Bacteria 10135
1907 Ga0501043_0032328 3300049579 Bacteria 4113
1908 Ga0501043_0062990 3300049579 Bacteria 2912
1909 Ga0501043_0176885 3300049579 Bacteria 1663
1910 Ga0501043_0252718 3300049579 Bacteria 1357
1911 Ga0501043_0314179 3300049579 Bacteria 1195
1912 Ga0501043_0412595 3300049579 Bacteria 1019
1913 Ga0501046_0037516 3300049580 Bacteria 3893
1914 Ga0501046_0119453 3300049580 Bacteria 2007
1915 Ga0501046_0143575 3300049580 Bacteria 1804
1916 Ga0501046_0494625 3300049580 Bacteria 876
1917 Ga0501047_0000072 3300049581 Bacteria 126542
1918 Ga0501047_0001607 3300049581 Bacteria 22028
1919 Ga0501047_0070941 3300049581 Bacteria 3353
1920 Ga0501047_0152655 3300049581 Bacteria 2184
1921 Ga0501047_0169702 3300049581 Bacteria 2051
1922 Ga0501047_0384844 3300049581 Bacteria 1237
1923 Ga0501048_0011519 3300049582 Bacteria 6593
1924 Ga0501048_0015295 3300049582 Bacteria 5666
1925 Ga0501048_0037211 3300049582 Bacteria 3494
1926 Ga0501048_0704370 3300049582 Bacteria 725
1927 Ga0501067_0013763 3300049583 Bacteria 4479
1928 Ga0501068_0003236 3300049584 Bacteria 8730
1929 Ga0501068_0333682 3300049584 Bacteria 973
1930 Ga0501068_0493369 3300049584 Bacteria 794
1931 Ga0501069_0017860 3300049585 Bacteria 3825
1932 Ga0501069_0031481 3300049585 Bacteria 2917
1933 Ga0501069_0305289 3300049585 Bacteria 934
1934 Ga0501070_0005040 3300049586 Bacteria 11267
1935 Ga0501070_0008482 3300049586 Bacteria 8684
1936 Ga0501070_0009153 3300049586 Bacteria 8375
1937 Ga0501070_0012340 3300049586 Bacteria 7208
1938 Ga0501070_0012975 3300049586 Bacteria 7023
1939 Ga0501070_0031412 3300049586 Bacteria 4450
1940 Ga0501070_0845307 3300049586 Bacteria 716
1941 Ga0501070_1474102 3300049586 Bacteria 515
1942 Ga0501071_0006687 3300049587 Bacteria 7492
1943 Ga0501071_0205182 3300049587 Bacteria 1481
1944 Ga0501071_0244047 3300049587 Bacteria 1355
1945 Ga0501071_0689739 3300049587 Bacteria 786
1946 Ga0501072_0001898 3300049588 Bacteria 15570
1947 Ga0501072_0267605 3300049588 Bacteria 1360
1948 Ga0501072_0333566 3300049588 Bacteria 1205
1949 Ga0501073_0009415 3300049589 Bacteria 7213
1950 Ga0501073_0015567 3300049589 Bacteria 5517
1951 Ga0501073_0771727 3300049589 Bacteria 663
1952 Ga0501074_0000607 3300049590 Bacteria 22272
1953 Ga0501074_0006705 3300049590 Bacteria 8310
1954 Ga0501074_0016000 3300049590 Bacteria 5452
1955 Ga0501074_0076631 3300049590 Bacteria 2400
1956 Ga0501074_0080253 3300049590 Bacteria 2341
1957 Ga0501075_0011003 3300049591 Bacteria 6384
1958 Ga0501075_0020072 3300049591 Bacteria 4854
1959 Ga0501076_0003333 3300049592 Bacteria 11268
1960 Ga0501076_0035235 3300049592 Bacteria 3916
1961 Ga0501076_0424529 3300049592 Bacteria 1094
1962 Ga0501076_0549399 3300049592 Bacteria 952
1963 Ga0501076_0644736 3300049592 Bacteria 874
1964 Ga0501077_0019671 3300049593 Bacteria 4271
1965 Ga0501077_0023052 3300049593 Bacteria 3948
1966 Ga0501235_008627 3300049669 Bacteria 2225
1967 Ga0501251_022715 3300049681 Bacteria 845
1968 Ga0501261_034512 3300049690 Bacteria 777
1969 Ga0501079_0000029 3300049741 Bacteria 60538
1970 Ga0501079_0007167 3300049741 Bacteria 8417
1971 Ga0501079_0328774 3300049741 Bacteria 1197
1972 Ga0501080_0006601 3300049742 Bacteria 10427
1973 Ga0501080_0013816 3300049742 Bacteria 7434
1974 Ga0501080_0121371 3300049742 Bacteria 2421
1975 Ga0501080_0193663 3300049742 Bacteria 1867
1976 Ga0501080_0639037 3300049742 Bacteria 942
1977 Ga0501080_1383399 3300049742 Bacteria 601
1978 Ga0501080_1407600 3300049742 Bacteria 595
1979 Ga0501081_0076315 3300049743 Bacteria 2340
1980 Ga0501083_0383782 3300049744 Bacteria 914
1981 Ga0501282_001694 3300049778 Bacteria 2435
1982 Ga0501035_0005086 3300049822 Bacteria 12462
1983 Ga0501035_0012487 3300049822 Bacteria 7847
1984 Ga0501035_0024124 3300049822 Bacteria 5579
1985 Ga0501035_0111057 3300049822 Bacteria 2403
1986 Ga0501035_0132132 3300049822 Bacteria 2175
1987 Ga0501035_0298983 3300049822 Bacteria 1356
1988 Ga0501035_0479587 3300049822 Bacteria 1026
1989 Ga0501044_0005927 3300049823 Bacteria 13541
1990 Ga0501044_0007860 3300049823 Bacteria 11729
1991 Ga0501044_0050036 3300049823 Bacteria 4313
1992 Ga0501044_0059401 3300049823 Bacteria 3918
1993 Ga0501044_0065905 3300049823 Bacteria 3693
1994 Ga0501044_0091036 3300049823 Bacteria 3076
1995 Ga0501044_0092812 3300049823 Bacteria 3044
1996 Ga0501044_0203538 3300049823 Bacteria 1937
1997 Ga0501044_0210357 3300049823 Bacteria 1899
1998 Ga0501044_0237979 3300049823 Bacteria 1765
1999 Ga0501044_0777924 3300049823 Bacteria 838
2000 Ga0501045_0014996 3300049824 Bacteria 5499
2001 Ga0501045_0037572 3300049824 Bacteria 3520
2002 Ga0501045_0348642 3300049824 Bacteria 1102
2003 Ga0501045_0553357 3300049824 Bacteria 853
2004 Ga0501045_0801738 3300049824 Bacteria 693
2005 nmdc:mga03683_331178_c1 3300050489 Bacteria 718
2006 nmdc:mga03n38_71279_c1 3300050490 Bacteria 1609
2007 nmdc:mga0yw44_371395_c1 3300050492 Bacteria 965
2008 nmdc:mga05p37_1302285_c1 3300050507 Bacteria 741
2009 nmdc:mga05p37_1677414_c1 3300050507 Bacteria 621
2010 nmdc:mga05p37_2012723_c1 3300050507 Bacteria 546
2011 nmdc:mga05p37_425422_c1 3300050507 Unclassified 1544
2012 nmdc:mga05p37_4279_c1 3300050507 Bacteria 16672
2013 nmdc:mga05p37_728152_c1 3300050507 Bacteria 1097
2014 nmdc:mga09592_21197_c1 3300050508 Bacteria 5354
2015 nmdc:mga09592_326452_c1 3300050508 Bacteria 1329
2016 nmdc:mga08y16_142507_c1 3300050511 Bacteria 2491
2017 nmdc:mga08y16_52073_c1 3300050511 Bacteria 4284
2018 nmdc:mga08y16_735505_c1 3300050511 Bacteria 984
2019 nmdc:mga0n895_1080559_c1 3300050512 Bacteria 780
2020 nmdc:mga0n895_1231098_c1 3300050512 Bacteria 722
2021 nmdc:mga0n895_149115_c1 3300050512 Bacteria 2368
2022 nmdc:mga0n895_347695_c1 3300050512 Bacteria 1502
2023 nmdc:mga0n895_63544_c1 3300050512 Bacteria 3651
2024 nmdc:mga0n895_7764_c1 3300050512 Bacteria 9243
2025 nmdc:mga0rr50_103846_c1 3300050513 Bacteria 2238
2026 nmdc:mga0rr50_1174000_c1 3300050513 Bacteria 652
2027 nmdc:mga0rr50_1483984_c1 3300050513 Bacteria 573
2028 nmdc:mga0rr50_1831282_c1 3300050513 Bacteria 511
2029 nmdc:mga0rr50_4305_c1 3300050513 Bacteria 8339
2030 nmdc:mga0rr50_9965_c1 3300050513 Bacteria 6007
2031 nmdc:mga08x19_107348_c1 3300050514 Bacteria 1859
2032 nmdc:mga08x19_15062_c1 3300050514 Bacteria 4697
2033 nmdc:mga08x19_16720_c1 3300050514 Bacteria 4479
2034 nmdc:mga08x19_308513_c1 3300050514 Bacteria 1100
2035 nmdc:mga08x19_382382_c1 3300050514 Bacteria 986
2036 nmdc:mga0a205_306282_c1 3300050515 Bacteria 1461
2037 nmdc:mga0a205_312603_c1 3300050515 Bacteria 1443
2038 nmdc:mga0a205_362154_c1 3300050515 Bacteria 1317
2039 nmdc:mga0a205_618_c1 3300050515 Bacteria 28265
2040 nmdc:mga0a205_81627_c1 3300050515 Bacteria 3123
2041 Ga0495601_0039256 3300053077 Bacteria 2964
2042 Ga0495601_0053846 3300053077 Bacteria 2544
2043 Ga0495601_0151747 3300053077 Bacteria 1512
2044 Ga0495601_0264047 3300053077 Bacteria 1123
2045 Ga0495601_0734996 3300053077 Bacteria 628
2046 Ga0495601_0802431 3300053077 Bacteria 597
2047 Ga0495612_0001654 3300053078 Bacteria 9176
2048 Ga0495612_0003302 3300053078 Bacteria 6687
2049 Ga0495612_0028326 3300053078 Bacteria 2255
2050 Ga0495612_0095192 3300053078 Bacteria 1264
2051 Ga0495612_0228164 3300053078 Bacteria 825
2052 Ga0495655_0020718 3300053083 Bacteria 1479
2053 Ga0495655_0176416 3300053083 Bacteria 687
2054 Ga0495595_0003935 3300053084 Bacteria 5933
2055 Ga0495595_0087318 3300053084 Bacteria 1493
2056 Ga0495619_0007135 3300053085 Bacteria 7074
2057 Ga0495619_0014045 3300053085 Bacteria 5052
2058 Ga0495619_0067820 3300053085 Bacteria 2382
2059 Ga0495619_0092261 3300053085 Bacteria 2051
2060 Ga0495619_0245604 3300053085 Bacteria 1240
2061 Ga0495619_0699125 3300053085 Bacteria 689
2062 Ga0500583_0271553 3300053092 Bacteria 834
2063 Ga0500651_0403077 3300053093 Bacteria 768
2064 Ga0500566_0137313 3300053094 Bacteria 1301
2065 Ga0500641_0084013 3300053096 Bacteria 1354
2066 Ga0500641_0381705 3300053096 Bacteria 559
2067 Ga0500654_064920 3300053099 Bacteria 1833
2068 Ga0500553_118913 3300053101 Bacteria 1093
2069 Ga0500556_0401583 3300053104 Bacteria 526
2070 Ga0500558_067368 3300053106 Bacteria 1484
2071 Ga0500560_127497 3300053107 Bacteria 852
2072 Ga0500569_004143 3300053109 Bacteria 3026
2073 Ga0500594_0022448 3300053118 Bacteria 1592
2074 Ga0500614_017862 3300053123 Bacteria 1608
2075 Ga0500628_012677 3300053129 Bacteria 1557
2076 Ga0500652_008937 3300053131 Bacteria 3365
2077 Ga0500655_147778 3300053133 Bacteria 507
2078 Ga0500658_0003343 3300053134 Bacteria 6078
2079 Ga0500573_0065287 3300053140 Bacteria 2081
2080 Ga0500573_0137513 3300053140 Bacteria 1348
2081 Ga0500573_0320426 3300053140 Bacteria 766
2082 Ga0500579_018317 3300053143 Bacteria 4535
2083 Ga0500589_207773 3300053147 Bacteria 747
2084 Ga0500600_0032935 3300053149 Bacteria 3033
2085 Ga0500600_0295193 3300053149 Bacteria 697
2086 Ga0500603_105497 3300053150 Bacteria 842
2087 Ga0500616_0256946 3300053153 Bacteria 743
2088 Ga0500633_0000825 3300053160 Bacteria 5333
2089 Ga0500634_0050937 3300053161 Bacteria 2228
2090 Ga0500656_001561 3300053732 Bacteria 1992
2091 Ga0500587_002484 3300053739 Bacteria 2620
2092 Ga0501084_0004130 3300054114 Bacteria 11829
2093 Ga0501084_0048010 3300054114 Bacteria 3575
2094 Ga0501084_0110758 3300054114 Bacteria 2307
2095 Ga0501084_0284950 3300054114 Bacteria 1395
2096 Ga0501084_0891695 3300054114 Bacteria 748
2097 Ga0590075_003626 3300059424 Bacteria 3662
2098 Ga0587066_125493 3300059490 Bacteria 611
2099 Ga0587072_046729 3300059643 Bacteria 857
2100 Ga0587078_075059 3300059646 Bacteria 534
2101 Ga0587114_108277 3300059655 Bacteria 549
2102 Ga0587071_085205 3300060344 Bacteria 710
2103 Ga0587111_0019558 3300060346 Bacteria 1286
2104 Ga0501082_0008254 3300060353 Bacteria 8980
2105 Ga0501082_0188578 3300060353 Bacteria 1794
2106 Ga0501082_0689082 3300060353 Bacteria 894
2107 Ga0466962_0001597 3300061719 Bacteria 10609
2108 Ga0466962_0003215 3300061719 Bacteria 7762
2109 Ga0466962_0019804 3300061719 Bacteria 3233
2110 Ga0466962_0024928 3300061719 Bacteria 2871
2111 Ga0466962_0035029 3300061719 Bacteria 2403
2112 Ga0466962_0209981 3300061719 Bacteria 952
2113 Ga0466962_0567793 3300061719 Bacteria 577
2114 Ga0530510_0056005 3300061734 Bacteria 2848
2115 Ga0530510_0241313 3300061734 Bacteria 1345
2116 Ga0530510_1109580 3300061734 Bacteria 606
2117 Ga0530510_1135254 3300061734 Bacteria 599
2118 2528202875 2527291627 Bacteria 5309833
2119 2528213253 2527291629 Bacteria 5267418
2120 2537898779 2537561592 Bacteria 4348607
2121 2546947610 2546825537 Bacteria 5389291
2122 2547408185 2547132111 Bacteria 8013147
2123 2554257760 2554235005 Bacteria 6457341
2124 2579748402 2576861822 Bacteria 5004595
2125 2579857875 2579778521 Bacteria 7624758
2126 2585299224 2582581312 Bacteria 7308206
2127 2585308877 2582581313 Bacteria 10042643
2128 2600198837 2599185353 Bacteria 2219443
2129 2616904550 2616644941 Bacteria 8510691
2130 2619858529 2619618881 Bacteria 7521104
2131 2620353764 2619619003 Bacteria 7619552
2132 2626634477 2626541554 Bacteria 7741902
2133 2643765030 2643221548 Bacteria 8053412
2134 2643900764 2643221578 Bacteria 9213798
2135 2643942346 2643221587 Bacteria 7586415
2136 2644017133 2643221601 Bacteria 7493239
2137 2644173906 2643221631 Bacteria 8168043
2138 2644262368 2643221647 Bacteria 10741251
2139 2644389982 2643221670 Bacteria 6497041
2140 2644405015 2643221673 Bacteria 9196637
2141 2644429426 2643221677 Bacteria 7584031
2142 2644461131 2643221682 Bacteria 6743283
2143 2676497096 2675903060 Bacteria 10051191
2144 2686534371 2684623035 Bacteria 8032739
2145 2686543749 2684623036 Bacteria 5199090
2146 2710604303 2710264753 Bacteria 5455564
2147 2768643512 2767802112 Bacteria 6465194
2148 2774864285 2773857924 Bacteria 5256821
2149 2784588645 2784132148 Bacteria 8627943
2150 2785343206 2784746763 Bacteria 9783172
2151 2785369589 2784746768 Bacteria 10036182
2152 2786670679 2786546132 Bacteria 10419719
2153 2791213414 2788500588 Bacteria 4584915
2154 2793984432 2791355406 Bacteria 11364898
2155 2804846910 2802429296 Bacteria 7227771
2156 2809232255 2808606448 Bacteria 8656184
2157 2811849127 2808606982 Bacteria 7791042
2158 2812358008 2811994879 Bacteria 9313447
2159 2812480452 2811994917 Bacteria 7761064
2160 2819627478 2818991451 Bacteria 4697364
2161 2819695484 2818991463 Bacteria 7948711
2162 2819741196 2818991472 Bacteria 10089953
2163 2844851709 2844849076 Bacteria 4091819
2164 2847088829 2847085930 Bacteria 5070450
2165 2852636577 2852635781 Bacteria 8251373
2166 2856744598 2856741275 Bacteria 8096094
2167 2862179398 2862178590 Bacteria 8583590
2168 2862285734 2862281513 Bacteria 9621493
2169 2862294834 2862290372 Bacteria 7471434
2170 2862391572 2862382967 Bacteria 10317375
2171 2862511733 2862507626 Bacteria 9425308
2172 2862579180 2862574272 Bacteria 10567477
2173 2862709359 2862705112 Bacteria 6563286
2174 2863404518 2863404153 Bacteria 9672205
2175 2867348898 2867346516 Bacteria 7608576
2176 2867371955 2867369537 Bacteria 6501581
2177 2867434852 2867428634 Bacteria 9590268
2178 2867479902 2867475112 Bacteria 6909112
2179 2873155656 2873151551 Bacteria 8625867
2180 2873316372 2873314349 Bacteria 8512634
2181 2875395639 2875391855 Bacteria 7600475
2182 2877681039 2877676314 Bacteria 9512378
2183 2884703590 2884693830 Bacteria 11273186
2184 2891398903 2891395885 Bacteria 9251614
2185 2891559113 2891554331 Bacteria 8812224
2186 2891569556 2891562705 Bacteria 8039471
2187 2895438539 2895427314 Bacteria 13147766
2188 2895443382 2895442618 Bacteria 11027144
2189 2895883767 2895880812 Bacteria 11255272
2190 2904501520 2904497146 Bacteria 4731781
2191 2904608559 2904606771 Bacteria 4684500
2192 2912724285 2912723979 Bacteria 8557534
2193 2912760859 2912757875 Bacteria 7940295
2194 2918505511 2918501144 Bacteria 8668083
2195 2919035526 2919034639 Bacteria 4763403
2196 2935393340 2935390628 Bacteria 7043367
2197 2946049000 2946045630 Bacteria 8527308
2198 2946067835 2946064051 Bacteria 8957905
2199 2946075977 2946072368 Bacteria 8999607
2200 2947229160 2947224130 Bacteria 9938529
2201 2954386148 2954380949 Bacteria 10050426
2202 2954677002 2954673503 Bacteria 9685905
2203 2954687155 2954682443 Bacteria 9862841
2204 2954696786 2954691527 Bacteria 10720516
2205 2954705352 2954701450 Bacteria 10834262
2206 2954716165 2954711539 Bacteria 10867210
2207 2954726108 2954721474 Bacteria 10456478
2208 2954735702 2954731030 Bacteria 10243860
2209 2954745034 2954740390 Bacteria 10229294
2210 2954754558 2954749733 Bacteria 10366972
2211 2954764006 2954759201 Bacteria 9358192
2212 2966601722 2966598605 Bacteria 7676064
2213 2990048080 2990044586 Bacteria 6603797
2214 2990063166 2990059506 Bacteria 9321252
2215 2995465892 2995463766 Bacteria 8577691
2216 2995466746 2995463766 Bacteria 8577691
2217 2997457774 2997451912 Bacteria 8492419
2218 2997600354 2997600082 Bacteria 9896405
2219 3003004870 3002998708 Bacteria 11715108
2220 3006324990 3006321560 Bacteria 8247479
2221 3006399692 3006393351 Bacteria 6615579
2222 3006428769 3006425503 Bacteria 6491253
2223 3006487457 3006486233 Bacteria 8157040
2224 3006500827 3006493962 Bacteria 8825450
2225 637877588 637000116 Bacteria 5433628
2226 8007377605 8007375930 Bacteria 4080554
2227 8008488623 8008485437 Bacteria 7198341
2228 8008567201 8008558824 Bacteria 10610750
2229 8008578821 8008574985 Bacteria 7815457
2230 8023629810 8023623736 Bacteria 8593882
2231 8025417821 8025413630 Bacteria 7014048
2232 8025481844 8025478263 Bacteria 8209203
2233 8025527399 8025524527 Bacteria 7197316
2234 8025537943 8025530807 Bacteria 8495698
2235 8033686962 8033684223 Bacteria 6906479
2236 8047898044 8047893842 Bacteria 11723082
2237 8048128019 8048127548 Bacteria 11053136
2238 8048360849 8048356638 Bacteria 11044339
2239 8048375007 8048369669 Bacteria 11666822
2240 8048383199 8048379754 Bacteria 11877923
2241 8048412667 8048406513 Bacteria 8936924
2242 8054167024 8054160619 Bacteria 7783213
2243 8055074387 8055066027 Bacteria 9479577
2244 8055173924 8055172936 Bacteria 9305943
2245 8056449183 8056447290 Bacteria 7680491
2246 8056671188 8056667051 Bacteria 6953971
2247 Ga0466961_0728462
2248 JGI24741J21665_1068614
2249 JGI24752J21851_1053559
2250 JGI24747J21853_1048214
2251 JGI24740J21852_10144583
2252 JGI24743J22301_10063866
2253 JGI24745J21846_1054131
2254 JGI24033J26618_1075896
2255 JGI24751J29686_10011389
2256 JGI25152J39213_1000431
2257 Ga0006759J45824_1010939
2258 JGI25151J46595_10048603
2259 rootH1_10054865
2260 rootL2_10002354
2261 rootH1_10077154
2262 Ga0007417J51691_1031744
2263 Ga0007416J51690_1039243
2264 Ga0006562J51391_1013573
2265 Ga0007429J51699_1029739
2266 JGI25404J52841_10004078
2267 Ga0058859_11593662
2268 Ga0070658_10080675
2269 Ga0070658_10109176
2270 Ga0070658_10126206
2271 Ga0070658_10384459
2272 Ga0070658_10467407
2273 Ga0070658_10489431
2274 Ga0070658_10573142
2275 Ga0070658_11618769
2276 Ga0070676_10132525
2277 Ga0070676_10199801
2278 Ga0070683_100086548
2279 Ga0070683_100236714
2280 Ga0070683_100242651
2281 Ga0070683_100319737
2282 Ga0070683_100649829
2283 Ga0070683_100769179
2284 Ga0070683_100933785
2285 Ga0070683_100993534
2286 Ga0070690_100074092
2287 Ga0070690_100728694
2288 Ga0070670_100116948
2289 Ga0070670_100304737
2290 Ga0070670_100714487
2291 Ga0068869_100102951
2292 Ga0068869_100415167
2293 Ga0070666_10354187
2294 Ga0070666_10956143
2295 Ga0070680_100046686
2296 Ga0070680_100538264
2297 Ga0070680_100606669
2298 Ga0070680_100610347
2299 Ga0070680_100698235
2300 Ga0070680_101025375
2301 Ga0070682_100156042
2302 Ga0070682_100393943
2303 Ga0070682_100538345
2304 Ga0068868_100047482
2305 Ga0068868_100124661
2306 Ga0068868_100147618
2307 Ga0068868_100284076
2308 Ga0068868_100542797
2309 Ga0068868_100858346
2310 Ga0068868_102239428
2311 Ga0070660_100056154
2312 Ga0070660_100205642
2313 Ga0070660_100263905
2314 Ga0070660_100354618
2315 Ga0070660_100510441
2316 Ga0070660_101554158
2317 Ga0070689_100023700
2318 Ga0070689_100077283
2319 Ga0070691_10011376
2320 Ga0070691_10102607
2321 Ga0070687_100030344
2322 Ga0070687_100063632
2323 Ga0070661_100021766
2324 Ga0070661_100124775
2325 Ga0070661_100334839
2326 Ga0070661_101843976
2327 Ga0070692_10041379
2328 Ga0070692_10055692
2329 Ga0070692_10254029
2330 Ga0070692_11110272
2331 Ga0070692_11233403
2332 Ga0070668_100125509
2333 Ga0070668_101289281
2334 Ga0070669_100198950
2335 Ga0070669_100614344
2336 Ga0070675_100014849
2337 Ga0070675_100412316
2338 Ga0070671_100079033
2339 Ga0070671_100093054
2340 Ga0070671_100984026
2341 Ga0070671_101505015
2342 Ga0070674_100106617
2343 Ga0070674_100420697
2344 Ga0070674_100474125
2345 Ga0070674_100928262
2346 Ga0070673_100104251
2347 Ga0070673_100154142
2348 Ga0070673_100870359
2349 Ga0070673_102250448
2350 Ga0070688_100871259
2351 Ga0070659_100122200
2352 Ga0070659_100498801
2353 Ga0070659_102159688
2354 Ga0070667_100120475
2355 Ga0070667_100600987
2356 Ga0070667_101238485
2357 Ga0070667_101365278
2358 Ga0070667_101456044
2359 Ga0070703_10180095
2360 Ga0070709_10001280
2361 Ga0070709_10006908
2362 Ga0070709_10063516
2363 Ga0070709_10087255
2364 Ga0070709_10174334
2365 Ga0070709_10202510
2366 Ga0070709_10778168
2367 Ga0070714_100001940
2368 Ga0070714_100034995
2369 Ga0070714_100037342
2370 Ga0070714_100095332
2371 Ga0070714_100377177
2372 Ga0070714_100988991
2373 Ga0070714_101171864
2374 Ga0070714_101177506
2375 Ga0070714_101715283
2376 Ga0070713_100004434
2377 Ga0070713_100012635
2378 Ga0070713_100013221
2379 Ga0070713_100049348
2380 Ga0070713_100088315
2381 Ga0070713_100147071
2382 Ga0070713_100649696
2383 Ga0070713_100841886
2384 Ga0070713_100898909
2385 Ga0070713_101061230
2386 Ga0070713_101255139
2387 Ga0070713_101653296
2388 Ga0070713_101710907
2389 Ga0070713_102016839
2390 Ga0070710_10001003
2391 Ga0070710_10023246
2392 Ga0070710_10040445
2393 Ga0070710_10092801
2394 Ga0070710_10788568
2395 Ga0070701_10002382
2396 Ga0070701_10017082
2397 Ga0070701_10383669
2398 Ga0070711_100002980
2399 Ga0070711_100012494
2400 Ga0070711_100032246
2401 Ga0070711_100047988
2402 Ga0070711_100305332
2403 Ga0070711_100360005
2404 Ga0070711_100463276
2405 Ga0070711_100914197
2406 Ga0070711_100989946
2407 Ga0070705_100117944
2408 Ga0070705_100253250
2409 Ga0070705_100676564
2410 Ga0070700_100084167
2411 Ga0070700_100126695
2412 Ga0070694_100159574
2413 Ga0070694_101185010
2414 Ga0070708_100025343
2415 Ga0070708_100224558
2416 Ga0070708_100530524
2417 Ga0070708_101258753
2418 Ga0070663_100054987
2419 Ga0070663_100188437
2420 Ga0070663_100257789
2421 Ga0070663_100496541
2422 Ga0070663_100524603
2423 Ga0070663_101374622
2424 Ga0070678_100001635
2425 Ga0070678_100096431
2426 Ga0070678_100977622
2427 Ga0070678_101473509
2428 Ga0070662_100222732
2429 Ga0070662_101195085
2430 Ga0070662_101293285
2431 Ga0070681_10010877
2432 Ga0070681_10108042
2433 Ga0070681_10137321
2434 Ga0070681_10196105
2435 Ga0070681_10337063
2436 Ga0070681_10553769
2437 Ga0070681_11172480
2438 Ga0070681_11596470
2439 Ga0068867_100319689
2440 Ga0068867_100732792
2441 Ga0068867_101855960
2442 Ga0070685_10035130
2443 Ga0070706_100003283
2444 Ga0070706_100057923
2445 Ga0070706_100068689
2446 Ga0070706_100122297
2447 Ga0070706_100149776
2448 Ga0070706_100176547
2449 Ga0070706_100535921
2450 Ga0070707_100000759
2451 Ga0070707_100038811
2452 Ga0070707_100365192
2453 Ga0070707_100508407
2454 Ga0070707_100591905
2455 Ga0070698_100001019
2456 Ga0070698_100002343
2457 Ga0070698_100015778
2458 Ga0070698_100061092
2459 Ga0070698_100080895
2460 Ga0070698_100120956
2461 Ga0070698_100322503
2462 Ga0070698_101133924
2463 Ga0070699_100145669
2464 Ga0070679_100010387
2465 Ga0070679_100025712
2466 Ga0070679_100106370
2467 Ga0070679_100271602
2468 Ga0070679_100298098
2469 Ga0070679_100345874
2470 Ga0070679_101406517
2471 Ga0070684_100206692
2472 Ga0070684_100212168
2473 Ga0070684_100312069
2474 Ga0070684_100443196
2475 Ga0070684_100584887
2476 Ga0070684_100729378
2477 Ga0070684_100984099
2478 Ga0070697_100004357
2479 Ga0070697_100010938
2480 Ga0070697_100190470
2481 Ga0070697_100608698
2482 Ga0070697_101160348
2483 Ga0068853_100325991
2484 Ga0068853_100600049
2485 Ga0070672_100025168
2486 Ga0070672_100264280
2487 Ga0070672_100491634
2488 Ga0070672_100668898
2489 Ga0070686_100908941
2490 Ga0070695_100050897
2491 Ga0070695_100342472
2492 Ga0070695_101709408
2493 Ga0070696_100060268
2494 Ga0070696_100177283
2495 Ga0070696_101169569
2496 Ga0070696_101407026
2497 Ga0070696_101819046
2498 Ga0070693_100005092
2499 Ga0070693_100598680
2500 Ga0070693_101049708
2501 Ga0070665_100030159
2502 Ga0070665_100260984
2503 Ga0070665_100396212
2504 Ga0070665_100447186
2505 Ga0070704_100265991
2506 Ga0070704_100874040
2507 Ga0070704_101940956
2508 Ga0068855_100121025
2509 Ga0068855_100158059
2510 Ga0068855_100678137
2511 Ga0068855_100919154
2512 Ga0068855_101817696
2513 Ga0068855_102212485
2514 Ga0070664_100074926
2515 Ga0070664_101325913
2516 Ga0070664_101414514
2517 Ga0070664_101589521
2518 Ga0068857_100272546
2519 Ga0068857_100609823
2520 Ga0068857_100728433
2521 Ga0068857_101054175
2522 Ga0068857_101174897
2523 Ga0068857_101876973
2524 Ga0068854_100056428
2525 Ga0068854_100393090
2526 Ga0068854_101826830
2527 Ga0068856_100105265
2528 Ga0068856_101059653
2529 Ga0068856_101851418
2530 Ga0070702_100068800
2531 Ga0070702_100213681
2532 Ga0068852_100000497
2533 Ga0068852_100075312
2534 Ga0068852_100096999
2535 Ga0068852_100340080
2536 Ga0068852_100602885
2537 Ga0068852_102172148
2538 Ga0068859_100246961
2539 Ga0068859_100273218
2540 Ga0068859_100889388
2541 Ga0068859_101870180
2542 Ga0068864_100003244
2543 Ga0068864_100127348
2544 Ga0068864_101623856
2545 Ga0068864_101662577
2546 Ga0068864_101764136
2547 Ga0068866_10032583
2548 Ga0068866_10386663
2549 Ga0068861_100358099
2550 Ga0068851_10081316
2551 Ga0068851_10356563
2552 Ga0068870_10021137
2553 Ga0068870_10563046
2554 Ga0068870_10732648
2555 Ga0068870_10906967
2556 Ga0068863_100003332
2557 Ga0068863_100519231
2558 Ga0068863_100565331
2559 Ga0068863_100819907
2560 Ga0068858_100214839
2561 Ga0068858_100246158
2562 Ga0068858_100398373
2563 Ga0068858_100422857
2564 Ga0068858_100748928
2565 Ga0068860_100371807
2566 Ga0068860_101451373
2567 Ga0068860_102725001
2568 Ga0068862_100020590
2569 Ga0081455_10181061
2570 Ga0081538_10035881
2571 Ga0081540_1000193
2572 Ga0081540_1000355
2573 Ga0081540_1078394
2574 Ga0081539_10389280
2575 Ga0070717_10017503
2576 Ga0070717_10107833
2577 Ga0070717_10156341
2578 Ga0070717_10303179
2579 Ga0070717_10314830
2580 Ga0070717_10403326
2581 Ga0070717_10608322
2582 Ga0070717_10761132
2583 Ga0070717_10812605
2584 Ga0070717_11141430
2585 Ga0070717_11528065
2586 Ga0070717_11741542
2587 Ga0075363_100138181
2588 Ga0075363_100647093
2589 Ga0075432_10260394
2590 Ga0070715_10018614
2591 Ga0070715_10083546
2592 Ga0070715_10131122
2593 Ga0070716_100003676
2594 Ga0070716_100013747
2595 Ga0070716_100018980
2596 Ga0070716_100149237
2597 Ga0070716_100575500
2598 Ga0070712_100001764
2599 Ga0070712_100220805
2600 Ga0070712_100330101
2601 Ga0070712_100396209
2602 Ga0070712_100808737
2603 Ga0070712_101487354
2604 Ga0070712_101693509
2605 Ga0097621_100028657
2606 Ga0097621_100138272
2607 Ga0097621_100467346
2608 Ga0068871_100116304
2609 Ga0068871_100192461
2610 Ga0068871_100934828
2611 Ga0075428_100116954
2612 Ga0075428_100248314
2613 Ga0075428_100875814
2614 Ga0075433_10004667
2615 Ga0075433_10058534
2616 Ga0075433_10212584
2617 Ga0075433_10302864
2618 Ga0075433_10487249
2619 Ga0075434_100004126
2620 Ga0075434_100121257
2621 Ga0075434_100295990
2622 Ga0075434_100381904
2623 Ga0075434_100509932
2624 Ga0075429_100032855
2625 Ga0075429_100995142
2626 Ga0068865_100197174
2627 Ga0068865_100223398
2628 Ga0068865_100226394
2629 Ga0075436_100005351
2630 Ga0075436_100130030
2631 Ga0075436_100214031
2632 Ga0075436_100370472
2633 Ga0097620_100246968
2634 Ga0097620_100273204
2635 Ga0097620_100889376
2636 Ga0097620_101869838
2637 Ga0099826_10129515
2638 Ga0075435_100008998
2639 Ga0075435_100137120
2640 Ga0075435_100184646
2641 Ga0075435_100853002
2642 Ga0075435_101056291
2643 Ga0099794_10376727
2644 Ga0099794_10501751
2645 Ga0099795_10015129
2646 Ga0099795_10346424
2647 Ga0105251_10009748
2648 Ga0105251_10038963
2649 Ga0105244_10227262
2650 Ga0105244_10254694
2651 Ga0105244_10362605
2652 Ga0105250_10114222
2653 Ga0105250_10351630
2654 Ga0105250_10417671
2655 Ga0105240_10535477
2656 Ga0105240_10639032
2657 Ga0105240_10733600
2658 Ga0105240_11127334
2659 Ga0111539_10088965
2660 Ga0111539_10189764
2661 Ga0111539_13273931
2662 Ga0105245_10001105
2663 Ga0105245_10103611
2664 Ga0105245_10251416
2665 Ga0105245_10423434
2666 Ga0105245_10443110
2667 Ga0105245_10541536
2668 Ga0105245_10784209
2669 Ga0105245_11488914
2670 Ga0105245_11818852
2671 Ga0105245_12683201
2672 Ga0105247_10000156
2673 Ga0105247_10004622
2674 Ga0105247_10212950
2675 Ga0105247_10448552
2676 Ga0105247_10674909
2677 Ga0105247_10716612
2678 Ga0114129_10003727
2679 Ga0114129_10176253
2680 Ga0114129_10672238
2681 Ga0114129_10818495
2682 Ga0114129_10905906
2683 Ga0114129_11140280
2684 Ga0114129_11520112
2685 Ga0114129_13415871
2686 Ga0105243_10011592
2687 Ga0105243_10081732
2688 Ga0105243_10132867
2689 Ga0105243_10329695
2690 Ga0105243_10641639
2691 Ga0105243_11886270
2692 Ga0105241_10131584
2693 Ga0105241_10185322
2694 Ga0105241_10687614
2695 Ga0105241_10793881
2696 Ga0105241_10989007
2697 Ga0105242_10103963
2698 Ga0105242_10222383
2699 Ga0105242_10410322
2700 Ga0105242_11683134
2701 Ga0105242_12045705
2702 Ga0105242_12307653
2703 Ga0105248_10001256
2704 Ga0105248_10039623
2705 Ga0105248_10184254
2706 Ga0105248_10288636
2707 Ga0105248_11215465
2708 Ga0105248_12343562
2709 Ga0105237_10365688
2710 Ga0105237_10426969
2711 Ga0105237_10591198
2712 Ga0105237_10797391
2713 Ga0105237_11081608
2714 Ga0105237_11224797
2715 Ga0105237_11985958
2716 Ga0105238_10044356
2717 Ga0105238_10378578
2718 Ga0105238_10997556
2719 Ga0105238_11087337
2720 Ga0105238_12227639
2721 Ga0105238_12423355
2722 Ga0105238_12909923
2723 Ga0105249_10040745
2724 Ga0105249_10329162
2725 Ga0105249_10330115
2726 Ga0105249_10453128
2727 Ga0105249_11166391
2728 Ga0105249_11469127
2729 Ga0105249_11973888
2730 Ga0105249_12291228
2731 Ga0105249_12308920
2732 Ga0105249_12353397
2733 Ga0105249_12421697
2734 Ga0105249_12560354
2735 Ga0099796_10023887
2736 Ga0099796_10275871
2737 Ga0105239_10131095
2738 Ga0105239_10244856
2739 Ga0105239_10424269
2740 Ga0105239_10738877
2741 Ga0105239_10824069
2742 Ga0105239_11055172
2743 Ga0105239_11296739
2744 Ga0105239_11681072
2745 Ga0105239_11843541
2746 Ga0105239_12626434
2747 Ga0105246_10000677
2748 Ga0105246_10043815
2749 Ga0105246_10246314
2750 Ga0105246_10264562
2751 Ga0105246_10271422
2752 Ga0105246_10685213
2753 Ga0105246_10696760
2754 Ga0105246_10865976
2755 Ga0157340_1029428
2756 Ga0157336_1017202
2757 Ga0157346_1000486
2758 Ga0157337_1006266
2759 Ga0157325_1018162
2760 Ga0157329_1021702
2761 Ga0157335_1009023
2762 Ga0157341_1041648
2763 Ga0157319_1010846
2764 Ga0157345_1002512
2765 Ga0157314_1012932
2766 Ga0157347_1005321
2767 Ga0157313_1014030
2768 Ga0157339_1010108
2769 Ga0157342_1002674
2770 Ga0157315_1007234
2771 Ga0157327_1068898
2772 Ga0157326_1029780
2773 Ga0157326_1032110
2774 Ga0157338_1005803
2775 Ga0157373_10080116
2776 Ga0157373_10094196
2777 Ga0157373_10128644
2778 Ga0157373_10481267
2779 Ga0157373_10832202
2780 Ga0157373_11468612
2781 Ga0157371_10018435
2782 Ga0157371_10042438
2783 Ga0157371_10055988
2784 Ga0157371_10165197
2785 Ga0157371_11540194
2786 Ga0157370_10045055
2787 Ga0157370_10282438
2788 Ga0157370_10389342
2789 Ga0157370_10684486
2790 Ga0157370_10927128
2791 Ga0157370_11139673
2792 Ga0157369_10001226
2793 Ga0157369_10045005
2794 Ga0157369_10174634
2795 Ga0157369_10177656
2796 Ga0157369_10226639
2797 Ga0157369_10553907
2798 Ga0157369_10615632
2799 Ga0157369_10884227
2800 Ga0157369_11113725
2801 Ga0157369_11332328
2802 Ga0157369_11579337
2803 Ga0157374_10007839
2804 Ga0157374_10551488
2805 Ga0157374_10660329
2806 Ga0157374_11068011
2807 Ga0157374_11379621
2808 Ga0157374_12592194
2809 Ga0157374_12615690
2810 Ga0157374_12967956
2811 Ga0157378_10143210
2812 Ga0157378_10188750
2813 Ga0157378_10340383
2814 Ga0157378_10874525
2815 Ga0157378_10926671
2816 Ga0157378_12965929
2817 Ga0163162_10224162
2818 Ga0163162_10544828
2819 Ga0163162_10595887
2820 Ga0163162_10666633
2821 Ga0163162_11226593
2822 Ga0163162_11237422
2823 Ga0163162_11347230
2824 Ga0163162_11666999
2825 Ga0163162_12154867
2826 Ga0163162_12432619
2827 Ga0163162_13038927
2828 Ga0157372_10023978
2829 Ga0157372_10089347
2830 Ga0157372_10340463
2831 Ga0157372_10372037
2832 Ga0157372_10472225
2833 Ga0157372_10639515
2834 Ga0157372_11103280
2835 Ga0157372_11261359
2836 Ga0157372_11286038
2837 Ga0157372_11845359
2838 Ga0157372_11846959
2839 Ga0157372_11938749
2840 Ga0157372_12355373
2841 Ga0157372_13386755
2842 Ga0157375_10298048
2843 Ga0157375_10313841
2844 Ga0157375_10445668
2845 Ga0157375_10513284
2846 Ga0157375_10691200
2847 Ga0157375_11036968
2848 Ga0157375_11240915
2849 Ga0157375_11395859
2850 Ga0157375_11580698
2851 Ga0163163_10086319
2852 Ga0163163_10134524
2853 Ga0163163_10294750
2854 Ga0163163_10513046
2855 Ga0163163_11440644
2856 Ga0157380_10419005
2857 Ga0157380_10572085
2858 Ga0157380_11041806
2859 Ga0157380_11204456
2860 Ga0182008_10001280
2861 Ga0182008_10063733
2862 Ga0182008_10154693
2863 Ga0182008_10771580
2864 Ga0157377_10099503
2865 Ga0157377_10297683
2866 Ga0157377_11014908
2867 Ga0157377_11740804
2868 Ga0157379_10017316
2869 Ga0157379_10245301
2870 Ga0157379_10580398
2871 Ga0157379_11580780
2872 Ga0157376_10149208
2873 Ga0157376_10176007
2874 Ga0157376_10289769
2875 Ga0157376_10743029
2876 Ga0157376_11141997
2877 Ga0157376_11854885
2878 Ga0182006_1239719
2879 Ga0182007_10000582
2880 Ga0182007_10271434
2881 Ga0182005_1100806
2882 Ga0183367_1005
2883 Ga0163161_10159234
2884 Ga0163161_10283976
2885 Ga0163161_10463463
2886 Ga0163161_11057483
2887 Ga0163161_11283187
2888 Ga0184601_106011
2889 Ga0197907_10000430
2890 Ga0197907_10288082
2891 Ga0197907_10328527
2892 Ga0197907_10376985
2893 Ga0197907_11094604
2894 Ga0197907_11205039
2895 Ga0197907_11225079
2896 Ga0206356_10944536
2897 Ga0206356_11038323
2898 Ga0206356_11717365
2899 Ga0206349_1677274
2900 Ga0206355_1500362
2901 Ga0206355_1718134
2902 Ga0206351_10722143
2903 Ga0206351_10773125
2904 Ga0206352_10254953
2905 Ga0206352_10791224
2906 Ga0206352_11198618
2907 Ga0206352_11221252
2908 Ga0206350_10374030
2909 Ga0206350_11294616
2910 Ga0206350_11421611
2911 Ga0206354_10431806
2912 Ga0206354_10445256
2913 Ga0206354_10750047
2914 Ga0206354_11141536
2915 Ga0206354_11265793
2916 Ga0206354_11381198
2917 Ga0206354_11660386
2918 Ga0206353_10158060
2919 Ga0206353_10211368
2920 Ga0206353_10224648
2921 Ga0206353_11402443
2922 Ga0206353_11571215
2923 Ga0206353_11776395
2924 Ga0154015_1173053
2925 Ga0154015_1285698
2926 Ga0213873_10048000
2927 Ga0213872_10363985
2928 Ga0213874_10109716
2929 Ga0213875_10001074
2930 Ga0213875_10134582
2931 Ga0213875_10180928
2932 Ga0224712_10018811
2933 Ga0224712_10033439
2934 Ga0224712_10038218
2935 Ga0224712_10038848
2936 Ga0224712_10154823
2937 Ga0224712_10169541
2938 Ga0224712_10539998
2939 Ga0224712_10580348
2940 Ga0247551_104776
2941 Ga0247528_111965
2942 Ga0224572_1016890
2943 Ga0224572_1039710
2944 Ga0228598_1006679
2945 Ga0207425_1040092
2946 Ga0209759_1041554
2947 Ga0209129_1000109
2948 Ga0209673_1075826
2949 Ga0209025_1001288
2950 Ga0209758_1004710
2951 Ga0207426_1010098
2952 Ga0207426_1021647
2953 Ga0207426_1035840
2954 Ga0209051_1022745
2955 Ga0207656_10002744
2956 Ga0207656_10317020
2957 Ga0207696_1089907
2958 Ga0207713_1015813
2959 Ga0207713_1069261
2960 Ga0207713_1187793
2961 Ga0207713_1208068
2962 Ga0207653_10010290
2963 Ga0207682_10434243
2964 Ga0207692_10003532
2965 Ga0207692_10061982
2966 Ga0207692_10283443
2967 Ga0207692_10435207
2968 Ga0207692_11113518
2969 Ga0207710_10048418
2970 Ga0207710_10148245
2971 Ga0207710_10285787
2972 Ga0207688_10005845
2973 Ga0207688_10202007
2974 Ga0207680_10092482
2975 Ga0207680_10990028
2976 Ga0207647_10129790
2977 Ga0207647_10180858
2978 Ga0207647_10337524
2979 Ga0207685_10029674
2980 Ga0207685_10106860
2981 Ga0207685_10128805
2982 Ga0207699_10005247
2983 Ga0207699_10008388
2984 Ga0207699_10019950
2985 Ga0207699_10052519
2986 Ga0207699_10057858
2987 Ga0207699_10127567
2988 Ga0207699_11421641
2989 Ga0207645_10125468
2990 Ga0207645_10140421
2991 Ga0207643_10000785
2992 Ga0207643_10097704
2993 Ga0207705_10008895
2994 Ga0207705_10330599
2995 Ga0207705_10462458
2996 Ga0207705_10665820
2997 Ga0207684_10001971
2998 Ga0207684_10033328
2999 Ga0207684_10053609
3000 Ga0207684_10152406
3001 Ga0207684_10169825
3002 Ga0207684_10190164
3003 Ga0207684_10339361
3004 Ga0207684_11239355
3005 Ga0207684_11326226
3006 Ga0207654_10011556
3007 Ga0207654_11072503
3008 Ga0207707_10000257
3009 Ga0207707_10070531
3010 Ga0207707_10083004
3011 Ga0207707_10085902
3012 Ga0207707_10239879
3013 Ga0207707_10761002
3014 Ga0207707_10961448
3015 Ga0207707_11543701
3016 Ga0207695_10204898
3017 Ga0207695_10522574
3018 Ga0207671_10032194
3019 Ga0207671_10706685
3020 Ga0207693_10049363
3021 Ga0207693_10140509
3022 Ga0207693_10245271
3023 Ga0207693_10880097
3024 Ga0207693_10967246
3025 Ga0207663_10004352
3026 Ga0207663_10065057
3027 Ga0207663_10219811
3028 Ga0207663_10321391
3029 Ga0207663_10899073
3030 Ga0207660_10000443
3031 Ga0207660_10010834
3032 Ga0207660_10032108
3033 Ga0207660_10271016
3034 Ga0207660_10294724
3035 Ga0207660_10681717
3036 Ga0207660_11615416
3037 Ga0207662_10026955
3038 Ga0207662_10088442
3039 Ga0207657_10009895
3040 Ga0207657_10029438
3041 Ga0207657_10090094
3042 Ga0207657_10104721
3043 Ga0207657_10149661
3044 Ga0207657_10641272
3045 Ga0207649_10007710
3046 Ga0207649_10280483
3047 Ga0207652_10000070
3048 Ga0207652_10006407
3049 Ga0207652_10013800
3050 Ga0207652_10039314
3051 Ga0207652_10292989
3052 Ga0207652_10411397
3053 Ga0207652_10412404
3054 Ga0207652_10670105
3055 Ga0207652_11499633
3056 Ga0207652_11760923
3057 Ga0207646_10000180
3058 Ga0207646_10003225
3059 Ga0207646_10072175
3060 Ga0207646_10170346
3061 Ga0207646_10410649
3062 Ga0207646_10639852
3063 Ga0207646_11344708
3064 Ga0207694_10263491
3065 Ga0207694_10815868
3066 Ga0207694_11368813
3067 Ga0207650_10007339
3068 Ga0207650_10301782
3069 Ga0207650_10792471
3070 Ga0207659_10076357
3071 Ga0207659_10538630
3072 Ga0207659_11045978
3073 Ga0207687_10004699
3074 Ga0207687_10085074
3075 Ga0207687_10145689
3076 Ga0207687_10253750
3077 Ga0207687_10430985
3078 Ga0207700_10002172
3079 Ga0207700_10004822
3080 Ga0207700_10053681
3081 Ga0207700_10078649
3082 Ga0207700_10110485
3083 Ga0207700_10138114
3084 Ga0207700_10218242
3085 Ga0207700_10377698
3086 Ga0207700_10447459
3087 Ga0207700_10631391
3088 Ga0207664_10000298
3089 Ga0207664_10001524
3090 Ga0207664_10001845
3091 Ga0207664_10003186
3092 Ga0207664_10009124
3093 Ga0207664_10145876
3094 Ga0207664_10178957
3095 Ga0207664_10184829
3096 Ga0207664_10185885
3097 Ga0207664_10391912
3098 Ga0207664_10432426
3099 Ga0207664_10482268
3100 Ga0207664_10555525
3101 Ga0207664_10624254
3102 Ga0207664_10709886
3103 Ga0207664_10758987
3104 Ga0207644_10330883
3105 Ga0207644_10472008
3106 Ga0207644_10670477
3107 Ga0207644_11566601
3108 Ga0207644_11571817
3109 Ga0207690_10000219
3110 Ga0207690_10016824
3111 Ga0207690_10184443
3112 Ga0207690_10916477
3113 Ga0207706_10072026
3114 Ga0207706_10103797
3115 Ga0207686_10070926
3116 Ga0207686_10085700
3117 Ga0207686_10182120
3118 Ga0207686_10396874
3119 Ga0207686_11003919
3120 Ga0207709_10051993
3121 Ga0207709_10149879
3122 Ga0207709_10260330
3123 Ga0207709_10683302
3124 Ga0207670_10280515
3125 Ga0207670_10404127
3126 Ga0207669_10138738
3127 Ga0207669_11108928
3128 Ga0207669_11368232
3129 Ga0207704_10694076
3130 Ga0207704_10800144
3131 Ga0207704_11471486
3132 Ga0207665_10000657
3133 Ga0207665_10023462
3134 Ga0207665_10064239
3135 Ga0207665_10229302
3136 Ga0207691_10006993
3137 Ga0207691_10292907
3138 Ga0207691_10978209
3139 Ga0207711_10247142
3140 Ga0207711_10355742
3141 Ga0207711_11487377
3142 Ga0207689_10006217
3143 Ga0207689_10038661
3144 Ga0207689_10796465
3145 Ga0207661_10000336
3146 Ga0207661_10182423
3147 Ga0207661_10215294
3148 Ga0207661_10669166
3149 Ga0207661_11065429
3150 Ga0207661_11118335
3151 Ga0207679_10001066
3152 Ga0207679_10322244
3153 Ga0207679_10612563
3154 Ga0207679_11558178
3155 Ga0207667_10274291
3156 Ga0207667_10426342
3157 Ga0207667_10787716
3158 Ga0207667_11077547
3159 Ga0207667_11743916
3160 Ga0207651_10091623
3161 Ga0207651_10212793
3162 Ga0207712_10486292
3163 Ga0207712_10509532
3164 Ga0207712_10919774
3165 Ga0207668_11605737
3166 Ga0207640_10031537
3167 Ga0207640_11383406
3168 Ga0207658_10012955
3169 Ga0207658_10147132
3170 Ga0207658_10928694
3171 Ga0207658_11503540
3172 Ga0207658_11610945
3173 Ga0207677_10019593
3174 Ga0207677_10251985
3175 Ga0207677_10592148
3176 Ga0207677_10721886
3177 Ga0207677_11523031
3178 Ga0207703_10234602
3179 Ga0207703_10395638
3180 Ga0207703_10852492
3181 Ga0207703_10981002
3182 Ga0207703_11790484
3183 Ga0207639_10056849
3184 Ga0207639_11183784
3185 Ga0207678_10001106
3186 Ga0207678_10070312
3187 Ga0207678_10085601
3188 Ga0207678_10880553
3189 Ga0207678_11050358
3190 Ga0207708_10009638
3191 Ga0207708_10102554
3192 Ga0207708_10516949
3193 Ga0207708_12014051
3194 Ga0207702_10041776
3195 Ga0207702_10373661
3196 Ga0207702_10569475
3197 Ga0207702_10738716
3198 Ga0207702_10940286
3199 Ga0207702_11012825
3200 Ga0207702_11229571
3201 Ga0207641_10138939
3202 Ga0207641_10464178
3203 Ga0207641_10666830
3204 Ga0207641_11228017
3205 Ga0207641_12122744
3206 Ga0207648_10100745
3207 Ga0207648_10902268
3208 Ga0207648_11117755
3209 Ga0207648_11203373
3210 Ga0207648_11784803
3211 Ga0207676_10000648
3212 Ga0207676_10998509
3213 Ga0207676_11928961
3214 Ga0207676_11935980
3215 Ga0207674_10011766
3216 Ga0207674_10132094
3217 Ga0207674_10627488
3218 Ga0207674_11452112
3219 Ga0207675_100021849
3220 Ga0207675_100359039
3221 Ga0207675_100397646
3222 Ga0207675_100700662
3223 Ga0207675_101174281
3224 Ga0207683_10001393
3225 Ga0207683_10028516
3226 Ga0207683_10608142
3227 Ga0207683_11309190
3228 Ga0207698_10607498
3229 Ga0207698_10714364
3230 Ga0209179_1125150
3231 Ga0207428_10003435
3232 Ga0207428_10264295
3233 Ga0268266_10132557
3234 Ga0268266_10244148
3235 Ga0268266_11156271
3236 Ga0268265_10109619
3237 Ga0268265_10769483
3238 Ga0268264_10346751
3239 Ga0268264_12003302
3240 Ga0265337_1000015
3241 Ga0265326_10017844
3242 Ga0265319_1001246
3243 Ga0265334_10000373
3244 Ga0265322_10012472
3245 Ga0265336_10004317
3246 Ga0307517_10008703
3247 Ga0307517_10576044
3248 Ga0265338_10003873
3249 Ga0265338_10007479
3250 Ga0265338_10014640
3251 Ga0265338_11166024
3252 Ga0311003_101840
3253 Ga0265324_10002740
3254 Ga0268256_1018028
3255 Ga0307511_10136404
3256 Ga0307511_10142565
3257 Ga0307511_10276720
3258 Ga0265762_1085621
3259 Ga0265762_1087115
3260 Ga0265766_1022293
3261 Ga0265770_1039554
3262 Ga0265764_111591
3263 Ga0265761_110884
3264 Ga0265768_109562
3265 Ga0265771_1002017
3266 Ga0265771_1013123
3267 Ga0265774_103887
3268 Ga0265760_10006434
3269 Ga0265760_10069611
3270 Ga0265760_10113006
3271 Ga0265330_10212907
3272 Ga0265332_10001675
3273 Ga0265332_10058380
3274 Ga0265332_10474348
3275 Ga0265320_10001898
3276 Ga0265320_10041316
3277 Ga0265325_10015321
3278 Ga0265325_10060617
3279 Ga0265340_10003540
3280 Ga0265340_10004519
3281 Ga0265340_10082220
3282 Ga0265339_10000762
3283 Ga0265339_10014234
3284 Ga0265331_10028427
3285 Ga0265331_10246008
3286 Ga0265316_10006862
3287 Ga0265316_10154230
3288 Ga0307509_10009190
3289 Ga0307408_100053565
3290 Ga0307408_100437564
3291 Ga0307408_101472446
3292 Ga0310117_121880
3293 Ga0265313_10090959
3294 Ga0310107_133548
3295 Ga0307508_10042905
3296 Ga0307508_10049088
3297 Ga0307508_10436673
3298 Ga0307514_10175696
3299 Ga0310111_125385
3300 Ga0310111_140077
3301 Ga0265314_10005562
3302 Ga0265314_10016664
3303 Ga0265314_10048633
3304 Ga0265342_10006989
3305 Ga0265342_10033693
3306 Ga0265342_10036408
3307 Ga0307516_10056359
3308 Ga0307516_10068332
3309 Ga0307405_10583633
3310 Ga0316044_123521
3311 Ga0307413_10154461
3312 Ga0307413_10239047
3313 Ga0307413_10428832
3314 Ga0307413_10783646
3315 Ga0307410_10018684
3316 Ga0307410_10041314
3317 Ga0307410_10461216
3318 Ga0307410_10517336
3319 Ga0307410_10585933
3320 Ga0307406_10061971
3321 Ga0307406_10091864
3322 Ga0307406_10326390
3323 Ga0307407_10270552
3324 Ga0307407_10272626
3325 Ga0307412_11657115
3326 Ga0307409_100251429
3327 Ga0307409_100316575
3328 Ga0307409_100568728
3329 Ga0307409_100586607
3330 Ga0307409_100767361
3331 Ga0307409_100778866
3332 Ga0307409_100997431
3333 Ga0307409_102105659
3334 Ga0307416_100035506
3335 Ga0307416_100229736
3336 Ga0307416_100482859
3337 Ga0307416_101073035
3338 Ga0307416_101966629
3339 Ga0307416_103054440
3340 Ga0307414_10157413
3341 Ga0307411_10046422
3342 Ga0307411_11889445
3343 Ga0307411_12002959
3344 Ga0307507_10000013
3345 Ga0307507_10331584
3346 Ga0307507_10620089
3347 Ga0307510_10144369
3348 Ga0316214_1000482
3349 Ga0316214_1003948
3350 Ga0316212_1003331
3351 Ga0373930_0109559
3352 Ga0373948_0041310
3353 Ga0373950_0090347
3354 Ga0373958_0006992
3355 Ga0373959_0005926
3356 Ga0373926_0024276
3357 Ga0373926_0038845
3358 Ga0373929_0074912
3359 Ga0373934_0006708
3360 Ga0373934_0016099
3361 Ga0373934_0020722
3362 Ga0373934_0065600
3363 Ga0373934_0077028
3364 Ga0373934_0326016
3365 Ga0373940_0162500
3366 Ga0373944_0054981
3367 Ga0373944_0266351
3368 Ga0373951_0015579
3369 Ga0373951_0162768
3370 Ga0373952_0255440
3371 Ga0373923_0014721
3372 Ga0373923_0188582
3373 Ga0373923_0222494
3374 Ga0373923_0423120
3375 Ga0373932_0349125
3376 Ga0373936_0001178
3377 Ga0373936_0063067
3378 Ga0373936_0199673
3379 Ga0373936_0311106
3380 Ga0373941_0100267
3381 Ga0373941_0324149
3382 Ga0373945_0157682
3383 Ga0373945_0167148
3384 Ga0373945_0296159
3385 Ga0373945_0423426
3386 Ga0373945_0465205
3387 Ga0373953_0001772
3388 Ga0373953_0043953
3389 Ga0373953_0079348
3390 Ga0373953_0421401
3391 Ga0373954_0027830
3392 Ga0373954_0048362
3393 Ga0373954_0097558
3394 Ga0373954_0194369
3395 Ga0373956_0000844
3396 Ga0373956_0031323
3397 Ga0373956_0034924
3398 Ga0373956_0050919
3399 Ga0373957_0000011
3400 Ga0373957_0037568
3401 Ga0373957_0101528
3402 Ga0373957_0171550
3403 Ga0373957_0200007
3404 Ga0373960_0091762
3405 Ga0373960_0137114
3406 Ga0373943_0081332
3407 Ga0373943_0151010
3408 Ga0373943_0221704
3409 Ga0373943_0535043
3410 Ga0373946_0066712
3411 Ga0373946_0071884
3412 Ga0373946_0289756
3413 Ga0373946_0410365
3414 Ga0373955_0000060
3415 Ga0373955_0014764
3416 Ga0373955_0140143
3417 Ga0373955_0325507
3418 Ga0373955_0486184
3419 Ga0373942_0047227
3420 Ga0373942_0272647
3421 Ga0373924_0000672
3422 Ga0373924_0019378
3423 Ga0373924_0021188
3424 Ga0373924_0066473
3425 Ga0373924_0585618
3426 Ga0373931_0091826
3427 Ga0373931_0098523
3428 Ga0373931_0142313
3429 Ga0373931_0836462
3430 Ga0373935_0004616
3431 Ga0373935_0016967
3432 Ga0373935_0305980
3433 Ga0373935_0338594
3434 Ga0373927_0024730
3435 Ga0373927_0108817
3436 Ga0373927_0157259
3437 Ga0373927_0579698
3438 Ga0373933_0014325
3439 Ga0373933_0016385
3440 Ga0373933_0133630
3441 Ga0373933_0248337
3442 Ga0373933_0463129
3443 Ga0373947_0061727
3444 Ga0373947_0093287
3445 Ga0373947_0336826
3446 Ga0373947_0528508
3447 Ga0310104_20196
3448 Ga0373937_0000110
3449 Ga0373937_0030844
3450 Ga0373937_0037069
3451 Ga0373937_0269908
3452 Ga0373937_0271984
3453 Ga0373937_0366169
3454 Ga0373937_0808561
3455 Ga0265778_024529
3456 Ga0373925_0000540
3457 Ga0373925_0005130
3458 Ga0373925_0019497
3459 Ga0373925_0108373
3460 Ga0373925_0188311
3461 Ga0373925_0357750
3462 Ga0373925_0466959
3463 Ga0373925_1196327
3464 Ga0395900_0186888
3465 Ga0395898_0408457
3466 Ga0395898_0550320
3467 Ga0395898_0955662
3468 Ga0395905_0441340
3469 Ga0436364_0081229
3470 Ga0436364_0098049
3471 Ga0436364_0243023
3472 Ga0436364_0479741
3473 Ga0436364_0718628
3474 Ga0436364_1098280
3475 Ga0436364_1174043
3476 Ga0436364_1263484
3477 Ga0436364_1272150
3478 Ga0436364_1381350
3479 Ga0436364_1527719
3480 Ga0395901_0368107
3481 Ga0395901_1522668
3482 Ga0436365_0207903
3483 Ga0436365_0456440
3484 Ga0436360_0519033
3485 Ga0436360_0800473
3486 Ga0436361_0083233
3487 Ga0436361_0085148
3488 Ga0436361_0592735
3489 Ga0436361_0739507
3490 Ga0436361_1089145
3491 Ga0436363_0129145
3492 Ga0436363_0216045
3493 Ga0436363_0287803
3494 Ga0436363_1231403
3495 Ga0436363_1481670
3496 Ga0436363_1578490
3497 Ga0436363_1583483
3498 Ga0436362_0324614
3499 Ga0436362_0452318
3500 Ga0436362_1221077
3501 Ga0436362_1298483
3502 Ga0436362_1301744
3503 Ga0439436_0000524
3504 Ga0439436_0006412
3505 Ga0439436_0017389
3506 Ga0439436_0080170
3507 Ga0439436_0194399
3508 Ga0439438_041185
3509 Ga0439439_0010113
3510 Ga0439439_0068353
3511 Ga0439439_0082194
3512 Ga0439461_0001303
3513 Ga0439466_0006342
3514 Ga0439466_0166992
3515 Ga0451789_0026674
3516 Ga0451793_1135109
3517 Ga0451797_1112463
3518 Ga0451805_068977
3519 Ga0451804_0477614
3520 Ga0451839_0225412
3521 Ga0451839_0572827
3522 Ga0451841_0311264
3523 Ga0451845_0003149
3524 Ga0451843_1278596
3525 Ga0451853_3555550
3526 Ga0451853_3556725
3527 Ga0439431_0021633
3528 Ga0439433_0001892
3529 Ga0439442_016934
3530 Ga0439442_071616
3531 Ga0439448_0001950
3532 Ga0439448_0076419
3533 Ga0439448_0319083
3534 Ga0439432_091108
3535 Ga0439449_0011654
3536 Ga0439449_0019562
3537 Ga0439449_0032403
3538 Ga0439449_0055906
3539 Ga0439449_0298946
3540 Ga0439452_002242
3541 Ga0439455_0009521
3542 Ga0439455_0076718
3543 Ga0439456_043895
3544 Ga0439457_001024
3545 Ga0439457_001614
3546 Ga0439457_004463
3547 Ga0439462_0004876
3548 Ga0439462_0051833
3549 Ga0439462_0111836
3550 Ga0439462_0113673
3551 Ga0439463_179444
3552 Ga0450911_011083
3553 Ga0450914_065157
3554 Ga0450919_000085
3555 Ga0450920_039778
3556 Ga0450890_071893
3557 Ga0450894_000035
3558 Ga0450896_002593
3559 Ga0450898_078105
3560 Ga0450899_000138
3561 Ga0450902_032410
3562 Ga0450903_000067
3563 Ga0450906_002005
3564 Ga0450907_018490
3565 Ga0450907_064767
3566 Ga0439446_0020862
3567 Ga0439458_0005318
3568 Ga0439458_0050659
3569 Ga0450908_008452
3570 Ga0450909_002630
3571 Ga0439434_0065435
3572 Ga0439459_0004735
3573 Ga0439459_0042938
3574 Ga0439459_0176540
3575 Ga0439464_0169427
3576 Ga0450918_016419
3577 Ga0450901_006724
3578 Ga0466969_0001305
3579 Ga0466969_0006155
3580 Ga0466972_0031457
3581 Ga0466972_0252403
3582 Ga0466966_0001016
3583 Ga0466966_0002663
3584 Ga0466966_0009462
3585 Ga0466966_0012013
3586 Ga0466966_0019210
3587 Ga0466966_0213373
3588 Ga0466966_0255491
3589 Ga0466966_0271706
3590 Ga0466961_0003691
3591 Ga0466961_0006277
3592 Ga0466961_0007449
3593 Ga0466961_0018930
3594 Ga0466961_0023269
3595 Ga0466961_0032959
3596 Ga0466961_0094041
3597 Ga0466961_0160266
3598 Ga0466961_0806876
3599 Ga0466963_0028158
3600 Ga0466963_0035906
3601 Ga0466963_0060997
3602 Ga0466963_0069338
3603 Ga0466963_0406126
3604 Ga0466963_0553184
3605 Ga0466963_0890380
3606 Ga0466963_0942863
3607 Ga0466963_1101807
3608 Ga0466964_0112830
3609 Ga0466964_0562917
3610 Ga0466964_0668844
3611 Ga0466971_0000730
3612 Ga0466971_0005155
3613 Ga0466971_0005390
3614 Ga0466971_0011377
3615 Ga0466971_0031674
3616 Ga0466968_0315931
3617 Ga0466968_0375624
3618 Ga0466968_0496860
3619 Ga0466970_0002624
3620 Ga0466970_0062185
3621 Ga0466970_0310853
3622 Ga0466970_0354333
3623 Ga0466970_0410163
3624 Ga0466970_0611728
3625 Ga0466970_0720331
3626 Ga0466957_0008107
3627 Ga0466957_0228107
3628 Ga0466957_0629040
3629 Ga0466957_0664502
3630 Ga0466957_0737721
3631 Ga0466960_0028068
3632 Ga0466959_0000507
3633 Ga0466959_0007332
3634 Ga0466959_0011863
3635 Ga0466959_0036329
3636 Ga0466959_0048336
3637 Ga0466959_0060117
3638 Ga0466959_0141200
3639 Ga0466959_0355270
3640 Ga0466959_0524937
3641 Ga0451576_0227272
3642 Ga0466958_0004494
3643 Ga0466958_0010466
3644 Ga0466958_0028068
3645 Ga0466958_0034351
3646 Ga0466958_0192525
3647 Ga0466967_0007787
3648 Ga0466967_0101495
3649 Ga0466967_0525765
3650 Ga0466967_0628538
3651 Ga0466967_0665844
3652 Ga0466967_0725842
3653 Ga0466967_1271460
3654 Ga0466967_1419345
3655 Ga0466967_1642962
3656 Ga0466967_1916326
3657 Ga0466967_2527919
3658 Ga0495627_107445
3659 Ga0495592_0000049
3660 Ga0495592_0011895
3661 Ga0495592_0041774
3662 Ga0495592_0127909
3663 Ga0495592_0149061
3664 Ga0495592_0183636
3665 Ga0495592_0485817
3666 Ga0495603_0010028
3667 Ga0495603_0024116
3668 Ga0495603_0026170
3669 Ga0495603_0047280
3670 Ga0495603_0049435
3671 Ga0495603_0072963
3672 Ga0495629_0009686
3673 Ga0495629_0010230
3674 Ga0495629_0102424
3675 Ga0495629_0102605
3676 Ga0495629_0105404
3677 Ga0495629_0261125
3678 Ga0495629_0695599
3679 Ga0495638_0049888
3680 Ga0495638_0118662
3681 Ga0495638_0251119
3682 Ga0495641_0008332
3683 Ga0495641_0013098
3684 Ga0495641_0027940
3685 Ga0495651_0000007
3686 Ga0495651_0000079
3687 Ga0495651_0034997
3688 Ga0495651_0044140
3689 Ga0495651_0047991
3690 Ga0495651_0105233
3691 Ga0495651_0235360
3692 Ga0495651_0408707
3693 Ga0495651_0446451
3694 Ga0495651_0452362
3695 Ga0495651_0552354
3696 Ga0495653_0046082
3697 Ga0495653_0046578
3698 Ga0495653_0066610
3699 Ga0495653_0090526
3700 Ga0495653_0239989
3701 Ga0495653_0247654
3702 Ga0495653_0352192
3703 Ga0495653_0769772
3704 Ga0495580_0015098
3705 Ga0495580_0154805
3706 Ga0495580_0169758
3707 Ga0495580_0303167
3708 Ga0495582_0002158
3709 Ga0495582_0005432
3710 Ga0495582_0085008
3711 Ga0495582_0319741
3712 Ga0495639_0010968
3713 Ga0495639_0081464
3714 Ga0495639_0143354
3715 Ga0495662_0002989
3716 Ga0495662_0008805
3717 Ga0495662_0020179
3718 Ga0495662_0020438
3719 Ga0495662_0035526
3720 Ga0495662_0179222
3721 Ga0495664_0003530
3722 Ga0495664_0020885
3723 Ga0495664_0091512
3724 Ga0495664_0117975
3725 Ga0495664_0134953
3726 Ga0495664_0194739
3727 Ga0495664_0422355
3728 Ga0495585_0013695
3729 Ga0495585_0042588
3730 Ga0495585_0059459
3731 Ga0495585_0202801
3732 Ga0495594_0012305
3733 Ga0495594_0013501
3734 Ga0495594_0019227
3735 Ga0495594_0055542
3736 Ga0495594_0140826
3737 Ga0495594_0471433
3738 Ga0495594_0783896
3739 Ga0495607_0042933
3740 Ga0495608_0000076
3741 Ga0495608_0009966
3742 Ga0495608_0040008
3743 Ga0495608_0067448
3744 Ga0495608_0157894
3745 Ga0495608_0208708
3746 Ga0495608_0447957
3747 Ga0495608_0627494
3748 Ga0495618_0007856
3749 Ga0495618_0022729
3750 Ga0495618_0106122
3751 Ga0495618_0255728
3752 Ga0495618_0387054
3753 Ga0495618_0569619
3754 Ga0495620_0110578
3755 Ga0495628_0001215
3756 Ga0495628_0005605
3757 Ga0495628_0010042
3758 Ga0495628_0021216
3759 Ga0495628_0103086
3760 Ga0495628_0137701
3761 Ga0495628_0156972
3762 Ga0495628_0584191
3763 Ga0495630_0008315
3764 Ga0495630_0025191
3765 Ga0495630_0032183
3766 Ga0495630_0217395
3767 Ga0495630_0307930
3768 Ga0495630_0844286
3769 Ga0495630_1402619
3770 Ga0495631_0139636
3771 Ga0495631_0219806
3772 Ga0495631_0260618
3773 Ga0495637_0105712
3774 Ga0495643_0211792
3775 Ga0495666_0003384
3776 Ga0495666_0058823
3777 Ga0495666_0129992
3778 Ga0495666_0149655
3779 Ga0495666_0313549
3780 Ga0495666_0374085
3781 Ga0495652_0000168
3782 Ga0495652_0003588
3783 Ga0495652_0040527
3784 Ga0495652_0059422
3785 Ga0495652_0083184
3786 Ga0495652_0146356
3787 Ga0495652_0273460
3788 Ga0495652_0352690
3789 Ga0495652_0399634
3790 Ga0495652_0559306
3791 Ga0495652_0597782
3792 Ga0495665_0002190
3793 Ga0495665_0004007
3794 Ga0495665_0055065
3795 Ga0495665_0173646
3796 Ga0495665_0634612
3797 Ga0495640_0017135
3798 Ga0495640_0029098
3799 Ga0495640_0054496
3800 Ga0495640_0054695
3801 Ga0495640_0206494
3802 Ga0495586_0005311
3803 Ga0495586_0008958
3804 Ga0495586_0030648
3805 Ga0495586_0053081
3806 Ga0495586_0082387
3807 Ga0495586_0257410
3808 Ga0495586_0355569
3809 Ga0495586_0472462
3810 Ga0495586_0881121
3811 Ga0495587_0006741
3812 Ga0495587_0025931
3813 Ga0495587_0077239
3814 Ga0495587_0109041
3815 Ga0495587_0210367
3816 Ga0495587_0742135
3817 Ga0495645_0013097
3818 Ga0495645_0022878
3819 Ga0495645_0059107
3820 Ga0495645_0368563
3821 Ga0495645_0384113
3822 Ga0495645_0395575
3823 Ga0495622_0022827
3824 Ga0495622_0170550
3825 Ga0495622_0443017
3826 Ga0495667_0000072
3827 Ga0495667_0015012
3828 Ga0495667_0018766
3829 Ga0495667_0029452
3830 Ga0495667_0041818
3831 Ga0495667_0068317
3832 Ga0495667_0121316
3833 Ga0495656_0193205
3834 Ga0495656_0509219
3835 Ga0495634_0020030
3836 Ga0495634_0026954
3837 Ga0495634_0027278
3838 Ga0495634_0033758
3839 Ga0495634_0179627
3840 Ga0495634_0189762
3841 Ga0495611_0033087
3842 Ga0495625_0222544
3843 Ga0495635_0002665
3844 Ga0495635_0020890
3845 Ga0495635_0112703
3846 Ga0495635_0124402
3847 Ga0495635_0180933
3848 Ga0495635_0204784
3849 Ga0495635_0962288
3850 Ga0495661_0170131
3851 Ga0495588_0067287
3852 Ga0495588_0078571
3853 Ga0495588_0451689
3854 Ga0495588_0645247
3855 Ga0495588_0684305
3856 Ga0495657_0000424
3857 Ga0495657_0002584
3858 Ga0495657_0020458
3859 Ga0495657_0028016
3860 Ga0495657_0042001
3861 Ga0495657_0046215
3862 Ga0495657_0115442
3863 Ga0495657_0314532
3864 Ga0495657_0320965
3865 Ga0495599_0000062
3866 Ga0495599_0021197
3867 Ga0495599_0022810
3868 Ga0495599_0026841
3869 Ga0495599_0035257
3870 Ga0495599_0074779
3871 Ga0495599_0276693
3872 Ga0495599_0869618
3873 Ga0495623_0000777
3874 Ga0495623_0003796
3875 Ga0495623_0048459
3876 Ga0495623_0059079
3877 Ga0495623_0061932
3878 Ga0495623_0083855
3879 Ga0495623_0104972
3880 Ga0495623_0290995
3881 Ga0495623_0379528
3882 Ga0495623_0435910
3883 Ga0495646_0007097
3884 Ga0495646_0059352
3885 Ga0495646_0078693
3886 Ga0495646_0158769
3887 Ga0495646_0188431
3888 Ga0495646_0193027
3889 Ga0495646_0196394
3890 Ga0495646_0357357
3891 Ga0495647_0356750
3892 Ga0495647_0569406
3893 Ga0495658_0069348
3894 Ga0495658_0157765
3895 Ga0495658_0415133
3896 Ga0495613_0009407
3897 Ga0495613_0011441
3898 Ga0495613_0034690
3899 Ga0495613_0084477
3900 Ga0495613_0129270
3901 Ga0495613_0138981
3902 Ga0495613_0237480
3903 Ga0495613_0645089
3904 Ga0495624_0006967
3905 Ga0495624_0006974
3906 Ga0495624_0017325
3907 Ga0495624_0027762
3908 Ga0495624_0146888
3909 Ga0495624_0563981
3910 Ga0495670_0013056
3911 Ga0495670_0020026
3912 Ga0495671_0161446
3913 Ga0495649_0402218
3914 Ga0495589_0221108
3915 Ga0495589_0335128
3916 Ga0495589_0521254
3917 Ga0495600_0008443
3918 Ga0495600_0010085
3919 Ga0495600_0024163
3920 Ga0495600_0043077
3921 Ga0495600_0045437
3922 Ga0495600_0236626
3923 Ga0495600_0244884
3924 Ga0495600_0280645
3925 Ga0495660_0322596
3926 Ga0495581_0010953
3927 Ga0495581_0027064
3928 Ga0495581_0121582
3929 Ga0495581_0428420
3930 Ga0495604_0000062
3931 Ga0495604_0011814
3932 Ga0495604_0022655
3933 Ga0495604_0062529
3934 Ga0495604_0175014
3935 Ga0495604_0216151
3936 Ga0495604_0242504
3937 Ga0495604_0544271
3938 Ga0495636_0085601
3939 Ga0495636_0256394
3940 Ga0495674_0007071
3941 Ga0495674_0028482
3942 Ga0495674_0113536
3943 Ga0495674_0134153
3944 Ga0495674_0174539
3945 Ga0495674_0302329
3946 Ga0495674_0379116
3947 Ga0495676_0029254
3948 Ga0495676_0038718
3949 Ga0495676_0090636
3950 Ga0495676_0509018
3951 Ga0495676_0811775
3952 Ga0495676_0838847
3953 Ga0495676_0959964
3954 Ga0495680_0000101
3955 Ga0495680_0012972
3956 Ga0495680_0030458
3957 Ga0495680_0066746
3958 Ga0495680_0158901
3959 Ga0495680_0357554
3960 Ga0495680_0453200
3961 Ga0495683_0127665
3962 Ga0495683_0226451
3963 Ga0495687_014847
3964 Ga0495687_044422
3965 Ga0495675_0001304
3966 Ga0495675_0009960
3967 Ga0495675_0021462
3968 Ga0495675_0022793
3969 Ga0495675_0028408
3970 Ga0495675_0033104
3971 Ga0495675_0064305
3972 Ga0495675_0423473
3973 Ga0495685_005390
3974 Ga0495685_022256
3975 Ga0495685_138526
3976 Ga0495685_211284
3977 Ga0495681_0211603
3978 Ga0495684_0010492
3979 Ga0495684_0022686
3980 Ga0495684_0100367
3981 Ga0495684_0168641
3982 Ga0495684_0391701
3983 Ga0495684_0412100
3984 Ga0495686_0024806
3985 Ga0495593_0005748
3986 Ga0495593_0008680
3987 Ga0495593_0019207
3988 Ga0495593_0112896
3989 Ga0495602_0000115
3990 Ga0495602_0013494
3991 Ga0495602_0078195
3992 Ga0495602_0085778
3993 Ga0495602_0169551
3994 Ga0495602_0636795
3995 Ga0495602_0648191
3996 Ga0495602_0779261
3997 Ga0495614_0016031
3998 Ga0495614_0075784
3999 Ga0495614_0106237
4000 Ga0495614_0165911
4001 Ga0495614_0395590
4002 Ga0495626_0395030
4003 Ga0496100_0225359
4004 Ga0496100_0267539
4005 Ga0496100_0418829
4006 Ga0496100_0498592
4007 Ga0496101_0133559
4008 Ga0496101_0253562
4009 Ga0496101_0552835
4010 Ga0496101_0977712
4011 Ga0496102_0008136
4012 Ga0496102_0144707
4013 Ga0496102_0190191
4014 Ga0496102_0666327
4015 Ga0496102_0755743
4016 Ga0496102_0947438
4017 Ga0496102_1210177
4018 Ga0496103_0058025
4019 Ga0496103_0171518
4020 Ga0496103_0545441
4021 Ga0496103_0954846
4022 Ga0496104_0193546
4023 Ga0496104_0256480
4024 Ga0496104_0268139
4025 Ga0496104_0307286
4026 Ga0496104_1876195
4027 Ga0496105_0001951
4028 Ga0496105_0067234
4029 Ga0496105_0685997
4030 Ga0496105_1059263
4031 Ga0496106_0044619
4032 Ga0496106_0058655
4033 Ga0496106_0059467
4034 Ga0496106_0131596
4035 Ga0496106_0718939
4036 Ga0496106_0842165
4037 Ga0496107_0153111
4038 Ga0496107_0176672
4039 Ga0496107_0294675
4040 Ga0496108_0016852
4041 Ga0496108_0046337
4042 Ga0496108_0071716
4043 Ga0496108_1121815
4044 Ga0496108_1381098
4045 Ga0496109_0014763
4046 Ga0496109_0078823
4047 Ga0496109_0106641
4048 Ga0496109_0418089
4049 Ga0496109_0923171
4050 Ga0496109_1261090
4051 Ga0496109_1489189
4052 Ga0496110_0130544
4053 Ga0496110_0256284
4054 Ga0496110_0452662
4055 Ga0496110_0915618
4056 Ga0496111_0000966
4057 Ga0496111_0047485
4058 Ga0496111_0638406
4059 Ga0496111_1110594
4060 Ga0496112_0029297
4061 Ga0496112_0201674
4062 Ga0496112_0668870
4063 Ga0496112_1346837
4064 Ga0496112_1394456
4065 Ga0496112_1901542
4066 Ga0496113_0103401
4067 Ga0496113_0246203
4068 Ga0496113_0412533
4069 Ga0496113_0470773
4070 Ga0496113_1002278
4071 Ga0496114_0237928
4072 Ga0496114_0337413
4073 Ga0496114_0685415
4074 Ga0496114_0866278
4075 Ga0496114_1531513
4076 Ga0496115_0030212
4077 Ga0496115_0143568
4078 Ga0496115_0441847
4079 Ga0496115_0589125
4080 Ga0496126_0021509
4081 Ga0496126_0044968
4082 Ga0496126_0810372
4083 Ga0496126_0976717
4084 Ga0501306_082899
4085 Ga0501291_064155
4086 Ga0501311_084530
4087 Ga0501312_040992
4088 Ga0501315_082529
4089 Ga0501317_035088
4090 Ga0501318_044439
4091 Ga0501031_0002572
4092 Ga0501031_0085553
4093 Ga0501031_0196816
4094 Ga0501031_0342624
4095 Ga0501031_0721815
4096 Ga0501032_0001212
4097 Ga0501032_0004014
4098 Ga0501032_0061569
4099 Ga0501032_0083428
4100 Ga0501032_0216319
4101 Ga0501032_0292527
4102 Ga0501032_0731608
4103 Ga0501033_0008061
4104 Ga0501033_0038694
4105 Ga0501033_0043629
4106 Ga0501033_0102595
4107 Ga0501033_0121268
4108 Ga0501033_0487639
4109 Ga0501033_0608994
4110 Ga0501033_1028924
4111 Ga0501034_0006278
4112 Ga0501034_0035629
4113 Ga0501034_0092435
4114 Ga0501034_0135532
4115 Ga0501034_0204269
4116 Ga0501034_0770472
4117 Ga0501036_0008586
4118 Ga0501036_0026259
4119 Ga0501036_0070822
4120 Ga0501036_0136997
4121 Ga0501036_0287623
4122 Ga0501036_0404226
4123 Ga0501036_0636340
4124 Ga0501036_0771568
4125 Ga0501036_1290684
4126 Ga0501037_0000836
4127 Ga0501037_0028438
4128 Ga0501037_0038085
4129 Ga0501037_0047762
4130 Ga0501038_0012780
4131 Ga0501038_0038303
4132 Ga0501038_0098123
4133 Ga0501038_0202701
4134 Ga0501038_0381674
4135 Ga0501038_0432279
4136 Ga0501039_0007687
4137 Ga0501039_0186535
4138 Ga0501039_0356373
4139 Ga0501039_0373550
4140 Ga0501039_0409181
4141 Ga0501039_0720933
4142 Ga0501039_0774360
4143 Ga0501040_0007931
4144 Ga0501040_0029885
4145 Ga0501040_0057922
4146 Ga0501041_0001518
4147 Ga0501041_0254296
4148 Ga0501042_0015097
4149 Ga0501042_0121418
4150 Ga0501042_0140483
4151 Ga0501042_0312857
4152 Ga0501043_0005580
4153 Ga0501043_0032328
4154 Ga0501043_0062990
4155 Ga0501043_0176885
4156 Ga0501043_0252718
4157 Ga0501043_0314179
4158 Ga0501043_0412595
4159 Ga0501046_0037516
4160 Ga0501046_0119453
4161 Ga0501046_0143575
4162 Ga0501046_0494625
4163 Ga0501047_0000072
4164 Ga0501047_0001607
4165 Ga0501047_0070941
4166 Ga0501047_0152655
4167 Ga0501047_0169702
4168 Ga0501047_0384844
4169 Ga0501048_0011519
4170 Ga0501048_0015295
4171 Ga0501048_0037211
4172 Ga0501048_0704370
4173 Ga0501067_0013763
4174 Ga0501068_0003236
4175 Ga0501068_0333682
4176 Ga0501068_0493369
4177 Ga0501069_0017860
4178 Ga0501069_0031481
4179 Ga0501069_0305289
4180 Ga0501070_0005040
4181 Ga0501070_0008482
4182 Ga0501070_0009153
4183 Ga0501070_0012340
4184 Ga0501070_0012975
4185 Ga0501070_0031412
4186 Ga0501070_0845307
4187 Ga0501070_1474102
4188 Ga0501071_0006687
4189 Ga0501071_0205182
4190 Ga0501071_0244047
4191 Ga0501071_0689739
4192 Ga0501072_0001898
4193 Ga0501072_0267605
4194 Ga0501072_0333566
4195 Ga0501073_0009415
4196 Ga0501073_0015567
4197 Ga0501073_0771727
4198 Ga0501074_0000607
4199 Ga0501074_0006705
4200 Ga0501074_0016000
4201 Ga0501074_0076631
4202 Ga0501074_0080253
4203 Ga0501075_0011003
4204 Ga0501075_0020072
4205 Ga0501076_0003333
4206 Ga0501076_0035235
4207 Ga0501076_0424529
4208 Ga0501076_0549399
4209 Ga0501076_0644736
4210 Ga0501077_0019671
4211 Ga0501077_0023052
4212 Ga0501235_008627
4213 Ga0501251_022715
4214 Ga0501261_034512
4215 Ga0501079_0000029
4216 Ga0501079_0007167
4217 Ga0501079_0328774
4218 Ga0501080_0006601
4219 Ga0501080_0013816
4220 Ga0501080_0121371
4221 Ga0501080_0193663
4222 Ga0501080_0639037
4223 Ga0501080_1383399
4224 Ga0501080_1407600
4225 Ga0501081_0076315
4226 Ga0501083_0383782
4227 Ga0501282_001694
4228 Ga0501035_0005086
4229 Ga0501035_0012487
4230 Ga0501035_0024124
4231 Ga0501035_0111057
4232 Ga0501035_0132132
4233 Ga0501035_0298983
4234 Ga0501035_0479587
4235 Ga0501044_0005927
4236 Ga0501044_0007860
4237 Ga0501044_0050036
4238 Ga0501044_0059401
4239 Ga0501044_0065905
4240 Ga0501044_0091036
4241 Ga0501044_0092812
4242 Ga0501044_0203538
4243 Ga0501044_0210357
4244 Ga0501044_0237979
4245 Ga0501044_0777924
4246 Ga0501045_0014996
4247 Ga0501045_0037572
4248 Ga0501045_0348642
4249 Ga0501045_0553357
4250 Ga0501045_0801738
4251 nmdc:mga03683_331178_c1
4252 nmdc:mga03n38_71279_c1
4253 nmdc:mga0yw44_371395_c1
4254 nmdc:mga05p37_1302285_c1
4255 nmdc:mga05p37_1677414_c1
4256 nmdc:mga05p37_2012723_c1
4257 nmdc:mga05p37_425422_c1
4258 nmdc:mga05p37_4279_c1
4259 nmdc:mga05p37_728152_c1
4260 nmdc:mga09592_21197_c1
4261 nmdc:mga09592_326452_c1
4262 nmdc:mga08y16_142507_c1
4263 nmdc:mga08y16_52073_c1
4264 nmdc:mga08y16_735505_c1
4265 nmdc:mga0n895_1080559_c1
4266 nmdc:mga0n895_1231098_c1
4267 nmdc:mga0n895_149115_c1
4268 nmdc:mga0n895_347695_c1
4269 nmdc:mga0n895_63544_c1
4270 nmdc:mga0n895_7764_c1
4271 nmdc:mga0rr50_103846_c1
4272 nmdc:mga0rr50_1174000_c1
4273 nmdc:mga0rr50_1483984_c1
4274 nmdc:mga0rr50_1831282_c1
4275 nmdc:mga0rr50_4305_c1
4276 nmdc:mga0rr50_9965_c1
4277 nmdc:mga08x19_107348_c1
4278 nmdc:mga08x19_15062_c1
4279 nmdc:mga08x19_16720_c1
4280 nmdc:mga08x19_308513_c1
4281 nmdc:mga08x19_382382_c1
4282 nmdc:mga0a205_306282_c1
4283 nmdc:mga0a205_312603_c1
4284 nmdc:mga0a205_362154_c1
4285 nmdc:mga0a205_618_c1
4286 nmdc:mga0a205_81627_c1
4287 Ga0495601_0039256
4288 Ga0495601_0053846
4289 Ga0495601_0151747
4290 Ga0495601_0264047
4291 Ga0495601_0734996
4292 Ga0495601_0802431
4293 Ga0495612_0001654
4294 Ga0495612_0003302
4295 Ga0495612_0028326
4296 Ga0495612_0095192
4297 Ga0495612_0228164
4298 Ga0495655_0020718
4299 Ga0495655_0176416
4300 Ga0495595_0003935
4301 Ga0495595_0087318
4302 Ga0495619_0007135
4303 Ga0495619_0014045
4304 Ga0495619_0067820
4305 Ga0495619_0092261
4306 Ga0495619_0245604
4307 Ga0495619_0699125
4308 Ga0500583_0271553
4309 Ga0500651_0403077
4310 Ga0500566_0137313
4311 Ga0500641_0084013
4312 Ga0500641_0381705
4313 Ga0500654_064920
4314 Ga0500553_118913
4315 Ga0500556_0401583
4316 Ga0500558_067368
4317 Ga0500560_127497
4318 Ga0500569_004143
4319 Ga0500594_0022448
4320 Ga0500614_017862
4321 Ga0500628_012677
4322 Ga0500652_008937
4323 Ga0500655_147778
4324 Ga0500658_0003343
4325 Ga0500573_0065287
4326 Ga0500573_0137513
4327 Ga0500573_0320426
4328 Ga0500579_018317
4329 Ga0500589_207773
4330 Ga0500600_0032935
4331 Ga0500600_0295193
4332 Ga0500603_105497
4333 Ga0500616_0256946
4334 Ga0500633_0000825
4335 Ga0500634_0050937
4336 Ga0500656_001561
4337 Ga0500587_002484
4338 Ga0501084_0004130
4339 Ga0501084_0048010
4340 Ga0501084_0110758
4341 Ga0501084_0284950
4342 Ga0501084_0891695
4343 Ga0590075_003626
4344 Ga0587066_125493
4345 Ga0587072_046729
4346 Ga0587078_075059
4347 Ga0587114_108277
4348 Ga0587071_085205
4349 Ga0587111_0019558
4350 Ga0501082_0008254
4351 Ga0501082_0188578
4352 Ga0501082_0689082
4353 Ga0466962_0001597
4354 Ga0466962_0003215
4355 Ga0466962_0019804
4356 Ga0466962_0024928
4357 Ga0466962_0035029
4358 Ga0466962_0209981
4359 Ga0466962_0567793
4360 Ga0530510_0056005
4361 Ga0530510_0241313
4362 Ga0530510_1109580
4363 Ga0530510_1135254
4364 2528202875
4365 2528213253
4366 2537898779
4367 2546947610
4368 2547408185
4369 2554257760
4370 2579748402
4371 2579857875
4372 2585299224
4373 2585308877
4374 2600198837
4375 2616904550
4376 2619858529
4377 2620353764
4378 2626634477
4379 2643765030
4380 2643900764
4381 2643942346
4382 2644017133
4383 2644173906
4384 2644262368
4385 2644389982
4386 2644405015
4387 2644429426
4388 2644461131
4389 2676497096
4390 2686534371
4391 2686543749
4392 2710604303
4393 2768643512
4394 2774864285
4395 2784588645
4396 2785343206
4397 2785369589
4398 2786670679
4399 2791213414
4400 2793984432
4401 2804846910
4402 2809232255
4403 2811849127
4404 2812358008
4405 2812480452
4406 2819627478
4407 2819695484
4408 2819741196
4409 2844851709
4410 2847088829
4411 2852636577
4412 2856744598
4413 2862179398
4414 2862285734
4415 2862294834
4416 2862391572
4417 2862511733
4418 2862579180
4419 2862709359
4420 2863404518
4421 2867348898
4422 2867371955
4423 2867434852
4424 2867479902
4425 2873155656
4426 2873316372
4427 2875395639
4428 2877681039
4429 2884703590
4430 2891398903
4431 2891559113
4432 2891569556
4433 2895438539
4434 2895443382
4435 2895883767
4436 2904501520
4437 2904608559
4438 2912724285
4439 2912760859
4440 2918505511
4441 2919035526
4442 2935393340
4443 2946049000
4444 2946067835
4445 2946075977
4446 2947229160
4447 2954386148
4448 2954677002
4449 2954687155
4450 2954696786
4451 2954705352
4452 2954716165
4453 2954726108
4454 2954735702
4455 2954745034
4456 2954754558
4457 2954764006
4458 2966601722
4459 2990048080
4460 2990063166
4461 2995465892
4462 2995466746
4463 2997457774
4464 2997600354
4465 3003004870
4466 3006324990
4467 3006399692
4468 3006428769
4469 3006487457
4470 3006500827
4471 637877588
4472 8007377605
4473 8008488623
4474 8008567201
4475 8008578821
4476 8023629810
4477 8025417821
4478 8025481844
4479 8025527399
4480 8025537943
4481 8033686962
4482 8047898044
4483 8048128019
4484 8048360849
4485 8048375007
4486 8048383199
4487 8048412667
4488 8054167024
4489 8055074387
4490 8055173924
4491 8056449183
4492 8056671188

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00313

CSD

'Cold-shock' DNA-binding domain

11

75

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3i2z-assembly2.cif.gz_B structure of cold shock protein e from salmonella typhimurium 0.9752 1 66
1mjc-assembly1.cif.gz_A crystal structure of cspa, the major cold shock protein of escherichia coli 0.9699 2 66
1hza-assembly1.cif.gz_B bacillus caldolyticus cold-shock protein mutants to study determinants of protein stability 0.9673 1 67
1c9o-assembly1.cif.gz_B crystal structure analysis of the bacillus caldolyticus cold shock protein bc-csp 0.9601 1 66
1hz9-assembly1.cif.gz_B bacillus caldolyticus cold-shock protein mutants to study determinants of protein stability 0.959 1 66
ID Description Score Start End Superfamily
af_P92186_48_133_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9689 2 65 2.40.50.140
af_Q94C69_1_75_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9596 2 64 2.40.50.140
af_Q9VRN5_36_116_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9471 2 66 2.40.50.140
af_I1LPN7_1_82_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9441 2 65 2.40.50.140
5o6fA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9433 1 66 2.40.50.140
ID Description Score Start End GO Terms
AF-L8PCS3-F1-model_v4 Putative Cold shock protein 1.01 1 67 GO:0003677
GO:0005737
AF-A0A7Y6CAR0-F1-model_v4 Cold-shock protein 1.009 1 67 GO:0003677
GO:0005737
AF-A0A0M2GS90-F1-model_v4 Cold-shock protein 1.009 1 67 GO:0003677
GO:0005737
AF-A0A7K2YX20-F1-model_v4 Cold shock domain-containing protein 1.009 1 67 GO:0003677
GO:0005737
AF-A0A7W7BXJ9-F1-model_v4 deleted 1.008 1 67

Map